F486897
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 962 | 406 | 1924 | 433 |
Family's Representative Sequence
| Representative Sequence | 3300046492|Ga0495585_0008057|Ga0495585_0008057_1296_2768 |
| Length | 490 |
| Sequence | VDFGQETRHEQERLFSKLAEKELQLDHQEGATDRGFHGRCAAPCTQASPNPTRKDLIMTNGETSYSLTRRSFLTAIAAAGAVGVMPRTLLASPGEGVIRPFRVHIPEETLTDLRRRLAATRWPPKETVADASQGVPLDKLQPLVRYWEKRYNWRKTEAKLNALPQYMTNIDGVDIHFIHVRSRHPDAMPLLITHGWPGSIFEFLKLIGPLTDPTAFGGREENAFHLVIPSIPGYGFSGKPTVTGWDPERIARAWAELMKRLGYTRYVAQGGDWGAPITSAMARQAAPGLLGIHLNLPAAVPPEVTAALPTGIAPAGMSEQEHAVFDALVAYGKKGNSAYFTMLTARPQTISYGMSDSPAFLAAFMLVHPGFANWKFGADAAQSPGLDEVLDDLSLYWLTNTAASAARLYWENGARGSVIGSGPQKTQEITLPVAITVFPEDVYRPPESWARRAYRNLSYYHAVDRGGHFAAWEQPALFAEELRAAFRPLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 126 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 262 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 263 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 264 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 267 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 268 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 269 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 354 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 357 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 358 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 359 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 363 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 364 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 365 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 366 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 389 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 390 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 391 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 392 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 393 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 394 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 395 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 396 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 397 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 398 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 399 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 400 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 401 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 402 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 403 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 404 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 405 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 406 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.02 |
| Metatranscriptomes | 0 |
| Isolates | 1.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 1.56 |
| Rhizoplane | 9.36 |
| Rhizosphere | 87.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495585_0008057 | 3300046492 | Bacteria | 6405 |
| 2 | 2214745203 | 2209111006 | Bacteria | 15822 |
| 3 | ARSoilYngRDRAFT_c00160 | 3300000042 | Bacteria | 11561 |
| 4 | ARcpr5yngRDRAFT_c000030 | 3300000043 | Bacteria | 23301 |
| 5 | ARSoilOldRDRAFT_c000033 | 3300000044 | Bacteria | 30681 |
| 6 | ARCol0oldRDRAFT_c00343 | 3300000045 | Bacteria | 4538 |
| 7 | ARCol0yngRDRAFT_1000078 | 3300000652 | Bacteria | 18395 |
| 8 | JGI24752J21851_1002480 | 3300001976 | Bacteria | 2456 |
| 9 | JGI24738J21930_10006812 | 3300002075 | Bacteria | 2654 |
| 10 | JGI24749J21850_1002823 | 3300002076 | Bacteria | 2433 |
| 11 | JGI24744J21845_10002848 | 3300002077 | Bacteria | 3535 |
| 12 | JGI24033J26618_1000249 | 3300002155 | Bacteria | 6025 |
| 13 | JGI24742J22300_10001623 | 3300002244 | Bacteria | 3575 |
| 14 | Ga0055526_1009188 | 3300003771 | Bacteria | 4803 |
| 15 | Ga0055537_1000439 | 3300003773 | Bacteria | 26623 |
| 16 | Ga0055534_1000400 | 3300003784 | Bacteria | 26742 |
| 17 | Ga0055528_1000062 | 3300003790 | Bacteria | 85624 |
| 18 | JGI25405J52794_10012474 | 3300003911 | Bacteria | 1637 |
| 19 | Ga0065716_1001573 | 3300005277 | Bacteria | 6099 |
| 20 | Ga0065704_10076592 | 3300005289 | Bacteria | 5063 |
| 21 | Ga0065712_10085070 | 3300005290 | Bacteria | 2721 |
| 22 | Ga0065715_10089287 | 3300005293 | Bacteria | 11507 |
| 23 | Ga0065715_10115395 | 3300005293 | Bacteria | 2416 |
| 24 | Ga0065707_10120006 | 3300005295 | Bacteria | 2145 |
| 25 | Ga0070676_10010247 | 3300005328 | Bacteria | 5083 |
| 26 | Ga0070683_100059910 | 3300005329 | Bacteria | 3537 |
| 27 | Ga0070683_100152562 | 3300005329 | Bacteria | 2190 |
| 28 | Ga0070690_100002486 | 3300005330 | Bacteria | 9910 |
| 29 | Ga0070690_100025698 | 3300005330 | Bacteria | 3626 |
| 30 | Ga0070690_100039884 | 3300005330 | Bacteria | 2968 |
| 31 | Ga0070690_100048172 | 3300005330 | Bacteria | 2713 |
| 32 | Ga0070690_100078518 | 3300005330 | Bacteria | 2157 |
| 33 | Ga0070670_100001258 | 3300005331 | Bacteria | 20184 |
| 34 | Ga0070670_100005543 | 3300005331 | Bacteria | 10648 |
| 35 | Ga0068869_100004579 | 3300005334 | Bacteria | 8615 |
| 36 | Ga0070666_10011932 | 3300005335 | Bacteria | 5466 |
| 37 | Ga0070680_100004377 | 3300005336 | Bacteria | 10630 |
| 38 | Ga0070680_100111219 | 3300005336 | Bacteria | 2280 |
| 39 | Ga0070682_100003311 | 3300005337 | Bacteria | 8934 |
| 40 | Ga0070682_100009952 | 3300005337 | Bacteria | 5386 |
| 41 | Ga0068868_100000941 | 3300005338 | Bacteria | 19766 |
| 42 | Ga0068868_100062763 | 3300005338 | Unclassified | 2946 |
| 43 | Ga0070660_100003480 | 3300005339 | Bacteria | 10842 |
| 44 | Ga0070660_100019153 | 3300005339 | Bacteria | 5010 |
| 45 | Ga0070660_100033696 | 3300005339 | Bacteria | 3863 |
| 46 | Ga0070689_100013020 | 3300005340 | Bacteria | 6010 |
| 47 | Ga0070689_100063968 | 3300005340 | Bacteria | 2862 |
| 48 | Ga0070691_10001644 | 3300005341 | Bacteria | 9690 |
| 49 | Ga0070687_100003077 | 3300005343 | Bacteria | 6415 |
| 50 | Ga0070687_100019210 | 3300005343 | Bacteria | 3175 |
| 51 | Ga0070687_100019559 | 3300005343 | Bacteria | 3153 |
| 52 | Ga0070661_100005996 | 3300005344 | Bacteria | 8365 |
| 53 | Ga0070661_100014071 | 3300005344 | Bacteria | 5631 |
| 54 | Ga0070668_100006837 | 3300005347 | Bacteria | 8454 |
| 55 | Ga0070668_100017843 | 3300005347 | Bacteria | 5324 |
| 56 | Ga0070669_100004234 | 3300005353 | Bacteria | 10377 |
| 57 | Ga0070675_100004596 | 3300005354 | Bacteria | 10542 |
| 58 | Ga0070675_100270948 | 3300005354 | Bacteria | 1490 |
| 59 | Ga0070671_100008535 | 3300005355 | Bacteria | 8213 |
| 60 | Ga0070671_100018060 | 3300005355 | Bacteria | 5724 |
| 61 | Ga0070671_100025267 | 3300005355 | Bacteria | 4872 |
| 62 | Ga0070671_100031731 | 3300005355 | Bacteria | 4367 |
| 63 | Ga0070671_100054363 | 3300005355 | Bacteria | 3329 |
| 64 | Ga0070671_100109271 | 3300005355 | Bacteria | 2322 |
| 65 | Ga0070674_100022554 | 3300005356 | Bacteria | 4062 |
| 66 | Ga0070674_100205017 | 3300005356 | Bacteria | 1525 |
| 67 | Ga0070673_100003318 | 3300005364 | Bacteria | 9999 |
| 68 | Ga0070673_100068387 | 3300005364 | Bacteria | 2844 |
| 69 | Ga0070673_100212153 | 3300005364 | Bacteria | 1673 |
| 70 | Ga0070688_100003893 | 3300005365 | Bacteria | 7741 |
| 71 | Ga0070688_100014190 | 3300005365 | Bacteria | 4510 |
| 72 | Ga0070659_100011723 | 3300005366 | Bacteria | 6489 |
| 73 | Ga0070659_100047438 | 3300005366 | Bacteria | 3369 |
| 74 | Ga0070659_100132246 | 3300005366 | Bacteria | 2027 |
| 75 | Ga0070667_100022536 | 3300005367 | Bacteria | 5222 |
| 76 | Ga0070703_10008204 | 3300005406 | Bacteria | 2937 |
| 77 | Ga0070709_10040465 | 3300005434 | Bacteria | 2866 |
| 78 | Ga0070714_100070765 | 3300005435 | Bacteria | 3015 |
| 79 | Ga0070714_100137161 | 3300005435 | Bacteria | 2192 |
| 80 | Ga0070714_100152050 | 3300005435 | Bacteria | 2087 |
| 81 | Ga0070714_100182463 | 3300005435 | Bacteria | 1910 |
| 82 | Ga0070713_100010279 | 3300005436 | Bacteria | 6756 |
| 83 | Ga0070713_100055859 | 3300005436 | Bacteria | 3282 |
| 84 | Ga0070713_100078687 | 3300005436 | Bacteria | 2807 |
| 85 | Ga0070713_100080122 | 3300005436 | Bacteria | 2783 |
| 86 | Ga0070713_100131957 | 3300005436 | Bacteria | 2204 |
| 87 | Ga0070710_10026141 | 3300005437 | Bacteria | 3098 |
| 88 | Ga0070710_10030270 | 3300005437 | Bacteria | 2911 |
| 89 | Ga0070701_10005710 | 3300005438 | Bacteria | 5170 |
| 90 | Ga0070711_100033611 | 3300005439 | Bacteria | 3415 |
| 91 | Ga0070711_100225677 | 3300005439 | Bacteria | 1458 |
| 92 | Ga0070705_100002546 | 3300005440 | Bacteria | 9161 |
| 93 | Ga0070700_100006621 | 3300005441 | Bacteria | 6203 |
| 94 | Ga0070700_100009050 | 3300005441 | Bacteria | 5456 |
| 95 | Ga0070694_100006591 | 3300005444 | Bacteria | 7055 |
| 96 | Ga0070694_100030769 | 3300005444 | Bacteria | 3514 |
| 97 | Ga0070694_100053651 | 3300005444 | Bacteria | 2729 |
| 98 | Ga0070708_100036142 | 3300005445 | Bacteria | 4307 |
| 99 | Ga0070708_100049321 | 3300005445 | Bacteria | 3724 |
| 100 | Ga0070708_100085736 | 3300005445 | Bacteria | 2859 |
| 101 | Ga0070708_100189442 | 3300005445 | Bacteria | 1924 |
| 102 | Ga0070663_100008316 | 3300005455 | Bacteria | 6376 |
| 103 | Ga0070663_100009057 | 3300005455 | Bacteria | 6149 |
| 104 | Ga0070663_100044736 | 3300005455 | Bacteria | 3124 |
| 105 | Ga0070663_100186589 | 3300005455 | Bacteria | 1612 |
| 106 | Ga0070678_100013314 | 3300005456 | Bacteria | 5152 |
| 107 | Ga0070678_100035377 | 3300005456 | Bacteria | 3486 |
| 108 | Ga0070678_100104122 | 3300005456 | Bacteria | 2206 |
| 109 | Ga0070678_100119356 | 3300005456 | Bacteria | 2077 |
| 110 | Ga0070678_100141240 | 3300005456 | Bacteria | 1927 |
| 111 | Ga0070662_100000003 | 3300005457 | Bacteria | 239813 |
| 112 | Ga0070662_100004119 | 3300005457 | Bacteria | 9141 |
| 113 | Ga0070662_100016144 | 3300005457 | Bacteria | 5010 |
| 114 | Ga0070662_100057850 | 3300005457 | Bacteria | 2818 |
| 115 | Ga0070662_100132739 | 3300005457 | Bacteria | 1922 |
| 116 | Ga0070681_10007934 | 3300005458 | Bacteria | 10388 |
| 117 | Ga0070681_10080007 | 3300005458 | Bacteria | 3224 |
| 118 | Ga0068867_100028777 | 3300005459 | Bacteria | 4000 |
| 119 | Ga0068867_100048787 | 3300005459 | Bacteria | 3116 |
| 120 | Ga0068867_100064248 | 3300005459 | Bacteria | 2728 |
| 121 | Ga0070706_100015126 | 3300005467 | Bacteria | 7125 |
| 122 | Ga0070707_100010836 | 3300005468 | Bacteria | 8490 |
| 123 | Ga0070707_100029019 | 3300005468 | Bacteria | 5266 |
| 124 | Ga0070707_100048259 | 3300005468 | Bacteria | 4079 |
| 125 | Ga0070707_100051213 | 3300005468 | Bacteria | 3958 |
| 126 | Ga0070707_100129797 | 3300005468 | Bacteria | 2450 |
| 127 | Ga0070707_100145525 | 3300005468 | Bacteria | 2307 |
| 128 | Ga0070698_100031038 | 3300005471 | Bacteria | 5541 |
| 129 | Ga0070698_100058384 | 3300005471 | Bacteria | 3901 |
| 130 | Ga0070699_100012259 | 3300005518 | Bacteria | 7395 |
| 131 | Ga0070699_100020536 | 3300005518 | Bacteria | 5697 |
| 132 | Ga0070699_100070612 | 3300005518 | Bacteria | 3036 |
| 133 | Ga0070699_100159274 | 3300005518 | Bacteria | 1998 |
| 134 | Ga0070699_100223344 | 3300005518 | Bacteria | 1679 |
| 135 | Ga0070679_100023489 | 3300005530 | Bacteria | 6036 |
| 136 | Ga0070679_100176014 | 3300005530 | Bacteria | 2112 |
| 137 | Ga0070679_100228876 | 3300005530 | Bacteria | 1819 |
| 138 | Ga0070684_100009321 | 3300005535 | Bacteria | 7728 |
| 139 | Ga0070684_100043936 | 3300005535 | Bacteria | 3861 |
| 140 | Ga0070697_100053209 | 3300005536 | Bacteria | 3290 |
| 141 | Ga0070697_100070524 | 3300005536 | Bacteria | 2865 |
| 142 | Ga0070697_100095898 | 3300005536 | Bacteria | 2461 |
| 143 | Ga0070697_100124625 | 3300005536 | Bacteria | 2157 |
| 144 | Ga0068853_100032729 | 3300005539 | Bacteria | 4406 |
| 145 | Ga0070672_100005958 | 3300005543 | Bacteria | 8134 |
| 146 | Ga0070672_100007399 | 3300005543 | Bacteria | 7444 |
| 147 | Ga0070672_100074207 | 3300005543 | Bacteria | 2713 |
| 148 | Ga0070686_100002567 | 3300005544 | Bacteria | 10018 |
