F486903

General Info

Members Datasets Scaffolds Average Seq Length
962 496 1924 498

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221699|2644547923
Length 572
Sequence PXILSVVTFLPLVGAGLILLARLFNKGSADGAARWIALITTVAVLAVSAVLVMQFKPELATYQFVERYDWFAAAQYHMGVDGISILFVLLTAFLMPICIVASWXTIXXRVVDYMIAFLVLETLVIGVFTSLDLXXFYIFFEGTLVPMFIIIGVWGGANRIYASYKFFLYTLLGSVLMLLAMLWISVLMLLAMLWIEHFLVLETLVIGVFTSLDLFLFYIFFEGTLVPMFIIIGVWGGANRIYASYKFFLYTLLGSVLMLLAMLWMAAETGTTSIPALKDYAFSPTVQPLLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGILLKLGGYGFILFNLPMFPAASKMFAPLVFVLSAVAIVYTSLVAFRQTDMKKLIAYSSVAHMGFVTMGIFAGNALGVQGAVFQMLSHGLISGALFLCVGVVYDRMHTREIALYGGLTARMPWFAAIFLLFTMANVGLPGTSGFIGEILTMTGVYGVSTWTALFAATGVIFSAVYALTLYRNVMFGEITNPAMKAITDVDRRELLIFVPLIIGTLWLGVQPGLVLDYTAASVEALTSAFQLAIGG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
213 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
255 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
334 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
335 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
336 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
337 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
338 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
339 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
340 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
341 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
342 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
343 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
344 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
345 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
346 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
347 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
352 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
353 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
354 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
355 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
356 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
359 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
360 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
361 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
366 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
367 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
368 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
369 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
370 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
371 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
372 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
373 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
374 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
375 2547132512 Azospira oryzae 6a3 Isolate Unclassified
376 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
377 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
378 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
379 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
380 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
381 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
382 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
383 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
384 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
385 2643221583 Caulobacter sp. Root655 Isolate Unclassified
386 2643221584 Caulobacter sp. Root656 Isolate Unclassified
387 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
388 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
389 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
390 2643221640 Caulobacter sp. Root342 Isolate Unclassified
391 2643221642 Caulobacter sp. Root343 Isolate Unclassified
392 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
393 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
394 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
395 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
396 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
397 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
398 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
399 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
400 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
401 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
402 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
403 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
404 2818991435 Caulobacter henricii 536 Isolate Unclassified
405 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
406 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
407 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
408 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
409 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
410 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
411 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
412 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
413 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
414 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
415 2842694124 Methylopila sp. R-72369 Isolate Unclassified
416 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
417 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
418 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
419 2849560528 Caulobacter zeae 410 Isolate Unclassified
420 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
421 2851153111 Caulobacter radicis 736 Isolate Unclassified
422 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
423 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
424 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
425 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
426 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
427 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
428 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
429 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
430 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
431 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
432 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
433 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
434 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
435 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
436 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
437 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
438 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
439 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
440 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
441 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
442 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
443 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
444 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
445 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
446 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
447 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
448 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
