F486897

General Info

Members Datasets Scaffolds Average Seq Length
962 406 1924 433

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0008057|Ga0495585_0008057_1296_2768
Length 490
Sequence VDFGQETRHEQERLFSKLAEKELQLDHQEGATDRGFHGRCAAPCTQASPNPTRKDLIMTNGETSYSLTRRSFLTAIAAAGAVGVMPRTLLASPGEGVIRPFRVHIPEETLTDLRRRLAATRWPPKETVADASQGVPLDKLQPLVRYWEKRYNWRKTEAKLNALPQYMTNIDGVDIHFIHVRSRHPDAMPLLITHGWPGSIFEFLKLIGPLTDPTAFGGREENAFHLVIPSIPGYGFSGKPTVTGWDPERIARAWAELMKRLGYTRYVAQGGDWGAPITSAMARQAAPGLLGIHLNLPAAVPPEVTAALPTGIAPAGMSEQEHAVFDALVAYGKKGNSAYFTMLTARPQTISYGMSDSPAFLAAFMLVHPGFANWKFGADAAQSPGLDEVLDDLSLYWLTNTAASAARLYWENGARGSVIGSGPQKTQEITLPVAITVFPEDVYRPPESWARRAYRNLSYYHAVDRGGHFAAWEQPALFAEELRAAFRPLR