| 149 | Ga0070686_100010053 | 3300005544 | Bacteria | 5326 |
| 150 | Ga0070686_100045238 | 3300005544 | Bacteria | 2772 |
| 151 | Ga0070695_100004686 | 3300005545 | Bacteria | 8043 |
| 152 | Ga0070695_100038877 | 3300005545 | Bacteria | 3005 |
| 153 | Ga0070696_100020813 | 3300005546 | Bacteria | 4445 |
| 154 | Ga0070696_100045885 | 3300005546 | Bacteria | 3029 |
| 155 | Ga0070696_100142356 | 3300005546 | Bacteria | 1754 |
| 156 | Ga0070696_100173428 | 3300005546 | Bacteria | 1595 |
| 157 | Ga0070693_100003704 | 3300005547 | Bacteria | 7148 |
| 158 | Ga0070693_100006327 | 3300005547 | Bacteria | 5739 |
| 159 | Ga0070665_100069299 | 3300005548 | Bacteria | 3535 |
| 160 | Ga0070665_100072058 | 3300005548 | Bacteria | 3463 |
| 161 | Ga0070704_100002939 | 3300005549 | Bacteria | 9685 |
| 162 | Ga0070704_100131816 | 3300005549 | Bacteria | 1938 |
| 163 | Ga0068855_100000288 | 3300005563 | Bacteria | 62320 |
| 164 | Ga0068855_100060747 | 3300005563 | Bacteria | 4419 |
| 165 | Ga0068855_100210099 | 3300005563 | Bacteria | 2187 |
| 166 | Ga0070664_100003754 | 3300005564 | Bacteria | 12250 |
| 167 | Ga0070664_100015067 | 3300005564 | Bacteria | 6313 |
| 168 | Ga0070664_100042647 | 3300005564 | Bacteria | 3829 |
| 169 | Ga0070664_100091649 | 3300005564 | Bacteria | 2631 |
| 170 | Ga0070664_100091877 | 3300005564 | Bacteria | 2627 |
| 171 | Ga0070664_100132444 | 3300005564 | Bacteria | 2190 |
| 172 | Ga0068857_100006093 | 3300005577 | Bacteria | 10299 |
| 173 | Ga0068857_100015552 | 3300005577 | Bacteria | 6648 |
| 174 | Ga0068854_100002230 | 3300005578 | Bacteria | 11923 |
| 175 | Ga0068856_100025283 | 3300005614 | Bacteria | 5788 |
| 176 | Ga0068856_100062715 | 3300005614 | Bacteria | 3671 |
| 177 | Ga0068856_100230587 | 3300005614 | Bacteria | 1867 |
| 178 | Ga0070702_100015554 | 3300005615 | Bacteria | 3886 |
| 179 | Ga0068852_100030713 | 3300005616 | Bacteria | 4427 |
| 180 | Ga0068852_100035807 | 3300005616 | Bacteria | 4145 |
| 181 | Ga0068852_100244602 | 3300005616 | Bacteria | 1716 |
| 182 | Ga0068859_100002626 | 3300005617 | Bacteria | 18286 |
| 183 | Ga0068859_100005469 | 3300005617 | Bacteria | 12924 |
| 184 | Ga0068859_100018036 | 3300005617 | Bacteria | 7092 |
| 185 | Ga0068859_100130106 | 3300005617 | Bacteria | 2588 |
| 186 | Ga0068864_100000198 | 3300005618 | Bacteria | 54959 |
| 187 | Ga0068864_100000892 | 3300005618 | Bacteria | 25113 |
| 188 | Ga0068864_100025170 | 3300005618 | Bacteria | 5010 |
| 189 | Ga0068864_100045770 | 3300005618 | Bacteria | 3753 |
| 190 | Ga0068864_100150266 | 3300005618 | Bacteria | 2109 |
| 191 | Ga0068864_100247702 | 3300005618 | Bacteria | 1653 |
| 192 | Ga0068864_100249563 | 3300005618 | Bacteria | 1647 |
| 193 | Ga0068864_100344121 | 3300005618 | Bacteria | 1406 |
| 194 | Ga0068866_10001457 | 3300005718 | Bacteria | 10120 |
| 195 | Ga0068861_100012037 | 3300005719 | Bacteria | 6027 |
| 196 | Ga0068861_100218861 | 3300005719 | Bacteria | 1608 |
| 197 | Ga0068851_10124759 | 3300005834 | Bacteria | 1387 |
| 198 | Ga0068870_10002196 | 3300005840 | Bacteria | 8086 |
| 199 | Ga0068863_100049203 | 3300005841 | Bacteria | 3997 |
| 200 | Ga0068863_100109783 | 3300005841 | Bacteria | 2626 |
| 201 | Ga0068863_100151701 | 3300005841 | Bacteria | 2217 |
| 202 | Ga0068863_100167211 | 3300005841 | Bacteria | 2109 |
| 203 | Ga0068858_100013723 | 3300005842 | Bacteria | 7647 |
| 204 | Ga0068858_100085631 | 3300005842 | Bacteria | 2932 |
| 205 | Ga0068858_100204847 | 3300005842 | Bacteria | 1866 |
| 206 | Ga0068860_100013202 | 3300005843 | Bacteria | 8104 |
| 207 | Ga0068860_100026383 | 3300005843 | Bacteria | 5601 |
| 208 | Ga0068860_100048378 | 3300005843 | Bacteria | 4052 |
| 209 | Ga0068860_100051573 | 3300005843 | Bacteria | 3914 |
| 210 | Ga0068860_100060157 | 3300005843 | Bacteria | 3611 |
| 211 | Ga0068860_100072012 | 3300005843 | Bacteria | 3284 |
| 212 | Ga0068860_100100056 | 3300005843 | Bacteria | 2765 |
| 213 | Ga0068860_100150545 | 3300005843 | Bacteria | 2240 |
| 214 | Ga0068862_100049583 | 3300005844 | Bacteria | 3587 |
| 215 | Ga0068862_100051740 | 3300005844 | Bacteria | 3513 |
| 216 | Ga0068862_100115660 | 3300005844 | Bacteria | 2359 |
| 217 | Ga0081455_10000053 | 3300005937 | Bacteria | 122071 |
| 218 | Ga0081540_1000266 | 3300005983 | Bacteria | 54692 |
| 219 | Ga0081540_1000743 | 3300005983 | Bacteria | 29993 |
| 220 | Ga0081540_1002298 | 3300005983 | Bacteria | 15695 |
| 221 | Ga0081540_1003173 | 3300005983 | Bacteria | 13114 |
| 222 | Ga0081540_1021705 | 3300005983 | Bacteria | 3812 |
| 223 | Ga0081539_10052853 | 3300005985 | Bacteria | 2278 |
| 224 | Ga0070717_10005668 | 3300006028 | Bacteria | 9124 |
| 225 | Ga0070717_10029651 | 3300006028 | Bacteria | 4391 |
| 226 | Ga0070717_10041692 | 3300006028 | Bacteria | 3742 |
| 227 | Ga0070715_10000026 | 3300006163 | Bacteria | 97907 |
| 228 | Ga0070716_100108588 | 3300006173 | Bacteria | 1715 |
| 229 | Ga0070712_100018949 | 3300006175 | Bacteria | 4479 |
| 230 | Ga0070712_100038353 | 3300006175 | Bacteria | 3273 |
| 231 | Ga0075427_10000222 | 3300006194 | Bacteria | 5880 |
| 232 | Ga0097621_100006211 | 3300006237 | Bacteria | 8471 |
| 233 | Ga0097621_100024131 | 3300006237 | Bacteria | 4745 |
| 234 | Ga0068871_100009850 | 3300006358 | Bacteria | 6936 |
| 235 | Ga0068871_100068529 | 3300006358 | Bacteria | 2913 |
| 236 | Ga0075428_100186161 | 3300006844 | Bacteria | 2247 |
| 237 | Ga0075431_100019533 | 3300006847 | Bacteria | 6911 |
| 238 | Ga0075433_10009110 | 3300006852 | Bacteria | 7928 |
| 239 | Ga0075433_10028953 | 3300006852 | Bacteria | 4714 |
| 240 | Ga0075433_10029323 | 3300006852 | Bacteria | 4686 |
| 241 | Ga0075434_100000694 | 3300006871 | Bacteria | 26302 |
| 242 | Ga0075434_100016384 | 3300006871 | Bacteria | 7124 |
| 243 | Ga0075434_100018256 | 3300006871 | Bacteria | 6773 |
| 244 | Ga0075434_100039880 | 3300006871 | Bacteria | 4650 |
| 245 | Ga0075429_100009653 | 3300006880 | Bacteria | 8370 |
| 246 | Ga0068865_100004789 | 3300006881 | Bacteria | 8182 |
| 247 | Ga0068865_100016439 | 3300006881 | Bacteria | 4735 |
| 248 | Ga0068865_100030975 | 3300006881 | Bacteria | 3562 |
| 249 | Ga0068865_100165891 | 3300006881 | Bacteria | 1689 |
| 250 | Ga0097620_100002626 | 3300006931 | Bacteria | 18286 |
| 251 | Ga0097620_100005469 | 3300006931 | Bacteria | 12924 |
| 252 | Ga0097620_100018036 | 3300006931 | Bacteria | 7092 |
| 253 | Ga0097620_100130117 | 3300006931 | Bacteria | 2588 |
| 254 | Ga0105240_10000091 | 3300009093 | Bacteria | 182507 |
| 255 | Ga0105240_10000208 | 3300009093 | Bacteria | 118950 |
| 256 | Ga0105240_10066680 | 3300009093 | Bacteria | 4464 |
| 257 | Ga0111539_10006123 | 3300009094 | Bacteria | 15530 |
| 258 | Ga0111539_10015008 | 3300009094 | Bacteria | 9654 |
| 259 | Ga0111539_10085103 | 3300009094 | Bacteria | 3717 |
| 260 | Ga0111539_10153510 | 3300009094 | Bacteria | 2695 |
| 261 | Ga0111539_10193205 | 3300009094 | Bacteria | 2375 |
| 262 | Ga0105245_10002193 | 3300009098 | Bacteria | 17695 |
| 263 | Ga0105245_10033418 | 3300009098 | Bacteria | 4559 |
| 264 | Ga0105245_10099219 | 3300009098 | Bacteria | 2692 |
| 265 | Ga0105247_10065658 | 3300009101 | Bacteria | 2258 |
| 266 | Ga0114129_10085704 | 3300009147 | Bacteria | 4370 |
| 267 | Ga0114129_10099078 | 3300009147 | Bacteria | 4034 |
| 268 | Ga0114129_10148684 | 3300009147 | Bacteria | 3207 |
| 269 | Ga0105243_10006356 | 3300009148 | Bacteria | 9125 |
| 270 | Ga0105243_10011002 | 3300009148 | Bacteria | 6841 |
| 271 | Ga0105241_10045004 | 3300009174 | Bacteria | 3347 |
| 272 | Ga0105241_10056248 | 3300009174 | Bacteria | 3016 |
| 273 | Ga0105242_10014836 | 3300009176 | Bacteria | 6035 |
| 274 | Ga0105242_10033814 | 3300009176 | Bacteria | 4096 |
| 275 | Ga0105242_10069800 | 3300009176 | Bacteria | 2911 |
| 276 | Ga0105242_10111476 | 3300009176 | Bacteria | 2333 |
| 277 | Ga0105248_10013878 | 3300009177 | Bacteria | 8863 |
| 278 | Ga0105248_10040509 | 3300009177 | Bacteria | 5222 |
| 279 | Ga0105248_10048980 | 3300009177 | Bacteria | 4739 |
| 280 | Ga0105248_10137409 | 3300009177 | Bacteria | 2757 |
| 281 | Ga0105248_10151409 | 3300009177 | Bacteria | 2617 |
| 282 | Ga0105248_10246529 | 3300009177 | Bacteria | 2011 |
| 283 | Ga0105238_10393488 | 3300009551 | Bacteria | 1378 |
| 284 | Ga0105249_10007344 | 3300009553 | Bacteria | 9606 |
| 285 | Ga0105249_10019581 | 3300009553 | Bacteria | 6039 |
| 286 | Ga0105249_10101183 | 3300009553 | Bacteria | 2710 |
| 287 | Ga0105239_10002058 | 3300010375 | Bacteria | 26061 |
| 288 | Ga0105239_10025305 | 3300010375 | Bacteria | 6535 |
| 289 | Ga0105239_10038188 | 3300010375 | Bacteria | 5262 |
| 290 | Ga0105239_10098985 | 3300010375 | Bacteria | 3224 |
| 291 | Ga0105239_10186731 | 3300010375 | Bacteria | 2320 |
| 292 | Ga0105246_10062460 | 3300011119 | Bacteria | 2595 |
| 293 | Ga0105246_10144869 | 3300011119 | Bacteria | 1791 |
| 294 | Ga0157342_1001450 | 3300012507 | Bacteria | 1761 |
| 295 | Ga0157338_1000062 | 3300012515 | Bacteria | 4630 |
| 296 | Ga0157370_10104626 | 3300013104 | Bacteria | 2650 |
| 297 | Ga0157369_10030109 | 3300013105 | Bacteria | 5989 |
| 298 | Ga0157369_10160722 | 3300013105 | Bacteria | 2371 |
| 299 | Ga0157374_10003055 | 3300013296 | Bacteria | 14034 |
| 300 | Ga0157374_10005126 | 3300013296 | Bacteria | 10994 |
| 301 | Ga0157374_10031326 | 3300013296 | Bacteria | 4833 |
| 302 | Ga0157374_10322621 | 3300013296 | Bacteria | 1531 |
| 303 | Ga0157378_10015420 | 3300013297 | Bacteria | 6693 |
| 304 | Ga0157378_10029707 | 3300013297 | Bacteria | 4827 |
| 305 | Ga0157378_10088003 | 3300013297 | Bacteria | 2818 |
| 306 | Ga0163162_10038671 | 3300013306 | Bacteria | 4761 |
| 307 | Ga0163162_10075204 | 3300013306 | Bacteria | 3438 |
| 308 | Ga0163162_10076179 | 3300013306 | Bacteria | 3416 |
| 309 | Ga0163162_10129132 | 3300013306 | Bacteria | 2635 |
| 310 | Ga0157372_10019331 | 3300013307 | Bacteria | 7337 |
| 311 | Ga0157372_10407493 | 3300013307 | Bacteria | 1584 |
| 312 | Ga0157375_10014740 | 3300013308 | Bacteria | 6987 |
| 313 | Ga0157375_10045525 | 3300013308 | Bacteria | 4271 |
| 314 | Ga0157375_10058435 | 3300013308 | Bacteria | 3815 |
| 315 | Ga0157375_10111292 | 3300013308 | Bacteria | 2837 |
| 316 | Ga0157375_10254207 | 3300013308 | Bacteria | 1918 |
| 317 | Ga0157375_10254263 | 3300013308 | Bacteria | 1918 |
| 318 | Ga0157375_10384113 | 3300013308 | Bacteria | 1571 |
| 319 | Ga0163163_10061653 | 3300014325 | Bacteria | 3716 |
| 320 | Ga0163163_10098026 | 3300014325 | Bacteria | 2952 |
| 321 | Ga0163163_10137949 | 3300014325 | Bacteria | 2480 |
| 322 | Ga0163163_10262233 | 3300014325 | Bacteria | 1779 |
| 323 | Ga0157380_10023078 | 3300014326 | Bacteria | 4692 |
| 324 | Ga0157377_10005921 | 3300014745 | Bacteria | 5786 |
| 325 | Ga0157379_10012849 | 3300014968 | Bacteria | 7322 |
| 326 | Ga0157379_10015522 | 3300014968 | Bacteria | 6684 |
| 327 | Ga0157379_10015909 | 3300014968 | Bacteria | 6612 |
| 328 | Ga0157379_10032414 | 3300014968 | Bacteria | 4659 |
| 329 | Ga0157379_10099401 | 3300014968 | Bacteria | 2612 |
| 330 | Ga0157376_10032791 | 3300014969 | Bacteria | 4174 |
| 331 | Ga0157376_10080887 | 3300014969 | Bacteria | 2788 |
| 332 | Ga0157376_10089735 | 3300014969 | Bacteria | 2658 |
| 333 | Ga0157376_10152433 | 3300014969 | Bacteria | 2086 |
| 334 | Ga0157376_10170733 | 3300014969 | Bacteria | 1980 |
| 335 | Ga0163161_10027103 | 3300017792 | Bacteria | 4063 |
| 336 | Ga0163161_10198901 | 3300017792 | Bacteria | 1544 |
| 337 | Ga0213872_10000078 | 3300021361 | Bacteria | 89790 |
| 338 | Ga0209565_1000167 | 3300025263 | Bacteria | 85246 |
| 339 | Ga0207666_1000121 | 3300025271 | Bacteria | 12065 |
| 340 | Ga0209673_1000051 | 3300025273 | Bacteria | 282161 |
| 341 | Ga0207673_1000199 | 3300025290 | Bacteria | 6006 |
| 342 | Ga0209675_1000027 | 3300025291 | Bacteria | 282175 |
| 343 | Ga0209564_1000897 | 3300025295 | Bacteria | 39116 |