449 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
450 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
451 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
452 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
453 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
454 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
455 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
456 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
457 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
458 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
459 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
460 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
461 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
462 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
463 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
464 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
465 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
466 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
467 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
468 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
469 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
470 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
471 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
472 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
473 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
474 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
475 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
476 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
477 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
478 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
479 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
480 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
481 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
482 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
483 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
484 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
485 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
486 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
487 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
488 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
489 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
490 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
491 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
492 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
493 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
494 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
495 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
496 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.28
Metatranscriptomes 0.1
Isolates 13.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.24
Nodule 5.82
Rhizoplane 4.05
Rhizosphere 65.18
Stem 0
Stem Tuber 0.1
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000469 3300001904 Bacteria 7572
2 JGI24740J21852_10002149 3300001979 Bacteria 9011
3 JGI24740J21852_10011083 3300001979 Bacteria 3444
4 JGI24735J21928_10001159 3300002067 Bacteria 9419
5 JGI24735J21928_10001163 3300002067 Bacteria 9410
6 JGI24738J21930_10003997 3300002075 Bacteria 3661
7 JGI25157J39369_1000707 3300002741 Bacteria 17999
8 Ga0055537_1005923 3300003773 Bacteria 3193
9 Ga0055536_1005242 3300003781 Bacteria 6390
10 Ga0055536_1005282 3300003781 Bacteria 6360
11 Ga0055536_1008966 3300003781 Bacteria 4214
12 Ga0055528_1005371 3300003790 Bacteria 5980
13 Ga0055530_10000647 3300003791 Bacteria 29932
14 Ga0055530_10001148 3300003791 Bacteria 20593
15 Ga0055530_10006282 3300003791 Bacteria 5346
16 Ga0055530_10011836 3300003791 Bacteria 3096
17 Ga0055531_10003600 3300003794 Bacteria 9796
18 Ga0055531_10008745 3300003794 Bacteria 5283
19 Ga0055531_10014013 3300003794 Bacteria 3647
20 Ga0065165_1000845 3300005262 Bacteria 40173
21 Ga0065165_1003786 3300005262 Bacteria 10124
22 Ga0065165_1005117 3300005262 Bacteria 7595
23 Ga0065704_10070237 3300005289 Bacteria 52535
24 Ga0065707_10000608 3300005295 Bacteria 19207
25 Ga0070658_10000125 3300005327 Bacteria 68211
26 Ga0070658_10013254 3300005327 Bacteria 6613
27 Ga0070658_10083602 3300005327 Bacteria 2624
28 Ga0070658_10093326 3300005327 Bacteria 2482
29 Ga0070658_10172058 3300005327 Bacteria 1820
30 Ga0070683_100019454 3300005329 Bacteria 6031
31 Ga0070670_100000037 3300005331 Bacteria 156070
32 Ga0070677_10000656 3300005333 Bacteria 11544
33 Ga0070680_100002884 3300005336 Bacteria 12785
34 Ga0070680_100003695 3300005336 Bacteria 11429
35 Ga0070680_100029645 3300005336 Bacteria 4394
36 Ga0070680_100030844 3300005336 Bacteria 4307
37 Ga0070680_100072505 3300005336 Bacteria 2830
38 Ga0070680_100102079 3300005336 Bacteria 2381
39 Ga0070682_100012466 3300005337 Bacteria 4877
40 Ga0068868_100000001 3300005338 Bacteria 282170
41 Ga0070660_100003034 3300005339 Bacteria 11561
42 Ga0070660_100005715 3300005339 Bacteria 8612
43 Ga0070660_100028150 3300005339 Bacteria 4202
44 Ga0070660_100114842 3300005339 Bacteria 2145
45 Ga0070689_100072270 3300005340 Bacteria 2696
46 Ga0070691_10002895 3300005341 Bacteria 7695
47 Ga0070691_10019229 3300005341 Bacteria 3150
48 Ga0070691_10026589 3300005341 Bacteria 2698
49 Ga0070661_100014744 3300005344 Bacteria 5512
50 Ga0070661_100026358 3300005344 Bacteria 4180
51 Ga0070668_100000018 3300005347 Bacteria 99142
52 Ga0070668_100002188 3300005347 Bacteria 14336
53 Ga0070668_100074951 3300005347 Bacteria 2641
54 Ga0070669_100000329 3300005353 Bacteria 36963
55 Ga0070669_100023151 3300005353 Bacteria 4446
56 Ga0070675_100127929 3300005354 Bacteria 2163
57 Ga0070671_100001250 3300005355 Bacteria 19045
58 Ga0070671_100024938 3300005355 Bacteria 4900
59 Ga0070671_100026330 3300005355 Bacteria 4779
60 Ga0070659_100000001 3300005366 Bacteria 576390
61 Ga0070659_100026185 3300005366 Bacteria 4486
62 Ga0070659_100067276 3300005366 Bacteria 2841
63 Ga0070659_100096585 3300005366 Bacteria 2374
64 Ga0070659_100104104 3300005366 Bacteria 2286
65 Ga0070667_100000083 3300005367 Bacteria 118261
66 Ga0070667_100010505 3300005367 Bacteria 7646
67 Ga0070714_100016732 3300005435 Bacteria 5929
68 Ga0070713_100001498 3300005436 Bacteria 14893
69 Ga0070705_100041450 3300005440 Bacteria 2625
70 Ga0070663_100000958 3300005455 Bacteria 15673
71 Ga0070663_100001663 3300005455 Bacteria 12303
72 Ga0070663_100008703 3300005455 Bacteria 6257
73 Ga0070663_100018515 3300005455 Bacteria 4569
74 Ga0070663_100032434 3300005455 Bacteria 3600
75 Ga0070681_10020073 3300005458 Bacteria 6696
76 Ga0070681_10032415 3300005458 Bacteria 5244
77 Ga0070681_10227695 3300005458 Bacteria 1779
78 Ga0070679_100005502 3300005530 Bacteria 11741
79 Ga0070679_100006911 3300005530 Bacteria 10585
80 Ga0070679_100022016 3300005530 Bacteria 6226
81 Ga0070679_100050766 3300005530 Bacteria 4131
82 Ga0070679_100063706 3300005530 Bacteria 3675
83 Ga0070684_100002726 3300005535 Bacteria 13054
84 Ga0068853_100005921 3300005539 Bacteria 9651
85 Ga0068853_100010858 3300005539 Bacteria 7379