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
126 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
231 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
232 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
240 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
290 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
291 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
321 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
322 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
333 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
334 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
335 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
342 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
343 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
344 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
350 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
351 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
354 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
368 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
369 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
386 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 2849660919 Nostoc sp. T09 Isolate Unclassified
389 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
390 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
391 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
392 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
393 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
394 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
395 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
396 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
397 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
398 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
399 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
400 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
401 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
402 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
403 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
404 3004167301 Mesorhizobium loti 582 Isolate Unclassified
405 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
406 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 1.56
Rhizoplane 9.36
Rhizosphere 87.01
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0008057 3300046492 Bacteria 6405
2 2214745203 2209111006 Bacteria 15822
3 ARSoilYngRDRAFT_c00160 3300000042 Bacteria 11561
4 ARcpr5yngRDRAFT_c000030 3300000043 Bacteria 23301
5 ARSoilOldRDRAFT_c000033 3300000044 Bacteria 30681
6 ARCol0oldRDRAFT_c00343 3300000045 Bacteria 4538
7 ARCol0yngRDRAFT_1000078 3300000652 Bacteria 18395
8 JGI24752J21851_1002480 3300001976 Bacteria 2456
9 JGI24738J21930_10006812 3300002075 Bacteria 2654
10 JGI24749J21850_1002823 3300002076 Bacteria 2433
11 JGI24744J21845_10002848 3300002077 Bacteria 3535
12 JGI24033J26618_1000249 3300002155 Bacteria 6025
13 JGI24742J22300_10001623 3300002244 Bacteria 3575
14 Ga0055526_1009188 3300003771 Bacteria 4803
15 Ga0055537_1000439 3300003773 Bacteria 26623
16 Ga0055534_1000400 3300003784 Bacteria 26742
17 Ga0055528_1000062 3300003790 Bacteria 85624
18 JGI25405J52794_10012474 3300003911 Bacteria 1637
19 Ga0065716_1001573 3300005277 Bacteria 6099
20 Ga0065704_10076592 3300005289 Bacteria 5063
21 Ga0065712_10085070 3300005290 Bacteria 2721
22 Ga0065715_10089287 3300005293 Bacteria 11507
23 Ga0065715_10115395 3300005293 Bacteria 2416
24 Ga0065707_10120006 3300005295 Bacteria 2145
25 Ga0070676_10010247 3300005328 Bacteria 5083
26 Ga0070683_100059910 3300005329 Bacteria 3537
27 Ga0070683_100152562 3300005329 Bacteria 2190
28 Ga0070690_100002486 3300005330 Bacteria 9910
29 Ga0070690_100025698 3300005330 Bacteria 3626
30 Ga0070690_100039884 3300005330 Bacteria 2968
31 Ga0070690_100048172 3300005330 Bacteria 2713
32 Ga0070690_100078518 3300005330 Bacteria 2157
33 Ga0070670_100001258 3300005331 Bacteria 20184
34 Ga0070670_100005543 3300005331 Bacteria 10648
35 Ga0068869_100004579 3300005334 Bacteria 8615
36 Ga0070666_10011932 3300005335 Bacteria 5466
37 Ga0070680_100004377 3300005336 Bacteria 10630
38 Ga0070680_100111219 3300005336 Bacteria 2280
39 Ga0070682_100003311 3300005337 Bacteria 8934
40 Ga0070682_100009952 3300005337 Bacteria 5386
41 Ga0068868_100000941 3300005338 Bacteria 19766
42 Ga0068868_100062763 3300005338 Unclassified 2946
43 Ga0070660_100003480 3300005339 Bacteria 10842
44 Ga0070660_100019153 3300005339 Bacteria 5010
45 Ga0070660_100033696 3300005339 Bacteria 3863
46 Ga0070689_100013020 3300005340 Bacteria 6010
47 Ga0070689_100063968 3300005340 Bacteria 2862
48 Ga0070691_10001644 3300005341 Bacteria 9690
49 Ga0070687_100003077 3300005343 Bacteria 6415
50 Ga0070687_100019210 3300005343 Bacteria 3175
51 Ga0070687_100019559 3300005343 Bacteria 3153
52 Ga0070661_100005996 3300005344 Bacteria 8365
53 Ga0070661_100014071 3300005344 Bacteria 5631
54 Ga0070668_100006837 3300005347 Bacteria 8454
55 Ga0070668_100017843 3300005347 Bacteria 5324
56 Ga0070669_100004234 3300005353 Bacteria 10377
57 Ga0070675_100004596 3300005354 Bacteria 10542
58 Ga0070675_100270948 3300005354 Bacteria 1490
59 Ga0070671_100008535 3300005355 Bacteria 8213
60 Ga0070671_100018060 3300005355 Bacteria 5724
61 Ga0070671_100025267 3300005355 Bacteria 4872
62 Ga0070671_100031731 3300005355 Bacteria 4367
63 Ga0070671_100054363 3300005355 Bacteria 3329
64 Ga0070671_100109271 3300005355 Bacteria 2322
65 Ga0070674_100022554 3300005356 Bacteria 4062
66 Ga0070674_100205017 3300005356 Bacteria 1525
67 Ga0070673_100003318 3300005364 Bacteria 9999
68 Ga0070673_100068387 3300005364 Bacteria 2844
69 Ga0070673_100212153 3300005364 Bacteria 1673
70 Ga0070688_100003893 3300005365 Bacteria 7741
71 Ga0070688_100014190 3300005365 Bacteria 4510
72 Ga0070659_100011723 3300005366 Bacteria 6489
73 Ga0070659_100047438 3300005366 Bacteria 3369
74 Ga0070659_100132246 3300005366 Bacteria 2027
75 Ga0070667_100022536 3300005367 Bacteria 5222
76 Ga0070703_10008204 3300005406 Bacteria 2937
77 Ga0070709_10040465 3300005434 Bacteria 2866
78 Ga0070714_100070765 3300005435 Bacteria 3015
79 Ga0070714_100137161 3300005435 Bacteria 2192
80 Ga0070714_100152050 3300005435 Bacteria 2087
81 Ga0070714_100182463 3300005435 Bacteria 1910
82 Ga0070713_100010279 3300005436 Bacteria 6756
83 Ga0070713_100055859 3300005436 Bacteria 3282
84 Ga0070713_100078687 3300005436 Bacteria 2807
85 Ga0070713_100080122 3300005436 Bacteria 2783
86 Ga0070713_100131957 3300005436 Bacteria 2204
87 Ga0070710_10026141 3300005437 Bacteria 3098
88 Ga0070710_10030270 3300005437 Bacteria 2911
89 Ga0070701_10005710 3300005438 Bacteria 5170
90 Ga0070711_100033611 3300005439 Bacteria 3415
91 Ga0070711_100225677 3300005439 Bacteria 1458
92 Ga0070705_100002546 3300005440 Bacteria 9161
93 Ga0070700_100006621 3300005441 Bacteria 6203
94 Ga0070700_100009050 3300005441 Bacteria 5456
95 Ga0070694_100006591 3300005444 Bacteria 7055
96 Ga0070694_100030769 3300005444 Bacteria 3514
97 Ga0070694_100053651 3300005444 Bacteria 2729
98 Ga0070708_100036142 3300005445 Bacteria 4307
99 Ga0070708_100049321 3300005445 Bacteria 3724
100 Ga0070708_100085736 3300005445 Bacteria 2859
101 Ga0070708_100189442 3300005445 Bacteria 1924
102 Ga0070663_100008316 3300005455 Bacteria 6376
103 Ga0070663_100009057 3300005455 Bacteria 6149
104 Ga0070663_100044736 3300005455 Bacteria 3124
105 Ga0070663_100186589 3300005455 Bacteria 1612
106 Ga0070678_100013314 3300005456 Bacteria 5152
107 Ga0070678_100035377 3300005456 Bacteria 3486
108 Ga0070678_100104122 3300005456 Bacteria 2206
109 Ga0070678_100119356 3300005456 Bacteria 2077
110 Ga0070678_100141240 3300005456 Bacteria 1927
111 Ga0070662_100000003 3300005457 Bacteria 239813
112 Ga0070662_100004119 3300005457 Bacteria 9141
113 Ga0070662_100016144 3300005457 Bacteria 5010
114 Ga0070662_100057850 3300005457 Bacteria 2818
115 Ga0070662_100132739 3300005457 Bacteria 1922
116 Ga0070681_10007934 3300005458 Bacteria 10388
117 Ga0070681_10080007 3300005458 Bacteria 3224
118 Ga0068867_100028777 3300005459 Bacteria 4000
119 Ga0068867_100048787 3300005459 Bacteria 3116
120 Ga0068867_100064248 3300005459 Bacteria 2728
121 Ga0070706_100015126 3300005467 Bacteria 7125
122 Ga0070707_100010836 3300005468 Bacteria 8490
123 Ga0070707_100029019 3300005468 Bacteria 5266
124 Ga0070707_100048259 3300005468 Bacteria 4079
125 Ga0070707_100051213 3300005468 Bacteria 3958
126 Ga0070707_100129797 3300005468 Bacteria 2450
127 Ga0070707_100145525 3300005468 Bacteria 2307
128 Ga0070698_100031038 3300005471 Bacteria 5541
129 Ga0070698_100058384 3300005471 Bacteria 3901
130 Ga0070699_100012259 3300005518 Bacteria 7395
131 Ga0070699_100020536 3300005518 Bacteria 5697
132 Ga0070699_100070612 3300005518 Bacteria 3036
133 Ga0070699_100159274 3300005518 Bacteria 1998
134 Ga0070699_100223344 3300005518 Bacteria 1679
135 Ga0070679_100023489 3300005530 Bacteria 6036
136 Ga0070679_100176014 3300005530 Bacteria 2112
137 Ga0070679_100228876 3300005530 Bacteria 1819
138 Ga0070684_100009321 3300005535 Bacteria 7728
139 Ga0070684_100043936 3300005535 Bacteria 3861
140 Ga0070697_100053209 3300005536 Bacteria 3290
141 Ga0070697_100070524 3300005536 Bacteria 2865
142 Ga0070697_100095898 3300005536 Bacteria 2461
143 Ga0070697_100124625 3300005536 Bacteria 2157
144 Ga0068853_100032729 3300005539 Bacteria 4406
145 Ga0070672_100005958 3300005543 Bacteria 8134
146 Ga0070672_100007399 3300005543 Bacteria 7444
147 Ga0070672_100074207 3300005543 Bacteria 2713
148 Ga0070686_100002567 3300005544 Bacteria 10018
149 Ga0070686_100010053 3300005544 Bacteria 5326
150 Ga0070686_100045238 3300005544 Bacteria 2772
151 Ga0070695_100004686 3300005545 Bacteria 8043
152 Ga0070695_100038877 3300005545 Bacteria 3005
153 Ga0070696_100020813 3300005546 Bacteria 4445
154 Ga0070696_100045885 3300005546 Bacteria 3029
155 Ga0070696_100142356 3300005546 Bacteria 1754
156 Ga0070696_100173428 3300005546 Bacteria 1595
157 Ga0070693_100003704 3300005547 Bacteria 7148
158 Ga0070693_100006327 3300005547 Bacteria 5739
159 Ga0070665_100069299 3300005548 Bacteria 3535
160 Ga0070665_100072058 3300005548 Bacteria 3463
161 Ga0070704_100002939 3300005549 Bacteria 9685
162 Ga0070704_100131816 3300005549 Bacteria 1938
163 Ga0068855_100000288 3300005563 Bacteria 62320
164 Ga0068855_100060747 3300005563 Bacteria 4419
165 Ga0068855_100210099 3300005563 Bacteria 2187
166 Ga0070664_100003754 3300005564 Bacteria 12250
167 Ga0070664_100015067 3300005564 Bacteria 6313
168 Ga0070664_100042647 3300005564 Bacteria 3829
169 Ga0070664_100091649 3300005564 Bacteria 2631
170 Ga0070664_100091877 3300005564 Bacteria 2627
171 Ga0070664_100132444 3300005564 Bacteria 2190
172 Ga0068857_100006093 3300005577 Bacteria 10299
173 Ga0068857_100015552 3300005577 Bacteria 6648
174 Ga0068854_100002230 3300005578 Bacteria 11923
175 Ga0068856_100025283 3300005614 Bacteria 5788
176 Ga0068856_100062715 3300005614 Bacteria 3671
177 Ga0068856_100230587 3300005614 Bacteria 1867
178 Ga0070702_100015554 3300005615 Bacteria 3886
179 Ga0068852_100030713 3300005616 Bacteria 4427
180 Ga0068852_100035807 3300005616 Bacteria 4145
181 Ga0068852_100244602 3300005616 Bacteria 1716
182 Ga0068859_100002626 3300005617 Bacteria 18286
183 Ga0068859_100005469 3300005617 Bacteria 12924
184 Ga0068859_100018036 3300005617 Bacteria 7092
185 Ga0068859_100130106 3300005617 Bacteria 2588
186 Ga0068864_100000198 3300005618 Bacteria 54959
187 Ga0068864_100000892 3300005618 Bacteria 25113
188 Ga0068864_100025170 3300005618 Bacteria 5010
189 Ga0068864_100045770 3300005618 Bacteria 3753
190 Ga0068864_100150266 3300005618 Bacteria 2109
191 Ga0068864_100247702 3300005618 Bacteria 1653
192 Ga0068864_100249563 3300005618 Bacteria 1647
193 Ga0068864_100344121 3300005618 Bacteria 1406
194 Ga0068866_10001457 3300005718 Bacteria 10120
195 Ga0068861_100012037 3300005719 Bacteria 6027