| 344 | Ga0209256_1000265 | 3300025299 | Bacteria | 92716 |
| 345 | Ga0207697_10004636 | 3300025315 | Bacteria | 6526 |
| 346 | Ga0207697_10012779 | 3300025315 | Bacteria | 3513 |
| 347 | Ga0207656_10096309 | 3300025321 | Bacteria | 1351 |
| 348 | Ga0207653_10008878 | 3300025885 | Bacteria | 3135 |
| 349 | Ga0207682_10010711 | 3300025893 | Bacteria | 3588 |
| 350 | Ga0207692_10007099 | 3300025898 | Bacteria | 4576 |
| 351 | Ga0207692_10011983 | 3300025898 | Bacteria | 3711 |
| 352 | Ga0207692_10036932 | 3300025898 | Bacteria | 2386 |
| 353 | Ga0207642_10022378 | 3300025899 | Bacteria | 2506 |
| 354 | Ga0207710_10007880 | 3300025900 | Bacteria | 4507 |
| 355 | Ga0207710_10025060 | 3300025900 | Bacteria | 2572 |
| 356 | Ga0207688_10001502 | 3300025901 | Bacteria | 12242 |
| 357 | Ga0207680_10040697 | 3300025903 | Bacteria | 2706 |
| 358 | Ga0207680_10071823 | 3300025903 | Bacteria | 2146 |
| 359 | Ga0207680_10187650 | 3300025903 | Bacteria | 1402 |
| 360 | Ga0207647_10000049 | 3300025904 | Bacteria | 88392 |
| 361 | Ga0207647_10002513 | 3300025904 | Bacteria | 13884 |
| 362 | Ga0207685_10000009 | 3300025905 | Bacteria | 242842 |
| 363 | Ga0207699_10044934 | 3300025906 | Bacteria | 2574 |
| 364 | Ga0207699_10081042 | 3300025906 | Bacteria | 2012 |
| 365 | Ga0207645_10003686 | 3300025907 | Bacteria | 11554 |
| 366 | Ga0207643_10000170 | 3300025908 | Bacteria | 44654 |
| 367 | Ga0207684_10001521 | 3300025910 | Bacteria | 24854 |
| 368 | Ga0207654_10094257 | 3300025911 | Bacteria | 1832 |
| 369 | Ga0207654_10121311 | 3300025911 | Bacteria | 1642 |
| 370 | Ga0207707_10006812 | 3300025912 | Bacteria | 9970 |
| 371 | Ga0207707_10063119 | 3300025912 | Bacteria | 3224 |
| 372 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 373 | Ga0207695_10098679 | 3300025913 | Bacteria | 2920 |
| 374 | Ga0207695_10201253 | 3300025913 | Bacteria | 1905 |
| 375 | Ga0207695_10223772 | 3300025913 | Bacteria | 1788 |
| 376 | Ga0207693_10003442 | 3300025915 | Bacteria | 13505 |
| 377 | Ga0207693_10014217 | 3300025915 | Bacteria | 6404 |
| 378 | Ga0207693_10065734 | 3300025915 | Bacteria | 2839 |
| 379 | Ga0207693_10105547 | 3300025915 | Bacteria | 2209 |
| 380 | Ga0207663_10031299 | 3300025916 | Bacteria | 3148 |
| 381 | Ga0207660_10022481 | 3300025917 | Bacteria | 4248 |
| 382 | Ga0207662_10007466 | 3300025918 | Bacteria | 5954 |
| 383 | Ga0207662_10129503 | 3300025918 | Bacteria | 1590 |
| 384 | Ga0207657_10007036 | 3300025919 | Bacteria | 11575 |
| 385 | Ga0207657_10007416 | 3300025919 | Bacteria | 11248 |
| 386 | Ga0207657_10044583 | 3300025919 | Bacteria | 3898 |
| 387 | Ga0207649_10001009 | 3300025920 | Bacteria | 17378 |
| 388 | Ga0207652_10049393 | 3300025921 | Bacteria | 3601 |
| 389 | Ga0207652_10254518 | 3300025921 | Bacteria | 1584 |
| 390 | Ga0207646_10003821 | 3300025922 | Bacteria | 16737 |
| 391 | Ga0207646_10011237 | 3300025922 | Bacteria | 8695 |
| 392 | Ga0207646_10031775 | 3300025922 | Bacteria | 4779 |
| 393 | Ga0207681_10053519 | 3300025923 | Bacteria | 2740 |
| 394 | Ga0207681_10175905 | 3300025923 | Bacteria | 1626 |
| 395 | Ga0207650_10007451 | 3300025925 | Bacteria | 7460 |
| 396 | Ga0207659_10162803 | 3300025926 | Bacteria | 1753 |
| 397 | Ga0207687_10000941 | 3300025927 | Bacteria | 19857 |
| 398 | Ga0207687_10021029 | 3300025927 | Bacteria | 4332 |
| 399 | Ga0207687_10050893 | 3300025927 | Bacteria | 2886 |
| 400 | Ga0207700_10005756 | 3300025928 | Bacteria | 7443 |
| 401 | Ga0207700_10009622 | 3300025928 | Bacteria | 6051 |
| 402 | Ga0207664_10015029 | 3300025929 | Bacteria | 5606 |
| 403 | Ga0207664_10045233 | 3300025929 | Bacteria | 3451 |
| 404 | Ga0207664_10057700 | 3300025929 | Bacteria | 3086 |
| 405 | Ga0207664_10176051 | 3300025929 | Bacteria | 1834 |
| 406 | Ga0207664_10213840 | 3300025929 | Bacteria | 1669 |
| 407 | Ga0207644_10007715 | 3300025931 | Bacteria | 7022 |
| 408 | Ga0207644_10055879 | 3300025931 | Bacteria | 2847 |
| 409 | Ga0207644_10058880 | 3300025931 | Bacteria | 2777 |
| 410 | Ga0207644_10068961 | 3300025931 | Bacteria | 2581 |
| 411 | Ga0207644_10083261 | 3300025931 | Bacteria | 2368 |
| 412 | Ga0207644_10094153 | 3300025931 | Bacteria | 2237 |
| 413 | Ga0207644_10111355 | 3300025931 | Bacteria | 2070 |
| 414 | Ga0207644_10116480 | 3300025931 | Bacteria | 2028 |
| 415 | Ga0207690_10004445 | 3300025932 | Bacteria | 8275 |
| 416 | Ga0207690_10202566 | 3300025932 | Bacteria | 1508 |
| 417 | Ga0207706_10000111 | 3300025933 | Bacteria | 87282 |
| 418 | Ga0207706_10018959 | 3300025933 | Bacteria | 6187 |
| 419 | Ga0207706_10025115 | 3300025933 | Bacteria | 5342 |
| 420 | Ga0207706_10037211 | 3300025933 | Bacteria | 4322 |
| 421 | Ga0207706_10054953 | 3300025933 | Bacteria | 3513 |
| 422 | Ga0207706_10077028 | 3300025933 | Bacteria | 2933 |
| 423 | Ga0207706_10082759 | 3300025933 | Bacteria | 2821 |
| 424 | Ga0207686_10019407 | 3300025934 | Bacteria | 3867 |
| 425 | Ga0207686_10024867 | 3300025934 | Bacteria | 3476 |
| 426 | Ga0207686_10136509 | 3300025934 | Bacteria | 1689 |
| 427 | Ga0207709_10005222 | 3300025935 | Bacteria | 7390 |
| 428 | Ga0207709_10022544 | 3300025935 | Bacteria | 3572 |
| 429 | Ga0207709_10066077 | 3300025935 | Bacteria | 2277 |
| 430 | Ga0207670_10049133 | 3300025936 | Bacteria | 2820 |
| 431 | Ga0207669_10025866 | 3300025937 | Bacteria | 3181 |
| 432 | Ga0207669_10037873 | 3300025937 | Bacteria | 2772 |
| 433 | Ga0207704_10033631 | 3300025938 | Bacteria | 2918 |
| 434 | Ga0207665_10005232 | 3300025939 | Bacteria | 8667 |
| 435 | Ga0207665_10006610 | 3300025939 | Bacteria | 7690 |
| 436 | Ga0207665_10008176 | 3300025939 | Bacteria | 6906 |
| 437 | Ga0207665_10023526 | 3300025939 | Bacteria | 4058 |
| 438 | Ga0207665_10028191 | 3300025939 | Bacteria | 3708 |
| 439 | Ga0207691_10006198 | 3300025940 | Bacteria | 11552 |
| 440 | Ga0207691_10006422 | 3300025940 | Bacteria | 11361 |
| 441 | Ga0207691_10008613 | 3300025940 | Bacteria | 9788 |
| 442 | Ga0207691_10106179 | 3300025940 | Bacteria | 2501 |
| 443 | Ga0207711_10006243 | 3300025941 | Bacteria | 10055 |
| 444 | Ga0207711_10022156 | 3300025941 | Bacteria | 5311 |
| 445 | Ga0207711_10034111 | 3300025941 | Bacteria | 4310 |
| 446 | Ga0207711_10043350 | 3300025941 | Bacteria | 3837 |
| 447 | Ga0207711_10050148 | 3300025941 | Bacteria | 3573 |
| 448 | Ga0207711_10087642 | 3300025941 | Bacteria | 2731 |
| 449 | Ga0207711_10089562 | 3300025941 | Bacteria | 2703 |
| 450 | Ga0207711_10103432 | 3300025941 | Bacteria | 2522 |
| 451 | Ga0207711_10197682 | 3300025941 | Bacteria | 1834 |
| 452 | Ga0207689_10005901 | 3300025942 | Bacteria | 10848 |
| 453 | Ga0207689_10008098 | 3300025942 | Bacteria | 9166 |
| 454 | Ga0207689_10025089 | 3300025942 | Bacteria | 4998 |
| 455 | Ga0207661_10000500 | 3300025944 | Bacteria | 25254 |
| 456 | Ga0207661_10043789 | 3300025944 | Bacteria | 3534 |
| 457 | Ga0207679_10000073 | 3300025945 | Bacteria | 89687 |
| 458 | Ga0207679_10023752 | 3300025945 | Bacteria | 4196 |
| 459 | Ga0207667_10000234 | 3300025949 | Bacteria | 77157 |
| 460 | Ga0207667_10148060 | 3300025949 | Bacteria | 2416 |
| 461 | Ga0207712_10003735 | 3300025961 | Bacteria | 9607 |
| 462 | Ga0207712_10023192 | 3300025961 | Bacteria | 4093 |
| 463 | Ga0207712_10041025 | 3300025961 | Bacteria | 3179 |
| 464 | Ga0207712_10077652 | 3300025961 | Bacteria | 2407 |
| 465 | Ga0207668_10007786 | 3300025972 | Bacteria | 6373 |
| 466 | Ga0207668_10083077 | 3300025972 | Bacteria | 2329 |
| 467 | Ga0207658_10154643 | 3300025986 | Bacteria | 1873 |
| 468 | Ga0207677_10010220 | 3300026023 | Bacteria | 5304 |
| 469 | Ga0207677_10085618 | 3300026023 | Bacteria | 2275 |
| 470 | Ga0207703_10001970 | 3300026035 | Bacteria | 18125 |
| 471 | Ga0207703_10019848 | 3300026035 | Bacteria | 5253 |
| 472 | Ga0207703_10029178 | 3300026035 | Bacteria | 4352 |
| 473 | Ga0207703_10058776 | 3300026035 | Bacteria | 3139 |
| 474 | Ga0207703_10114734 | 3300026035 | Bacteria | 2304 |
| 475 | Ga0207703_10159136 | 3300026035 | Bacteria | 1977 |
| 476 | Ga0207703_10184538 | 3300026035 | Bacteria | 1843 |
| 477 | Ga0207639_10021608 | 3300026041 | Bacteria | 4625 |
| 478 | Ga0207639_10091419 | 3300026041 | Bacteria | 2437 |
| 479 | Ga0207678_10006861 | 3300026067 | Bacteria | 10098 |
| 480 | Ga0207678_10012045 | 3300026067 | Bacteria | 7595 |
| 481 | Ga0207678_10028319 | 3300026067 | Bacteria | 4891 |
| 482 | Ga0207678_10045247 | 3300026067 | Bacteria | 3807 |
| 483 | Ga0207678_10071631 | 3300026067 | Bacteria | 2972 |
| 484 | Ga0207708_10005825 | 3300026075 | Bacteria | 9116 |
| 485 | Ga0207708_10026987 | 3300026075 | Bacteria | 4348 |
| 486 | Ga0207708_10054687 | 3300026075 | Bacteria | 3044 |
| 487 | Ga0207702_10037313 | 3300026078 | Bacteria | 4067 |
| 488 | Ga0207702_10096581 | 3300026078 | Bacteria | 2599 |
| 489 | Ga0207702_10170059 | 3300026078 | Bacteria | 1997 |
| 490 | Ga0207641_10007312 | 3300026088 | Bacteria | 9203 |
| 491 | Ga0207641_10013057 | 3300026088 | Bacteria | 6813 |
| 492 | Ga0207641_10180303 | 3300026088 | Bacteria | 1934 |
| 493 | Ga0207641_10225813 | 3300026088 | Bacteria | 1738 |
| 494 | Ga0207648_10023509 | 3300026089 | Bacteria | 5519 |
| 495 | Ga0207648_10030417 | 3300026089 | Bacteria | 4782 |
| 496 | Ga0207648_10031345 | 3300026089 | Bacteria | 4700 |
| 497 | Ga0207648_10087929 | 3300026089 | Bacteria | 2712 |
| 498 | Ga0207676_10000996 | 3300026095 | Bacteria | 21831 |
| 499 | Ga0207676_10006169 | 3300026095 | Bacteria | 8464 |
| 500 | Ga0207676_10006739 | 3300026095 | Bacteria | 8129 |
| 501 | Ga0207676_10064163 | 3300026095 | Bacteria | 2919 |
| 502 | Ga0207674_10001648 | 3300026116 | Bacteria | 28724 |
| 503 | Ga0207674_10003682 | 3300026116 | Bacteria | 18700 |
| 504 | Ga0207675_100005605 | 3300026118 | Bacteria | 12023 |
| 505 | Ga0207675_100096502 | 3300026118 | Bacteria | 2783 |
| 506 | Ga0207683_10009988 | 3300026121 | Bacteria | 8100 |
| 507 | Ga0207683_10024313 | 3300026121 | Bacteria | 5216 |
| 508 | Ga0207683_10026381 | 3300026121 | Bacteria | 5014 |
| 509 | Ga0207683_10097314 | 3300026121 | Bacteria | 2624 |
| 510 | Ga0207683_10229223 | 3300026121 | Bacteria | 1694 |
| 511 | Ga0207698_10015454 | 3300026142 | Bacteria | 5111 |
| 512 | Ga0207698_10043979 | 3300026142 | Bacteria | 3351 |
| 513 | Ga0207698_10192950 | 3300026142 | Bacteria | 1816 |
| 514 | Ga0207698_10249944 | 3300026142 | Bacteria | 1622 |
| 515 | Ga0210002_1000584 | 3300027617 | Bacteria | 4947 |
| 516 | Ga0209974_10002790 | 3300027876 | Bacteria | 6336 |
| 517 | Ga0207428_10001104 | 3300027907 | Bacteria | 29349 |
| 518 | Ga0207428_10004390 | 3300027907 | Bacteria | 13448 |
| 519 | Ga0207428_10004461 | 3300027907 | Bacteria | 13282 |
| 520 | Ga0207428_10072519 | 3300027907 | Bacteria | 2703 |
| 521 | Ga0268266_10022307 | 3300028379 | Bacteria | 5395 |
| 522 | Ga0268266_10064207 | 3300028379 | Bacteria | 3171 |
| 523 | Ga0268266_10064832 | 3300028379 | Bacteria | 3157 |
| 524 | Ga0268266_10070266 | 3300028379 | Bacteria | 3034 |
| 525 | Ga0268265_10012161 | 3300028380 | Bacteria | 5830 |
| 526 | Ga0268265_10111947 | 3300028380 | Bacteria | 2230 |
| 527 | Ga0268264_10020450 | 3300028381 | Bacteria | 5408 |
| 528 | Ga0268264_10031800 | 3300028381 | Bacteria | 4328 |
| 529 | Ga0268264_10033842 | 3300028381 | Bacteria | 4201 |
| 530 | Ga0268264_10040688 | 3300028381 | Bacteria | 3841 |
| 531 | Ga0268264_10106425 | 3300028381 | Bacteria | 2448 |
| 532 | Ga0307513_10048341 | 3300031456 | Bacteria | 4618 |
| 533 | Ga0307408_100031441 | 3300031548 | Bacteria | 3696 |
| 534 | Ga0307408_100035958 | 3300031548 | Bacteria | 3478 |
| 535 | Ga0307508_10005636 | 3300031616 | Bacteria | 11867 |
| 536 | Ga0307405_10001068 | 3300031731 | Bacteria | 11129 |
| 537 | Ga0307410_10000446 | 3300031852 | Bacteria | 16584 |
| 538 | Ga0307410_10001648 | 3300031852 | Bacteria | 10273 |
| 539 | Ga0307406_10015807 | 3300031901 | Bacteria | 4374 |
| 540 | Ga0307407_10001157 | 3300031903 | Bacteria | 9261 |