86 Ga0068853_100015961 3300005539 Bacteria 6174
87 Ga0068853_100022761 3300005539 Bacteria 5237
88 Ga0068853_100025697 3300005539 Bacteria 4942
89 Ga0068853_100081486 3300005539 Bacteria 2834
90 Ga0068853_100127855 3300005539 Bacteria 2271
91 Ga0070686_100000597 3300005544 Bacteria 21352
92 Ga0070695_100032791 3300005545 Bacteria 3247
93 Ga0070665_100000116 3300005548 Bacteria 150141
94 Ga0070665_100000334 3300005548 Bacteria 72297
95 Ga0070665_100000883 3300005548 Bacteria 38439
96 Ga0070665_100005159 3300005548 Bacteria 13516
97 Ga0070704_100025527 3300005549 Bacteria 3892
98 Ga0068855_100031052 3300005563 Bacteria 6383
99 Ga0068855_100051832 3300005563 Bacteria 4833
100 Ga0068855_100059691 3300005563 Bacteria 4462
101 Ga0068855_100060289 3300005563 Bacteria 4438
102 Ga0068855_100066595 3300005563 Bacteria 4199
103 Ga0068855_100092635 3300005563 Bacteria 3485
104 Ga0068855_100160596 3300005563 Bacteria 2551
105 Ga0070664_100003103 3300005564 Bacteria 13439
106 Ga0070664_100065815 3300005564 Bacteria 3094
107 Ga0068857_100068835 3300005577 Bacteria 3151
108 Ga0068857_100108075 3300005577 Bacteria 2499
109 Ga0068857_100179160 3300005577 Bacteria 1928
110 Ga0068854_100010766 3300005578 Bacteria 5934
111 Ga0068854_100011856 3300005578 Bacteria 5693
112 Ga0068856_100012156 3300005614 Bacteria 8339
113 Ga0068852_100000387 3300005616 Bacteria 29490
114 Ga0068852_100006174 3300005616 Bacteria 8640
115 Ga0068852_100007731 3300005616 Bacteria 7862
116 Ga0068852_100134989 3300005616 Bacteria 2277
117 Ga0068852_100145389 3300005616 Bacteria 2199
118 Ga0068859_100021262 3300005617 Bacteria 6511
119 Ga0068859_100057359 3300005617 Bacteria 3922
120 Ga0068864_100000116 3300005618 Bacteria 79213
121 Ga0068864_100000363 3300005618 Bacteria 39706
122 Ga0068861_100097602 3300005719 Bacteria 2331
123 Ga0068861_100116950 3300005719 Bacteria 2145
124 Ga0068851_10011399 3300005834 Bacteria 4168
125 Ga0068851_10019055 3300005834 Bacteria 3315
126 Ga0068863_100000007 3300005841 Bacteria 257578
127 Ga0068863_100000122 3300005841 Bacteria 81534
128 Ga0068863_100003837 3300005841 Bacteria 14865
129 Ga0068863_100014998 3300005841 Bacteria 7444
130 Ga0068863_100039222 3300005841 Bacteria 4507
131 Ga0068863_100059984 3300005841 Bacteria 3599
132 Ga0068863_100060215 3300005841 Bacteria 3590
133 Ga0068863_100075817 3300005841 Bacteria 3182
134 Ga0068858_100000853 3300005842 Bacteria 31569
135 Ga0068858_100004079 3300005842 Bacteria 14391
136 Ga0068858_100012038 3300005842 Bacteria 8154
137 Ga0068858_100043412 3300005842 Bacteria 4168
138 Ga0068858_100144316 3300005842 Bacteria 2235
139 Ga0068860_100000348 3300005843 Bacteria 62147
140 Ga0068860_100001231 3300005843 Bacteria 27931
141 Ga0068860_100063874 3300005843 Bacteria 3497
142 Ga0068860_100066828 3300005843 Bacteria 3416
143 Ga0068862_100000067 3300005844 Bacteria 123668
144 Ga0068862_100000235 3300005844 Bacteria 61301
145 Ga0068862_100026581 3300005844 Bacteria 4865
146 Ga0081455_10001031 3300005937 Bacteria 35153
147 Ga0081455_10006263 3300005937 Bacteria 12803
148 Ga0081455_10014607 3300005937 Bacteria 7684
149 Ga0081540_1001263 3300005983 Bacteria 22058
150 Ga0081540_1001383 3300005983 Bacteria 21036
151 Ga0070717_10024295 3300006028 Bacteria 4810
152 Ga0075365_10000227 3300006038 Bacteria 19112
153 Ga0075365_10022854 3300006038 Bacteria 3924
154 Ga0075368_10000991 3300006042 Bacteria 8873
155 Ga0075368_10006977 3300006042 Bacteria 3973
156 Ga0075363_100000062 3300006048 Bacteria 21873
157 Ga0075363_100026434 3300006048 Bacteria 2969
158 Ga0075363_100038716 3300006048 Bacteria 2508
159 Ga0075364_10000935 3300006051 Bacteria 15418
160 Ga0075364_10001197 3300006051 Bacteria 13931
161 Ga0075364_10013747 3300006051 Bacteria 4985
162 Ga0075364_10078826 3300006051 Bacteria 2176
163 Ga0075432_10000094 3300006058 Bacteria 18657
164 Ga0075362_10002672 3300006177 Bacteria 6057
165 Ga0075362_10015878 3300006177 Bacteria 3072
166 Ga0075367_10000119 3300006178 Bacteria 22688
167 Ga0075367_10009476 3300006178 Bacteria 5091
168 Ga0075367_10094182 3300006178 Bacteria 1825
169 Ga0075369_10000060 3300006186 Bacteria 28160
170 Ga0075369_10014705 3300006186 Bacteria 3131
171 Ga0075427_10000023 3300006194 Bacteria 10265
172 Ga0075366_10000596 3300006195 Bacteria 16937
173 Ga0075366_10005099 3300006195 Bacteria 7103
174 Ga0075366_10051698 3300006195 Bacteria 2441
175 Ga0075370_10000043 3300006353 Bacteria 38612
176 Ga0075370_10000066 3300006353 Bacteria 31728
177 Ga0075370_10020413 3300006353 Bacteria 3621
178 Ga0075370_10023778 3300006353 Bacteria 3378
179 Ga0075370_10056584 3300006353 Bacteria 2229
180 Ga0075433_10026622 3300006852 Bacteria 4899
181 Ga0075434_100122090 3300006871 Bacteria 2621
182 Ga0075429_100006297 3300006880 Bacteria 10275
183 Ga0075436_100012782 3300006914 Bacteria 5756
184 Ga0097620_100021262 3300006931 Bacteria 6511
185 Ga0097620_100057357 3300006931 Bacteria 3922
186 Ga0075435_100016479 3300007076 Bacteria 5573
187 Ga0075435_100125914 3300007076 Bacteria 2141
188 Ga0105250_10002835 3300009092 Bacteria 8495
189 Ga0105250_10005265 3300009092 Bacteria 5816
190 Ga0105240_10000305 3300009093 Bacteria 94979
191 Ga0105240_10010558 3300009093 Bacteria 12971
192 Ga0105240_10019011 3300009093 Bacteria 9198
193 Ga0105240_10041126 3300009093 Bacteria 5903
194 Ga0105240_10133888 3300009093 Bacteria 2969
195 Ga0105245_10085797 3300009098 Bacteria 2886
196 Ga0105247_10003856 3300009101 Bacteria 9704
197 Ga0114129_10370390 3300009147 Bacteria 1893
198 Ga0105241_10060054 3300009174 Bacteria 2924
199 Ga0105248_10000059 3300009177 Bacteria 137176
200 Ga0105248_10000071 3300009177 Bacteria 118281
201 Ga0105248_10000438 3300009177 Bacteria 47263
202 Ga0105248_10045112 3300009177 Bacteria 4943
203 Ga0105248_10090660 3300009177 Bacteria 3442
204 Ga0105237_10003515 3300009545 Bacteria 18584
205 Ga0105237_10074969 3300009545 Bacteria 3375
206 Ga0105238_10011427 3300009551 Bacteria 8942
207 Ga0105238_10014487 3300009551 Bacteria 7973
208 Ga0105238_10027868 3300009551 Bacteria 5757
209 Ga0105238_10028949 3300009551 Bacteria 5642
210 Ga0105238_10029957 3300009551 Bacteria 5541
211 Ga0105238_10049267 3300009551 Bacteria 4243
212 Ga0105249_10000105 3300009553 Bacteria 117181
213 Ga0105249_10009441 3300009553 Bacteria 8541
214 Ga0105249_10011902 3300009553 Bacteria 7652
215 Ga0105249_10046170 3300009553 Bacteria 3964
216 Ga0105239_10000037 3300010375 Bacteria 206779
217 Ga0105239_10107230 3300010375 Bacteria 3095
218 Ga0105246_10017989 3300011119 Bacteria 4500
219 Ga0157373_10019439 3300013100 Bacteria 4943
220 Ga0157373_10030864 3300013100 Bacteria 3856
221 Ga0157373_10060215 3300013100 Bacteria 2690
222 Ga0157370_10018896 3300013104 Bacteria 6930
223 Ga0157370_10028965 3300013104 Bacteria 5441
224 Ga0157370_10037299 3300013104 Bacteria 4712
225 Ga0157370_10046511 3300013104 Bacteria 4161
226 Ga0157370_10064818 3300013104 Bacteria 3458
227 Ga0157370_10214112 3300013104 Bacteria 1785
228 Ga0157369_10066871 3300013105 Bacteria 3866
229 Ga0157369_10088770 3300013105 Bacteria 3300
230 Ga0157369_10149285 3300013105 Bacteria 2471