196 Ga0068861_100218861 3300005719 Bacteria 1608
197 Ga0068851_10124759 3300005834 Bacteria 1387
198 Ga0068870_10002196 3300005840 Bacteria 8086
199 Ga0068863_100049203 3300005841 Bacteria 3997
200 Ga0068863_100109783 3300005841 Bacteria 2626
201 Ga0068863_100151701 3300005841 Bacteria 2217
202 Ga0068863_100167211 3300005841 Bacteria 2109
203 Ga0068858_100013723 3300005842 Bacteria 7647
204 Ga0068858_100085631 3300005842 Bacteria 2932
205 Ga0068858_100204847 3300005842 Bacteria 1866
206 Ga0068860_100013202 3300005843 Bacteria 8104
207 Ga0068860_100026383 3300005843 Bacteria 5601
208 Ga0068860_100048378 3300005843 Bacteria 4052
209 Ga0068860_100051573 3300005843 Bacteria 3914
210 Ga0068860_100060157 3300005843 Bacteria 3611
211 Ga0068860_100072012 3300005843 Bacteria 3284
212 Ga0068860_100100056 3300005843 Bacteria 2765
213 Ga0068860_100150545 3300005843 Bacteria 2240
214 Ga0068862_100049583 3300005844 Bacteria 3587
215 Ga0068862_100051740 3300005844 Bacteria 3513
216 Ga0068862_100115660 3300005844 Bacteria 2359
217 Ga0081455_10000053 3300005937 Bacteria 122071
218 Ga0081540_1000266 3300005983 Bacteria 54692
219 Ga0081540_1000743 3300005983 Bacteria 29993
220 Ga0081540_1002298 3300005983 Bacteria 15695
221 Ga0081540_1003173 3300005983 Bacteria 13114
222 Ga0081540_1021705 3300005983 Bacteria 3812
223 Ga0081539_10052853 3300005985 Bacteria 2278
224 Ga0070717_10005668 3300006028 Bacteria 9124
225 Ga0070717_10029651 3300006028 Bacteria 4391
226 Ga0070717_10041692 3300006028 Bacteria 3742
227 Ga0070715_10000026 3300006163 Bacteria 97907
228 Ga0070716_100108588 3300006173 Bacteria 1715
229 Ga0070712_100018949 3300006175 Bacteria 4479
230 Ga0070712_100038353 3300006175 Bacteria 3273
231 Ga0075427_10000222 3300006194 Bacteria 5880
232 Ga0097621_100006211 3300006237 Bacteria 8471
233 Ga0097621_100024131 3300006237 Bacteria 4745
234 Ga0068871_100009850 3300006358 Bacteria 6936
235 Ga0068871_100068529 3300006358 Bacteria 2913
236 Ga0075428_100186161 3300006844 Bacteria 2247
237 Ga0075431_100019533 3300006847 Bacteria 6911
238 Ga0075433_10009110 3300006852 Bacteria 7928
239 Ga0075433_10028953 3300006852 Bacteria 4714
240 Ga0075433_10029323 3300006852 Bacteria 4686
241 Ga0075434_100000694 3300006871 Bacteria 26302
242 Ga0075434_100016384 3300006871 Bacteria 7124
243 Ga0075434_100018256 3300006871 Bacteria 6773
244 Ga0075434_100039880 3300006871 Bacteria 4650
245 Ga0075429_100009653 3300006880 Bacteria 8370
246 Ga0068865_100004789 3300006881 Bacteria 8182
247 Ga0068865_100016439 3300006881 Bacteria 4735
248 Ga0068865_100030975 3300006881 Bacteria 3562
249 Ga0068865_100165891 3300006881 Bacteria 1689
250 Ga0097620_100002626 3300006931 Bacteria 18286
251 Ga0097620_100005469 3300006931 Bacteria 12924
252 Ga0097620_100018036 3300006931 Bacteria 7092
253 Ga0097620_100130117 3300006931 Bacteria 2588
254 Ga0105240_10000091 3300009093 Bacteria 182507
255 Ga0105240_10000208 3300009093 Bacteria 118950
256 Ga0105240_10066680 3300009093 Bacteria 4464
257 Ga0111539_10006123 3300009094 Bacteria 15530
258 Ga0111539_10015008 3300009094 Bacteria 9654
259 Ga0111539_10085103 3300009094 Bacteria 3717
260 Ga0111539_10153510 3300009094 Bacteria 2695
261 Ga0111539_10193205 3300009094 Bacteria 2375
262 Ga0105245_10002193 3300009098 Bacteria 17695
263 Ga0105245_10033418 3300009098 Bacteria 4559
264 Ga0105245_10099219 3300009098 Bacteria 2692
265 Ga0105247_10065658 3300009101 Bacteria 2258
266 Ga0114129_10085704 3300009147 Bacteria 4370
267 Ga0114129_10099078 3300009147 Bacteria 4034
268 Ga0114129_10148684 3300009147 Bacteria 3207
269 Ga0105243_10006356 3300009148 Bacteria 9125
270 Ga0105243_10011002 3300009148 Bacteria 6841
271 Ga0105241_10045004 3300009174 Bacteria 3347
272 Ga0105241_10056248 3300009174 Bacteria 3016
273 Ga0105242_10014836 3300009176 Bacteria 6035
274 Ga0105242_10033814 3300009176 Bacteria 4096
275 Ga0105242_10069800 3300009176 Bacteria 2911
276 Ga0105242_10111476 3300009176 Bacteria 2333
277 Ga0105248_10013878 3300009177 Bacteria 8863
278 Ga0105248_10040509 3300009177 Bacteria 5222
279 Ga0105248_10048980 3300009177 Bacteria 4739
280 Ga0105248_10137409 3300009177 Bacteria 2757
281 Ga0105248_10151409 3300009177 Bacteria 2617
282 Ga0105248_10246529 3300009177 Bacteria 2011
283 Ga0105238_10393488 3300009551 Bacteria 1378
284 Ga0105249_10007344 3300009553 Bacteria 9606
285 Ga0105249_10019581 3300009553 Bacteria 6039
286 Ga0105249_10101183 3300009553 Bacteria 2710
287 Ga0105239_10002058 3300010375 Bacteria 26061
288 Ga0105239_10025305 3300010375 Bacteria 6535
289 Ga0105239_10038188 3300010375 Bacteria 5262
290 Ga0105239_10098985 3300010375 Bacteria 3224
291 Ga0105239_10186731 3300010375 Bacteria 2320
292 Ga0105246_10062460 3300011119 Bacteria 2595
293 Ga0105246_10144869 3300011119 Bacteria 1791
294 Ga0157342_1001450 3300012507 Bacteria 1761
295 Ga0157338_1000062 3300012515 Bacteria 4630
296 Ga0157370_10104626 3300013104 Bacteria 2650
297 Ga0157369_10030109 3300013105 Bacteria 5989
298 Ga0157369_10160722 3300013105 Bacteria 2371
299 Ga0157374_10003055 3300013296 Bacteria 14034
300 Ga0157374_10005126 3300013296 Bacteria 10994
301 Ga0157374_10031326 3300013296 Bacteria 4833
302 Ga0157374_10322621 3300013296 Bacteria 1531
303 Ga0157378_10015420 3300013297 Bacteria 6693
304 Ga0157378_10029707 3300013297 Bacteria 4827
305 Ga0157378_10088003 3300013297 Bacteria 2818
306 Ga0163162_10038671 3300013306 Bacteria 4761
307 Ga0163162_10075204 3300013306 Bacteria 3438
308 Ga0163162_10076179 3300013306 Bacteria 3416
309 Ga0163162_10129132 3300013306 Bacteria 2635
310 Ga0157372_10019331 3300013307 Bacteria 7337
311 Ga0157372_10407493 3300013307 Bacteria 1584
312 Ga0157375_10014740 3300013308 Bacteria 6987
313 Ga0157375_10045525 3300013308 Bacteria 4271
314 Ga0157375_10058435 3300013308 Bacteria 3815
315 Ga0157375_10111292 3300013308 Bacteria 2837
316 Ga0157375_10254207 3300013308 Bacteria 1918
317 Ga0157375_10254263 3300013308 Bacteria 1918
318 Ga0157375_10384113 3300013308 Bacteria 1571
319 Ga0163163_10061653 3300014325 Bacteria 3716
320 Ga0163163_10098026 3300014325 Bacteria 2952
321 Ga0163163_10137949 3300014325 Bacteria 2480
322 Ga0163163_10262233 3300014325 Bacteria 1779
323 Ga0157380_10023078 3300014326 Bacteria 4692
324 Ga0157377_10005921 3300014745 Bacteria 5786
325 Ga0157379_10012849 3300014968 Bacteria 7322
326 Ga0157379_10015522 3300014968 Bacteria 6684
327 Ga0157379_10015909 3300014968 Bacteria 6612
328 Ga0157379_10032414 3300014968 Bacteria 4659
329 Ga0157379_10099401 3300014968 Bacteria 2612
330 Ga0157376_10032791 3300014969 Bacteria 4174
331 Ga0157376_10080887 3300014969 Bacteria 2788
332 Ga0157376_10089735 3300014969 Bacteria 2658
333 Ga0157376_10152433 3300014969 Bacteria 2086
334 Ga0157376_10170733 3300014969 Bacteria 1980
335 Ga0163161_10027103 3300017792 Bacteria 4063
336 Ga0163161_10198901 3300017792 Bacteria 1544
337 Ga0213872_10000078 3300021361 Bacteria 89790
338 Ga0209565_1000167 3300025263 Bacteria 85246
339 Ga0207666_1000121 3300025271 Bacteria 12065
340 Ga0209673_1000051 3300025273 Bacteria 282161
341 Ga0207673_1000199 3300025290 Bacteria 6006
342 Ga0209675_1000027 3300025291 Bacteria 282175
343 Ga0209564_1000897 3300025295 Bacteria 39116
344 Ga0209256_1000265 3300025299 Bacteria 92716
345 Ga0207697_10004636 3300025315 Bacteria 6526
346 Ga0207697_10012779 3300025315 Bacteria 3513
347 Ga0207656_10096309 3300025321 Bacteria 1351
348 Ga0207653_10008878 3300025885 Bacteria 3135
349 Ga0207682_10010711 3300025893 Bacteria 3588
350 Ga0207692_10007099 3300025898 Bacteria 4576
351 Ga0207692_10011983 3300025898 Bacteria 3711
352 Ga0207692_10036932 3300025898 Bacteria 2386
353 Ga0207642_10022378 3300025899 Bacteria 2506
354 Ga0207710_10007880 3300025900 Bacteria 4507
355 Ga0207710_10025060 3300025900 Bacteria 2572
356 Ga0207688_10001502 3300025901 Bacteria 12242
357 Ga0207680_10040697 3300025903 Bacteria 2706
358 Ga0207680_10071823 3300025903 Bacteria 2146
359 Ga0207680_10187650 3300025903 Bacteria 1402
360 Ga0207647_10000049 3300025904 Bacteria 88392
361 Ga0207647_10002513 3300025904 Bacteria 13884
362 Ga0207685_10000009 3300025905 Bacteria 242842
363 Ga0207699_10044934 3300025906 Bacteria 2574
364 Ga0207699_10081042 3300025906 Bacteria 2012
365 Ga0207645_10003686 3300025907 Bacteria 11554
366 Ga0207643_10000170 3300025908 Bacteria 44654
367 Ga0207684_10001521 3300025910 Bacteria 24854
368 Ga0207654_10094257 3300025911 Bacteria 1832
369 Ga0207654_10121311 3300025911 Bacteria 1642
370 Ga0207707_10006812 3300025912 Bacteria 9970
371 Ga0207707_10063119 3300025912 Bacteria 3224
372 Ga0207695_10000018 3300025913 Bacteria 766611
373 Ga0207695_10098679 3300025913 Bacteria 2920
374 Ga0207695_10201253 3300025913 Bacteria 1905
375 Ga0207695_10223772 3300025913 Bacteria 1788
376 Ga0207693_10003442 3300025915 Bacteria 13505
377 Ga0207693_10014217 3300025915 Bacteria 6404
378 Ga0207693_10065734 3300025915 Bacteria 2839
379 Ga0207693_10105547 3300025915 Bacteria 2209
380 Ga0207663_10031299 3300025916 Bacteria 3148
381 Ga0207660_10022481 3300025917 Bacteria 4248
382 Ga0207662_10007466 3300025918 Bacteria 5954
383 Ga0207662_10129503 3300025918 Bacteria 1590
384 Ga0207657_10007036 3300025919 Bacteria 11575
385 Ga0207657_10007416 3300025919 Bacteria 11248
386 Ga0207657_10044583 3300025919 Bacteria 3898
387 Ga0207649_10001009 3300025920 Bacteria 17378
388 Ga0207652_10049393 3300025921 Bacteria 3601
389 Ga0207652_10254518 3300025921 Bacteria 1584
390 Ga0207646_10003821 3300025922 Bacteria 16737
391 Ga0207646_10011237 3300025922 Bacteria 8695
392 Ga0207646_10031775 3300025922 Bacteria 4779
393 Ga0207681_10053519 3300025923 Bacteria 2740
394 Ga0207681_10175905 3300025923 Bacteria 1626
395 Ga0207650_10007451 3300025925 Bacteria 7460
396 Ga0207659_10162803 3300025926 Bacteria 1753
397 Ga0207687_10000941 3300025927 Bacteria 19857
398 Ga0207687_10021029 3300025927 Bacteria 4332
399 Ga0207687_10050893 3300025927 Bacteria 2886
400 Ga0207700_10005756 3300025928 Bacteria 7443
401 Ga0207700_10009622 3300025928 Bacteria 6051
402 Ga0207664_10015029 3300025929 Bacteria 5606
403 Ga0207664_10045233 3300025929 Bacteria 3451
404 Ga0207664_10057700 3300025929 Bacteria 3086
405 Ga0207664_10176051 3300025929 Bacteria 1834
406 Ga0207664_10213840 3300025929 Bacteria 1669
407 Ga0207644_10007715 3300025931 Bacteria 7022
408 Ga0207644_10055879 3300025931 Bacteria 2847
409 Ga0207644_10058880 3300025931 Bacteria 2777
410 Ga0207644_10068961 3300025931 Bacteria 2581
411 Ga0207644_10083261 3300025931 Bacteria 2368
412 Ga0207644_10094153 3300025931 Bacteria 2237
413 Ga0207644_10111355 3300025931 Bacteria 2070
414 Ga0207644_10116480 3300025931 Bacteria 2028
415 Ga0207690_10004445 3300025932 Bacteria 8275
416 Ga0207690_10202566 3300025932 Bacteria 1508
417 Ga0207706_10000111 3300025933 Bacteria 87282
418 Ga0207706_10018959 3300025933 Bacteria 6187
419 Ga0207706_10025115 3300025933 Bacteria 5342
420 Ga0207706_10037211 3300025933 Bacteria 4322
421 Ga0207706_10054953 3300025933 Bacteria 3513
422 Ga0207706_10077028 3300025933 Bacteria 2933
423 Ga0207706_10082759 3300025933 Bacteria 2821
424 Ga0207686_10019407 3300025934 Bacteria 3867
425 Ga0207686_10024867 3300025934 Bacteria 3476
426 Ga0207686_10136509 3300025934 Bacteria 1689
427 Ga0207709_10005222 3300025935 Bacteria 7390
428 Ga0207709_10022544 3300025935 Bacteria 3572
429 Ga0207709_10066077 3300025935 Bacteria 2277
430 Ga0207670_10049133 3300025936 Bacteria 2820
431 Ga0207669_10025866 3300025937 Bacteria 3181
432 Ga0207669_10037873 3300025937 Bacteria 2772
433 Ga0207704_10033631 3300025938 Bacteria 2918
434 Ga0207665_10005232 3300025939 Bacteria 8667
435 Ga0207665_10006610 3300025939 Bacteria 7690
436 Ga0207665_10008176 3300025939 Bacteria 6906
437 Ga0207665_10023526 3300025939 Bacteria 4058
438 Ga0207665_10028191 3300025939 Bacteria 3708
439 Ga0207691_10006198 3300025940 Bacteria 11552
440 Ga0207691_10006422 3300025940 Bacteria 11361
441 Ga0207691_10008613 3300025940 Bacteria 9788