| 541 | Ga0307407_10012880 | 3300031903 | Bacteria | 4039 |
| 542 | Ga0307409_100006279 | 3300031995 | Bacteria | 6962 |
| 543 | Ga0307409_100058965 | 3300031995 | Bacteria | 2984 |
| 544 | Ga0307416_100023019 | 3300032002 | Bacteria | 4511 |
| 545 | Ga0307411_10005785 | 3300032005 | Bacteria | 6119 |
| 546 | Ga0307411_10042197 | 3300032005 | Bacteria | 2908 |
| 547 | Ga0307415_100000950 | 3300032126 | Bacteria | 13334 |
| 548 | Ga0373930_0000685 | 3300034816 | Bacteria | 4749 |
| 549 | Ga0373948_0000760 | 3300034817 | Bacteria | 4207 |
| 550 | Ga0373950_0001042 | 3300034818 | Bacteria | 3536 |
| 551 | Ga0373950_0006897 | 3300034818 | Bacteria | 1748 |
| 552 | Ga0373958_0002479 | 3300034819 | Bacteria | 2594 |
| 553 | Ga0373959_0000435 | 3300034820 | Bacteria | 7953 |
| 554 | Ga0373938_0006949 | 3300034957 | Bacteria | 1976 |
| 555 | Ga0373928_0000247 | 3300035084 | Bacteria | 10651 |
| 556 | Ga0373929_0000208 | 3300035085 | Bacteria | 10586 |
| 557 | Ga0373929_0003744 | 3300035085 | Bacteria | 2728 |
| 558 | Ga0373934_0002824 | 3300035086 | Bacteria | 6363 |
| 559 | Ga0373940_0000026 | 3300035088 | Bacteria | 16296 |
| 560 | Ga0373940_0029554 | 3300035088 | Bacteria | 1452 |
| 561 | Ga0373944_0000854 | 3300035089 | Bacteria | 7477 |
| 562 | Ga0373949_0002963 | 3300035090 | Bacteria | 4177 |
| 563 | Ga0373949_0006846 | 3300035090 | Bacteria | 2504 |
| 564 | Ga0373949_0019756 | 3300035090 | Bacteria | 1537 |
| 565 | Ga0373951_0000727 | 3300035091 | Bacteria | 9041 |
| 566 | Ga0373951_0006612 | 3300035091 | Bacteria | 2649 |
| 567 | Ga0373932_0000407 | 3300035112 | Bacteria | 13181 |
| 568 | Ga0373932_0012360 | 3300035112 | Bacteria | 2101 |
| 569 | Ga0373939_0005792 | 3300035114 | Bacteria | 2951 |
| 570 | Ga0373941_0001353 | 3300035115 | Bacteria | 5157 |
| 571 | Ga0373941_0003182 | 3300035115 | Bacteria | 3691 |
| 572 | Ga0373941_0032612 | 3300035115 | Unclassified | 1560 |
| 573 | Ga0373945_0016257 | 3300035116 | Bacteria | 2507 |
| 574 | Ga0373953_0001046 | 3300035117 | Bacteria | 7838 |
| 575 | Ga0373956_0015094 | 3300035119 | Bacteria | 3230 |
| 576 | Ga0373960_0002714 | 3300035121 | Bacteria | 4002 |
| 577 | Ga0373960_0037968 | 3300035121 | Bacteria | 1378 |
| 578 | Ga0373943_0019324 | 3300035170 | Bacteria | 3132 |
| 579 | Ga0373943_0051482 | 3300035170 | Bacteria | 2027 |
| 580 | Ga0373946_0017459 | 3300035171 | Bacteria | 2746 |
| 581 | Ga0373946_0018549 | 3300035171 | Bacteria | 2673 |
| 582 | Ga0373942_0000429 | 3300035207 | Bacteria | 11745 |
| 583 | Ga0373942_0029592 | 3300035207 | Bacteria | 1438 |
| 584 | Ga0373961_0005044 | 3300035241 | Bacteria | 3175 |
| 585 | Ga0373962_0005545 | 3300035242 | Bacteria | 3051 |
| 586 | Ga0373962_0007708 | 3300035242 | Bacteria | 2641 |
| 587 | Ga0373962_0008860 | 3300035242 | Bacteria | 2484 |
| 588 | Ga0373924_0008318 | 3300035410 | Bacteria | 3766 |
| 589 | Ga0373931_0003387 | 3300035691 | Bacteria | 7153 |
| 590 | Ga0373931_0005919 | 3300035691 | Bacteria | 5686 |
| 591 | Ga0373931_0041276 | 3300035691 | Bacteria | 2423 |
| 592 | Ga0373935_0023535 | 3300035692 | Bacteria | 3785 |
| 593 | Ga0373935_0061444 | 3300035692 | Bacteria | 2405 |
| 594 | Ga0373927_0017392 | 3300035695 | Bacteria | 4732 |
| 595 | Ga0373927_0048642 | 3300035695 | Bacteria | 2743 |
| 596 | Ga0373927_0147030 | 3300035695 | Bacteria | 1543 |
| 597 | Ga0373933_0004772 | 3300035724 | Bacteria | 7409 |
| 598 | Ga0373947_0018999 | 3300035725 | Bacteria | 3960 |
| 599 | Ga0373947_0022156 | 3300035725 | Bacteria | 3681 |
| 600 | Ga0373947_0039961 | 3300035725 | Bacteria | 2793 |
| 601 | Ga0373947_0054287 | 3300035725 | Bacteria | 2418 |
| 602 | Ga0373947_0057122 | 3300035725 | Bacteria | 2360 |
| 603 | Ga0373937_0018743 | 3300036401 | Bacteria | 6185 |
| 604 | Ga0373937_0060907 | 3300036401 | Bacteria | 3469 |
| 605 | Ga0373937_0065911 | 3300036401 | Bacteria | 3334 |
| 606 | Ga0373925_0007679 | 3300037068 | Bacteria | 7857 |
| 607 | Ga0373925_0019209 | 3300037068 | Bacteria | 4969 |
| 608 | Ga0373925_0021141 | 3300037068 | Bacteria | 4741 |
| 609 | Ga0373925_0053112 | 3300037068 | Bacteria | 3028 |
| 610 | Ga0373925_0116721 | 3300037068 | Bacteria | 2067 |
| 611 | Ga0395899_0001097 | 3300037312 | Bacteria | 24262 |
| 612 | Ga0395899_0020924 | 3300037312 | Bacteria | 4962 |
| 613 | Ga0395900_0007849 | 3300037418 | Bacteria | 10998 |
| 614 | Ga0395900_0056020 | 3300037418 | Bacteria | 4058 |
| 615 | Ga0395900_0077719 | 3300037418 | Bacteria | 3410 |
| 616 | Ga0395900_0104191 | 3300037418 | Bacteria | 2915 |
| 617 | Ga0395900_0359396 | 3300037418 | Bacteria | 1428 |
| 618 | Ga0395898_0010657 | 3300037466 | Bacteria | 9603 |
| 619 | Ga0395898_0010839 | 3300037466 | Bacteria | 9523 |
| 620 | Ga0395898_0062096 | 3300037466 | Bacteria | 3629 |
| 621 | Ga0395898_0083951 | 3300037466 | Bacteria | 3070 |
| 622 | Ga0395898_0100971 | 3300037466 | Bacteria | 2771 |
| 623 | Ga0395898_0190441 | 3300037466 | Bacteria | 1960 |
| 624 | Ga0395905_0005914 | 3300037471 | Bacteria | 12404 |
| 625 | Ga0395905_0007758 | 3300037471 | Bacteria | 10646 |
| 626 | Ga0395905_0027153 | 3300037471 | Bacteria | 5399 |
| 627 | Ga0395905_0084686 | 3300037471 | Bacteria | 2971 |
| 628 | Ga0395901_0005743 | 3300038443 | Bacteria | 12568 |
| 629 | Ga0395901_0009184 | 3300038443 | Bacteria | 10017 |
| 630 | Ga0395901_0016278 | 3300038443 | Bacteria | 7574 |
| 631 | Ga0395901_0026461 | 3300038443 | Bacteria | 5956 |
| 632 | Ga0395901_0115186 | 3300038443 | Bacteria | 2824 |
| 633 | Ga0395901_0141659 | 3300038443 | Bacteria | 2527 |
| 634 | Ga0436361_0081046 | 3300039447 | Bacteria | 44857 |
| 635 | Ga0436361_0173984 | 3300039447 | Bacteria | 4710 |
| 636 | Ga0436361_0775201 | 3300039447 | Bacteria | 1223 |
| 637 | Ga0436363_0000250 | 3300039450 | Bacteria | 2843 |
| 638 | Ga0436363_0520749 | 3300039450 | Bacteria | 2430 |
| 639 | Ga0451577_0010773 | 3300042876 | Bacteria | 8699 |
| 640 | Ga0451577_0013515 | 3300042876 | Bacteria | 7637 |
| 641 | Ga0453683_0004980 | 3300044673 | Bacteria | 9332 |
| 642 | Ga0453683_0108698 | 3300044673 | Bacteria | 1743 |
| 643 | Ga0453684_0016151 | 3300044712 | Bacteria | 11709 |
| 644 | Ga0453684_0121764 | 3300044712 | Bacteria | 3148 |
| 645 | Ga0466957_0003343 | 3300044842 | Bacteria | 8793 |
| 646 | Ga0451576_0007618 | 3300045051 | Bacteria | 12887 |
| 647 | Ga0451576_0075803 | 3300045051 | Bacteria | 3500 |
| 648 | Ga0451576_0169680 | 3300045051 | Bacteria | 2277 |
| 649 | Ga0495617_000387 | 3300046452 | Bacteria | 24303 |
| 650 | Ga0495617_002096 | 3300046452 | Bacteria | 8236 |
| 651 | Ga0495617_003252 | 3300046452 | Bacteria | 6165 |
| 652 | Ga0495592_0010172 | 3300046454 | Bacteria | 7092 |
| 653 | Ga0495592_0111618 | 3300046454 | Bacteria | 1934 |
| 654 | Ga0495603_0016118 | 3300046455 | Bacteria | 4518 |
| 655 | Ga0495603_0054930 | 3300046455 | Bacteria | 2360 |
| 656 | Ga0495603_0061459 | 3300046455 | Bacteria | 2218 |
| 657 | Ga0495590_0003942 | 3300046457 | Bacteria | 6034 |
| 658 | Ga0495590_0010756 | 3300046457 | Bacteria | 3429 |
| 659 | Ga0495629_0010654 | 3300046459 | Bacteria | 6688 |
| 660 | Ga0495629_0044719 | 3300046459 | Bacteria | 3107 |
| 661 | Ga0495629_0063398 | 3300046459 | Bacteria | 2581 |
| 662 | Ga0495638_0000520 | 3300046460 | Bacteria | 45045 |
| 663 | Ga0495638_0010656 | 3300046460 | Bacteria | 6367 |
| 664 | Ga0495641_0045665 | 3300046461 | Bacteria | 2016 |
| 665 | Ga0495653_0022255 | 3300046463 | Bacteria | 5131 |
| 666 | Ga0495580_0048323 | 3300046472 | Bacteria | 3013 |
| 667 | Ga0495580_0099343 | 3300046472 | Bacteria | 2024 |
| 668 | Ga0495580_0127320 | 3300046472 | Bacteria | 1768 |
| 669 | Ga0495582_0002101 | 3300046473 | Bacteria | 11145 |
| 670 | Ga0495582_0008520 | 3300046473 | Bacteria | 5656 |
| 671 | Ga0495582_0020177 | 3300046473 | Bacteria | 3646 |
| 672 | Ga0495605_0004646 | 3300046474 | Bacteria | 8028 |
| 673 | Ga0495605_0008241 | 3300046474 | Bacteria | 5894 |
| 674 | Ga0495639_0008880 | 3300046475 | Bacteria | 4308 |
| 675 | Ga0495639_0026761 | 3300046475 | Bacteria | 2551 |
| 676 | Ga0495662_0000090 | 3300046476 | Bacteria | 32519 |
| 677 | Ga0495664_0000146 | 3300046477 | Bacteria | 35506 |
| 678 | Ga0495664_0049659 | 3300046477 | Bacteria | 2490 |
| 679 | Ga0495584_0000005 | 3300046491 | Bacteria | 306957 |
| 680 | Ga0495584_0000144 | 3300046491 | Bacteria | 49665 |
| 681 | Ga0495584_0000148 | 3300046491 | Bacteria | 48720 |
| 682 | Ga0495584_0045902 | 3300046491 | Bacteria | 2204 |
| 683 | Ga0495584_0052096 | 3300046491 | Bacteria | 2060 |
| 684 | Ga0495584_0073080 | 3300046491 | Bacteria | 1723 |
| 685 | Ga0495585_0000023 | 3300046492 | Bacteria | 149218 |
| 686 | Ga0495585_0003154 | 3300046492 | Bacteria | 11289 |
| 687 | Ga0495585_0007462 | 3300046492 | Bacteria | 6689 |
| 688 | Ga0495585_0045048 | 3300046492 | Bacteria | 2463 |
| 689 | Ga0495585_0062442 | 3300046492 | Bacteria | 2046 |
| 690 | Ga0495594_0013321 | 3300046499 | Bacteria | 4291 |
| 691 | Ga0495596_0005603 | 3300046500 | Bacteria | 5904 |
| 692 | Ga0495607_0003127 | 3300046501 | Bacteria | 12850 |
| 693 | Ga0495607_0009303 | 3300046501 | Bacteria | 6660 |
| 694 | Ga0495607_0013889 | 3300046501 | Bacteria | 5262 |
| 695 | Ga0495607_0048423 | 3300046501 | Bacteria | 2485 |
| 696 | Ga0495607_0106628 | 3300046501 | Bacteria | 1491 |
| 697 | Ga0495583_0000045 | 3300046506 | Bacteria | 220503 |
| 698 | Ga0495583_0009632 | 3300046506 | Bacteria | 5746 |
| 699 | Ga0495583_0032541 | 3300046506 | Bacteria | 2516 |
| 700 | Ga0495606_0010259 | 3300046507 | Bacteria | 7803 |
| 701 | Ga0495606_0013445 | 3300046507 | Bacteria | 6463 |
| 702 | Ga0495608_0001166 | 3300046511 | Bacteria | 18615 |
| 703 | Ga0495616_0003950 | 3300046513 | Bacteria | 9442 |
| 704 | Ga0495616_0007571 | 3300046513 | Bacteria | 6498 |
| 705 | Ga0495616_0019134 | 3300046513 | Bacteria | 3742 |
| 706 | Ga0495616_0100117 | 3300046513 | Bacteria | 1360 |
| 707 | Ga0495618_0014081 | 3300046514 | Bacteria | 4869 |
| 708 | Ga0495618_0014685 | 3300046514 | Bacteria | 4775 |
| 709 | Ga0495618_0041634 | 3300046514 | Bacteria | 2894 |
| 710 | Ga0495618_0171775 | 3300046514 | Bacteria | 1379 |
| 711 | Ga0495620_0001243 | 3300046515 | Bacteria | 15564 |
| 712 | Ga0495630_0021724 | 3300046517 | Bacteria | 4739 |
| 713 | Ga0495630_0022831 | 3300046517 | Bacteria | 4621 |
| 714 | Ga0495644_0004742 | 3300046523 | Bacteria | 5339 |
| 715 | Ga0495648_0000048 | 3300046524 | Bacteria | 164840 |
| 716 | Ga0495648_0000326 | 3300046524 | Bacteria | 52532 |
| 717 | Ga0495648_0014256 | 3300046524 | Bacteria | 5829 |
| 718 | Ga0495648_0119131 | 3300046524 | Bacteria | 1422 |
| 719 | Ga0495642_0004115 | 3300046528 | Bacteria | 5674 |
| 720 | Ga0495652_0013906 | 3300046529 | Bacteria | 7237 |
| 721 | Ga0495652_0026750 | 3300046529 | Bacteria | 5092 |
| 722 | Ga0495652_0037469 | 3300046529 | Bacteria | 4207 |
| 723 | Ga0495652_0070602 | 3300046529 | Bacteria | 2918 |
| 724 | Ga0495665_0013021 | 3300046531 | Bacteria | 4504 |
| 725 | Ga0495640_0000406 | 3300046533 | Bacteria | 31017 |
| 726 | Ga0495640_0010615 | 3300046533 | Bacteria | 7105 |
| 727 | Ga0495640_0021298 | 3300046533 | Bacteria | 4759 |
| 728 | Ga0495586_0037773 | 3300046535 | Bacteria | 2593 |
| 729 | Ga0495586_0042660 | 3300046535 | Bacteria | 2442 |
| 730 | Ga0495587_0001403 | 3300046536 | Bacteria | 16023 |
| 731 | Ga0495587_0062851 | 3300046536 | Bacteria | 2173 |
| 732 | Ga0495609_0000889 | 3300046538 | Bacteria | 21817 |
| 733 | Ga0495609_0003207 | 3300046538 | Bacteria | 9495 |
| 734 | Ga0495609_0004379 | 3300046538 | Bacteria | 7747 |
| 735 | Ga0495597_0000307 | 3300046542 | Bacteria | 43960 |
| 736 | Ga0495645_0047921 | 3300046543 | Bacteria | 3113 |
| 737 | Ga0495645_0057222 | 3300046543 | Bacteria | 2830 |
| 738 | Ga0495645_0111205 | 3300046543 | Bacteria | 1938 |
| 739 | Ga0495622_0000009 | 3300046557 | Bacteria | 224622 |
| 740 | Ga0495633_0000464 | 3300046558 | Bacteria | 41549 |