231 Ga0163162_10090862 3300013306 Bacteria 3135
232 Ga0157372_10013006 3300013307 Bacteria 8879
233 Ga0157372_10029019 3300013307 Bacteria 6036
234 Ga0157372_10202608 3300013307 Bacteria 2299
235 Ga0157375_10171314 3300013308 Bacteria 2319
236 Ga0183365_10002 3300015684 Bacteria 545891
237 Ga0163161_10060355 3300017792 Bacteria 2760
238 Ga0213873_10001565 3300021358 Bacteria 3823
239 Ga0213872_10001454 3300021361 Bacteria 15422
240 Ga0213872_10005154 3300021361 Bacteria 6770
241 Ga0213874_10025668 3300021377 Bacteria 1664
242 Ga0213876_10000544 3300021384 Bacteria 28326
243 Ga0213876_10000716 3300021384 Bacteria 23196
244 Ga0213876_10003346 3300021384 Bacteria 9180
245 Ga0213875_10016246 3300021388 Bacteria 3611
246 Ga0213871_10006931 3300021441 Bacteria 2424
247 Ga0209566_100542 3300025225 Bacteria 25524
248 Ga0209674_101649 3300025226 Bacteria 5579
249 Ga0209148_1000465 3300025254 Bacteria 43292
250 Ga0209759_1000057 3300025256 Bacteria 205181
251 Ga0209565_1000332 3300025263 Bacteria 42136
252 Ga0209676_1000327 3300025292 Bacteria 91596
253 Ga0209676_1000409 3300025292 Bacteria 77127
254 Ga0209758_1002592 3300025297 Bacteria 18133
255 Ga0209758_1005274 3300025297 Bacteria 10105
256 Ga0209050_1000101 3300025298 Bacteria 230076
257 Ga0209050_1000217 3300025298 Bacteria 128833
258 Ga0209050_1004277 3300025298 Bacteria 9792
259 Ga0209050_1005272 3300025298 Bacteria 8226
260 Ga0209050_1013083 3300025298 Bacteria 3731
261 Ga0209256_1002189 3300025299 Bacteria 16751
262 Ga0209256_1003655 3300025299 Bacteria 10519
263 Ga0209257_1000178 3300025304 Bacteria 160969
264 Ga0209257_1000220 3300025304 Bacteria 135116
265 Ga0209257_1000386 3300025304 Bacteria 88085
266 Ga0209257_1005253 3300025304 Bacteria 9242
267 Ga0209257_1005921 3300025304 Bacteria 8228
268 Ga0209257_1009127 3300025304 Bacteria 5409
269 Ga0207682_10000833 3300025893 Bacteria 14256
270 Ga0207710_10004304 3300025900 Bacteria 6232
271 Ga0207647_10001078 3300025904 Bacteria 21029
272 Ga0207647_10007591 3300025904 Bacteria 7815
273 Ga0207647_10027206 3300025904 Bacteria 3731
274 Ga0207645_10006878 3300025907 Bacteria 8111
275 Ga0207705_10000004 3300025909 Bacteria 705756
276 Ga0207705_10001414 3300025909 Bacteria 19120
277 Ga0207705_10005634 3300025909 Bacteria 9354
278 Ga0207705_10007304 3300025909 Bacteria 8125
279 Ga0207705_10019624 3300025909 Bacteria 4833
280 Ga0207705_10041040 3300025909 Bacteria 3319
281 Ga0207705_10067491 3300025909 Bacteria 2588
282 Ga0207707_10001296 3300025912 Bacteria 23280
283 Ga0207707_10034921 3300025912 Bacteria 4398
284 Ga0207707_10054709 3300025912 Bacteria 3474
285 Ga0207695_10000718 3300025913 Bacteria 64451
286 Ga0207695_10001017 3300025913 Bacteria 49429
287 Ga0207695_10001195 3300025913 Bacteria 44633
288 Ga0207695_10003313 3300025913 Bacteria 22832
289 Ga0207695_10007252 3300025913 Bacteria 14157
290 Ga0207695_10014240 3300025913 Bacteria 9433
291 Ga0207695_10040465 3300025913 Bacteria 4996
292 Ga0207671_10007045 3300025914 Bacteria 9848
293 Ga0207660_10003153 3300025917 Bacteria 10795
294 Ga0207660_10008412 3300025917 Bacteria 6676
295 Ga0207657_10001137 3300025919 Bacteria 28234
296 Ga0207657_10001303 3300025919 Bacteria 26487
297 Ga0207657_10001904 3300025919 Bacteria 22544
298 Ga0207657_10008828 3300025919 Bacteria 10195
299 Ga0207657_10024687 3300025919 Bacteria 5558
300 Ga0207657_10042588 3300025919 Bacteria 4004
301 Ga0207649_10021111 3300025920 Bacteria 3743
302 Ga0207652_10003865 3300025921 Bacteria 12269
303 Ga0207652_10020568 3300025921 Bacteria 5438
304 Ga0207652_10047102 3300025921 Bacteria 3682
305 Ga0207652_10052024 3300025921 Bacteria 3514
306 Ga0207681_10000448 3300025923 Bacteria 28899
307 Ga0207694_10008152 3300025924 Bacteria 7917
308 Ga0207694_10011507 3300025924 Bacteria 6678
309 Ga0207694_10022405 3300025924 Bacteria 4791
310 Ga0207694_10042460 3300025924 Bacteria 3508
311 Ga0207694_10056099 3300025924 Bacteria 3059
312 Ga0207694_10078125 3300025924 Bacteria 2594
313 Ga0207650_10000062 3300025925 Bacteria 149776
314 Ga0207659_10106133 3300025926 Bacteria 2126
315 Ga0207687_10027427 3300025927 Bacteria 3821
316 Ga0207644_10000003 3300025931 Bacteria 585905
317 Ga0207644_10000602 3300025931 Bacteria 22923
318 Ga0207644_10006348 3300025931 Bacteria 7698
319 Ga0207644_10021731 3300025931 Bacteria 4375
320 Ga0207644_10022690 3300025931 Bacteria 4290
321 Ga0207690_10000051 3300025932 Bacteria 107367
322 Ga0207690_10000053 3300025932 Bacteria 105125
323 Ga0207690_10003079 3300025932 Bacteria 10047
324 Ga0207690_10005435 3300025932 Bacteria 7507
325 Ga0207690_10008542 3300025932 Bacteria 6078
326 Ga0207706_10046633 3300025933 Bacteria 3837
327 Ga0207706_10123176 3300025933 Bacteria 2281
328 Ga0207670_10038590 3300025936 Bacteria 3121
329 Ga0207711_10001604 3300025941 Bacteria 20913
330 Ga0207711_10016191 3300025941 Bacteria 6190
331 Ga0207679_10005151 3300025945 Bacteria 8185
332 Ga0207667_10007334 3300025949 Bacteria 13274
333 Ga0207667_10008988 3300025949 Bacteria 11821
334 Ga0207667_10043233 3300025949 Bacteria 4782
335 Ga0207667_10092888 3300025949 Bacteria 3116
336 Ga0207667_10107443 3300025949 Bacteria 2879
337 Ga0207667_10151876 3300025949 Bacteria 2383
338 Ga0207667_10198713 3300025949 Bacteria 2057
339 Ga0207651_10017670 3300025960 Bacteria 4220
340 Ga0207712_10000015 3300025961 Bacteria 346689
341 Ga0207712_10003975 3300025961 Bacteria 9334
342 Ga0207712_10017866 3300025961 Bacteria 4614
343 Ga0207712_10018228 3300025961 Bacteria 4569
344 Ga0207712_10030942 3300025961 Bacteria 3602
345 Ga0207668_10000342 3300025972 Bacteria 30270
346 Ga0207668_10001123 3300025972 Bacteria 15955
347 Ga0207668_10003651 3300025972 Bacteria 9043
348 Ga0207668_10066068 3300025972 Bacteria 2562
349 Ga0207640_10000535 3300025981 Bacteria 22763
350 Ga0207640_10021214 3300025981 Bacteria 3868
351 Ga0207640_10043541 3300025981 Bacteria 2870
352 Ga0207658_10000218 3300025986 Bacteria 60270
353 Ga0207658_10001134 3300025986 Bacteria 21429
354 Ga0207658_10023073 3300025986 Bacteria 4338
355 Ga0207658_10033721 3300025986 Bacteria 3653
356 Ga0207677_10000013 3300026023 Bacteria 186519
357 Ga0207677_10004145 3300026023 Bacteria 7757
358 Ga0207677_10107112 3300026023 Bacteria 2072
359 Ga0207703_10000038 3300026035 Bacteria 175917
360 Ga0207703_10002707 3300026035 Bacteria 15178
361 Ga0207703_10005677 3300026035 Bacteria 10017
362 Ga0207639_10000260 3300026041 Bacteria 38302
363 Ga0207639_10031700 3300026041 Bacteria 3886
364 Ga0207639_10042224 3300026041 Bacteria 3416
365 Ga0207678_10000104 3300026067 Bacteria 69027
366 Ga0207678_10000716 3300026067 Bacteria 30304
367 Ga0207678_10051842 3300026067 Bacteria 3541
368 Ga0207702_10015322 3300026078 Bacteria 6355
369 Ga0207641_10000001 3300026088 Bacteria 1180841
370 Ga0207641_10000012 3300026088 Bacteria 375486
371 Ga0207641_10005823 3300026088 Bacteria 10457
372 Ga0207641_10021395 3300026088 Bacteria 5315
373 Ga0207641_10052619 3300026088 Bacteria 3449
374 Ga0207676_10000179 3300026095 Bacteria 55697
375 Ga0207676_10000437 3300026095 Bacteria 35190