442 Ga0207691_10106179 3300025940 Bacteria 2501
443 Ga0207711_10006243 3300025941 Bacteria 10055
444 Ga0207711_10022156 3300025941 Bacteria 5311
445 Ga0207711_10034111 3300025941 Bacteria 4310
446 Ga0207711_10043350 3300025941 Bacteria 3837
447 Ga0207711_10050148 3300025941 Bacteria 3573
448 Ga0207711_10087642 3300025941 Bacteria 2731
449 Ga0207711_10089562 3300025941 Bacteria 2703
450 Ga0207711_10103432 3300025941 Bacteria 2522
451 Ga0207711_10197682 3300025941 Bacteria 1834
452 Ga0207689_10005901 3300025942 Bacteria 10848
453 Ga0207689_10008098 3300025942 Bacteria 9166
454 Ga0207689_10025089 3300025942 Bacteria 4998
455 Ga0207661_10000500 3300025944 Bacteria 25254
456 Ga0207661_10043789 3300025944 Bacteria 3534
457 Ga0207679_10000073 3300025945 Bacteria 89687
458 Ga0207679_10023752 3300025945 Bacteria 4196
459 Ga0207667_10000234 3300025949 Bacteria 77157
460 Ga0207667_10148060 3300025949 Bacteria 2416
461 Ga0207712_10003735 3300025961 Bacteria 9607
462 Ga0207712_10023192 3300025961 Bacteria 4093
463 Ga0207712_10041025 3300025961 Bacteria 3179
464 Ga0207712_10077652 3300025961 Bacteria 2407
465 Ga0207668_10007786 3300025972 Bacteria 6373
466 Ga0207668_10083077 3300025972 Bacteria 2329
467 Ga0207658_10154643 3300025986 Bacteria 1873
468 Ga0207677_10010220 3300026023 Bacteria 5304
469 Ga0207677_10085618 3300026023 Bacteria 2275
470 Ga0207703_10001970 3300026035 Bacteria 18125
471 Ga0207703_10019848 3300026035 Bacteria 5253
472 Ga0207703_10029178 3300026035 Bacteria 4352
473 Ga0207703_10058776 3300026035 Bacteria 3139
474 Ga0207703_10114734 3300026035 Bacteria 2304
475 Ga0207703_10159136 3300026035 Bacteria 1977
476 Ga0207703_10184538 3300026035 Bacteria 1843
477 Ga0207639_10021608 3300026041 Bacteria 4625
478 Ga0207639_10091419 3300026041 Bacteria 2437
479 Ga0207678_10006861 3300026067 Bacteria 10098
480 Ga0207678_10012045 3300026067 Bacteria 7595
481 Ga0207678_10028319 3300026067 Bacteria 4891
482 Ga0207678_10045247 3300026067 Bacteria 3807
483 Ga0207678_10071631 3300026067 Bacteria 2972
484 Ga0207708_10005825 3300026075 Bacteria 9116
485 Ga0207708_10026987 3300026075 Bacteria 4348
486 Ga0207708_10054687 3300026075 Bacteria 3044
487 Ga0207702_10037313 3300026078 Bacteria 4067
488 Ga0207702_10096581 3300026078 Bacteria 2599
489 Ga0207702_10170059 3300026078 Bacteria 1997
490 Ga0207641_10007312 3300026088 Bacteria 9203
491 Ga0207641_10013057 3300026088 Bacteria 6813
492 Ga0207641_10180303 3300026088 Bacteria 1934
493 Ga0207641_10225813 3300026088 Bacteria 1738
494 Ga0207648_10023509 3300026089 Bacteria 5519
495 Ga0207648_10030417 3300026089 Bacteria 4782
496 Ga0207648_10031345 3300026089 Bacteria 4700
497 Ga0207648_10087929 3300026089 Bacteria 2712
498 Ga0207676_10000996 3300026095 Bacteria 21831
499 Ga0207676_10006169 3300026095 Bacteria 8464
500 Ga0207676_10006739 3300026095 Bacteria 8129
501 Ga0207676_10064163 3300026095 Bacteria 2919
502 Ga0207674_10001648 3300026116 Bacteria 28724
503 Ga0207674_10003682 3300026116 Bacteria 18700
504 Ga0207675_100005605 3300026118 Bacteria 12023
505 Ga0207675_100096502 3300026118 Bacteria 2783
506 Ga0207683_10009988 3300026121 Bacteria 8100
507 Ga0207683_10024313 3300026121 Bacteria 5216
508 Ga0207683_10026381 3300026121 Bacteria 5014
509 Ga0207683_10097314 3300026121 Bacteria 2624
510 Ga0207683_10229223 3300026121 Bacteria 1694
511 Ga0207698_10015454 3300026142 Bacteria 5111
512 Ga0207698_10043979 3300026142 Bacteria 3351
513 Ga0207698_10192950 3300026142 Bacteria 1816
514 Ga0207698_10249944 3300026142 Bacteria 1622
515 Ga0210002_1000584 3300027617 Bacteria 4947
516 Ga0209974_10002790 3300027876 Bacteria 6336
517 Ga0207428_10001104 3300027907 Bacteria 29349
518 Ga0207428_10004390 3300027907 Bacteria 13448
519 Ga0207428_10004461 3300027907 Bacteria 13282
520 Ga0207428_10072519 3300027907 Bacteria 2703
521 Ga0268266_10022307 3300028379 Bacteria 5395
522 Ga0268266_10064207 3300028379 Bacteria 3171
523 Ga0268266_10064832 3300028379 Bacteria 3157
524 Ga0268266_10070266 3300028379 Bacteria 3034
525 Ga0268265_10012161 3300028380 Bacteria 5830
526 Ga0268265_10111947 3300028380 Bacteria 2230
527 Ga0268264_10020450 3300028381 Bacteria 5408
528 Ga0268264_10031800 3300028381 Bacteria 4328
529 Ga0268264_10033842 3300028381 Bacteria 4201
530 Ga0268264_10040688 3300028381 Bacteria 3841
531 Ga0268264_10106425 3300028381 Bacteria 2448
532 Ga0307513_10048341 3300031456 Bacteria 4618
533 Ga0307408_100031441 3300031548 Bacteria 3696
534 Ga0307408_100035958 3300031548 Bacteria 3478
535 Ga0307508_10005636 3300031616 Bacteria 11867
536 Ga0307405_10001068 3300031731 Bacteria 11129
537 Ga0307410_10000446 3300031852 Bacteria 16584
538 Ga0307410_10001648 3300031852 Bacteria 10273
539 Ga0307406_10015807 3300031901 Bacteria 4374
540 Ga0307407_10001157 3300031903 Bacteria 9261
541 Ga0307407_10012880 3300031903 Bacteria 4039
542 Ga0307409_100006279 3300031995 Bacteria 6962
543 Ga0307409_100058965 3300031995 Bacteria 2984
544 Ga0307416_100023019 3300032002 Bacteria 4511
545 Ga0307411_10005785 3300032005 Bacteria 6119
546 Ga0307411_10042197 3300032005 Bacteria 2908
547 Ga0307415_100000950 3300032126 Bacteria 13334
548 Ga0373930_0000685 3300034816 Bacteria 4749
549 Ga0373948_0000760 3300034817 Bacteria 4207
550 Ga0373950_0001042 3300034818 Bacteria 3536
551 Ga0373950_0006897 3300034818 Bacteria 1748
552 Ga0373958_0002479 3300034819 Bacteria 2594
553 Ga0373959_0000435 3300034820 Bacteria 7953
554 Ga0373938_0006949 3300034957 Bacteria 1976
555 Ga0373928_0000247 3300035084 Bacteria 10651
556 Ga0373929_0000208 3300035085 Bacteria 10586
557 Ga0373929_0003744 3300035085 Bacteria 2728
558 Ga0373934_0002824 3300035086 Bacteria 6363
559 Ga0373940_0000026 3300035088 Bacteria 16296
560 Ga0373940_0029554 3300035088 Bacteria 1452
561 Ga0373944_0000854 3300035089 Bacteria 7477
562 Ga0373949_0002963 3300035090 Bacteria 4177
563 Ga0373949_0006846 3300035090 Bacteria 2504
564 Ga0373949_0019756 3300035090 Bacteria 1537
565 Ga0373951_0000727 3300035091 Bacteria 9041
566 Ga0373951_0006612 3300035091 Bacteria 2649
567 Ga0373932_0000407 3300035112 Bacteria 13181
568 Ga0373932_0012360 3300035112 Bacteria 2101
569 Ga0373939_0005792 3300035114 Bacteria 2951
570 Ga0373941_0001353 3300035115 Bacteria 5157
571 Ga0373941_0003182 3300035115 Bacteria 3691
572 Ga0373941_0032612 3300035115 Unclassified 1560
573 Ga0373945_0016257 3300035116 Bacteria 2507
574 Ga0373953_0001046 3300035117 Bacteria 7838
575 Ga0373956_0015094 3300035119 Bacteria 3230
576 Ga0373960_0002714 3300035121 Bacteria 4002
577 Ga0373960_0037968 3300035121 Bacteria 1378
578 Ga0373943_0019324 3300035170 Bacteria 3132
579 Ga0373943_0051482 3300035170 Bacteria 2027
580 Ga0373946_0017459 3300035171 Bacteria 2746
581 Ga0373946_0018549 3300035171 Bacteria 2673
582 Ga0373942_0000429 3300035207 Bacteria 11745
583 Ga0373942_0029592 3300035207 Bacteria 1438
584 Ga0373961_0005044 3300035241 Bacteria 3175
585 Ga0373962_0005545 3300035242 Bacteria 3051
586 Ga0373962_0007708 3300035242 Bacteria 2641
587 Ga0373962_0008860 3300035242 Bacteria 2484
588 Ga0373924_0008318 3300035410 Bacteria 3766
589 Ga0373931_0003387 3300035691 Bacteria 7153
590 Ga0373931_0005919 3300035691 Bacteria 5686
591 Ga0373931_0041276 3300035691 Bacteria 2423
592 Ga0373935_0023535 3300035692 Bacteria 3785
593 Ga0373935_0061444 3300035692 Bacteria 2405
594 Ga0373927_0017392 3300035695 Bacteria 4732
595 Ga0373927_0048642 3300035695 Bacteria 2743
596 Ga0373927_0147030 3300035695 Bacteria 1543
597 Ga0373933_0004772 3300035724 Bacteria 7409
598 Ga0373947_0018999 3300035725 Bacteria 3960
599 Ga0373947_0022156 3300035725 Bacteria 3681
600 Ga0373947_0039961 3300035725 Bacteria 2793
601 Ga0373947_0054287 3300035725 Bacteria 2418
602 Ga0373947_0057122 3300035725 Bacteria 2360
603 Ga0373937_0018743 3300036401 Bacteria 6185
604 Ga0373937_0060907 3300036401 Bacteria 3469
605 Ga0373937_0065911 3300036401 Bacteria 3334
606 Ga0373925_0007679 3300037068 Bacteria 7857
607 Ga0373925_0019209 3300037068 Bacteria 4969
608 Ga0373925_0021141 3300037068 Bacteria 4741
609 Ga0373925_0053112 3300037068 Bacteria 3028
610 Ga0373925_0116721 3300037068 Bacteria 2067
611 Ga0395899_0001097 3300037312 Bacteria 24262
612 Ga0395899_0020924 3300037312 Bacteria 4962
613 Ga0395900_0007849 3300037418 Bacteria 10998
614 Ga0395900_0056020 3300037418 Bacteria 4058
615 Ga0395900_0077719 3300037418 Bacteria 3410
616 Ga0395900_0104191 3300037418 Bacteria 2915
617 Ga0395900_0359396 3300037418 Bacteria 1428
618 Ga0395898_0010657 3300037466 Bacteria 9603
619 Ga0395898_0010839 3300037466 Bacteria 9523
620 Ga0395898_0062096 3300037466 Bacteria 3629
621 Ga0395898_0083951 3300037466 Bacteria 3070
622 Ga0395898_0100971 3300037466 Bacteria 2771
623 Ga0395898_0190441 3300037466 Bacteria 1960
624 Ga0395905_0005914 3300037471 Bacteria 12404
625 Ga0395905_0007758 3300037471 Bacteria 10646
626 Ga0395905_0027153 3300037471 Bacteria 5399
627 Ga0395905_0084686 3300037471 Bacteria 2971
628 Ga0395901_0005743 3300038443 Bacteria 12568
629 Ga0395901_0009184 3300038443 Bacteria 10017
630 Ga0395901_0016278 3300038443 Bacteria 7574
631 Ga0395901_0026461 3300038443 Bacteria 5956
632 Ga0395901_0115186 3300038443 Bacteria 2824
633 Ga0395901_0141659 3300038443 Bacteria 2527
634 Ga0436361_0081046 3300039447 Bacteria 44857
635 Ga0436361_0173984 3300039447 Bacteria 4710
636 Ga0436361_0775201 3300039447 Bacteria 1223
637 Ga0436363_0000250 3300039450 Bacteria 2843
638 Ga0436363_0520749 3300039450 Bacteria 2430
639 Ga0451577_0010773 3300042876 Bacteria 8699
640 Ga0451577_0013515 3300042876 Bacteria 7637
641 Ga0453683_0004980 3300044673 Bacteria 9332
642 Ga0453683_0108698 3300044673 Bacteria 1743
643 Ga0453684_0016151 3300044712 Bacteria 11709
644 Ga0453684_0121764 3300044712 Bacteria 3148
645 Ga0466957_0003343 3300044842 Bacteria 8793
646 Ga0451576_0007618 3300045051 Bacteria 12887
647 Ga0451576_0075803 3300045051 Bacteria 3500
648 Ga0451576_0169680 3300045051 Bacteria 2277
649 Ga0495617_000387 3300046452 Bacteria 24303
650 Ga0495617_002096 3300046452 Bacteria 8236
651 Ga0495617_003252 3300046452 Bacteria 6165
652 Ga0495592_0010172 3300046454 Bacteria 7092
653 Ga0495592_0111618 3300046454 Bacteria 1934
654 Ga0495603_0016118 3300046455 Bacteria 4518
655 Ga0495603_0054930 3300046455 Bacteria 2360
656 Ga0495603_0061459 3300046455 Bacteria 2218
657 Ga0495590_0003942 3300046457 Bacteria 6034
658 Ga0495590_0010756 3300046457 Bacteria 3429
659 Ga0495629_0010654 3300046459 Bacteria 6688
660 Ga0495629_0044719 3300046459 Bacteria 3107
661 Ga0495629_0063398 3300046459 Bacteria 2581
662 Ga0495638_0000520 3300046460 Bacteria 45045
663 Ga0495638_0010656 3300046460 Bacteria 6367
664 Ga0495641_0045665 3300046461 Bacteria 2016
665 Ga0495653_0022255 3300046463 Bacteria 5131
666 Ga0495580_0048323 3300046472 Bacteria 3013
667 Ga0495580_0099343 3300046472 Bacteria 2024
668 Ga0495580_0127320 3300046472 Bacteria 1768
669 Ga0495582_0002101 3300046473 Bacteria 11145
670 Ga0495582_0008520 3300046473 Bacteria 5656
671 Ga0495582_0020177 3300046473 Bacteria 3646
672 Ga0495605_0004646 3300046474 Bacteria 8028
673 Ga0495605_0008241 3300046474 Bacteria 5894
674 Ga0495639_0008880 3300046475 Bacteria 4308
675 Ga0495639_0026761 3300046475 Bacteria 2551
676 Ga0495662_0000090 3300046476 Bacteria 32519
677 Ga0495664_0000146 3300046477 Bacteria 35506
678 Ga0495664_0049659 3300046477 Bacteria 2490
679 Ga0495584_0000005 3300046491 Bacteria 306957
680 Ga0495584_0000144 3300046491 Bacteria 49665
681 Ga0495584_0000148 3300046491 Bacteria 48720
682 Ga0495584_0045902 3300046491 Bacteria 2204
683 Ga0495584_0052096 3300046491 Bacteria 2060
684 Ga0495584_0073080 3300046491 Bacteria 1723
685 Ga0495585_0000023 3300046492 Bacteria 149218
686 Ga0495585_0003154 3300046492 Bacteria 11289
687 Ga0495585_0007462 3300046492 Bacteria 6689
688 Ga0495585_0045048 3300046492 Bacteria 2463
689 Ga0495585_0062442 3300046492 Bacteria 2046
690 Ga0495594_0013321 3300046499 Bacteria 4291
691 Ga0495596_0005603 3300046500 Bacteria 5904