| 741 | Ga0495633_0000963 | 3300046558 | Bacteria | 23724 |
| 742 | Ga0495633_0004728 | 3300046558 | Bacteria | 8554 |
| 743 | Ga0495633_0029268 | 3300046558 | Bacteria | 2680 |
| 744 | Ga0495667_0025132 | 3300046559 | Bacteria | 4015 |
| 745 | Ga0495656_0000722 | 3300046615 | Bacteria | 10672 |
| 746 | Ga0495668_0000020 | 3300046616 | Bacteria | 411641 |
| 747 | Ga0495668_0004123 | 3300046616 | Bacteria | 10522 |
| 748 | Ga0495668_0018680 | 3300046616 | Bacteria | 4006 |
| 749 | Ga0495634_0022115 | 3300046642 | Bacteria | 4483 |
| 750 | Ga0495634_0040746 | 3300046642 | Bacteria | 3156 |
| 751 | Ga0495634_0071492 | 3300046642 | Bacteria | 2284 |
| 752 | Ga0495611_0003431 | 3300046648 | Bacteria | 6989 |
| 753 | Ga0495611_0011354 | 3300046648 | Bacteria | 3775 |
| 754 | Ga0495611_0043040 | 3300046648 | Bacteria | 2017 |
| 755 | Ga0495625_0009047 | 3300046660 | Bacteria | 8406 |
| 756 | Ga0495625_0026987 | 3300046660 | Bacteria | 4330 |
| 757 | Ga0495625_0033048 | 3300046660 | Bacteria | 3829 |
| 758 | Ga0495635_0002945 | 3300046663 | Bacteria | 11681 |
| 759 | Ga0495635_0025247 | 3300046663 | Bacteria | 4138 |
| 760 | Ga0495659_0000339 | 3300046664 | Bacteria | 18435 |
| 761 | Ga0495659_0003958 | 3300046664 | Bacteria | 4689 |
| 762 | Ga0495661_0141273 | 3300046665 | Bacteria | 1309 |
| 763 | Ga0495657_0008402 | 3300046675 | Bacteria | 7902 |
| 764 | Ga0495599_0014730 | 3300046678 | Bacteria | 4842 |
| 765 | Ga0495623_0025889 | 3300046679 | Bacteria | 3778 |
| 766 | Ga0495646_0021835 | 3300046680 | Bacteria | 4042 |
| 767 | Ga0495647_0022374 | 3300046681 | Bacteria | 2283 |
| 768 | Ga0495658_0000912 | 3300046683 | Bacteria | 15805 |
| 769 | Ga0495658_0007426 | 3300046683 | Bacteria | 5423 |
| 770 | Ga0495669_0002490 | 3300046684 | Bacteria | 7519 |
| 771 | Ga0495624_0021798 | 3300046690 | Bacteria | 4245 |
| 772 | Ga0495624_0093692 | 3300046690 | Bacteria | 1851 |
| 773 | Ga0495670_0000472 | 3300046691 | Bacteria | 19142 |
| 774 | Ga0495670_0001538 | 3300046691 | Bacteria | 11278 |
| 775 | Ga0495670_0004164 | 3300046691 | Bacteria | 7084 |
| 776 | Ga0495671_0010860 | 3300046692 | Bacteria | 5033 |
| 777 | Ga0495671_0016052 | 3300046692 | Bacteria | 4004 |
| 778 | Ga0495589_0000157 | 3300046794 | Bacteria | 62544 |
| 779 | Ga0495589_0042264 | 3300046794 | Bacteria | 2272 |
| 780 | Ga0495600_0001461 | 3300046809 | Bacteria | 13109 |
| 781 | Ga0495660_0042821 | 3300046810 | Bacteria | 2500 |
| 782 | Ga0495581_0017357 | 3300047315 | Bacteria | 4179 |
| 783 | Ga0495581_0038854 | 3300047315 | Bacteria | 2755 |
| 784 | Ga0495604_0004956 | 3300047317 | Bacteria | 10553 |
| 785 | Ga0495636_0007652 | 3300047318 | Bacteria | 4247 |
| 786 | Ga0495674_0009409 | 3300047319 | Bacteria | 9283 |
| 787 | Ga0495674_0010462 | 3300047319 | Bacteria | 8782 |
| 788 | Ga0495674_0062895 | 3300047319 | Bacteria | 3230 |
| 789 | Ga0495672_0001035 | 3300047320 | Bacteria | 28588 |
| 790 | Ga0495672_0002045 | 3300047320 | Bacteria | 18954 |
| 791 | Ga0495680_0028268 | 3300047322 | Bacteria | 4599 |
| 792 | Ga0495680_0065554 | 3300047322 | Bacteria | 2781 |
| 793 | Ga0495680_0194445 | 3300047322 | Bacteria | 1458 |
| 794 | Ga0495683_0000036 | 3300047323 | Bacteria | 144974 |
| 795 | Ga0495683_0000932 | 3300047323 | Bacteria | 20627 |
| 796 | Ga0495683_0007648 | 3300047323 | Bacteria | 5818 |
| 797 | Ga0495683_0071460 | 3300047323 | Bacteria | 1703 |
| 798 | Ga0495687_000096 | 3300047443 | Bacteria | 133560 |
| 799 | Ga0495687_002087 | 3300047443 | Bacteria | 16803 |
| 800 | Ga0495679_034243 | 3300047446 | Bacteria | 1618 |
| 801 | Ga0495685_000045 | 3300047447 | Bacteria | 50520 |
| 802 | Ga0495673_0016550 | 3300047469 | Bacteria | 3768 |
| 803 | Ga0495681_0004963 | 3300047470 | Bacteria | 8980 |
| 804 | Ga0495684_0009890 | 3300047471 | Bacteria | 7362 |
| 805 | Ga0495684_0065158 | 3300047471 | Bacteria | 2769 |
| 806 | Ga0495684_0106746 | 3300047471 | Bacteria | 2115 |
| 807 | Ga0495686_0001027 | 3300047472 | Bacteria | 33650 |
| 808 | Ga0495593_0004230 | 3300047673 | Bacteria | 8532 |
| 809 | Ga0495593_0012333 | 3300047673 | Bacteria | 4884 |
| 810 | Ga0495593_0037002 | 3300047673 | Bacteria | 2643 |
| 811 | Ga0495602_0018615 | 3300048088 | Bacteria | 6927 |
| 812 | Ga0495614_0001497 | 3300048089 | Bacteria | 10107 |
| 813 | Ga0495626_0004606 | 3300048091 | Bacteria | 8402 |
| 814 | Ga0496100_0010418 | 3300048903 | Bacteria | 5260 |
| 815 | Ga0496100_0015038 | 3300048903 | Bacteria | 4512 |
| 816 | Ga0496100_0074153 | 3300048903 | Bacteria | 2279 |
| 817 | Ga0496100_0092437 | 3300048903 | Bacteria | 2067 |
| 818 | Ga0496101_0001838 | 3300048904 | Bacteria | 12798 |
| 819 | Ga0496101_0004943 | 3300048904 | Bacteria | 8463 |
| 820 | Ga0496101_0076559 | 3300048904 | Bacteria | 2464 |
| 821 | Ga0496101_0097236 | 3300048904 | Bacteria | 2198 |
| 822 | Ga0496101_0121627 | 3300048904 | Bacteria | 1974 |
| 823 | Ga0496101_0169190 | 3300048904 | Bacteria | 1679 |
| 824 | Ga0496102_0006490 | 3300048905 | Bacteria | 9974 |
| 825 | Ga0496102_0020550 | 3300048905 | Bacteria | 5834 |
| 826 | Ga0496102_0028967 | 3300048905 | Bacteria | 4950 |
| 827 | Ga0496102_0048548 | 3300048905 | Bacteria | 3859 |
| 828 | Ga0496102_0071171 | 3300048905 | Bacteria | 3193 |
| 829 | Ga0496102_0079041 | 3300048905 | Bacteria | 3028 |
| 830 | Ga0496102_0105587 | 3300048905 | Bacteria | 2620 |
| 831 | Ga0496102_0143981 | 3300048905 | Bacteria | 2236 |
| 832 | Ga0496103_0011391 | 3300048906 | Bacteria | 5268 |
| 833 | Ga0496103_0021882 | 3300048906 | Bacteria | 3847 |
| 834 | Ga0496103_0030107 | 3300048906 | Bacteria | 3301 |
| 835 | Ga0496103_0123420 | 3300048906 | Bacteria | 1651 |
| 836 | Ga0496104_0006743 | 3300048907 | Bacteria | 10113 |
| 837 | Ga0496104_0013113 | 3300048907 | Bacteria | 7469 |
| 838 | Ga0496104_0023987 | 3300048907 | Bacteria | 5612 |
| 839 | Ga0496104_0041444 | 3300048907 | Bacteria | 4317 |
| 840 | Ga0496104_0070144 | 3300048907 | Bacteria | 3331 |
| 841 | Ga0496104_0316014 | 3300048907 | Bacteria | 1475 |
| 842 | Ga0496105_0006930 | 3300048908 | Bacteria | 8727 |
| 843 | Ga0496105_0031733 | 3300048908 | Bacteria | 4332 |
| 844 | Ga0496105_0041364 | 3300048908 | Bacteria | 3798 |
| 845 | Ga0496105_0062484 | 3300048908 | Bacteria | 3073 |
| 846 | Ga0496105_0088924 | 3300048908 | Bacteria | 2552 |
| 847 | Ga0496105_0092265 | 3300048908 | Bacteria | 2500 |
| 848 | Ga0496105_0253745 | 3300048908 | Bacteria | 1424 |
| 849 | Ga0496106_0033973 | 3300048909 | Bacteria | 3808 |
| 850 | Ga0496106_0036797 | 3300048909 | Bacteria | 3661 |
| 851 | Ga0496106_0040570 | 3300048909 | Bacteria | 3486 |
| 852 | Ga0496106_0048199 | 3300048909 | Bacteria | 3208 |
| 853 | Ga0496106_0053752 | 3300048909 | Bacteria | 3042 |
| 854 | Ga0496106_0105527 | 3300048909 | Bacteria | 2189 |
| 855 | Ga0496106_0182253 | 3300048909 | Bacteria | 1667 |
| 856 | Ga0496107_0000300 | 3300048910 | Bacteria | 26454 |
| 857 | Ga0496107_0047573 | 3300048910 | Bacteria | 3088 |
| 858 | Ga0496107_0065343 | 3300048910 | Bacteria | 2637 |
| 859 | Ga0496107_0067202 | 3300048910 | Bacteria | 2600 |
| 860 | Ga0496108_0006949 | 3300048911 | Bacteria | 9160 |
| 861 | Ga0496108_0015017 | 3300048911 | Bacteria | 6322 |
| 862 | Ga0496108_0030325 | 3300048911 | Bacteria | 4482 |
| 863 | Ga0496108_0046616 | 3300048911 | Bacteria | 3621 |
| 864 | Ga0496109_0009186 | 3300048912 | Bacteria | 8420 |
| 865 | Ga0496109_0023916 | 3300048912 | Bacteria | 5425 |
| 866 | Ga0496109_0025177 | 3300048912 | Bacteria | 5300 |
| 867 | Ga0496109_0069613 | 3300048912 | Bacteria | 3227 |
| 868 | Ga0496109_0088299 | 3300048912 | Bacteria | 2865 |
| 869 | Ga0496109_0107416 | 3300048912 | Bacteria | 2592 |
| 870 | Ga0496109_0284291 | 3300048912 | Bacteria | 1559 |
| 871 | Ga0496109_0347249 | 3300048912 | Bacteria | 1401 |
| 872 | Ga0496110_0009460 | 3300048913 | Bacteria | 7890 |
| 873 | Ga0496110_0013063 | 3300048913 | Bacteria | 6851 |
| 874 | Ga0496110_0015814 | 3300048913 | Bacteria | 6291 |
| 875 | Ga0496110_0149331 | 3300048913 | Bacteria | 2115 |
| 876 | Ga0496110_0224759 | 3300048913 | Bacteria | 1707 |
| 877 | Ga0496111_0024976 | 3300048914 | Bacteria | 4215 |
| 878 | Ga0496111_0051839 | 3300048914 | Bacteria | 2962 |
| 879 | Ga0496111_0072298 | 3300048914 | Bacteria | 2510 |
| 880 | Ga0496111_0100894 | 3300048914 | Bacteria | 2120 |
| 881 | Ga0496111_0140494 | 3300048914 | Bacteria | 1789 |
| 882 | Ga0496112_0000047 | 3300048915 | Bacteria | 84877 |
| 883 | Ga0496112_0001203 | 3300048915 | Bacteria | 19412 |
| 884 | Ga0496112_0011435 | 3300048915 | Bacteria | 8105 |
| 885 | Ga0496112_0027237 | 3300048915 | Bacteria | 5511 |
| 886 | Ga0496112_0081132 | 3300048915 | Bacteria | 3207 |
| 887 | Ga0496112_0118235 | 3300048915 | Bacteria | 2620 |
| 888 | Ga0496112_0195046 | 3300048915 | Bacteria | 1986 |
| 889 | Ga0496112_0224043 | 3300048915 | Bacteria | 1836 |
| 890 | Ga0496113_0013276 | 3300048916 | Bacteria | 5574 |
| 891 | Ga0496113_0033443 | 3300048916 | Bacteria | 3743 |
| 892 | Ga0496113_0076980 | 3300048916 | Bacteria | 2549 |
| 893 | Ga0496114_0008007 | 3300048917 | Bacteria | 8362 |
| 894 | Ga0496114_0010725 | 3300048917 | Bacteria | 7293 |
| 895 | Ga0496114_0026876 | 3300048917 | Bacteria | 4714 |
| 896 | Ga0496114_0232008 | 3300048917 | Bacteria | 1622 |
| 897 | Ga0496114_0246563 | 3300048917 | Bacteria | 1571 |
| 898 | Ga0496115_0011637 | 3300048918 | Bacteria | 6601 |
| 899 | Ga0496115_0019731 | 3300048918 | Bacteria | 5191 |
| 900 | Ga0496115_0020196 | 3300048918 | Bacteria | 5135 |
| 901 | Ga0496115_0035322 | 3300048918 | Bacteria | 3954 |
| 902 | Ga0496115_0082567 | 3300048918 | Bacteria | 2618 |
| 903 | Ga0496115_0092281 | 3300048918 | Bacteria | 2475 |
| 904 | Ga0496118_0048772 | 3300048921 | Bacteria | 3266 |
| 905 | Ga0495678_000284 | 3300049459 | Bacteria | 55655 |
| 906 | Ga0495678_001496 | 3300049459 | Bacteria | 18211 |
| 907 | Ga0495678_018701 | 3300049459 | Bacteria | 3110 |
| 908 | Ga0495682_0000278 | 3300049460 | Bacteria | 40095 |
| 909 | Ga0495682_0003215 | 3300049460 | Bacteria | 7341 |
| 910 | Ga0501031_0042271 | 3300049568 | Bacteria | 2976 |
| 911 | Ga0501076_0116829 | 3300049592 | Bacteria | 2159 |
| 912 | Ga0501045_0015280 | 3300049824 | Bacteria | 5449 |
| 913 | nmdc:mga05p37_40884_c1 | 3300050507 | Bacteria | 5692 |
| 914 | nmdc:mga05p37_44122_c1 | 3300050507 | Bacteria | 5486 |
| 915 | nmdc:mga05p37_5445_c1 | 3300050507 | Bacteria | 14947 |
| 916 | nmdc:mga09592_2531_c1 | 3300050508 | Bacteria | 14793 |
| 917 | nmdc:mga0qj67_1916_c1 | 3300050509 | Bacteria | 14767 |
| 918 | nmdc:mga06r32_209314_c1 | 3300050510 | Bacteria | 1938 |
| 919 | nmdc:mga06r32_3051_c1 | 3300050510 | Bacteria | 14992 |
| 920 | nmdc:mga08y16_129662_c1 | 3300050511 | Bacteria | 2623 |
| 921 | nmdc:mga08y16_15510_c1 | 3300050511 | Bacteria | 8011 |
| 922 | nmdc:mga08y16_217059_c1 | 3300050511 | Bacteria | 1980 |
| 923 | nmdc:mga08y16_5774_c1 | 3300050511 | Bacteria | 12961 |
| 924 | nmdc:mga08y16_5884_c1 | 3300050511 | Bacteria | 12850 |
| 925 | nmdc:mga0n895_26546_c1 | 3300050512 | Bacteria | 5487 |
| 926 | nmdc:mga0n895_39124_c1 | 3300050512 | Bacteria | 4599 |
| 927 | nmdc:mga0n895_5597_c1 | 3300050512 | Bacteria | 10517 |
| 928 | nmdc:mga0n895_936_c1 | 3300050512 | Bacteria | 21069 |
| 929 | nmdc:mga0rr50_128802_c1 | 3300050513 | Bacteria | 2024 |
| 930 | nmdc:mga0a205_10752_c1 | 3300050515 | Bacteria | 8414 |
| 931 | nmdc:mga0a205_1376_c1 | 3300050515 | Bacteria | 20536 |
| 932 | Ga0495601_0001219 | 3300053077 | Bacteria | 14087 |
| 933 | Ga0495601_0004122 | 3300053077 | Bacteria | 8371 |
| 934 | Ga0495601_0009272 | 3300053077 | Bacteria | 5817 |
| 935 | Ga0495601_0190541 | 3300053077 | Bacteria | 1340 |
| 936 | Ga0495612_0003481 | 3300053078 | Bacteria | 6520 |
| 937 | Ga0495595_0007040 | 3300053084 | Bacteria | 4595 |
| 938 | Ga0495619_0000764 | 3300053085 | Bacteria | 20984 |