376 Ga0207676_10045215 3300026095 Bacteria 3401
377 Ga0207674_10003125 3300026116 Bacteria 20421
378 Ga0207674_10024869 3300026116 Bacteria 6391
379 Ga0207675_100025874 3300026118 Bacteria 5459
380 Ga0207675_100079812 3300026118 Bacteria 3067
381 Ga0207675_100094527 3300026118 Bacteria 2812
382 Ga0207675_100137525 3300026118 Bacteria 2319
383 Ga0207683_10184130 3300026121 Bacteria 1894
384 Ga0207698_10000193 3300026142 Bacteria 38052
385 Ga0207698_10003399 3300026142 Bacteria 9579
386 Ga0207698_10003964 3300026142 Bacteria 8973
387 Ga0207698_10010338 3300026142 Bacteria 5987
388 Ga0207698_10046164 3300026142 Bacteria 3287
389 Ga0209389_1000117 3300027296 Bacteria 71506
390 Ga0209489_109135 3300027361 Bacteria 12644
391 Ga0209700_100021 3300027363 Bacteria 230859
392 Ga0209813_10000053 3300027866 Bacteria 47000
393 Ga0209813_10000873 3300027866 Bacteria 6787
394 Ga0209813_10002965 3300027866 Bacteria 3931
395 Ga0207428_10035873 3300027907 Bacteria 4050
396 Ga0268266_10000064 3300028379 Bacteria 249533
397 Ga0268266_10001119 3300028379 Bacteria 33470
398 Ga0268266_10003430 3300028379 Bacteria 15845
399 Ga0268266_10008959 3300028379 Bacteria 8858
400 Ga0268265_10000021 3300028380 Bacteria 272292
401 Ga0268265_10000600 3300028380 Bacteria 36213
402 Ga0268265_10045113 3300028380 Bacteria 3287
403 Ga0268264_10000046 3300028381 Bacteria 364597
404 Ga0268264_10000059 3300028381 Bacteria 306927
405 Ga0268264_10000330 3300028381 Bacteria 74311
406 Ga0268264_10032863 3300028381 Bacteria 4258
407 Ga0268264_10046476 3300028381 Bacteria 3605
408 Ga0268264_10098912 3300028381 Bacteria 2531
409 Ga0265337_1001337 3300028556 Bacteria 12227
410 Ga0265334_10001279 3300028573 Bacteria 12182
411 Ga0307517_10006007 3300028786 Bacteria 18094
412 Ga0307515_10101092 3300028794 Bacteria 3484
413 Ga0265338_10033178 3300028800 Bacteria 5016
414 Ga0265338_10038295 3300028800 Bacteria 4546
415 Ga0265338_10095129 3300028800 Bacteria 2448
416 Ga0307511_10053071 3300030521 Bacteria 3219
417 Ga0265330_10006479 3300031235 Bacteria 5788
418 Ga0265330_10046044 3300031235 Bacteria 1922
419 Ga0265330_10064138 3300031235 Bacteria 1596
420 Ga0265332_10000016 3300031238 Bacteria 229887
421 Ga0265329_10006065 3300031242 Bacteria 4827
422 Ga0265340_10031218 3300031247 Bacteria 2665
423 Ga0265339_10034446 3300031249 Bacteria 2845
424 Ga0265339_10069712 3300031249 Bacteria 1876
425 Ga0265331_10000695 3300031250 Bacteria 28793
426 Ga0265331_10008614 3300031250 Bacteria 5788
427 Ga0265331_10010985 3300031250 Bacteria 4972
428 Ga0265331_10011789 3300031250 Bacteria 4771
429 Ga0265327_10000588 3300031251 Bacteria 61029
430 Ga0265327_10000602 3300031251 Bacteria 59632
431 Ga0265327_10002222 3300031251 Bacteria 21132
432 Ga0265327_10004643 3300031251 Bacteria 12048
433 Ga0265327_10019344 3300031251 Bacteria 4190
434 Ga0265327_10041024 3300031251 Bacteria 2498
435 Ga0265327_10062793 3300031251 Bacteria 1889
436 Ga0265316_10000169 3300031344 Bacteria 73902
437 Ga0307513_10000261 3300031456 Bacteria 76045
438 Ga0307513_10004825 3300031456 Bacteria 17901
439 Ga0307513_10014216 3300031456 Bacteria 9734
440 Ga0307513_10021686 3300031456 Bacteria 7577
441 Ga0307408_100025242 3300031548 Bacteria 4069
442 Ga0316575_10000032 3300031665 Bacteria 33845
443 Ga0265342_10088293 3300031712 Bacteria 1781
444 Ga0316576_10016359 3300031727 Bacteria 5006
445 Ga0316578_10017916 3300031728 Bacteria 3867
446 Ga0307516_10000352 3300031730 Bacteria 59644
447 Ga0307405_10026182 3300031731 Bacteria 3362
448 Ga0307413_10019680 3300031824 Bacteria 3573
449 Ga0307413_10044707 3300031824 Bacteria 2620
450 Ga0307410_10000957 3300031852 Bacteria 12384
451 Ga0307406_10002549 3300031901 Bacteria 9931
452 Ga0307406_10031861 3300031901 Bacteria 3213
453 Ga0307412_10148330 3300031911 Bacteria 1727
454 Ga0307409_100030371 3300031995 Bacteria 3881
455 Ga0307409_100145419 3300031995 Bacteria 2049
456 Ga0307416_100034538 3300032002 Bacteria 3849
457 Ga0307414_10040568 3300032004 Bacteria 3146
458 Ga0307414_10061493 3300032004 Bacteria 2660
459 Ga0307411_10001513 3300032005 Bacteria 9568
460 Ga0307411_10007647 3300032005 Bacteria 5527
461 Ga0307415_100013094 3300032126 Bacteria 4826
462 Ga0316583_10028121 3300032133 Bacteria 2005
463 Ga0316593_10000364 3300032168 Bacteria 7995
464 Ga0373953_0009093 3300035117 Bacteria 3399
465 Ga0373946_0015362 3300035171 Bacteria 2902
466 Ga0373955_0001026 3300035172 Bacteria 11850
467 Ga0373961_0003522 3300035241 Bacteria 3865
468 Ga0316574_0000274 3300035398 Bacteria 19146
469 Ga0373931_0053499 3300035691 Bacteria 2154
470 Ga0373935_0046449 3300035692 Bacteria 2743
471 Ga0373927_0103826 3300035695 Bacteria 1850
472 Ga0373933_0024125 3300035724 Bacteria 3481
473 Ga0373937_0002849 3300036401 Bacteria 14447
474 Ga0316584_0029523 3300036712 Bacteria 4048
475 Ga0373925_0000061 3300037068 Bacteria 117783
476 Ga0395899_0000013 3300037312 Bacteria 510397
477 Ga0395899_0000151 3300037312 Bacteria 105368
478 Ga0395899_0000167 3300037312 Bacteria 100973
479 Ga0395899_0000804 3300037312 Bacteria 30745
480 Ga0395899_0000885 3300037312 Bacteria 28458
481 Ga0395899_0009300 3300037312 Bacteria 7546
482 Ga0395899_0012431 3300037312 Bacteria 6522
483 Ga0395899_0022192 3300037312 Bacteria 4813
484 Ga0395899_0086958 3300037312 Bacteria 2269
485 Ga0395900_0000009 3300037418 Bacteria 476249
486 Ga0395900_0000020 3300037418 Bacteria 353500
487 Ga0395900_0000031 3300037418 Bacteria 262393
488 Ga0395900_0001255 3300037418 Bacteria 31098
489 Ga0395900_0002764 3300037418 Bacteria 19179
490 Ga0395900_0029097 3300037418 Bacteria 5666
491 Ga0395900_0059667 3300037418 Bacteria 3927
492 Ga0395900_0121552 3300037418 Bacteria 2679
493 Ga0395900_0147150 3300037418 Bacteria 2408
494 Ga0395900_0191156 3300037418 Bacteria 2076
495 Ga0395898_0000104 3300037466 Bacteria 223462
496 Ga0395898_0006464 3300037466 Bacteria 12517
497 Ga0395898_0018445 3300037466 Bacteria 7115
498 Ga0395898_0027194 3300037466 Bacteria 5745
499 Ga0395898_0032773 3300037466 Bacteria 5188
500 Ga0395898_0049253 3300037466 Bacteria 4128
501 Ga0395905_0000019 3300037471 Bacteria 353500
502 Ga0395905_0000271 3300037471 Bacteria 77040
503 Ga0395905_0000458 3300037471 Bacteria 57029
504 Ga0395905_0001765 3300037471 Bacteria 25140
505 Ga0395905_0007899 3300037471 Bacteria 10523
506 Ga0395905_0073033 3300037471 Bacteria 3215
507 Ga0395905_0105913 3300037471 Bacteria 2640
508 Ga0395905_0184082 3300037471 Bacteria 1961
509 Ga0436364_0238815 3300037853 Bacteria 8510
510 Ga0436364_0414769 3300037853 Bacteria 4611
511 Ga0395901_0000014 3300038443 Bacteria 375100
512 Ga0395901_0000016 3300038443 Bacteria 354008
513 Ga0395901_0000035 3300038443 Bacteria 223888
514 Ga0395901_0001264 3300038443 Bacteria 26810
515 Ga0395901_0006984 3300038443 Bacteria 11409
516 Ga0395901_0008542 3300038443 Bacteria 10349
517 Ga0395901_0043872 3300038443 Bacteria 4638
518 Ga0395901_0147294 3300038443 Bacteria 2474
519 Ga0395901_0217321 3300038443 Bacteria 1998
520 Ga0395901_0220860 3300038443 Bacteria 1981
521 Ga0400485_03094 3300038735 Bacteria 3386
522 Ga0400483_135188 3300039062 Bacteria 2125