692 Ga0495607_0003127 3300046501 Bacteria 12850
693 Ga0495607_0009303 3300046501 Bacteria 6660
694 Ga0495607_0013889 3300046501 Bacteria 5262
695 Ga0495607_0048423 3300046501 Bacteria 2485
696 Ga0495607_0106628 3300046501 Bacteria 1491
697 Ga0495583_0000045 3300046506 Bacteria 220503
698 Ga0495583_0009632 3300046506 Bacteria 5746
699 Ga0495583_0032541 3300046506 Bacteria 2516
700 Ga0495606_0010259 3300046507 Bacteria 7803
701 Ga0495606_0013445 3300046507 Bacteria 6463
702 Ga0495608_0001166 3300046511 Bacteria 18615
703 Ga0495616_0003950 3300046513 Bacteria 9442
704 Ga0495616_0007571 3300046513 Bacteria 6498
705 Ga0495616_0019134 3300046513 Bacteria 3742
706 Ga0495616_0100117 3300046513 Bacteria 1360
707 Ga0495618_0014081 3300046514 Bacteria 4869
708 Ga0495618_0014685 3300046514 Bacteria 4775
709 Ga0495618_0041634 3300046514 Bacteria 2894
710 Ga0495618_0171775 3300046514 Bacteria 1379
711 Ga0495620_0001243 3300046515 Bacteria 15564
712 Ga0495630_0021724 3300046517 Bacteria 4739
713 Ga0495630_0022831 3300046517 Bacteria 4621
714 Ga0495644_0004742 3300046523 Bacteria 5339
715 Ga0495648_0000048 3300046524 Bacteria 164840
716 Ga0495648_0000326 3300046524 Bacteria 52532
717 Ga0495648_0014256 3300046524 Bacteria 5829
718 Ga0495648_0119131 3300046524 Bacteria 1422
719 Ga0495642_0004115 3300046528 Bacteria 5674
720 Ga0495652_0013906 3300046529 Bacteria 7237
721 Ga0495652_0026750 3300046529 Bacteria 5092
722 Ga0495652_0037469 3300046529 Bacteria 4207
723 Ga0495652_0070602 3300046529 Bacteria 2918
724 Ga0495665_0013021 3300046531 Bacteria 4504
725 Ga0495640_0000406 3300046533 Bacteria 31017
726 Ga0495640_0010615 3300046533 Bacteria 7105
727 Ga0495640_0021298 3300046533 Bacteria 4759
728 Ga0495586_0037773 3300046535 Bacteria 2593
729 Ga0495586_0042660 3300046535 Bacteria 2442
730 Ga0495587_0001403 3300046536 Bacteria 16023
731 Ga0495587_0062851 3300046536 Bacteria 2173
732 Ga0495609_0000889 3300046538 Bacteria 21817
733 Ga0495609_0003207 3300046538 Bacteria 9495
734 Ga0495609_0004379 3300046538 Bacteria 7747
735 Ga0495597_0000307 3300046542 Bacteria 43960
736 Ga0495645_0047921 3300046543 Bacteria 3113
737 Ga0495645_0057222 3300046543 Bacteria 2830
738 Ga0495645_0111205 3300046543 Bacteria 1938
739 Ga0495622_0000009 3300046557 Bacteria 224622
740 Ga0495633_0000464 3300046558 Bacteria 41549
741 Ga0495633_0000963 3300046558 Bacteria 23724
742 Ga0495633_0004728 3300046558 Bacteria 8554
743 Ga0495633_0029268 3300046558 Bacteria 2680
744 Ga0495667_0025132 3300046559 Bacteria 4015
745 Ga0495656_0000722 3300046615 Bacteria 10672
746 Ga0495668_0000020 3300046616 Bacteria 411641
747 Ga0495668_0004123 3300046616 Bacteria 10522
748 Ga0495668_0018680 3300046616 Bacteria 4006
749 Ga0495634_0022115 3300046642 Bacteria 4483
750 Ga0495634_0040746 3300046642 Bacteria 3156
751 Ga0495634_0071492 3300046642 Bacteria 2284
752 Ga0495611_0003431 3300046648 Bacteria 6989
753 Ga0495611_0011354 3300046648 Bacteria 3775
754 Ga0495611_0043040 3300046648 Bacteria 2017
755 Ga0495625_0009047 3300046660 Bacteria 8406
756 Ga0495625_0026987 3300046660 Bacteria 4330
757 Ga0495625_0033048 3300046660 Bacteria 3829
758 Ga0495635_0002945 3300046663 Bacteria 11681
759 Ga0495635_0025247 3300046663 Bacteria 4138
760 Ga0495659_0000339 3300046664 Bacteria 18435
761 Ga0495659_0003958 3300046664 Bacteria 4689
762 Ga0495661_0141273 3300046665 Bacteria 1309
763 Ga0495657_0008402 3300046675 Bacteria 7902
764 Ga0495599_0014730 3300046678 Bacteria 4842
765 Ga0495623_0025889 3300046679 Bacteria 3778
766 Ga0495646_0021835 3300046680 Bacteria 4042
767 Ga0495647_0022374 3300046681 Bacteria 2283
768 Ga0495658_0000912 3300046683 Bacteria 15805
769 Ga0495658_0007426 3300046683 Bacteria 5423
770 Ga0495669_0002490 3300046684 Bacteria 7519
771 Ga0495624_0021798 3300046690 Bacteria 4245
772 Ga0495624_0093692 3300046690 Bacteria 1851
773 Ga0495670_0000472 3300046691 Bacteria 19142
774 Ga0495670_0001538 3300046691 Bacteria 11278
775 Ga0495670_0004164 3300046691 Bacteria 7084
776 Ga0495671_0010860 3300046692 Bacteria 5033
777 Ga0495671_0016052 3300046692 Bacteria 4004
778 Ga0495589_0000157 3300046794 Bacteria 62544
779 Ga0495589_0042264 3300046794 Bacteria 2272
780 Ga0495600_0001461 3300046809 Bacteria 13109
781 Ga0495660_0042821 3300046810 Bacteria 2500
782 Ga0495581_0017357 3300047315 Bacteria 4179
783 Ga0495581_0038854 3300047315 Bacteria 2755
784 Ga0495604_0004956 3300047317 Bacteria 10553
785 Ga0495636_0007652 3300047318 Bacteria 4247
786 Ga0495674_0009409 3300047319 Bacteria 9283
787 Ga0495674_0010462 3300047319 Bacteria 8782
788 Ga0495674_0062895 3300047319 Bacteria 3230
789 Ga0495672_0001035 3300047320 Bacteria 28588
790 Ga0495672_0002045 3300047320 Bacteria 18954
791 Ga0495680_0028268 3300047322 Bacteria 4599
792 Ga0495680_0065554 3300047322 Bacteria 2781
793 Ga0495680_0194445 3300047322 Bacteria 1458
794 Ga0495683_0000036 3300047323 Bacteria 144974
795 Ga0495683_0000932 3300047323 Bacteria 20627
796 Ga0495683_0007648 3300047323 Bacteria 5818
797 Ga0495683_0071460 3300047323 Bacteria 1703
798 Ga0495687_000096 3300047443 Bacteria 133560
799 Ga0495687_002087 3300047443 Bacteria 16803
800 Ga0495679_034243 3300047446 Bacteria 1618
801 Ga0495685_000045 3300047447 Bacteria 50520
802 Ga0495673_0016550 3300047469 Bacteria 3768
803 Ga0495681_0004963 3300047470 Bacteria 8980
804 Ga0495684_0009890 3300047471 Bacteria 7362
805 Ga0495684_0065158 3300047471 Bacteria 2769
806 Ga0495684_0106746 3300047471 Bacteria 2115
807 Ga0495686_0001027 3300047472 Bacteria 33650
808 Ga0495593_0004230 3300047673 Bacteria 8532
809 Ga0495593_0012333 3300047673 Bacteria 4884
810 Ga0495593_0037002 3300047673 Bacteria 2643
811 Ga0495602_0018615 3300048088 Bacteria 6927
812 Ga0495614_0001497 3300048089 Bacteria 10107
813 Ga0495626_0004606 3300048091 Bacteria 8402
814 Ga0496100_0010418 3300048903 Bacteria 5260
815 Ga0496100_0015038 3300048903 Bacteria 4512
816 Ga0496100_0074153 3300048903 Bacteria 2279
817 Ga0496100_0092437 3300048903 Bacteria 2067
818 Ga0496101_0001838 3300048904 Bacteria 12798
819 Ga0496101_0004943 3300048904 Bacteria 8463
820 Ga0496101_0076559 3300048904 Bacteria 2464
821 Ga0496101_0097236 3300048904 Bacteria 2198
822 Ga0496101_0121627 3300048904 Bacteria 1974
823 Ga0496101_0169190 3300048904 Bacteria 1679
824 Ga0496102_0006490 3300048905 Bacteria 9974
825 Ga0496102_0020550 3300048905 Bacteria 5834
826 Ga0496102_0028967 3300048905 Bacteria 4950
827 Ga0496102_0048548 3300048905 Bacteria 3859
828 Ga0496102_0071171 3300048905 Bacteria 3193
829 Ga0496102_0079041 3300048905 Bacteria 3028
830 Ga0496102_0105587 3300048905 Bacteria 2620
831 Ga0496102_0143981 3300048905 Bacteria 2236
832 Ga0496103_0011391 3300048906 Bacteria 5268
833 Ga0496103_0021882 3300048906 Bacteria 3847
834 Ga0496103_0030107 3300048906 Bacteria 3301
835 Ga0496103_0123420 3300048906 Bacteria 1651
836 Ga0496104_0006743 3300048907 Bacteria 10113
837 Ga0496104_0013113 3300048907 Bacteria 7469
838 Ga0496104_0023987 3300048907 Bacteria 5612
839 Ga0496104_0041444 3300048907 Bacteria 4317
840 Ga0496104_0070144 3300048907 Bacteria 3331
841 Ga0496104_0316014 3300048907 Bacteria 1475
842 Ga0496105_0006930 3300048908 Bacteria 8727
843 Ga0496105_0031733 3300048908 Bacteria 4332
844 Ga0496105_0041364 3300048908 Bacteria 3798
845 Ga0496105_0062484 3300048908 Bacteria 3073
846 Ga0496105_0088924 3300048908 Bacteria 2552
847 Ga0496105_0092265 3300048908 Bacteria 2500
848 Ga0496105_0253745 3300048908 Bacteria 1424
849 Ga0496106_0033973 3300048909 Bacteria 3808
850 Ga0496106_0036797 3300048909 Bacteria 3661
851 Ga0496106_0040570 3300048909 Bacteria 3486
852 Ga0496106_0048199 3300048909 Bacteria 3208
853 Ga0496106_0053752 3300048909 Bacteria 3042
854 Ga0496106_0105527 3300048909 Bacteria 2189
855 Ga0496106_0182253 3300048909 Bacteria 1667
856 Ga0496107_0000300 3300048910 Bacteria 26454
857 Ga0496107_0047573 3300048910 Bacteria 3088
858 Ga0496107_0065343 3300048910 Bacteria 2637
859 Ga0496107_0067202 3300048910 Bacteria 2600
860 Ga0496108_0006949 3300048911 Bacteria 9160
861 Ga0496108_0015017 3300048911 Bacteria 6322
862 Ga0496108_0030325 3300048911 Bacteria 4482
863 Ga0496108_0046616 3300048911 Bacteria 3621
864 Ga0496109_0009186 3300048912 Bacteria 8420
865 Ga0496109_0023916 3300048912 Bacteria 5425
866 Ga0496109_0025177 3300048912 Bacteria 5300
867 Ga0496109_0069613 3300048912 Bacteria 3227
868 Ga0496109_0088299 3300048912 Bacteria 2865
869 Ga0496109_0107416 3300048912 Bacteria 2592
870 Ga0496109_0284291 3300048912 Bacteria 1559
871 Ga0496109_0347249 3300048912 Bacteria 1401
872 Ga0496110_0009460 3300048913 Bacteria 7890
873 Ga0496110_0013063 3300048913 Bacteria 6851
874 Ga0496110_0015814 3300048913 Bacteria 6291
875 Ga0496110_0149331 3300048913 Bacteria 2115
876 Ga0496110_0224759 3300048913 Bacteria 1707
877 Ga0496111_0024976 3300048914 Bacteria 4215
878 Ga0496111_0051839 3300048914 Bacteria 2962
879 Ga0496111_0072298 3300048914 Bacteria 2510
880 Ga0496111_0100894 3300048914 Bacteria 2120
881 Ga0496111_0140494 3300048914 Bacteria 1789
882 Ga0496112_0000047 3300048915 Bacteria 84877
883 Ga0496112_0001203 3300048915 Bacteria 19412
884 Ga0496112_0011435 3300048915 Bacteria 8105
885 Ga0496112_0027237 3300048915 Bacteria 5511
886 Ga0496112_0081132 3300048915 Bacteria 3207
887 Ga0496112_0118235 3300048915 Bacteria 2620
888 Ga0496112_0195046 3300048915 Bacteria 1986
889 Ga0496112_0224043 3300048915 Bacteria 1836
890 Ga0496113_0013276 3300048916 Bacteria 5574
891 Ga0496113_0033443 3300048916 Bacteria 3743
892 Ga0496113_0076980 3300048916 Bacteria 2549
893 Ga0496114_0008007 3300048917 Bacteria 8362
894 Ga0496114_0010725 3300048917 Bacteria 7293
895 Ga0496114_0026876 3300048917 Bacteria 4714
896 Ga0496114_0232008 3300048917 Bacteria 1622
897 Ga0496114_0246563 3300048917 Bacteria 1571
898 Ga0496115_0011637 3300048918 Bacteria 6601
899 Ga0496115_0019731 3300048918 Bacteria 5191
900 Ga0496115_0020196 3300048918 Bacteria 5135
901 Ga0496115_0035322 3300048918 Bacteria 3954
902 Ga0496115_0082567 3300048918 Bacteria 2618
903 Ga0496115_0092281 3300048918 Bacteria 2475
904 Ga0496118_0048772 3300048921 Bacteria 3266
905 Ga0495678_000284 3300049459 Bacteria 55655
906 Ga0495678_001496 3300049459 Bacteria 18211
907 Ga0495678_018701 3300049459 Bacteria 3110
908 Ga0495682_0000278 3300049460 Bacteria 40095
909 Ga0495682_0003215 3300049460 Bacteria 7341
910 Ga0501031_0042271 3300049568 Bacteria 2976
911 Ga0501076_0116829 3300049592 Bacteria 2159
912 Ga0501045_0015280 3300049824 Bacteria 5449
913 nmdc:mga05p37_40884_c1 3300050507 Bacteria 5692
914 nmdc:mga05p37_44122_c1 3300050507 Bacteria 5486
915 nmdc:mga05p37_5445_c1 3300050507 Bacteria 14947
916 nmdc:mga09592_2531_c1 3300050508 Bacteria 14793
917 nmdc:mga0qj67_1916_c1 3300050509 Bacteria 14767
918 nmdc:mga06r32_209314_c1 3300050510 Bacteria 1938
919 nmdc:mga06r32_3051_c1 3300050510 Bacteria 14992
920 nmdc:mga08y16_129662_c1 3300050511 Bacteria 2623
921 nmdc:mga08y16_15510_c1 3300050511 Bacteria 8011
922 nmdc:mga08y16_217059_c1 3300050511 Bacteria 1980
923 nmdc:mga08y16_5774_c1 3300050511 Bacteria 12961
924 nmdc:mga08y16_5884_c1 3300050511 Bacteria 12850
925 nmdc:mga0n895_26546_c1 3300050512 Bacteria 5487
926 nmdc:mga0n895_39124_c1 3300050512 Bacteria 4599
927 nmdc:mga0n895_5597_c1 3300050512 Bacteria 10517
928 nmdc:mga0n895_936_c1 3300050512 Bacteria 21069
929 nmdc:mga0rr50_128802_c1 3300050513 Bacteria 2024
930 nmdc:mga0a205_10752_c1 3300050515 Bacteria 8414
931 nmdc:mga0a205_1376_c1 3300050515 Bacteria 20536
932 Ga0495601_0001219 3300053077 Bacteria 14087
933 Ga0495601_0004122 3300053077 Bacteria 8371
934 Ga0495601_0009272 3300053077 Bacteria 5817
935 Ga0495601_0190541 3300053077 Bacteria 1340
936 Ga0495612_0003481 3300053078 Bacteria 6520
937 Ga0495595_0007040 3300053084 Bacteria 4595
938 Ga0495619_0000764 3300053085 Bacteria 20984
939 Ga0495619_0003959 3300053085 Bacteria 9511
940 Ga0495619_0008427 3300053085 Bacteria 6517