| 939 | Ga0495619_0003959 | 3300053085 | Bacteria | 9511 |
| 940 | Ga0495619_0008427 | 3300053085 | Bacteria | 6517 |
| 941 | Ga0500658_0016514 | 3300053134 | Bacteria | 2750 |
| 942 | Ga0500627_0011052 | 3300053158 | Bacteria | 3316 |
| 943 | Ga0501084_0116283 | 3300054114 | Bacteria | 2248 |
| 944 | 2849665960 | 2849660919 | Bacteria | 8251853 |
| 945 | 2871501124 | 2871495908 | Bacteria | 6935695 |
| 946 | 2878765125 | 2878760144 | Bacteria | 6823465 |
| 947 | 2878772308 | 2878767105 | Bacteria | 6898628 |
| 948 | 2888354433 | 2888350351 | Bacteria | 7372807 |
| 949 | 2903545938 | 2903540706 | Bacteria | 7062119 |
| 950 | 2913851821 | 2913844669 | Bacteria | 8381711 |
| 951 | 2922130665 | 2922130491 | Bacteria | 7173936 |
| 952 | 2937999794 | 2937994558 | Bacteria | 7036190 |
| 953 | 2958170259 | 2958165035 | Bacteria | 6906348 |
| 954 | 2961168711 | 2961163497 | Bacteria | 6901077 |
| 955 | 2965023513 | 2965018300 | Bacteria | 6883036 |
| 956 | 2968177123 | 2968171901 | Bacteria | 6894245 |
| 957 | 2970559973 | 2970554993 | Bacteria | 6814252 |
| 958 | 2979748578 | 2979742915 | Bacteria | 7301278 |
| 959 | 2987664742 | 2987659509 | Bacteria | 6966464 |
| 960 | 3004172141 | 3004167301 | Bacteria | 8330599 |
| 961 | 3004193799 | 3004188549 | Bacteria | 6952365 |
| 962 | 8046771384 | 8046767195 | Bacteria | 7547379 |
| 963 | Ga0495585_0008057 | |||
| 964 | 2214745203 | |||
| 965 | ARSoilYngRDRAFT_c00160 | |||
| 966 | ARcpr5yngRDRAFT_c000030 | |||
| 967 | ARSoilOldRDRAFT_c000033 | |||
| 968 | ARCol0oldRDRAFT_c00343 | |||
| 969 | ARCol0yngRDRAFT_1000078 | |||
| 970 | JGI24752J21851_1002480 | |||
| 971 | JGI24738J21930_10006812 | |||
| 972 | JGI24749J21850_1002823 | |||
| 973 | JGI24744J21845_10002848 | |||
| 974 | JGI24033J26618_1000249 | |||
| 975 | JGI24742J22300_10001623 | |||
| 976 | Ga0055526_1009188 | |||
| 977 | Ga0055537_1000439 | |||
| 978 | Ga0055534_1000400 | |||
| 979 | Ga0055528_1000062 | |||
| 980 | JGI25405J52794_10012474 | |||
| 981 | Ga0065716_1001573 | |||
| 982 | Ga0065704_10076592 | |||
| 983 | Ga0065712_10085070 | |||
| 984 | Ga0065715_10089287 | |||
| 985 | Ga0065715_10115395 | |||
| 986 | Ga0065707_10120006 | |||
| 987 | Ga0070676_10010247 | |||
| 988 | Ga0070683_100059910 | |||
| 989 | Ga0070683_100152562 | |||
| 990 | Ga0070690_100002486 | |||
| 991 | Ga0070690_100025698 | |||
| 992 | Ga0070690_100039884 | |||
| 993 | Ga0070690_100048172 | |||
| 994 | Ga0070690_100078518 | |||
| 995 | Ga0070670_100001258 | |||
| 996 | Ga0070670_100005543 | |||
| 997 | Ga0068869_100004579 | |||
| 998 | Ga0070666_10011932 | |||
| 999 | Ga0070680_100004377 | |||
| 1000 | Ga0070680_100111219 | |||
| 1001 | Ga0070682_100003311 | |||
| 1002 | Ga0070682_100009952 | |||
| 1003 | Ga0068868_100000941 | |||
| 1004 | Ga0068868_100062763 | |||
| 1005 | Ga0070660_100003480 | |||
| 1006 | Ga0070660_100019153 | |||
| 1007 | Ga0070660_100033696 | |||
| 1008 | Ga0070689_100013020 | |||
| 1009 | Ga0070689_100063968 | |||
| 1010 | Ga0070691_10001644 | |||
| 1011 | Ga0070687_100003077 | |||
| 1012 | Ga0070687_100019210 | |||
| 1013 | Ga0070687_100019559 | |||
| 1014 | Ga0070661_100005996 | |||
| 1015 | Ga0070661_100014071 | |||
| 1016 | Ga0070668_100006837 | |||
| 1017 | Ga0070668_100017843 | |||
| 1018 | Ga0070669_100004234 | |||
| 1019 | Ga0070675_100004596 | |||
| 1020 | Ga0070675_100270948 | |||
| 1021 | Ga0070671_100008535 | |||
| 1022 | Ga0070671_100018060 | |||
| 1023 | Ga0070671_100025267 | |||
| 1024 | Ga0070671_100031731 | |||
| 1025 | Ga0070671_100054363 | |||
| 1026 | Ga0070671_100109271 | |||
| 1027 | Ga0070674_100022554 | |||
| 1028 | Ga0070674_100205017 | |||
| 1029 | Ga0070673_100003318 | |||
| 1030 | Ga0070673_100068387 | |||
| 1031 | Ga0070673_100212153 | |||
| 1032 | Ga0070688_100003893 | |||
| 1033 | Ga0070688_100014190 | |||
| 1034 | Ga0070659_100011723 | |||
| 1035 | Ga0070659_100047438 | |||
| 1036 | Ga0070659_100132246 | |||
| 1037 | Ga0070667_100022536 | |||
| 1038 | Ga0070703_10008204 | |||
| 1039 | Ga0070709_10040465 | |||
| 1040 | Ga0070714_100070765 | |||
| 1041 | Ga0070714_100137161 | |||
| 1042 | Ga0070714_100152050 | |||
| 1043 | Ga0070714_100182463 | |||
| 1044 | Ga0070713_100010279 | |||
| 1045 | Ga0070713_100055859 | |||
| 1046 | Ga0070713_100078687 | |||
| 1047 | Ga0070713_100080122 | |||
| 1048 | Ga0070713_100131957 | |||
| 1049 | Ga0070710_10026141 | |||
| 1050 | Ga0070710_10030270 | |||
| 1051 | Ga0070701_10005710 | |||
| 1052 | Ga0070711_100033611 | |||
| 1053 | Ga0070711_100225677 | |||
| 1054 | Ga0070705_100002546 | |||
| 1055 | Ga0070700_100006621 | |||
| 1056 | Ga0070700_100009050 | |||
| 1057 | Ga0070694_100006591 | |||
| 1058 | Ga0070694_100030769 | |||
| 1059 | Ga0070694_100053651 | |||
| 1060 | Ga0070708_100036142 | |||
| 1061 | Ga0070708_100049321 | |||
| 1062 | Ga0070708_100085736 | |||
| 1063 | Ga0070708_100189442 | |||
| 1064 | Ga0070663_100008316 | |||
| 1065 | Ga0070663_100009057 | |||
| 1066 | Ga0070663_100044736 | |||
| 1067 | Ga0070663_100186589 | |||
| 1068 | Ga0070678_100013314 | |||
| 1069 | Ga0070678_100035377 | |||
| 1070 | Ga0070678_100104122 | |||
| 1071 | Ga0070678_100119356 | |||
| 1072 | Ga0070678_100141240 | |||
| 1073 | Ga0070662_100000003 | |||
| 1074 | Ga0070662_100004119 | |||
| 1075 | Ga0070662_100016144 | |||
| 1076 | Ga0070662_100057850 | |||
| 1077 | Ga0070662_100132739 | |||
| 1078 | Ga0070681_10007934 | |||
| 1079 | Ga0070681_10080007 | |||
| 1080 | Ga0068867_100028777 | |||
| 1081 | Ga0068867_100048787 | |||
| 1082 | Ga0068867_100064248 | |||
| 1083 | Ga0070706_100015126 | |||
| 1084 | Ga0070707_100010836 | |||
| 1085 | Ga0070707_100029019 | |||
| 1086 | Ga0070707_100048259 | |||
| 1087 | Ga0070707_100051213 | |||
| 1088 | Ga0070707_100129797 | |||
| 1089 | Ga0070707_100145525 | |||
| 1090 | Ga0070698_100031038 | |||
| 1091 | Ga0070698_100058384 | |||
| 1092 | Ga0070699_100012259 | |||
| 1093 | Ga0070699_100020536 | |||
| 1094 | Ga0070699_100070612 | |||
| 1095 | Ga0070699_100159274 | |||
| 1096 | Ga0070699_100223344 | |||
| 1097 | Ga0070679_100023489 | |||
| 1098 | Ga0070679_100176014 | |||
| 1099 | Ga0070679_100228876 | |||
| 1100 | Ga0070684_100009321 | |||
| 1101 | Ga0070684_100043936 | |||
| 1102 | Ga0070697_100053209 | |||
| 1103 | Ga0070697_100070524 | |||
| 1104 | Ga0070697_100095898 | |||
| 1105 | Ga0070697_100124625 | |||
| 1106 | Ga0068853_100032729 | |||
| 1107 | Ga0070672_100005958 | |||
| 1108 | Ga0070672_100007399 | |||
| 1109 | Ga0070672_100074207 | |||
| 1110 | Ga0070686_100002567 | |||
| 1111 | Ga0070686_100010053 | |||
| 1112 | Ga0070686_100045238 | |||
| 1113 | Ga0070695_100004686 | |||
| 1114 | Ga0070695_100038877 | |||
| 1115 | Ga0070696_100020813 | |||
| 1116 | Ga0070696_100045885 | |||
| 1117 | Ga0070696_100142356 | |||
| 1118 | Ga0070696_100173428 | |||
| 1119 | Ga0070693_100003704 | |||
| 1120 | Ga0070693_100006327 | |||
| 1121 | Ga0070665_100069299 | |||
| 1122 | Ga0070665_100072058 | |||
| 1123 | Ga0070704_100002939 | |||
| 1124 | Ga0070704_100131816 | |||
| 1125 | Ga0068855_100000288 | |||
| 1126 | Ga0068855_100060747 | |||
| 1127 | Ga0068855_100210099 | |||
| 1128 | Ga0070664_100003754 | |||
| 1129 | Ga0070664_100015067 | |||
| 1130 | Ga0070664_100042647 | |||
| 1131 | Ga0070664_100091649 | |||
| 1132 | Ga0070664_100091877 | |||
| 1133 | Ga0070664_100132444 | |||
| 1134 | Ga0068857_100006093 | |||
| 1135 | Ga0068857_100015552 | |||
| 1136 | Ga0068854_100002230 | |||
| 1137 | Ga0068856_100025283 | |||
| 1138 | Ga0068856_100062715 | |||
| 1139 | Ga0068856_100230587 | |||
| 1140 | Ga0070702_100015554 | |||
| 1141 | Ga0068852_100030713 | |||
| 1142 | Ga0068852_100035807 | |||
| 1143 | Ga0068852_100244602 | |||
| 1144 | Ga0068859_100002626 | |||
| 1145 | Ga0068859_100005469 | |||
| 1146 | Ga0068859_100018036 | |||
| 1147 | Ga0068859_100130106 | |||
| 1148 | Ga0068864_100000198 | |||
| 1149 | Ga0068864_100000892 | |||
| 1150 | Ga0068864_100025170 | |||
| 1151 | Ga0068864_100045770 | |||
| 1152 | Ga0068864_100150266 | |||
| 1153 | Ga0068864_100247702 | |||
| 1154 | Ga0068864_100249563 | |||
| 1155 | Ga0068864_100344121 | |||
| 1156 | Ga0068866_10001457 | |||
| 1157 | Ga0068861_100012037 | |||
| 1158 | Ga0068861_100218861 | |||
| 1159 | Ga0068851_10124759 | |||
| 1160 | Ga0068870_10002196 | |||
| 1161 | Ga0068863_100049203 | |||
| 1162 | Ga0068863_100109783 | |||
| 1163 | Ga0068863_100151701 | |||
| 1164 | Ga0068863_100167211 | |||
| 1165 | Ga0068858_100013723 | |||
| 1166 | Ga0068858_100085631 | |||
| 1167 | Ga0068858_100204847 | |||
| 1168 | Ga0068860_100013202 | |||
| 1169 | Ga0068860_100026383 | |||
| 1170 | Ga0068860_100048378 | |||
| 1171 | Ga0068860_100051573 | |||
| 1172 | Ga0068860_100060157 | |||
| 1173 | Ga0068860_100072012 | |||
| 1174 | Ga0068860_100100056 | |||
| 1175 | Ga0068860_100150545 | |||
| 1176 | Ga0068862_100049583 | |||
| 1177 | Ga0068862_100051740 | |||
| 1178 | Ga0068862_100115660 | |||
| 1179 | Ga0081455_10000053 | |||
| 1180 | Ga0081540_1000266 | |||
| 1181 | Ga0081540_1000743 | |||
| 1182 | Ga0081540_1002298 | |||
| 1183 | Ga0081540_1003173 | |||
| 1184 | Ga0081540_1021705 | |||
| 1185 | Ga0081539_10052853 | |||
| 1186 | Ga0070717_10005668 | |||
| 1187 | Ga0070717_10029651 | |||
| 1188 | Ga0070717_10041692 | |||
| 1189 | Ga0070715_10000026 | |||
| 1190 | Ga0070716_100108588 | |||
| 1191 | Ga0070712_100018949 | |||
| 1192 | Ga0070712_100038353 | |||
| 1193 | Ga0075427_10000222 | |||
| 1194 | Ga0097621_100006211 | |||
| 1195 | Ga0097621_100024131 | |||
| 1196 | Ga0068871_100009850 | |||
| 1197 | Ga0068871_100068529 | |||
| 1198 | Ga0075428_100186161 | |||
| 1199 | Ga0075431_100019533 | |||
| 1200 | Ga0075433_10009110 | |||
| 1201 | Ga0075433_10028953 | |||
| 1202 | Ga0075433_10029323 | |||
| 1203 | Ga0075434_100000694 | |||
| 1204 | Ga0075434_100016384 | |||
| 1205 | Ga0075434_100018256 | |||
| 1206 | Ga0075434_100039880 | |||
| 1207 | Ga0075429_100009653 | |||
| 1208 | Ga0068865_100004789 | |||
| 1209 | Ga0068865_100016439 | |||
| 1210 | Ga0068865_100030975 | |||
| 1211 | Ga0068865_100165891 | |||
| 1212 | Ga0097620_100002626 | |||
| 1213 | Ga0097620_100005469 | |||
| 1214 | Ga0097620_100018036 | |||
| 1215 | Ga0097620_100130117 | |||
| 1216 | Ga0105240_10000091 | |||
| 1217 | Ga0105240_10000208 | |||
| 1218 | Ga0105240_10066680 | |||
| 1219 | Ga0111539_10006123 | |||
| 1220 | Ga0111539_10015008 | |||
| 1221 | Ga0111539_10085103 | |||
| 1222 | Ga0111539_10153510 | |||
| 1223 | Ga0111539_10193205 | |||
| 1224 | Ga0105245_10002193 | |||
| 1225 | Ga0105245_10033418 | |||
| 1226 | Ga0105245_10099219 | |||
| 1227 | Ga0105247_10065658 | |||
| 1228 | Ga0114129_10085704 | |||
| 1229 | Ga0114129_10099078 | |||
| 1230 | Ga0114129_10148684 | |||
| 1231 | Ga0105243_10006356 | |||
| 1232 | Ga0105243_10011002 | |||
| 1233 | Ga0105241_10045004 | |||
| 1234 | Ga0105241_10056248 | |||
| 1235 | Ga0105242_10014836 | |||
| 1236 | Ga0105242_10033814 | |||
| 1237 | Ga0105242_10069800 | |||
| 1238 | Ga0105242_10111476 | |||
| 1239 | Ga0105248_10013878 | |||
| 1240 | Ga0105248_10040509 | |||
| 1241 | Ga0105248_10048980 | |||
| 1242 | Ga0105248_10137409 | |||
| 1243 | Ga0105248_10151409 | |||
| 1244 | Ga0105248_10246529 | |||
| 1245 | Ga0105238_10393488 | |||
| 1246 | Ga0105249_10007344 | |||
| 1247 | Ga0105249_10019581 | |||
| 1248 | Ga0105249_10101183 | |||
| 1249 | Ga0105239_10002058 | |||
| 1250 | Ga0105239_10025305 | |||
| 1251 | Ga0105239_10038188 | |||
| 1252 | Ga0105239_10098985 | |||
| 1253 | Ga0105239_10186731 | |||
| 1254 | Ga0105246_10062460 | |||
| 1255 | Ga0105246_10144869 | |||
| 1256 | Ga0157342_1001450 | |||
| 1257 | Ga0157338_1000062 | |||
| 1258 | Ga0157370_10104626 | |||
| 1259 | Ga0157369_10030109 | |||
| 1260 | Ga0157369_10160722 | |||
| 1261 | Ga0157374_10003055 | |||
| 1262 | Ga0157374_10005126 | |||
| 1263 | Ga0157374_10031326 | |||
| 1264 | Ga0157374_10322621 | |||
| 1265 | Ga0157378_10015420 | |||
| 1266 | Ga0157378_10029707 | |||