523 Ga0400483_198091 3300039062 Bacteria 2110
524 Ga0436365_0400394 3300039437 Bacteria 25450
525 Ga0436365_0835883 3300039437 Bacteria 3507
526 Ga0436365_0886091 3300039437 Bacteria 43353
527 Ga0436360_0197367 3300039438 Bacteria 2151
528 Ga0436361_0496775 3300039447 Bacteria 11116
529 Ga0436361_0917304 3300039447 Bacteria 39295
530 Ga0436363_0609059 3300039450 Bacteria 20913
531 Ga0436363_1027775 3300039450 Bacteria 2521
532 Ga0436363_1720929 3300039450 Bacteria 8555
533 Ga0436362_0516986 3300039453 Bacteria 11871
534 Ga0439446_0015224 3300042156 Bacteria 2132
535 Ga0439460_0012638 3300042461 Bacteria 2195
536 Ga0450901_002064 3300042533 Bacteria 2221
537 Ga0466969_0000193 3300044656 Bacteria 32883
538 Ga0466966_0000688 3300044684 Bacteria 21491
539 Ga0466966_0031712 3300044684 Bacteria 3427
540 Ga0466966_0076533 3300044684 Bacteria 2089
541 Ga0466961_0003224 3300044693 Bacteria 10143
542 Ga0466963_0001435 3300044694 Bacteria 12837
543 Ga0466963_0043037 3300044694 Bacteria 2967
544 Ga0466963_0100827 3300044694 Bacteria 1976
545 Ga0466963_0128588 3300044694 Bacteria 1748
546 Ga0466971_0002179 3300044719 Bacteria 8282
547 Ga0466970_0065108 3300044765 Bacteria 1955
548 Ga0466957_0002794 3300044842 Bacteria 9442
549 Ga0466959_0000118 3300045049 Bacteria 51145
550 Ga0451576_0000034 3300045051 Bacteria 390778
551 Ga0451576_0059690 3300045051 Bacteria 3981
552 Ga0466958_0000398 3300045836 Bacteria 17799
553 Ga0466958_0036198 3300045836 Bacteria 2953
554 Ga0495627_001043 3300046453 Bacteria 18449
555 Ga0495590_0019068 3300046457 Bacteria 2448
556 Ga0495650_0000017 3300046471 Bacteria 542552
557 Ga0495584_0015466 3300046491 Bacteria 3888
558 Ga0495585_0077303 3300046492 Bacteria 1807
559 Ga0495596_0000288 3300046500 Bacteria 33511
560 Ga0495583_0000020 3300046506 Bacteria 296185
561 Ga0495583_0000426 3300046506 Bacteria 63627
562 Ga0495606_0023713 3300046507 Bacteria 4438
563 Ga0495610_0000030 3300046512 Bacteria 265950
564 Ga0495610_0000908 3300046512 Bacteria 27545
565 Ga0495610_0007741 3300046512 Bacteria 7091
566 Ga0495616_0001591 3300046513 Bacteria 15584
567 Ga0495620_0017326 3300046515 Bacteria 3594
568 Ga0495632_0060259 3300046519 Bacteria 1844
569 Ga0495637_0002075 3300046520 Bacteria 11270
570 Ga0495648_0000948 3300046524 Bacteria 30025
571 Ga0495648_0003360 3300046524 Bacteria 14095
572 Ga0495654_0000216 3300046530 Bacteria 54273
573 Ga0495621_0014749 3300046539 Bacteria 2480
574 Ga0495597_0047282 3300046542 Bacteria 1905
575 Ga0495633_0002271 3300046558 Bacteria 13754
576 Ga0495668_0000092 3300046616 Bacteria 142835
577 Ga0495668_0006535 3300046616 Bacteria 7617
578 Ga0495668_0015161 3300046616 Bacteria 4506
579 Ga0495668_0016490 3300046616 Bacteria 4293
580 Ga0495669_0000003 3300046684 Bacteria 267741
581 Ga0495669_0000234 3300046684 Bacteria 32800
582 Ga0495649_0000345 3300046694 Bacteria 39827
583 Ga0495672_0001561 3300047320 Bacteria 22420
584 Ga0495677_0005616 3300047445 Bacteria 4754
585 Ga0495679_005032 3300047446 Bacteria 5945
586 Ga0495673_0000078 3300047469 Bacteria 203066
587 Ga0495673_0000401 3300047469 Bacteria 50743
588 Ga0495681_0000011 3300047470 Bacteria 201843
589 Ga0495686_0003214 3300047472 Bacteria 14390
590 Ga0495686_0011256 3300047472 Bacteria 6308
591 Ga0496101_0034152 3300048904 Bacteria 3591
592 Ga0496102_0062324 3300048905 Bacteria 3414
593 Ga0496103_0008642 3300048906 Bacteria 6050
594 Ga0496103_0103884 3300048906 Bacteria 1800
595 Ga0496104_0009696 3300048907 Bacteria 8580
596 Ga0496105_0006289 3300048908 Bacteria 9118
597 Ga0496106_0002158 3300048909 Bacteria 14703
598 Ga0496106_0002226 3300048909 Bacteria 14458
599 Ga0496106_0005334 3300048909 Bacteria 9514
600 Ga0496106_0179652 3300048909 Bacteria 1680
601 Ga0496107_0001868 3300048910 Bacteria 13316
602 Ga0496107_0060523 3300048910 Bacteria 2741
603 Ga0496107_0084790 3300048910 Bacteria 2312
604 Ga0496107_0131617 3300048910 Bacteria 1847
605 Ga0496108_0002227 3300048911 Bacteria 15527
606 Ga0496108_0034941 3300048911 Bacteria 4176
607 Ga0496109_0002047 3300048912 Bacteria 16717
608 Ga0496109_0023339 3300048912 Bacteria 5490
609 Ga0496109_0060051 3300048912 Bacteria 3474
610 Ga0496110_0026758 3300048913 Bacteria 4939
611 Ga0496110_0097858 3300048913 Bacteria 2629
612 Ga0496111_0008316 3300048914 Bacteria 6859
613 Ga0496111_0014620 3300048914 Bacteria 5369
614 Ga0496112_0003678 3300048915 Bacteria 12783
615 Ga0496112_0025671 3300048915 Bacteria 5660
616 Ga0496112_0036881 3300048915 Bacteria 4769
617 Ga0496112_0045422 3300048915 Bacteria 4306
618 Ga0496112_0068585 3300048915 Bacteria 3502
619 Ga0496113_0001823 3300048916 Bacteria 12118
620 Ga0496113_0001984 3300048916 Bacteria 11730
621 Ga0496113_0076057 3300048916 Bacteria 2564
622 Ga0496114_0007532 3300048917 Bacteria 8611
623 Ga0496114_0024978 3300048917 Bacteria 4880
624 Ga0496114_0094783 3300048917 Bacteria 2539
625 Ga0496115_0000571 3300048918 Bacteria 28486
626 Ga0496115_0000794 3300048918 Bacteria 23158
627 Ga0496115_0001409 3300048918 Bacteria 17195
628 Ga0496116_0000019 3300048919 Bacteria 533227
629 Ga0496116_0000039 3300048919 Bacteria 349134
630 Ga0496117_0054267 3300048920 Bacteria 2808
631 Ga0496118_0020178 3300048921 Bacteria 5920
632 Ga0496119_0003333 3300048922 Bacteria 16734
633 Ga0496119_0011136 3300048922 Bacteria 7491
634 Ga0496120_0036784 3300048923 Bacteria 2909
635 Ga0496121_0000001 3300048924 Bacteria 1830318
636 Ga0496121_0000009 3300048924 Bacteria 836971
637 Ga0496121_0000018 3300048924 Bacteria 542045
638 Ga0496121_0001392 3300048924 Bacteria 40941
639 Ga0496121_0004259 3300048924 Bacteria 19444
640 Ga0496121_0030838 3300048924 Bacteria 4916
641 Ga0496121_0035073 3300048924 Bacteria 4501
642 Ga0496122_0015650 3300048925 Bacteria 7236
643 Ga0496122_0066534 3300048925 Bacteria 2602
644 Ga0496123_0003680 3300048926 Bacteria 16906
645 Ga0496123_0005251 3300048926 Bacteria 13145
646 Ga0496124_0002764 3300048927 Bacteria 22312
647 Ga0496125_0000001 3300048928 Bacteria 1766138
648 Ga0496125_0000749 3300048928 Bacteria 53580
649 Ga0496125_0002786 3300048928 Bacteria 22105
650 Ga0496125_0007529 3300048928 Bacteria 11573
651 Ga0496125_0078257 3300048928 Bacteria 2543
652 Ga0496126_0000041 3300048929 Bacteria 340389
653 Ga0496126_0001877 3300048929 Bacteria 30562
654 Ga0496126_0071794 3300048929 Bacteria 3081
655 Ga0495678_001720 3300049459 Bacteria 16374
656 Ga0501031_0000019 3300049568 Bacteria 104793
657 Ga0501032_0000009 3300049569 Bacteria 228107
658 Ga0501032_0003255 3300049569 Bacteria 12491
659 Ga0501033_0000019 3300049570 Bacteria 204699
660 Ga0501033_0002053 3300049570 Bacteria 17511
661 Ga0501033_0041719 3300049570 Bacteria 3423
662 Ga0501033_0074012 3300049570 Bacteria 2501
663 Ga0501034_0000044 3300049571 Bacteria 227982
664 Ga0501034_0000176 3300049571 Bacteria 119228
665 Ga0501034_0014235 3300049571 Bacteria 8199
666 Ga0501034_0072566 3300049571 Bacteria 3451
667 Ga0501034_0090118 3300049571 Bacteria 3065
668 Ga0501034_0105144 3300049571 Bacteria 2816
669 Ga0501034_0198704 3300049571 Bacteria 1964
670 Ga0501036_0000008 3300049572 Bacteria 228106