941 Ga0500658_0016514 3300053134 Bacteria 2750
942 Ga0500627_0011052 3300053158 Bacteria 3316
943 Ga0501084_0116283 3300054114 Bacteria 2248
944 2849665960 2849660919 Bacteria 8251853
945 2871501124 2871495908 Bacteria 6935695
946 2878765125 2878760144 Bacteria 6823465
947 2878772308 2878767105 Bacteria 6898628
948 2888354433 2888350351 Bacteria 7372807
949 2903545938 2903540706 Bacteria 7062119
950 2913851821 2913844669 Bacteria 8381711
951 2922130665 2922130491 Bacteria 7173936
952 2937999794 2937994558 Bacteria 7036190
953 2958170259 2958165035 Bacteria 6906348
954 2961168711 2961163497 Bacteria 6901077
955 2965023513 2965018300 Bacteria 6883036
956 2968177123 2968171901 Bacteria 6894245
957 2970559973 2970554993 Bacteria 6814252
958 2979748578 2979742915 Bacteria 7301278
959 2987664742 2987659509 Bacteria 6966464
960 3004172141 3004167301 Bacteria 8330599
961 3004193799 3004188549 Bacteria 6952365
962 8046771384 8046767195 Bacteria 7547379
963 Ga0495585_0008057
964 2214745203
965 ARSoilYngRDRAFT_c00160
966 ARcpr5yngRDRAFT_c000030
967 ARSoilOldRDRAFT_c000033
968 ARCol0oldRDRAFT_c00343
969 ARCol0yngRDRAFT_1000078
970 JGI24752J21851_1002480
971 JGI24738J21930_10006812
972 JGI24749J21850_1002823
973 JGI24744J21845_10002848
974 JGI24033J26618_1000249
975 JGI24742J22300_10001623
976 Ga0055526_1009188
977 Ga0055537_1000439
978 Ga0055534_1000400
979 Ga0055528_1000062
980 JGI25405J52794_10012474
981 Ga0065716_1001573
982 Ga0065704_10076592
983 Ga0065712_10085070
984 Ga0065715_10089287
985 Ga0065715_10115395
986 Ga0065707_10120006
987 Ga0070676_10010247
988 Ga0070683_100059910
989 Ga0070683_100152562
990 Ga0070690_100002486
991 Ga0070690_100025698
992 Ga0070690_100039884
993 Ga0070690_100048172
994 Ga0070690_100078518
995 Ga0070670_100001258
996 Ga0070670_100005543
997 Ga0068869_100004579
998 Ga0070666_10011932
999 Ga0070680_100004377
1000 Ga0070680_100111219
1001 Ga0070682_100003311
1002 Ga0070682_100009952
1003 Ga0068868_100000941
1004 Ga0068868_100062763
1005 Ga0070660_100003480
1006 Ga0070660_100019153
1007 Ga0070660_100033696
1008 Ga0070689_100013020
1009 Ga0070689_100063968
1010 Ga0070691_10001644
1011 Ga0070687_100003077
1012 Ga0070687_100019210
1013 Ga0070687_100019559
1014 Ga0070661_100005996
1015 Ga0070661_100014071
1016 Ga0070668_100006837
1017 Ga0070668_100017843
1018 Ga0070669_100004234
1019 Ga0070675_100004596
1020 Ga0070675_100270948
1021 Ga0070671_100008535
1022 Ga0070671_100018060
1023 Ga0070671_100025267
1024 Ga0070671_100031731
1025 Ga0070671_100054363
1026 Ga0070671_100109271
1027 Ga0070674_100022554
1028 Ga0070674_100205017
1029 Ga0070673_100003318
1030 Ga0070673_100068387
1031 Ga0070673_100212153
1032 Ga0070688_100003893
1033 Ga0070688_100014190
1034 Ga0070659_100011723
1035 Ga0070659_100047438
1036 Ga0070659_100132246
1037 Ga0070667_100022536
1038 Ga0070703_10008204
1039 Ga0070709_10040465
1040 Ga0070714_100070765
1041 Ga0070714_100137161
1042 Ga0070714_100152050
1043 Ga0070714_100182463
1044 Ga0070713_100010279
1045 Ga0070713_100055859
1046 Ga0070713_100078687
1047 Ga0070713_100080122
1048 Ga0070713_100131957
1049 Ga0070710_10026141
1050 Ga0070710_10030270
1051 Ga0070701_10005710
1052 Ga0070711_100033611
1053 Ga0070711_100225677
1054 Ga0070705_100002546
1055 Ga0070700_100006621
1056 Ga0070700_100009050
1057 Ga0070694_100006591
1058 Ga0070694_100030769
1059 Ga0070694_100053651
1060 Ga0070708_100036142
1061 Ga0070708_100049321
1062 Ga0070708_100085736
1063 Ga0070708_100189442
1064 Ga0070663_100008316
1065 Ga0070663_100009057
1066 Ga0070663_100044736
1067 Ga0070663_100186589
1068 Ga0070678_100013314
1069 Ga0070678_100035377
1070 Ga0070678_100104122
1071 Ga0070678_100119356
1072 Ga0070678_100141240
1073 Ga0070662_100000003
1074 Ga0070662_100004119
1075 Ga0070662_100016144
1076 Ga0070662_100057850
1077 Ga0070662_100132739
1078 Ga0070681_10007934
1079 Ga0070681_10080007
1080 Ga0068867_100028777
1081 Ga0068867_100048787
1082 Ga0068867_100064248
1083 Ga0070706_100015126
1084 Ga0070707_100010836
1085 Ga0070707_100029019
1086 Ga0070707_100048259
1087 Ga0070707_100051213
1088 Ga0070707_100129797
1089 Ga0070707_100145525
1090 Ga0070698_100031038
1091 Ga0070698_100058384
1092 Ga0070699_100012259
1093 Ga0070699_100020536
1094 Ga0070699_100070612
1095 Ga0070699_100159274
1096 Ga0070699_100223344
1097 Ga0070679_100023489
1098 Ga0070679_100176014
1099 Ga0070679_100228876
1100 Ga0070684_100009321
1101 Ga0070684_100043936
1102 Ga0070697_100053209
1103 Ga0070697_100070524
1104 Ga0070697_100095898
1105 Ga0070697_100124625
1106 Ga0068853_100032729
1107 Ga0070672_100005958
1108 Ga0070672_100007399
1109 Ga0070672_100074207
1110 Ga0070686_100002567
1111 Ga0070686_100010053
1112 Ga0070686_100045238
1113 Ga0070695_100004686
1114 Ga0070695_100038877
1115 Ga0070696_100020813
1116 Ga0070696_100045885
1117 Ga0070696_100142356
1118 Ga0070696_100173428
1119 Ga0070693_100003704
1120 Ga0070693_100006327
1121 Ga0070665_100069299
1122 Ga0070665_100072058
1123 Ga0070704_100002939
1124 Ga0070704_100131816
1125 Ga0068855_100000288
1126 Ga0068855_100060747
1127 Ga0068855_100210099
1128 Ga0070664_100003754
1129 Ga0070664_100015067
1130 Ga0070664_100042647
1131 Ga0070664_100091649
1132 Ga0070664_100091877
1133 Ga0070664_100132444
1134 Ga0068857_100006093
1135 Ga0068857_100015552
1136 Ga0068854_100002230
1137 Ga0068856_100025283
1138 Ga0068856_100062715
1139 Ga0068856_100230587
1140 Ga0070702_100015554
1141 Ga0068852_100030713
1142 Ga0068852_100035807
1143 Ga0068852_100244602
1144 Ga0068859_100002626
1145 Ga0068859_100005469
1146 Ga0068859_100018036
1147 Ga0068859_100130106
1148 Ga0068864_100000198
1149 Ga0068864_100000892
1150 Ga0068864_100025170
1151 Ga0068864_100045770
1152 Ga0068864_100150266
1153 Ga0068864_100247702
1154 Ga0068864_100249563
1155 Ga0068864_100344121
1156 Ga0068866_10001457
1157 Ga0068861_100012037
1158 Ga0068861_100218861
1159 Ga0068851_10124759
1160 Ga0068870_10002196
1161 Ga0068863_100049203
1162 Ga0068863_100109783
1163 Ga0068863_100151701
1164 Ga0068863_100167211
1165 Ga0068858_100013723
1166 Ga0068858_100085631
1167 Ga0068858_100204847
1168 Ga0068860_100013202
1169 Ga0068860_100026383
1170 Ga0068860_100048378
1171 Ga0068860_100051573
1172 Ga0068860_100060157
1173 Ga0068860_100072012
1174 Ga0068860_100100056
1175 Ga0068860_100150545
1176 Ga0068862_100049583
1177 Ga0068862_100051740
1178 Ga0068862_100115660
1179 Ga0081455_10000053
1180 Ga0081540_1000266
1181 Ga0081540_1000743
1182 Ga0081540_1002298
1183 Ga0081540_1003173
1184 Ga0081540_1021705
1185 Ga0081539_10052853
1186 Ga0070717_10005668
1187 Ga0070717_10029651
1188 Ga0070717_10041692
1189 Ga0070715_10000026
1190 Ga0070716_100108588
1191 Ga0070712_100018949
1192 Ga0070712_100038353
1193 Ga0075427_10000222
1194 Ga0097621_100006211
1195 Ga0097621_100024131
1196 Ga0068871_100009850
1197 Ga0068871_100068529
1198 Ga0075428_100186161
1199 Ga0075431_100019533
1200 Ga0075433_10009110
1201 Ga0075433_10028953
1202 Ga0075433_10029323
1203 Ga0075434_100000694
1204 Ga0075434_100016384
1205 Ga0075434_100018256
1206 Ga0075434_100039880
1207 Ga0075429_100009653
1208 Ga0068865_100004789
1209 Ga0068865_100016439
1210 Ga0068865_100030975
1211 Ga0068865_100165891
1212 Ga0097620_100002626
1213 Ga0097620_100005469
1214 Ga0097620_100018036
1215 Ga0097620_100130117
1216 Ga0105240_10000091
1217 Ga0105240_10000208
1218 Ga0105240_10066680
1219 Ga0111539_10006123
1220 Ga0111539_10015008
1221 Ga0111539_10085103
1222 Ga0111539_10153510
1223 Ga0111539_10193205
1224 Ga0105245_10002193
1225 Ga0105245_10033418
1226 Ga0105245_10099219
1227 Ga0105247_10065658
1228 Ga0114129_10085704
1229 Ga0114129_10099078
1230 Ga0114129_10148684
1231 Ga0105243_10006356
1232 Ga0105243_10011002
1233 Ga0105241_10045004
1234 Ga0105241_10056248
1235 Ga0105242_10014836
1236 Ga0105242_10033814
1237 Ga0105242_10069800
1238 Ga0105242_10111476
1239 Ga0105248_10013878
1240 Ga0105248_10040509
1241 Ga0105248_10048980
1242 Ga0105248_10137409
1243 Ga0105248_10151409
1244 Ga0105248_10246529
1245 Ga0105238_10393488
1246 Ga0105249_10007344
1247 Ga0105249_10019581
1248 Ga0105249_10101183
1249 Ga0105239_10002058
1250 Ga0105239_10025305
1251 Ga0105239_10038188
1252 Ga0105239_10098985
1253 Ga0105239_10186731
1254 Ga0105246_10062460
1255 Ga0105246_10144869
1256 Ga0157342_1001450
1257 Ga0157338_1000062
1258 Ga0157370_10104626
1259 Ga0157369_10030109
1260 Ga0157369_10160722
1261 Ga0157374_10003055
1262 Ga0157374_10005126
1263 Ga0157374_10031326
1264 Ga0157374_10322621
1265 Ga0157378_10015420
1266 Ga0157378_10029707
1267 Ga0157378_10088003
1268 Ga0163162_10038671
1269 Ga0163162_10075204
1270 Ga0163162_10076179
1271 Ga0163162_10129132
1272 Ga0157372_10019331
1273 Ga0157372_10407493
1274 Ga0157375_10014740
1275 Ga0157375_10045525
1276 Ga0157375_10058435
1277 Ga0157375_10111292
1278 Ga0157375_10254207
1279 Ga0157375_10254263
1280 Ga0157375_10384113
1281 Ga0163163_10061653
1282 Ga0163163_10098026
1283 Ga0163163_10137949
1284 Ga0163163_10262233
1285 Ga0157380_10023078
1286 Ga0157377_10005921
1287 Ga0157379_10012849
1288 Ga0157379_10015522
1289 Ga0157379_10015909
1290 Ga0157379_10032414
1291 Ga0157379_10099401
1292 Ga0157376_10032791
1293 Ga0157376_10080887
1294 Ga0157376_10089735
1295 Ga0157376_10152433
1296 Ga0157376_10170733
1297 Ga0163161_10027103
1298 Ga0163161_10198901
1299 Ga0213872_10000078
1300 Ga0209565_1000167
1301 Ga0207666_1000121
1302 Ga0209673_1000051
1303 Ga0207673_1000199
1304 Ga0209675_1000027
1305 Ga0209564_1000897
1306 Ga0209256_1000265
1307 Ga0207697_10004636
1308 Ga0207697_10012779
1309 Ga0207656_10096309
1310 Ga0207653_10008878
1311 Ga0207682_10010711
1312 Ga0207692_10007099
1313 Ga0207692_10011983
1314 Ga0207692_10036932
1315 Ga0207642_10022378
1316 Ga0207710_10007880
1317 Ga0207710_10025060
1318 Ga0207688_10001502
1319 Ga0207680_10040697
1320 Ga0207680_10071823
1321 Ga0207680_10187650
1322 Ga0207647_10000049
1323 Ga0207647_10002513
1324 Ga0207685_10000009
1325 Ga0207699_10044934
1326 Ga0207699_10081042
1327 Ga0207645_10003686
1328 Ga0207643_10000170
1329 Ga0207684_10001521
1330 Ga0207654_10094257
1331 Ga0207654_10121311
1332 Ga0207707_10006812
1333 Ga0207707_10063119
1334 Ga0207695_10000018
1335 Ga0207695_10098679
1336 Ga0207695_10201253
1337 Ga0207695_10223772
1338 Ga0207693_10003442
1339 Ga0207693_10014217
1340 Ga0207693_10065734
1341 Ga0207693_10105547
1342 Ga0207663_10031299
1343 Ga0207660_10022481
1344 Ga0207662_10007466
1345 Ga0207662_10129503
1346 Ga0207657_10007036
1347 Ga0207657_10007416
1348 Ga0207657_10044583
1349 Ga0207649_10001009
1350 Ga0207652_10049393
1351 Ga0207652_10254518
1352 Ga0207646_10003821
1353 Ga0207646_10011237
1354 Ga0207646_10031775
1355 Ga0207681_10053519
1356 Ga0207681_10175905
1357 Ga0207650_10007451
1358 Ga0207659_10162803
1359 Ga0207687_10000941
1360 Ga0207687_10021029
1361 Ga0207687_10050893
1362 Ga0207700_10005756
1363 Ga0207700_10009622
1364 Ga0207664_10015029
1365 Ga0207664_10045233
1366 Ga0207664_10057700
1367 Ga0207664_10176051
1368 Ga0207664_10213840
1369 Ga0207644_10007715
1370 Ga0207644_10055879
1371 Ga0207644_10058880
1372 Ga0207644_10068961
1373 Ga0207644_10083261
1374 Ga0207644_10094153
1375 Ga0207644_10111355
1376 Ga0207644_10116480
1377 Ga0207690_10004445
1378 Ga0207690_10202566
1379 Ga0207706_10000111
1380 Ga0207706_10018959
1381 Ga0207706_10025115
1382 Ga0207706_10037211
1383 Ga0207706_10054953
1384 Ga0207706_10077028
1385 Ga0207706_10082759
1386 Ga0207686_10019407
1387 Ga0207686_10024867
1388 Ga0207686_10136509
1389 Ga0207709_10005222
1390 Ga0207709_10022544
1391 Ga0207709_10066077
1392 Ga0207670_10049133
1393 Ga0207669_10025866
1394 Ga0207669_10037873
1395 Ga0207704_10033631
1396 Ga0207665_10005232
1397 Ga0207665_10006610
1398 Ga0207665_10008176
1399 Ga0207665_10023526
1400 Ga0207665_10028191
1401 Ga0207691_10006198
1402 Ga0207691_10006422
1403 Ga0207691_10008613
1404 Ga0207691_10106179
1405 Ga0207711_10006243
1406 Ga0207711_10022156
1407 Ga0207711_10034111
1408 Ga0207711_10043350
1409 Ga0207711_10050148
1410 Ga0207711_10087642