| 1267 | Ga0157378_10088003 | |||
| 1268 | Ga0163162_10038671 | |||
| 1269 | Ga0163162_10075204 | |||
| 1270 | Ga0163162_10076179 | |||
| 1271 | Ga0163162_10129132 | |||
| 1272 | Ga0157372_10019331 | |||
| 1273 | Ga0157372_10407493 | |||
| 1274 | Ga0157375_10014740 | |||
| 1275 | Ga0157375_10045525 | |||
| 1276 | Ga0157375_10058435 | |||
| 1277 | Ga0157375_10111292 | |||
| 1278 | Ga0157375_10254207 | |||
| 1279 | Ga0157375_10254263 | |||
| 1280 | Ga0157375_10384113 | |||
| 1281 | Ga0163163_10061653 | |||
| 1282 | Ga0163163_10098026 | |||
| 1283 | Ga0163163_10137949 | |||
| 1284 | Ga0163163_10262233 | |||
| 1285 | Ga0157380_10023078 | |||
| 1286 | Ga0157377_10005921 | |||
| 1287 | Ga0157379_10012849 | |||
| 1288 | Ga0157379_10015522 | |||
| 1289 | Ga0157379_10015909 | |||
| 1290 | Ga0157379_10032414 | |||
| 1291 | Ga0157379_10099401 | |||
| 1292 | Ga0157376_10032791 | |||
| 1293 | Ga0157376_10080887 | |||
| 1294 | Ga0157376_10089735 | |||
| 1295 | Ga0157376_10152433 | |||
| 1296 | Ga0157376_10170733 | |||
| 1297 | Ga0163161_10027103 | |||
| 1298 | Ga0163161_10198901 | |||
| 1299 | Ga0213872_10000078 | |||
| 1300 | Ga0209565_1000167 | |||
| 1301 | Ga0207666_1000121 | |||
| 1302 | Ga0209673_1000051 | |||
| 1303 | Ga0207673_1000199 | |||
| 1304 | Ga0209675_1000027 | |||
| 1305 | Ga0209564_1000897 | |||
| 1306 | Ga0209256_1000265 | |||
| 1307 | Ga0207697_10004636 | |||
| 1308 | Ga0207697_10012779 | |||
| 1309 | Ga0207656_10096309 | |||
| 1310 | Ga0207653_10008878 | |||
| 1311 | Ga0207682_10010711 | |||
| 1312 | Ga0207692_10007099 | |||
| 1313 | Ga0207692_10011983 | |||
| 1314 | Ga0207692_10036932 | |||
| 1315 | Ga0207642_10022378 | |||
| 1316 | Ga0207710_10007880 | |||
| 1317 | Ga0207710_10025060 | |||
| 1318 | Ga0207688_10001502 | |||
| 1319 | Ga0207680_10040697 | |||
| 1320 | Ga0207680_10071823 | |||
| 1321 | Ga0207680_10187650 | |||
| 1322 | Ga0207647_10000049 | |||
| 1323 | Ga0207647_10002513 | |||
| 1324 | Ga0207685_10000009 | |||
| 1325 | Ga0207699_10044934 | |||
| 1326 | Ga0207699_10081042 | |||
| 1327 | Ga0207645_10003686 | |||
| 1328 | Ga0207643_10000170 | |||
| 1329 | Ga0207684_10001521 | |||
| 1330 | Ga0207654_10094257 | |||
| 1331 | Ga0207654_10121311 | |||
| 1332 | Ga0207707_10006812 | |||
| 1333 | Ga0207707_10063119 | |||
| 1334 | Ga0207695_10000018 | |||
| 1335 | Ga0207695_10098679 | |||
| 1336 | Ga0207695_10201253 | |||
| 1337 | Ga0207695_10223772 | |||
| 1338 | Ga0207693_10003442 | |||
| 1339 | Ga0207693_10014217 | |||
| 1340 | Ga0207693_10065734 | |||
| 1341 | Ga0207693_10105547 | |||
| 1342 | Ga0207663_10031299 | |||
| 1343 | Ga0207660_10022481 | |||
| 1344 | Ga0207662_10007466 | |||
| 1345 | Ga0207662_10129503 | |||
| 1346 | Ga0207657_10007036 | |||
| 1347 | Ga0207657_10007416 | |||
| 1348 | Ga0207657_10044583 | |||
| 1349 | Ga0207649_10001009 | |||
| 1350 | Ga0207652_10049393 | |||
| 1351 | Ga0207652_10254518 | |||
| 1352 | Ga0207646_10003821 | |||
| 1353 | Ga0207646_10011237 | |||
| 1354 | Ga0207646_10031775 | |||
| 1355 | Ga0207681_10053519 | |||
| 1356 | Ga0207681_10175905 | |||
| 1357 | Ga0207650_10007451 | |||
| 1358 | Ga0207659_10162803 | |||
| 1359 | Ga0207687_10000941 | |||
| 1360 | Ga0207687_10021029 | |||
| 1361 | Ga0207687_10050893 | |||
| 1362 | Ga0207700_10005756 | |||
| 1363 | Ga0207700_10009622 | |||
| 1364 | Ga0207664_10015029 | |||
| 1365 | Ga0207664_10045233 | |||
| 1366 | Ga0207664_10057700 | |||
| 1367 | Ga0207664_10176051 | |||
| 1368 | Ga0207664_10213840 | |||
| 1369 | Ga0207644_10007715 | |||
| 1370 | Ga0207644_10055879 | |||
| 1371 | Ga0207644_10058880 | |||
| 1372 | Ga0207644_10068961 | |||
| 1373 | Ga0207644_10083261 | |||
| 1374 | Ga0207644_10094153 | |||
| 1375 | Ga0207644_10111355 | |||
| 1376 | Ga0207644_10116480 | |||
| 1377 | Ga0207690_10004445 | |||
| 1378 | Ga0207690_10202566 | |||
| 1379 | Ga0207706_10000111 | |||
| 1380 | Ga0207706_10018959 | |||
| 1381 | Ga0207706_10025115 | |||
| 1382 | Ga0207706_10037211 | |||
| 1383 | Ga0207706_10054953 | |||
| 1384 | Ga0207706_10077028 | |||
| 1385 | Ga0207706_10082759 | |||
| 1386 | Ga0207686_10019407 | |||
| 1387 | Ga0207686_10024867 | |||
| 1388 | Ga0207686_10136509 | |||
| 1389 | Ga0207709_10005222 | |||
| 1390 | Ga0207709_10022544 | |||
| 1391 | Ga0207709_10066077 | |||
| 1392 | Ga0207670_10049133 | |||
| 1393 | Ga0207669_10025866 | |||
| 1394 | Ga0207669_10037873 | |||
| 1395 | Ga0207704_10033631 | |||
| 1396 | Ga0207665_10005232 | |||
| 1397 | Ga0207665_10006610 | |||
| 1398 | Ga0207665_10008176 | |||
| 1399 | Ga0207665_10023526 | |||
| 1400 | Ga0207665_10028191 | |||
| 1401 | Ga0207691_10006198 | |||
| 1402 | Ga0207691_10006422 | |||
| 1403 | Ga0207691_10008613 | |||
| 1404 | Ga0207691_10106179 | |||
| 1405 | Ga0207711_10006243 | |||
| 1406 | Ga0207711_10022156 | |||
| 1407 | Ga0207711_10034111 | |||
| 1408 | Ga0207711_10043350 | |||
| 1409 | Ga0207711_10050148 | |||
| 1410 | Ga0207711_10087642 | |||
| 1411 | Ga0207711_10089562 | |||
| 1412 | Ga0207711_10103432 | |||
| 1413 | Ga0207711_10197682 | |||
| 1414 | Ga0207689_10005901 | |||
| 1415 | Ga0207689_10008098 | |||
| 1416 | Ga0207689_10025089 | |||
| 1417 | Ga0207661_10000500 | |||
| 1418 | Ga0207661_10043789 | |||
| 1419 | Ga0207679_10000073 | |||
| 1420 | Ga0207679_10023752 | |||
| 1421 | Ga0207667_10000234 | |||
| 1422 | Ga0207667_10148060 | |||
| 1423 | Ga0207712_10003735 | |||
| 1424 | Ga0207712_10023192 | |||
| 1425 | Ga0207712_10041025 | |||
| 1426 | Ga0207712_10077652 | |||
| 1427 | Ga0207668_10007786 | |||
| 1428 | Ga0207668_10083077 | |||
| 1429 | Ga0207658_10154643 | |||
| 1430 | Ga0207677_10010220 | |||
| 1431 | Ga0207677_10085618 | |||
| 1432 | Ga0207703_10001970 | |||
| 1433 | Ga0207703_10019848 | |||
| 1434 | Ga0207703_10029178 | |||
| 1435 | Ga0207703_10058776 | |||
| 1436 | Ga0207703_10114734 | |||
| 1437 | Ga0207703_10159136 | |||
| 1438 | Ga0207703_10184538 | |||
| 1439 | Ga0207639_10021608 | |||
| 1440 | Ga0207639_10091419 | |||
| 1441 | Ga0207678_10006861 | |||
| 1442 | Ga0207678_10012045 | |||
| 1443 | Ga0207678_10028319 | |||
| 1444 | Ga0207678_10045247 | |||
| 1445 | Ga0207678_10071631 | |||
| 1446 | Ga0207708_10005825 | |||
| 1447 | Ga0207708_10026987 | |||
| 1448 | Ga0207708_10054687 | |||
| 1449 | Ga0207702_10037313 | |||
| 1450 | Ga0207702_10096581 | |||
| 1451 | Ga0207702_10170059 | |||
| 1452 | Ga0207641_10007312 | |||
| 1453 | Ga0207641_10013057 | |||
| 1454 | Ga0207641_10180303 | |||
| 1455 | Ga0207641_10225813 | |||
| 1456 | Ga0207648_10023509 | |||
| 1457 | Ga0207648_10030417 | |||
| 1458 | Ga0207648_10031345 | |||
| 1459 | Ga0207648_10087929 | |||
| 1460 | Ga0207676_10000996 | |||
| 1461 | Ga0207676_10006169 | |||
| 1462 | Ga0207676_10006739 | |||
| 1463 | Ga0207676_10064163 | |||
| 1464 | Ga0207674_10001648 | |||
| 1465 | Ga0207674_10003682 | |||
| 1466 | Ga0207675_100005605 | |||
| 1467 | Ga0207675_100096502 | |||
| 1468 | Ga0207683_10009988 | |||
| 1469 | Ga0207683_10024313 | |||
| 1470 | Ga0207683_10026381 | |||
| 1471 | Ga0207683_10097314 | |||
| 1472 | Ga0207683_10229223 | |||
| 1473 | Ga0207698_10015454 | |||
| 1474 | Ga0207698_10043979 | |||
| 1475 | Ga0207698_10192950 | |||
| 1476 | Ga0207698_10249944 | |||
| 1477 | Ga0210002_1000584 | |||
| 1478 | Ga0209974_10002790 | |||
| 1479 | Ga0207428_10001104 | |||
| 1480 | Ga0207428_10004390 | |||
| 1481 | Ga0207428_10004461 | |||
| 1482 | Ga0207428_10072519 | |||
| 1483 | Ga0268266_10022307 | |||
| 1484 | Ga0268266_10064207 | |||
| 1485 | Ga0268266_10064832 | |||
| 1486 | Ga0268266_10070266 | |||
| 1487 | Ga0268265_10012161 | |||
| 1488 | Ga0268265_10111947 | |||
| 1489 | Ga0268264_10020450 | |||
| 1490 | Ga0268264_10031800 | |||
| 1491 | Ga0268264_10033842 | |||
| 1492 | Ga0268264_10040688 | |||
| 1493 | Ga0268264_10106425 | |||
| 1494 | Ga0307513_10048341 | |||
| 1495 | Ga0307408_100031441 | |||
| 1496 | Ga0307408_100035958 | |||
| 1497 | Ga0307508_10005636 | |||
| 1498 | Ga0307405_10001068 | |||
| 1499 | Ga0307410_10000446 | |||
| 1500 | Ga0307410_10001648 | |||
| 1501 | Ga0307406_10015807 | |||
| 1502 | Ga0307407_10001157 | |||
| 1503 | Ga0307407_10012880 | |||
| 1504 | Ga0307409_100006279 | |||
| 1505 | Ga0307409_100058965 | |||
| 1506 | Ga0307416_100023019 | |||
| 1507 | Ga0307411_10005785 | |||
| 1508 | Ga0307411_10042197 | |||
| 1509 | Ga0307415_100000950 | |||
| 1510 | Ga0373930_0000685 | |||
| 1511 | Ga0373948_0000760 | |||
| 1512 | Ga0373950_0001042 | |||
| 1513 | Ga0373950_0006897 | |||
| 1514 | Ga0373958_0002479 | |||
| 1515 | Ga0373959_0000435 | |||
| 1516 | Ga0373938_0006949 | |||
| 1517 | Ga0373928_0000247 | |||
| 1518 | Ga0373929_0000208 | |||
| 1519 | Ga0373929_0003744 | |||
| 1520 | Ga0373934_0002824 | |||
| 1521 | Ga0373940_0000026 | |||
| 1522 | Ga0373940_0029554 | |||
| 1523 | Ga0373944_0000854 | |||
| 1524 | Ga0373949_0002963 | |||
| 1525 | Ga0373949_0006846 | |||
| 1526 | Ga0373949_0019756 | |||
| 1527 | Ga0373951_0000727 | |||
| 1528 | Ga0373951_0006612 | |||
| 1529 | Ga0373932_0000407 | |||
| 1530 | Ga0373932_0012360 | |||
| 1531 | Ga0373939_0005792 | |||
| 1532 | Ga0373941_0001353 | |||
| 1533 | Ga0373941_0003182 | |||
| 1534 | Ga0373941_0032612 | |||
| 1535 | Ga0373945_0016257 | |||
| 1536 | Ga0373953_0001046 | |||
| 1537 | Ga0373956_0015094 | |||
| 1538 | Ga0373960_0002714 | |||
| 1539 | Ga0373960_0037968 | |||
| 1540 | Ga0373943_0019324 | |||
| 1541 | Ga0373943_0051482 | |||
| 1542 | Ga0373946_0017459 | |||
| 1543 | Ga0373946_0018549 | |||
| 1544 | Ga0373942_0000429 | |||
| 1545 | Ga0373942_0029592 | |||
| 1546 | Ga0373961_0005044 | |||
| 1547 | Ga0373962_0005545 | |||
| 1548 | Ga0373962_0007708 | |||
| 1549 | Ga0373962_0008860 | |||
| 1550 | Ga0373924_0008318 | |||
| 1551 | Ga0373931_0003387 | |||
| 1552 | Ga0373931_0005919 | |||
| 1553 | Ga0373931_0041276 | |||
| 1554 | Ga0373935_0023535 | |||
| 1555 | Ga0373935_0061444 | |||
| 1556 | Ga0373927_0017392 | |||
| 1557 | Ga0373927_0048642 | |||
| 1558 | Ga0373927_0147030 | |||
| 1559 | Ga0373933_0004772 | |||
| 1560 | Ga0373947_0018999 | |||
| 1561 | Ga0373947_0022156 | |||
| 1562 | Ga0373947_0039961 | |||
| 1563 | Ga0373947_0054287 | |||
| 1564 | Ga0373947_0057122 | |||
| 1565 | Ga0373937_0018743 | |||
| 1566 | Ga0373937_0060907 | |||
| 1567 | Ga0373937_0065911 | |||
| 1568 | Ga0373925_0007679 | |||
| 1569 | Ga0373925_0019209 | |||
| 1570 | Ga0373925_0021141 | |||
| 1571 | Ga0373925_0053112 | |||
| 1572 | Ga0373925_0116721 | |||
| 1573 | Ga0395899_0001097 | |||
| 1574 | Ga0395899_0020924 | |||
| 1575 | Ga0395900_0007849 | |||
| 1576 | Ga0395900_0056020 | |||
| 1577 | Ga0395900_0077719 | |||
| 1578 | Ga0395900_0104191 | |||
| 1579 | Ga0395900_0359396 | |||
| 1580 | Ga0395898_0010657 | |||
| 1581 | Ga0395898_0010839 | |||
| 1582 | Ga0395898_0062096 | |||
| 1583 | Ga0395898_0083951 | |||
| 1584 | Ga0395898_0100971 | |||
| 1585 | Ga0395898_0190441 | |||
| 1586 | Ga0395905_0005914 | |||
| 1587 | Ga0395905_0007758 | |||
| 1588 | Ga0395905_0027153 | |||
| 1589 | Ga0395905_0084686 | |||
| 1590 | Ga0395901_0005743 | |||
| 1591 | Ga0395901_0009184 | |||
| 1592 | Ga0395901_0016278 | |||
| 1593 | Ga0395901_0026461 | |||
| 1594 | Ga0395901_0115186 | |||
| 1595 | Ga0395901_0141659 | |||
| 1596 | Ga0436361_0081046 | |||
| 1597 | Ga0436361_0173984 | |||
| 1598 | Ga0436361_0775201 | |||
| 1599 | Ga0436363_0000250 | |||
| 1600 | Ga0436363_0520749 | |||
| 1601 | Ga0451577_0010773 | |||
| 1602 | Ga0451577_0013515 | |||
| 1603 | Ga0453683_0004980 | |||
| 1604 | Ga0453683_0108698 | |||
| 1605 | Ga0453684_0016151 | |||
| 1606 | Ga0453684_0121764 | |||
| 1607 | Ga0466957_0003343 | |||
| 1608 | Ga0451576_0007618 | |||
| 1609 | Ga0451576_0075803 | |||
| 1610 | Ga0451576_0169680 | |||
| 1611 | Ga0495617_000387 | |||
| 1612 | Ga0495617_002096 | |||
| 1613 | Ga0495617_003252 | |||
| 1614 | Ga0495592_0010172 | |||
| 1615 | Ga0495592_0111618 | |||
| 1616 | Ga0495603_0016118 | |||
| 1617 | Ga0495603_0054930 | |||