671 Ga0501036_0025756 3300049572 Bacteria 4964
672 Ga0501036_0039031 3300049572 Bacteria 4021
673 Ga0501036_0089461 3300049572 Bacteria 2601
674 Ga0501037_0000055 3300049573 Bacteria 109790
675 Ga0501038_0000006 3300049574 Bacteria 228107
676 Ga0501038_0011223 3300049574 Bacteria 8179
677 Ga0501038_0160191 3300049574 Bacteria 1829
678 Ga0501038_0181333 3300049574 Bacteria 1699
679 Ga0501039_0000014 3300049575 Bacteria 228107
680 Ga0501039_0016254 3300049575 Bacteria 5700
681 Ga0501039_0085206 3300049575 Bacteria 2462
682 Ga0501040_0010441 3300049576 Bacteria 6073
683 Ga0501040_0057621 3300049576 Bacteria 2668
684 Ga0501041_0024027 3300049577 Bacteria 3657
685 Ga0501041_0053334 3300049577 Bacteria 2466
686 Ga0501042_0007634 3300049578 Bacteria 7095
687 Ga0501042_0025516 3300049578 Bacteria 4151
688 Ga0501043_0021029 3300049579 Bacteria 5116
689 Ga0501043_0071258 3300049579 Bacteria 2730
690 Ga0501046_0001115 3300049580 Bacteria 26209
691 Ga0501046_0003242 3300049580 Bacteria 14954
692 Ga0501047_0000290 3300049581 Bacteria 57649
693 Ga0501047_0008388 3300049581 Bacteria 9752
694 Ga0501047_0036257 3300049581 Bacteria 4766
695 Ga0501047_0085685 3300049581 Bacteria 3027
696 Ga0501047_0210013 3300049581 Bacteria 1805
697 Ga0501048_0021203 3300049582 Bacteria 4757
698 Ga0501048_0050050 3300049582 Bacteria 2976
699 Ga0501048_0059997 3300049582 Bacteria 2695
700 Ga0501067_0000905 3300049583 Bacteria 15942
701 Ga0501067_0001682 3300049583 Bacteria 12159
702 Ga0501070_0002529 3300049586 Bacteria 16034
703 Ga0501070_0063518 3300049586 Bacteria 3058
704 Ga0501070_0111973 3300049586 Bacteria 2256
705 Ga0501071_0005547 3300049587 Bacteria 8126
706 Ga0501071_0100061 3300049587 Bacteria 2136
707 Ga0501072_0004184 3300049588 Bacteria 10934
708 Ga0501073_0000018 3300049589 Bacteria 155244
709 Ga0501073_0003442 3300049589 Bacteria 11879
710 Ga0501074_0044326 3300049590 Bacteria 3220
711 Ga0501074_0081192 3300049590 Bacteria 2325
712 Ga0501075_0009175 3300049591 Bacteria 6914
713 Ga0501075_0105082 3300049591 Bacteria 2146
714 Ga0501076_0010765 3300049592 Bacteria 6799
715 Ga0501076_0049755 3300049592 Bacteria 3315
716 Ga0501077_0000026 3300049593 Bacteria 76023
717 Ga0501077_0027418 3300049593 Bacteria 3617
718 Ga0501257_000095 3300049686 Bacteria 21617
719 Ga0501079_0004232 3300049741 Bacteria 10642
720 Ga0501079_0017813 3300049741 Bacteria 5426
721 Ga0501079_0056185 3300049741 Bacteria 3037
722 Ga0501080_0000003 3300049742 Bacteria 214890
723 Ga0501080_0001057 3300049742 Bacteria 22628
724 Ga0501080_0005874 3300049742 Bacteria 10994
725 Ga0501080_0045353 3300049742 Bacteria 4092
726 Ga0501080_0050525 3300049742 Bacteria 3869
727 Ga0501080_0061944 3300049742 Bacteria 3482
728 Ga0501081_0008312 3300049743 Bacteria 6736
729 Ga0501081_0009224 3300049743 Bacteria 6426
730 Ga0501083_0021296 3300049744 Bacteria 4505
731 Ga0501280_002283 3300049776 Bacteria 3247
732 Ga0501035_0000096 3300049822 Bacteria 110635
733 Ga0501035_0000384 3300049822 Bacteria 50737
734 Ga0501035_0051742 3300049822 Bacteria 3676
735 Ga0501035_0054473 3300049822 Bacteria 3574
736 Ga0501035_0077431 3300049822 Bacteria 2939
737 Ga0501035_0208548 3300049822 Bacteria 1673
738 Ga0501044_0000017 3300049823 Bacteria 228107
739 Ga0501044_0000570 3300049823 Bacteria 44794
740 Ga0501044_0013529 3300049823 Bacteria 8821
741 Ga0501044_0030476 3300049823 Bacteria 5685
742 Ga0501044_0083632 3300049823 Bacteria 3227
743 Ga0501045_0049169 3300049824 Bacteria 3074
744 Ga0501045_0124006 3300049824 Bacteria 1918
745 nmdc:mga03683_625_c1 3300050489 Bacteria 10155
746 nmdc:mga03683_6_c1 3300050489 Bacteria 141493
747 nmdc:mga03n38_114044_c1 3300050490 Bacteria 1320
748 nmdc:mga03n38_61_c1 3300050490 Bacteria 22538
749 nmdc:mga00v17_146_c1 3300050491 Bacteria 40788
750 nmdc:mga00v17_322_c1 3300050491 Bacteria 27155
751 nmdc:mga00v17_505_c1 3300050491 Bacteria 21902
752 nmdc:mga00v17_934_c1 3300050491 Bacteria 15691
753 nmdc:mga00v17_99467_c1 3300050491 Bacteria 1835
754 nmdc:mga0yw44_57_c1 3300050492 Bacteria 40136
755 nmdc:mga0k408_6_c1 3300050493 Bacteria 200443
756 nmdc:mga06z11_105_c1 3300050494 Bacteria 34898
757 nmdc:mga06z11_12375_c1 3300050494 Bacteria 3710
758 nmdc:mga06z11_147_c1 3300050494 Bacteria 27767
759 nmdc:mga06z11_52078_c1 3300050494 Bacteria 2098
760 nmdc:mga04h51_24_c1 3300050495 Bacteria 59995
761 nmdc:mga04h51_2624_c1 3300050495 Bacteria 4279
762 nmdc:mga07m45_187_c2 3300050496 Bacteria 10171
763 nmdc:mga07m45_32659_c1 3300050496 Bacteria 2886
764 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
765 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
766 nmdc:mga07m45_66_c1 3300050496 Bacteria 40757
767 nmdc:mga09592_40497_c1 3300050508 Bacteria 3914
768 nmdc:mga08y16_134810_c1 3300050511 Bacteria 2566
769 nmdc:mga08y16_33263_c1 3300050511 Bacteria 5415
770 nmdc:mga0n895_207881_c1 3300050512 Bacteria 1988
771 nmdc:mga0rr50_39858_c1 3300050513 Bacteria 3410
772 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
773 nmdc:mga0sz30_118_c1 3300050516 Bacteria 29758
774 nmdc:mga0sz30_29578_c1 3300050516 Bacteria 2259
775 nmdc:mga0sz30_44_c1 3300050516 Bacteria 44851
776 Ga0500635_0000489 3300053080 Bacteria 11028
777 Ga0500635_0001292 3300053080 Bacteria 5983
778 Ga0500578_0000420 3300053086 Bacteria 51926
779 Ga0500643_008792 3300053087 Bacteria 3926
780 Ga0500643_009931 3300053087 Bacteria 3590
781 Ga0500643_011734 3300053087 Bacteria 3177
782 Ga0500643_022035 3300053087 Bacteria 2057
783 Ga0500644_0000274 3300053088 Bacteria 28730
784 Ga0500646_0007952 3300053090 Bacteria 2711
785 Ga0500641_0000486 3300053096 Bacteria 14448
786 Ga0500641_0010426 3300053096 Bacteria 3358
787 Ga0500641_0010581 3300053096 Bacteria 3336
788 Ga0500554_001836 3300053102 Bacteria 4100
789 Ga0500556_0000587 3300053104 Bacteria 23997
790 Ga0500556_0001909 3300053104 Bacteria 7444
791 Ga0500557_000050 3300053105 Bacteria 54589
792 Ga0500562_000021 3300053108 Bacteria 112425
793 Ga0500562_000519 3300053108 Bacteria 9336
794 Ga0500562_002122 3300053108 Bacteria 4955
795 Ga0500593_000050 3300053117 Bacteria 42339
796 Ga0500594_0003103 3300053118 Bacteria 3634
797 Ga0500595_002565 3300053119 Bacteria 8893
798 Ga0500595_007222 3300053119 Bacteria 4625
799 Ga0500608_000080 3300053122 Bacteria 40873
800 Ga0500608_000397 3300053122 Bacteria 16687
801 Ga0500608_002327 3300053122 Bacteria 6895
802 Ga0500618_000112 3300053125 Bacteria 65643
803 Ga0500642_0000065 3300053130 Bacteria 57974
804 Ga0500658_0001458 3300053134 Bacteria 9461
805 Ga0500559_0000077 3300053136 Bacteria 76287
806 Ga0500559_0000111 3300053136 Bacteria 64064
807 Ga0500564_000021 3300053138 Bacteria 47765
808 Ga0500568_0000001 3300053139 Bacteria 988705
809 Ga0500588_0005049 3300053146 Bacteria 2903
810 Ga0500590_021481 3300053148 Bacteria 3350
811 Ga0500604_0000078 3300053151 Bacteria 34635
812 Ga0500616_0018371 3300053153 Bacteria 3955
813 Ga0500622_0000526 3300053156 Bacteria 35500
814 Ga0500622_0007443 3300053156 Bacteria 6218
815 Ga0500624_000001 3300053157 Bacteria 284974
816 Ga0500624_000045 3300053157 Bacteria 89838