1411 Ga0207711_10089562
1412 Ga0207711_10103432
1413 Ga0207711_10197682
1414 Ga0207689_10005901
1415 Ga0207689_10008098
1416 Ga0207689_10025089
1417 Ga0207661_10000500
1418 Ga0207661_10043789
1419 Ga0207679_10000073
1420 Ga0207679_10023752
1421 Ga0207667_10000234
1422 Ga0207667_10148060
1423 Ga0207712_10003735
1424 Ga0207712_10023192
1425 Ga0207712_10041025
1426 Ga0207712_10077652
1427 Ga0207668_10007786
1428 Ga0207668_10083077
1429 Ga0207658_10154643
1430 Ga0207677_10010220
1431 Ga0207677_10085618
1432 Ga0207703_10001970
1433 Ga0207703_10019848
1434 Ga0207703_10029178
1435 Ga0207703_10058776
1436 Ga0207703_10114734
1437 Ga0207703_10159136
1438 Ga0207703_10184538
1439 Ga0207639_10021608
1440 Ga0207639_10091419
1441 Ga0207678_10006861
1442 Ga0207678_10012045
1443 Ga0207678_10028319
1444 Ga0207678_10045247
1445 Ga0207678_10071631
1446 Ga0207708_10005825
1447 Ga0207708_10026987
1448 Ga0207708_10054687
1449 Ga0207702_10037313
1450 Ga0207702_10096581
1451 Ga0207702_10170059
1452 Ga0207641_10007312
1453 Ga0207641_10013057
1454 Ga0207641_10180303
1455 Ga0207641_10225813
1456 Ga0207648_10023509
1457 Ga0207648_10030417
1458 Ga0207648_10031345
1459 Ga0207648_10087929
1460 Ga0207676_10000996
1461 Ga0207676_10006169
1462 Ga0207676_10006739
1463 Ga0207676_10064163
1464 Ga0207674_10001648
1465 Ga0207674_10003682
1466 Ga0207675_100005605
1467 Ga0207675_100096502
1468 Ga0207683_10009988
1469 Ga0207683_10024313
1470 Ga0207683_10026381
1471 Ga0207683_10097314
1472 Ga0207683_10229223
1473 Ga0207698_10015454
1474 Ga0207698_10043979
1475 Ga0207698_10192950
1476 Ga0207698_10249944
1477 Ga0210002_1000584
1478 Ga0209974_10002790
1479 Ga0207428_10001104
1480 Ga0207428_10004390
1481 Ga0207428_10004461
1482 Ga0207428_10072519
1483 Ga0268266_10022307
1484 Ga0268266_10064207
1485 Ga0268266_10064832
1486 Ga0268266_10070266
1487 Ga0268265_10012161
1488 Ga0268265_10111947
1489 Ga0268264_10020450
1490 Ga0268264_10031800
1491 Ga0268264_10033842
1492 Ga0268264_10040688
1493 Ga0268264_10106425
1494 Ga0307513_10048341
1495 Ga0307408_100031441
1496 Ga0307408_100035958
1497 Ga0307508_10005636
1498 Ga0307405_10001068
1499 Ga0307410_10000446
1500 Ga0307410_10001648
1501 Ga0307406_10015807
1502 Ga0307407_10001157
1503 Ga0307407_10012880
1504 Ga0307409_100006279
1505 Ga0307409_100058965
1506 Ga0307416_100023019
1507 Ga0307411_10005785
1508 Ga0307411_10042197
1509 Ga0307415_100000950
1510 Ga0373930_0000685
1511 Ga0373948_0000760
1512 Ga0373950_0001042
1513 Ga0373950_0006897
1514 Ga0373958_0002479
1515 Ga0373959_0000435
1516 Ga0373938_0006949
1517 Ga0373928_0000247
1518 Ga0373929_0000208
1519 Ga0373929_0003744
1520 Ga0373934_0002824
1521 Ga0373940_0000026
1522 Ga0373940_0029554
1523 Ga0373944_0000854
1524 Ga0373949_0002963
1525 Ga0373949_0006846
1526 Ga0373949_0019756
1527 Ga0373951_0000727
1528 Ga0373951_0006612
1529 Ga0373932_0000407
1530 Ga0373932_0012360
1531 Ga0373939_0005792
1532 Ga0373941_0001353
1533 Ga0373941_0003182
1534 Ga0373941_0032612
1535 Ga0373945_0016257
1536 Ga0373953_0001046
1537 Ga0373956_0015094
1538 Ga0373960_0002714
1539 Ga0373960_0037968
1540 Ga0373943_0019324
1541 Ga0373943_0051482
1542 Ga0373946_0017459
1543 Ga0373946_0018549
1544 Ga0373942_0000429
1545 Ga0373942_0029592
1546 Ga0373961_0005044
1547 Ga0373962_0005545
1548 Ga0373962_0007708
1549 Ga0373962_0008860
1550 Ga0373924_0008318
1551 Ga0373931_0003387
1552 Ga0373931_0005919
1553 Ga0373931_0041276
1554 Ga0373935_0023535
1555 Ga0373935_0061444
1556 Ga0373927_0017392
1557 Ga0373927_0048642
1558 Ga0373927_0147030
1559 Ga0373933_0004772
1560 Ga0373947_0018999
1561 Ga0373947_0022156
1562 Ga0373947_0039961
1563 Ga0373947_0054287
1564 Ga0373947_0057122
1565 Ga0373937_0018743
1566 Ga0373937_0060907
1567 Ga0373937_0065911
1568 Ga0373925_0007679
1569 Ga0373925_0019209
1570 Ga0373925_0021141
1571 Ga0373925_0053112
1572 Ga0373925_0116721
1573 Ga0395899_0001097
1574 Ga0395899_0020924
1575 Ga0395900_0007849
1576 Ga0395900_0056020
1577 Ga0395900_0077719
1578 Ga0395900_0104191
1579 Ga0395900_0359396
1580 Ga0395898_0010657
1581 Ga0395898_0010839
1582 Ga0395898_0062096
1583 Ga0395898_0083951
1584 Ga0395898_0100971
1585 Ga0395898_0190441
1586 Ga0395905_0005914
1587 Ga0395905_0007758
1588 Ga0395905_0027153
1589 Ga0395905_0084686
1590 Ga0395901_0005743
1591 Ga0395901_0009184
1592 Ga0395901_0016278
1593 Ga0395901_0026461
1594 Ga0395901_0115186
1595 Ga0395901_0141659
1596 Ga0436361_0081046
1597 Ga0436361_0173984
1598 Ga0436361_0775201
1599 Ga0436363_0000250
1600 Ga0436363_0520749
1601 Ga0451577_0010773
1602 Ga0451577_0013515
1603 Ga0453683_0004980
1604 Ga0453683_0108698
1605 Ga0453684_0016151
1606 Ga0453684_0121764
1607 Ga0466957_0003343
1608 Ga0451576_0007618
1609 Ga0451576_0075803
1610 Ga0451576_0169680
1611 Ga0495617_000387
1612 Ga0495617_002096
1613 Ga0495617_003252
1614 Ga0495592_0010172
1615 Ga0495592_0111618
1616 Ga0495603_0016118
1617 Ga0495603_0054930
1618 Ga0495603_0061459
1619 Ga0495590_0003942
1620 Ga0495590_0010756
1621 Ga0495629_0010654
1622 Ga0495629_0044719
1623 Ga0495629_0063398
1624 Ga0495638_0000520
1625 Ga0495638_0010656
1626 Ga0495641_0045665
1627 Ga0495653_0022255
1628 Ga0495580_0048323
1629 Ga0495580_0099343
1630 Ga0495580_0127320
1631 Ga0495582_0002101
1632 Ga0495582_0008520
1633 Ga0495582_0020177
1634 Ga0495605_0004646
1635 Ga0495605_0008241
1636 Ga0495639_0008880
1637 Ga0495639_0026761
1638 Ga0495662_0000090
1639 Ga0495664_0000146
1640 Ga0495664_0049659
1641 Ga0495584_0000005
1642 Ga0495584_0000144
1643 Ga0495584_0000148
1644 Ga0495584_0045902
1645 Ga0495584_0052096
1646 Ga0495584_0073080
1647 Ga0495585_0000023
1648 Ga0495585_0003154
1649 Ga0495585_0007462
1650 Ga0495585_0045048
1651 Ga0495585_0062442
1652 Ga0495594_0013321
1653 Ga0495596_0005603
1654 Ga0495607_0003127
1655 Ga0495607_0009303
1656 Ga0495607_0013889
1657 Ga0495607_0048423
1658 Ga0495607_0106628
1659 Ga0495583_0000045
1660 Ga0495583_0009632
1661 Ga0495583_0032541
1662 Ga0495606_0010259
1663 Ga0495606_0013445
1664 Ga0495608_0001166
1665 Ga0495616_0003950
1666 Ga0495616_0007571
1667 Ga0495616_0019134
1668 Ga0495616_0100117
1669 Ga0495618_0014081
1670 Ga0495618_0014685
1671 Ga0495618_0041634
1672 Ga0495618_0171775
1673 Ga0495620_0001243
1674 Ga0495630_0021724
1675 Ga0495630_0022831
1676 Ga0495644_0004742
1677 Ga0495648_0000048
1678 Ga0495648_0000326
1679 Ga0495648_0014256
1680 Ga0495648_0119131
1681 Ga0495642_0004115
1682 Ga0495652_0013906
1683 Ga0495652_0026750
1684 Ga0495652_0037469
1685 Ga0495652_0070602
1686 Ga0495665_0013021
1687 Ga0495640_0000406
1688 Ga0495640_0010615
1689 Ga0495640_0021298
1690 Ga0495586_0037773
1691 Ga0495586_0042660
1692 Ga0495587_0001403
1693 Ga0495587_0062851
1694 Ga0495609_0000889
1695 Ga0495609_0003207
1696 Ga0495609_0004379
1697 Ga0495597_0000307
1698 Ga0495645_0047921
1699 Ga0495645_0057222
1700 Ga0495645_0111205
1701 Ga0495622_0000009
1702 Ga0495633_0000464
1703 Ga0495633_0000963
1704 Ga0495633_0004728
1705 Ga0495633_0029268
1706 Ga0495667_0025132
1707 Ga0495656_0000722
1708 Ga0495668_0000020
1709 Ga0495668_0004123
1710 Ga0495668_0018680
1711 Ga0495634_0022115
1712 Ga0495634_0040746
1713 Ga0495634_0071492
1714 Ga0495611_0003431
1715 Ga0495611_0011354
1716 Ga0495611_0043040
1717 Ga0495625_0009047
1718 Ga0495625_0026987
1719 Ga0495625_0033048
1720 Ga0495635_0002945
1721 Ga0495635_0025247
1722 Ga0495659_0000339
1723 Ga0495659_0003958
1724 Ga0495661_0141273
1725 Ga0495657_0008402
1726 Ga0495599_0014730
1727 Ga0495623_0025889
1728 Ga0495646_0021835
1729 Ga0495647_0022374
1730 Ga0495658_0000912
1731 Ga0495658_0007426
1732 Ga0495669_0002490
1733 Ga0495624_0021798
1734 Ga0495624_0093692
1735 Ga0495670_0000472
1736 Ga0495670_0001538
1737 Ga0495670_0004164
1738 Ga0495671_0010860
1739 Ga0495671_0016052
1740 Ga0495589_0000157
1741 Ga0495589_0042264
1742 Ga0495600_0001461
1743 Ga0495660_0042821
1744 Ga0495581_0017357
1745 Ga0495581_0038854
1746 Ga0495604_0004956
1747 Ga0495636_0007652
1748 Ga0495674_0009409
1749 Ga0495674_0010462
1750 Ga0495674_0062895
1751 Ga0495672_0001035
1752 Ga0495672_0002045
1753 Ga0495680_0028268
1754 Ga0495680_0065554
1755 Ga0495680_0194445
1756 Ga0495683_0000036
1757 Ga0495683_0000932
1758 Ga0495683_0007648
1759 Ga0495683_0071460
1760 Ga0495687_000096
1761 Ga0495687_002087
1762 Ga0495679_034243
1763 Ga0495685_000045
1764 Ga0495673_0016550
1765 Ga0495681_0004963
1766 Ga0495684_0009890
1767 Ga0495684_0065158
1768 Ga0495684_0106746
1769 Ga0495686_0001027
1770 Ga0495593_0004230
1771 Ga0495593_0012333
1772 Ga0495593_0037002
1773 Ga0495602_0018615
1774 Ga0495614_0001497
1775 Ga0495626_0004606
1776 Ga0496100_0010418
1777 Ga0496100_0015038
1778 Ga0496100_0074153
1779 Ga0496100_0092437
1780 Ga0496101_0001838
1781 Ga0496101_0004943
1782 Ga0496101_0076559
1783 Ga0496101_0097236
1784 Ga0496101_0121627
1785 Ga0496101_0169190
1786 Ga0496102_0006490
1787 Ga0496102_0020550
1788 Ga0496102_0028967
1789 Ga0496102_0048548
1790 Ga0496102_0071171
1791 Ga0496102_0079041
1792 Ga0496102_0105587
1793 Ga0496102_0143981
1794 Ga0496103_0011391
1795 Ga0496103_0021882
1796 Ga0496103_0030107
1797 Ga0496103_0123420
1798 Ga0496104_0006743
1799 Ga0496104_0013113
1800 Ga0496104_0023987
1801 Ga0496104_0041444
1802 Ga0496104_0070144
1803 Ga0496104_0316014
1804 Ga0496105_0006930
1805 Ga0496105_0031733
1806 Ga0496105_0041364
1807 Ga0496105_0062484
1808 Ga0496105_0088924
1809 Ga0496105_0092265
1810 Ga0496105_0253745
1811 Ga0496106_0033973
1812 Ga0496106_0036797
1813 Ga0496106_0040570
1814 Ga0496106_0048199
1815 Ga0496106_0053752
1816 Ga0496106_0105527
1817 Ga0496106_0182253
1818 Ga0496107_0000300
1819 Ga0496107_0047573
1820 Ga0496107_0065343
1821 Ga0496107_0067202
1822 Ga0496108_0006949
1823 Ga0496108_0015017
1824 Ga0496108_0030325
1825 Ga0496108_0046616
1826 Ga0496109_0009186
1827 Ga0496109_0023916
1828 Ga0496109_0025177
1829 Ga0496109_0069613
1830 Ga0496109_0088299
1831 Ga0496109_0107416
1832 Ga0496109_0284291
1833 Ga0496109_0347249
1834 Ga0496110_0009460
1835 Ga0496110_0013063
1836 Ga0496110_0015814
1837 Ga0496110_0149331
1838 Ga0496110_0224759
1839 Ga0496111_0024976
1840 Ga0496111_0051839
1841 Ga0496111_0072298
1842 Ga0496111_0100894
1843 Ga0496111_0140494
1844 Ga0496112_0000047
1845 Ga0496112_0001203
1846 Ga0496112_0011435
1847 Ga0496112_0027237
1848 Ga0496112_0081132
1849 Ga0496112_0118235
1850 Ga0496112_0195046
1851 Ga0496112_0224043
1852 Ga0496113_0013276
1853 Ga0496113_0033443
1854 Ga0496113_0076980
1855 Ga0496114_0008007
1856 Ga0496114_0010725
1857 Ga0496114_0026876
1858 Ga0496114_0232008
1859 Ga0496114_0246563
1860 Ga0496115_0011637
1861 Ga0496115_0019731
1862 Ga0496115_0020196
1863 Ga0496115_0035322
1864 Ga0496115_0082567
1865 Ga0496115_0092281
1866 Ga0496118_0048772
1867 Ga0495678_000284
1868 Ga0495678_001496
1869 Ga0495678_018701
1870 Ga0495682_0000278
1871 Ga0495682_0003215
1872 Ga0501031_0042271
1873 Ga0501076_0116829
1874 Ga0501045_0015280
1875 nmdc:mga05p37_40884_c1
1876 nmdc:mga05p37_44122_c1
1877 nmdc:mga05p37_5445_c1
1878 nmdc:mga09592_2531_c1
1879 nmdc:mga0qj67_1916_c1
1880 nmdc:mga06r32_209314_c1
1881 nmdc:mga06r32_3051_c1
1882 nmdc:mga08y16_129662_c1
1883 nmdc:mga08y16_15510_c1
1884 nmdc:mga08y16_217059_c1
1885 nmdc:mga08y16_5774_c1
1886 nmdc:mga08y16_5884_c1
1887 nmdc:mga0n895_26546_c1
1888 nmdc:mga0n895_39124_c1
1889 nmdc:mga0n895_5597_c1
1890 nmdc:mga0n895_936_c1
1891 nmdc:mga0rr50_128802_c1
1892 nmdc:mga0a205_10752_c1
1893 nmdc:mga0a205_1376_c1
1894 Ga0495601_0001219
1895 Ga0495601_0004122
1896 Ga0495601_0009272
1897 Ga0495601_0190541
1898 Ga0495612_0003481
1899 Ga0495595_0007040
1900 Ga0495619_0000764
1901 Ga0495619_0003959
1902 Ga0495619_0008427
1903 Ga0500658_0016514
1904 Ga0500627_0011052
1905 Ga0501084_0116283
1906 2849665960
1907 2871501124
1908 2878765125
1909 2878772308
1910 2888354433
1911 2903545938
1912 2913851821
1913 2922130665
1914 2937999794
1915 2958170259
1916 2961168711
1917 2965023513
1918 2968177123
1919 2970559973
1920 2979748578
1921 2987664742
1922 3004172141
1923 3004193799
1924 8046771384