| 1618 | Ga0495603_0061459 | |||
| 1619 | Ga0495590_0003942 | |||
| 1620 | Ga0495590_0010756 | |||
| 1621 | Ga0495629_0010654 | |||
| 1622 | Ga0495629_0044719 | |||
| 1623 | Ga0495629_0063398 | |||
| 1624 | Ga0495638_0000520 | |||
| 1625 | Ga0495638_0010656 | |||
| 1626 | Ga0495641_0045665 | |||
| 1627 | Ga0495653_0022255 | |||
| 1628 | Ga0495580_0048323 | |||
| 1629 | Ga0495580_0099343 | |||
| 1630 | Ga0495580_0127320 | |||
| 1631 | Ga0495582_0002101 | |||
| 1632 | Ga0495582_0008520 | |||
| 1633 | Ga0495582_0020177 | |||
| 1634 | Ga0495605_0004646 | |||
| 1635 | Ga0495605_0008241 | |||
| 1636 | Ga0495639_0008880 | |||
| 1637 | Ga0495639_0026761 | |||
| 1638 | Ga0495662_0000090 | |||
| 1639 | Ga0495664_0000146 | |||
| 1640 | Ga0495664_0049659 | |||
| 1641 | Ga0495584_0000005 | |||
| 1642 | Ga0495584_0000144 | |||
| 1643 | Ga0495584_0000148 | |||
| 1644 | Ga0495584_0045902 | |||
| 1645 | Ga0495584_0052096 | |||
| 1646 | Ga0495584_0073080 | |||
| 1647 | Ga0495585_0000023 | |||
| 1648 | Ga0495585_0003154 | |||
| 1649 | Ga0495585_0007462 | |||
| 1650 | Ga0495585_0045048 | |||
| 1651 | Ga0495585_0062442 | |||
| 1652 | Ga0495594_0013321 | |||
| 1653 | Ga0495596_0005603 | |||
| 1654 | Ga0495607_0003127 | |||
| 1655 | Ga0495607_0009303 | |||
| 1656 | Ga0495607_0013889 | |||
| 1657 | Ga0495607_0048423 | |||
| 1658 | Ga0495607_0106628 | |||
| 1659 | Ga0495583_0000045 | |||
| 1660 | Ga0495583_0009632 | |||
| 1661 | Ga0495583_0032541 | |||
| 1662 | Ga0495606_0010259 | |||
| 1663 | Ga0495606_0013445 | |||
| 1664 | Ga0495608_0001166 | |||
| 1665 | Ga0495616_0003950 | |||
| 1666 | Ga0495616_0007571 | |||
| 1667 | Ga0495616_0019134 | |||
| 1668 | Ga0495616_0100117 | |||
| 1669 | Ga0495618_0014081 | |||
| 1670 | Ga0495618_0014685 | |||
| 1671 | Ga0495618_0041634 | |||
| 1672 | Ga0495618_0171775 | |||
| 1673 | Ga0495620_0001243 | |||
| 1674 | Ga0495630_0021724 | |||
| 1675 | Ga0495630_0022831 | |||
| 1676 | Ga0495644_0004742 | |||
| 1677 | Ga0495648_0000048 | |||
| 1678 | Ga0495648_0000326 | |||
| 1679 | Ga0495648_0014256 | |||
| 1680 | Ga0495648_0119131 | |||
| 1681 | Ga0495642_0004115 | |||
| 1682 | Ga0495652_0013906 | |||
| 1683 | Ga0495652_0026750 | |||
| 1684 | Ga0495652_0037469 | |||
| 1685 | Ga0495652_0070602 | |||
| 1686 | Ga0495665_0013021 | |||
| 1687 | Ga0495640_0000406 | |||
| 1688 | Ga0495640_0010615 | |||
| 1689 | Ga0495640_0021298 | |||
| 1690 | Ga0495586_0037773 | |||
| 1691 | Ga0495586_0042660 | |||
| 1692 | Ga0495587_0001403 | |||
| 1693 | Ga0495587_0062851 | |||
| 1694 | Ga0495609_0000889 | |||
| 1695 | Ga0495609_0003207 | |||
| 1696 | Ga0495609_0004379 | |||
| 1697 | Ga0495597_0000307 | |||
| 1698 | Ga0495645_0047921 | |||
| 1699 | Ga0495645_0057222 | |||
| 1700 | Ga0495645_0111205 | |||
| 1701 | Ga0495622_0000009 | |||
| 1702 | Ga0495633_0000464 | |||
| 1703 | Ga0495633_0000963 | |||
| 1704 | Ga0495633_0004728 | |||
| 1705 | Ga0495633_0029268 | |||
| 1706 | Ga0495667_0025132 | |||
| 1707 | Ga0495656_0000722 | |||
| 1708 | Ga0495668_0000020 | |||
| 1709 | Ga0495668_0004123 | |||
| 1710 | Ga0495668_0018680 | |||
| 1711 | Ga0495634_0022115 | |||
| 1712 | Ga0495634_0040746 | |||
| 1713 | Ga0495634_0071492 | |||
| 1714 | Ga0495611_0003431 | |||
| 1715 | Ga0495611_0011354 | |||
| 1716 | Ga0495611_0043040 | |||
| 1717 | Ga0495625_0009047 | |||
| 1718 | Ga0495625_0026987 | |||
| 1719 | Ga0495625_0033048 | |||
| 1720 | Ga0495635_0002945 | |||
| 1721 | Ga0495635_0025247 | |||
| 1722 | Ga0495659_0000339 | |||
| 1723 | Ga0495659_0003958 | |||
| 1724 | Ga0495661_0141273 | |||
| 1725 | Ga0495657_0008402 | |||
| 1726 | Ga0495599_0014730 | |||
| 1727 | Ga0495623_0025889 | |||
| 1728 | Ga0495646_0021835 | |||
| 1729 | Ga0495647_0022374 | |||
| 1730 | Ga0495658_0000912 | |||
| 1731 | Ga0495658_0007426 | |||
| 1732 | Ga0495669_0002490 | |||
| 1733 | Ga0495624_0021798 | |||
| 1734 | Ga0495624_0093692 | |||
| 1735 | Ga0495670_0000472 | |||
| 1736 | Ga0495670_0001538 | |||
| 1737 | Ga0495670_0004164 | |||
| 1738 | Ga0495671_0010860 | |||
| 1739 | Ga0495671_0016052 | |||
| 1740 | Ga0495589_0000157 | |||
| 1741 | Ga0495589_0042264 | |||
| 1742 | Ga0495600_0001461 | |||
| 1743 | Ga0495660_0042821 | |||
| 1744 | Ga0495581_0017357 | |||
| 1745 | Ga0495581_0038854 | |||
| 1746 | Ga0495604_0004956 | |||
| 1747 | Ga0495636_0007652 | |||
| 1748 | Ga0495674_0009409 | |||
| 1749 | Ga0495674_0010462 | |||
| 1750 | Ga0495674_0062895 | |||
| 1751 | Ga0495672_0001035 | |||
| 1752 | Ga0495672_0002045 | |||
| 1753 | Ga0495680_0028268 | |||
| 1754 | Ga0495680_0065554 | |||
| 1755 | Ga0495680_0194445 | |||
| 1756 | Ga0495683_0000036 | |||
| 1757 | Ga0495683_0000932 | |||
| 1758 | Ga0495683_0007648 | |||
| 1759 | Ga0495683_0071460 | |||
| 1760 | Ga0495687_000096 | |||
| 1761 | Ga0495687_002087 | |||
| 1762 | Ga0495679_034243 | |||
| 1763 | Ga0495685_000045 | |||
| 1764 | Ga0495673_0016550 | |||
| 1765 | Ga0495681_0004963 | |||
| 1766 | Ga0495684_0009890 | |||
| 1767 | Ga0495684_0065158 | |||
| 1768 | Ga0495684_0106746 | |||
| 1769 | Ga0495686_0001027 | |||
| 1770 | Ga0495593_0004230 | |||
| 1771 | Ga0495593_0012333 | |||
| 1772 | Ga0495593_0037002 | |||
| 1773 | Ga0495602_0018615 | |||
| 1774 | Ga0495614_0001497 | |||
| 1775 | Ga0495626_0004606 | |||
| 1776 | Ga0496100_0010418 | |||
| 1777 | Ga0496100_0015038 | |||
| 1778 | Ga0496100_0074153 | |||
| 1779 | Ga0496100_0092437 | |||
| 1780 | Ga0496101_0001838 | |||
| 1781 | Ga0496101_0004943 | |||
| 1782 | Ga0496101_0076559 | |||
| 1783 | Ga0496101_0097236 | |||
| 1784 | Ga0496101_0121627 | |||
| 1785 | Ga0496101_0169190 | |||
| 1786 | Ga0496102_0006490 | |||
| 1787 | Ga0496102_0020550 | |||
| 1788 | Ga0496102_0028967 | |||
| 1789 | Ga0496102_0048548 | |||
| 1790 | Ga0496102_0071171 | |||
| 1791 | Ga0496102_0079041 | |||
| 1792 | Ga0496102_0105587 | |||
| 1793 | Ga0496102_0143981 | |||
| 1794 | Ga0496103_0011391 | |||
| 1795 | Ga0496103_0021882 | |||
| 1796 | Ga0496103_0030107 | |||
| 1797 | Ga0496103_0123420 | |||
| 1798 | Ga0496104_0006743 | |||
| 1799 | Ga0496104_0013113 | |||
| 1800 | Ga0496104_0023987 | |||
| 1801 | Ga0496104_0041444 | |||
| 1802 | Ga0496104_0070144 | |||
| 1803 | Ga0496104_0316014 | |||
| 1804 | Ga0496105_0006930 | |||
| 1805 | Ga0496105_0031733 | |||
| 1806 | Ga0496105_0041364 | |||
| 1807 | Ga0496105_0062484 | |||
| 1808 | Ga0496105_0088924 | |||
| 1809 | Ga0496105_0092265 | |||
| 1810 | Ga0496105_0253745 | |||
| 1811 | Ga0496106_0033973 | |||
| 1812 | Ga0496106_0036797 | |||
| 1813 | Ga0496106_0040570 | |||
| 1814 | Ga0496106_0048199 | |||
| 1815 | Ga0496106_0053752 | |||
| 1816 | Ga0496106_0105527 | |||
| 1817 | Ga0496106_0182253 | |||
| 1818 | Ga0496107_0000300 | |||
| 1819 | Ga0496107_0047573 | |||
| 1820 | Ga0496107_0065343 | |||
| 1821 | Ga0496107_0067202 | |||
| 1822 | Ga0496108_0006949 | |||
| 1823 | Ga0496108_0015017 | |||
| 1824 | Ga0496108_0030325 | |||
| 1825 | Ga0496108_0046616 | |||
| 1826 | Ga0496109_0009186 | |||
| 1827 | Ga0496109_0023916 | |||
| 1828 | Ga0496109_0025177 | |||
| 1829 | Ga0496109_0069613 | |||
| 1830 | Ga0496109_0088299 | |||
| 1831 | Ga0496109_0107416 | |||
| 1832 | Ga0496109_0284291 | |||
| 1833 | Ga0496109_0347249 | |||
| 1834 | Ga0496110_0009460 | |||
| 1835 | Ga0496110_0013063 | |||
| 1836 | Ga0496110_0015814 | |||
| 1837 | Ga0496110_0149331 | |||
| 1838 | Ga0496110_0224759 | |||
| 1839 | Ga0496111_0024976 | |||
| 1840 | Ga0496111_0051839 | |||
| 1841 | Ga0496111_0072298 | |||
| 1842 | Ga0496111_0100894 | |||
| 1843 | Ga0496111_0140494 | |||
| 1844 | Ga0496112_0000047 | |||
| 1845 | Ga0496112_0001203 | |||
| 1846 | Ga0496112_0011435 | |||
| 1847 | Ga0496112_0027237 | |||
| 1848 | Ga0496112_0081132 | |||
| 1849 | Ga0496112_0118235 | |||
| 1850 | Ga0496112_0195046 | |||
| 1851 | Ga0496112_0224043 | |||
| 1852 | Ga0496113_0013276 | |||
| 1853 | Ga0496113_0033443 | |||
| 1854 | Ga0496113_0076980 | |||
| 1855 | Ga0496114_0008007 | |||
| 1856 | Ga0496114_0010725 | |||
| 1857 | Ga0496114_0026876 | |||
| 1858 | Ga0496114_0232008 | |||
| 1859 | Ga0496114_0246563 | |||
| 1860 | Ga0496115_0011637 | |||
| 1861 | Ga0496115_0019731 | |||
| 1862 | Ga0496115_0020196 | |||
| 1863 | Ga0496115_0035322 | |||
| 1864 | Ga0496115_0082567 | |||
| 1865 | Ga0496115_0092281 | |||
| 1866 | Ga0496118_0048772 | |||
| 1867 | Ga0495678_000284 | |||
| 1868 | Ga0495678_001496 | |||
| 1869 | Ga0495678_018701 | |||
| 1870 | Ga0495682_0000278 | |||
| 1871 | Ga0495682_0003215 | |||
| 1872 | Ga0501031_0042271 | |||
| 1873 | Ga0501076_0116829 | |||
| 1874 | Ga0501045_0015280 | |||
| 1875 | nmdc:mga05p37_40884_c1 | |||
| 1876 | nmdc:mga05p37_44122_c1 | |||
| 1877 | nmdc:mga05p37_5445_c1 | |||
| 1878 | nmdc:mga09592_2531_c1 | |||
| 1879 | nmdc:mga0qj67_1916_c1 | |||
| 1880 | nmdc:mga06r32_209314_c1 | |||
| 1881 | nmdc:mga06r32_3051_c1 | |||
| 1882 | nmdc:mga08y16_129662_c1 | |||
| 1883 | nmdc:mga08y16_15510_c1 | |||
| 1884 | nmdc:mga08y16_217059_c1 | |||
| 1885 | nmdc:mga08y16_5774_c1 | |||
| 1886 | nmdc:mga08y16_5884_c1 | |||
| 1887 | nmdc:mga0n895_26546_c1 | |||
| 1888 | nmdc:mga0n895_39124_c1 | |||
| 1889 | nmdc:mga0n895_5597_c1 | |||
| 1890 | nmdc:mga0n895_936_c1 | |||
| 1891 | nmdc:mga0rr50_128802_c1 | |||
| 1892 | nmdc:mga0a205_10752_c1 | |||
| 1893 | nmdc:mga0a205_1376_c1 | |||
| 1894 | Ga0495601_0001219 | |||
| 1895 | Ga0495601_0004122 | |||
| 1896 | Ga0495601_0009272 | |||
| 1897 | Ga0495601_0190541 | |||
| 1898 | Ga0495612_0003481 | |||
| 1899 | Ga0495595_0007040 | |||
| 1900 | Ga0495619_0000764 | |||
| 1901 | Ga0495619_0003959 | |||
| 1902 | Ga0495619_0008427 | |||
| 1903 | Ga0500658_0016514 | |||
| 1904 | Ga0500627_0011052 | |||
| 1905 | Ga0501084_0116283 | |||
| 1906 | 2849665960 | |||
| 1907 | 2871501124 | |||
| 1908 | 2878765125 | |||
| 1909 | 2878772308 | |||
| 1910 | 2888354433 | |||
| 1911 | 2903545938 | |||
| 1912 | 2913851821 | |||
| 1913 | 2922130665 | |||
| 1914 | 2937999794 | |||
| 1915 | 2958170259 | |||
| 1916 | 2961168711 | |||
| 1917 | 2965023513 | |||
| 1918 | 2968177123 | |||
| 1919 | 2970559973 | |||
| 1920 | 2979748578 | |||
| 1921 | 2987664742 | |||
| 1922 | 3004172141 | |||
| 1923 | 3004193799 | |||
| 1924 | 8046771384 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qa9-assembly1.cif.gz_A | ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. | 0.9074 | 42 | 437 |
| 4qa9-assembly1.cif.gz_A | ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. | 0.9006 | 42 | 437 |
| 3g0i-assembly1.cif.gz_B | complex of aspergillus niger epoxide hydrolase with valpromide (2-propylpentanamide) | 0.8943 | 44 | 435 |
| 3g02-assembly1.cif.gz_A | structure of enantioselective mutant of epoxide hydrolase from aspergillus niger generated by directed evolution | 0.8931 | 44 | 435 |
| 5f4z-assembly3.cif.gz_E | the crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus | 0.8853 | 46 | 437 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qa9A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9074 | 42 | 437 | 3.40.50.1820 |
| 4qa9A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9006 | 42 | 437 | 3.40.50.1820 |
| 3g02B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8841 | 36 | 435 | 3.40.50.1820 |
| af_Q9D379_48_454_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8772 | 46 | 437 | 3.40.50.1820 |
| 4qlaB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8713 | 42 | 437 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538L1P0-F1-model_v4 | Epoxide hydrolase 1 | 0.984 | 43 | 242 |
GO:0004301
GO:0009056 GO:0097176 |
| AF-A0A3N5MXB2-F1-model_v4 | Epoxide hydrolase | 0.9728 | 224 | 436 |
GO:0004301
GO:0097176 |
| AF-A0A7X3R243-F1-model_v4 | Epoxide hydrolase | 0.9676 | 45 | 225 |
GO:0004301
GO:0009056 GO:0097176 |
| AF-A0A381ZZR1-F1-model_v4 | Epoxide hydrolase N-terminal domain-containing protein | 0.9656 | 43 | 240 |
GO:0004301
GO:0009056 GO:0097176 |
| AF-A0A1B1JZI0-F1-model_v4 | Epoxide hydrolase | 0.9656 | 45 | 218 |
GO:0004301
GO:0009056 GO:0097176 |