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06441

EHN

Epoxide hydrolase N terminus

98

203

0.97

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

188

313

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qa9-assembly1.cif.gz_A ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. 0.9074 42 437
4qa9-assembly1.cif.gz_A ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. 0.9006 42 437
3g0i-assembly1.cif.gz_B complex of aspergillus niger epoxide hydrolase with valpromide (2-propylpentanamide) 0.8943 44 435
3g02-assembly1.cif.gz_A structure of enantioselective mutant of epoxide hydrolase from aspergillus niger generated by directed evolution 0.8931 44 435
5f4z-assembly3.cif.gz_E the crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus 0.8853 46 437
ID Description Score Start End Superfamily
4qa9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9074 42 437 3.40.50.1820
4qa9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9006 42 437 3.40.50.1820
3g02B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8841 36 435 3.40.50.1820
af_Q9D379_48_454_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8772 46 437 3.40.50.1820
4qlaB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8713 42 437 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A538L1P0-F1-model_v4 Epoxide hydrolase 1 0.984 43 242 GO:0004301
GO:0009056
GO:0097176
AF-A0A3N5MXB2-F1-model_v4 Epoxide hydrolase 0.9728 224 436 GO:0004301
GO:0097176
AF-A0A7X3R243-F1-model_v4 Epoxide hydrolase 0.9676 45 225 GO:0004301
GO:0009056
GO:0097176
AF-A0A381ZZR1-F1-model_v4 Epoxide hydrolase N-terminal domain-containing protein 0.9656 43 240 GO:0004301
GO:0009056
GO:0097176
AF-A0A1B1JZI0-F1-model_v4 Epoxide hydrolase 0.9656 45 218 GO:0004301
GO:0009056
GO:0097176

Map