817 Ga0500627_0009954 3300053158 Bacteria 3447
818 Ga0500645_000353 3300053730 Bacteria 32638
819 Ga0500645_000461 3300053730 Bacteria 27834
820 Ga0500645_001891 3300053730 Bacteria 9997
821 Ga0500645_002164 3300053730 Bacteria 9004
822 Ga0500596_000572 3300053735 Bacteria 7020
823 Ga0501084_0018508 3300054114 Bacteria 5798
824 Ga0501084_0049834 3300054114 Bacteria 3505
825 Ga0501084_0098628 3300054114 Bacteria 2453
826 Ga0501082_0004153 3300060353 Bacteria 12655
827 Ga0501082_0054287 3300060353 Bacteria 3453
828 Ga0501082_0258071 3300060353 Bacteria 1516
829 Ga0466962_0000345 3300061719 Bacteria 19915
830 Ga0530510_0013704 3300061734 Bacteria 5706
831 Ga0530510_0017724 3300061734 Bacteria 5046
832 2644547923 2643221699 Bacteria 5731501
833 2509387515 2509276021 Bacteria 7634384
834 2510840150 2510461069 Bacteria 5505000
835 2511125408 2510917020 Bacteria 5657507
836 2511127112 2510917021 Bacteria 5705459
837 2512033972 2511231221 Bacteria 6846400
838 2513592719 2513237087 Bacteria 5817514
839 2514420062 2513237305 Bacteria 7293571
840 2515111463 2515075009 Bacteria 7288508
841 2548846988 2547132512 Bacteria 3416496
842 2585148510 2582581279 Bacteria 4980720
843 2585153099 2582581280 Bacteria 5994497
844 2585196661 2582581293 Bacteria 5907401
845 2587916721 2585428106 Bacteria 5179711
846 2599741020 2599185239 Bacteria 8686614
847 2600201021 2599185354 Bacteria 4398675
848 2643751417 2643221545 Bacteria 5083237
849 2643778207 2643221552 Bacteria 5708754
850 2643883259 2643221574 Bacteria 2789653
851 2643923489 2643221583 Bacteria 5218014
852 2643928414 2643221584 Bacteria 5511711
853 2644000277 2643221598 Bacteria 4578346
854 2644040207 2643221605 Bacteria 4772303
855 2644084959 2643221614 Bacteria 4260023
856 2644225747 2643221640 Bacteria 5258820
857 2644235236 2643221642 Bacteria 5357871
858 2644342511 2643221661 Bacteria 4267604
859 2644351902 2643221663 Bacteria 3425771
860 2644365811 2643221666 Bacteria 4265935
861 2644510530 2643221691 Bacteria 5093099
862 2715499639 2713897090 Bacteria 3353799
863 2723575579 2721755686 Bacteria 7343952
864 2738946388 2738541317 Bacteria 5340176
865 2739791273 2739367756 Bacteria 4553612
866 2740030137 2739367865 Bacteria 4114482
867 2753765313 2751185897 Bacteria 5322941
868 2778123689 2775507255 Bacteria 3945731
869 2792460622 2791355048 Bacteria 5832535
870 2819536600 2818991435 Bacteria 5433759
871 2819550569 2818991438 Bacteria 5793701
872 2819645761 2818991454 Bacteria 5563326
873 2828310123 2828305725 Bacteria 4916900
874 2834579933 2834578030 Bacteria 3530182
875 2840883813 2840878972 Bacteria 5483153
876 2841739465 2841734538 Bacteria 6784580
877 2841865299 2841864319 Bacteria 6742987
878 2842334877 2842333319 Bacteria 8899485
879 2842343423 2842341865 Bacteria 7003929
880 2842365437 2842363717 Bacteria 6844742
881 2842696911 2842694124 Bacteria 4063419
882 2843747775 2843744320 Bacteria 5659202
883 2847675781 2847670302 Bacteria 6165597
884 2847692427 2847686936 Bacteria 6278406
885 2849565354 2849560528 Bacteria 5393480
886 2849578417 2849573788 Bacteria 5421256
887 2851153806 2851153111 Bacteria 5542585
888 2854682736 2854681122 Bacteria 4548679
889 2855022844 2855020534 Bacteria 3204685
890 2856319718 2856314179 Bacteria 6477897
891 2857506365 2857504554 Bacteria 5369913
892 2871501218 2871495908 Bacteria 6935695
893 2874107506 2874102143 Bacteria 6342645
894 2874123865 2874123672 Bacteria 7238285
895 2876375664 2876369609 Bacteria 6807521
896 2876398626 2876392853 Bacteria 6660880
897 2878040901 2878035449 Bacteria 6555736
898 2878765198 2878760144 Bacteria 6823465
899 2878772905 2878767105 Bacteria 6898628
900 2881151701 2881147464 Bacteria 7779814
901 2881167719 2881161766 Bacteria 7127907
902 2882636462 2882632389 Bacteria 8154593
903 2882807681 2882806704 Bacteria 3007728
904 2884965114 2884960567 Bacteria 5437054
905 2885309608 2885305155 Bacteria 7348390
906 2885330632 2885326080 Bacteria 7134805
907 2885338941 2885334103 Bacteria 7216818
908 2894818408 2894817345 Bacteria 4892941
909 2895886317 2895880812 Bacteria 11255272
910 2896430526 2896429255 Bacteria 2557483
911 2898329521 2898329390 Bacteria 5168154
912 2898796198 2898795034 Bacteria 4294459
913 2899261570 2899259804 Bacteria 3320927
914 2899275703 2899275550 Bacteria 3958688
915 2899807898 2899803654 Bacteria 5577784
916 2903546029 2903540706 Bacteria 7062119
917 2904665181 2904659560 Bacteria 6685615
918 2906329840 2906328253 Bacteria 6585166
919 2906420438 2906414383 Bacteria 6580790
920 2913310801 2913308742 Bacteria 5350706
921 2917557042 2917554339 Bacteria 4987857
922 2919680996 2919679072 Bacteria 4629602
923 2919710013 2919709256 Bacteria 4318106
924 2922160460 2922158528 Bacteria 6573167
925 2924732323 2924726620 Bacteria 6271473
926 2924767191 2924762789 Bacteria 6561353
927 2928535387 2928531327 Bacteria 5101314
928 2928975122 2928972540 Bacteria 3058286
929 2929139680 2929138655 Bacteria 5810547
930 2937824663 2937822353 Bacteria 7290551
931 2937893650 2937891427 Bacteria 6357007
932 2937999887 2937994558 Bacteria 7036190
933 2941488429 2941485952 Bacteria 3591484
934 2958118626 2958115193 Bacteria 6923548
935 2958170350 2958165035 Bacteria 6906348
936 2961120182 2961114664 Bacteria 6680456
937 2961168805 2961163497 Bacteria 6901077
938 2965024092 2965018300 Bacteria 6883036
939 2968096441 2968091066 Bacteria 6052692
940 2968101179 2968097103 Bacteria 6107094
941 2968116539 2968110612 Bacteria 6814636
942 2968132231 2968128360 Bacteria 6270294
943 2968177199 2968171901 Bacteria 6894245
944 2970560045 2970554993 Bacteria 6814252
945 2977241885 2977240413 Bacteria 3191065
946 2977861097 2977858184 Bacteria 6215359
947 2977866911 2977864932 Bacteria 7534097
948 2979780168 2979779861 Bacteria 6219781
949 2987664836 2987659509 Bacteria 6966464
950 2987669045 2987666974 Bacteria 6509233
951 3000409113 3000405567 Bacteria 3779330
952 3004193893 3004188549 Bacteria 6952365
953 8002063545 8002060224 Bacteria 4026565
954 8004447518 8004445564 Bacteria 6322258
955 8004709528 8004703790 Bacteria 8006957
956 8005462109 8005460587 Bacteria 7157962
957 8021123174 8021120328 Bacteria 8782274
958 8045865199 8045864390 Bacteria 5043873
959 8046769344 8046767195 Bacteria 7547379
960 8054307344 8054302542 Bacteria 5698134
961 8057133051 8057132660 Bacteria 4061191
962 8057577135 8057575449 Bacteria 7367519
963 JGI24736J21556_1000469
964 JGI24740J21852_10002149
965 JGI24740J21852_10011083
966 JGI24735J21928_10001159
967 JGI24735J21928_10001163
968 JGI24738J21930_10003997
969 JGI25157J39369_1000707
970 Ga0055537_1005923
971 Ga0055536_1005242
972 Ga0055536_1005282
973 Ga0055536_1008966
974 Ga0055528_1005371
975 Ga0055530_10000647
976 Ga0055530_10001148
977 Ga0055530_10006282
978 Ga0055530_10011836
979 Ga0055531_10003600
980 Ga0055531_10008745
981 Ga0055531_10014013
982 Ga0065165_1000845
983 Ga0065165_1003786
984 Ga0065165_1005117
985 Ga0065704_10070237
986 Ga0065707_10000608
987 Ga0070658_10000125
988 Ga0070658_10013254
989 Ga0070658_10083602
990 Ga0070658_10093326
991 Ga0070658_10172058
992 Ga0070683_100019454
993 Ga0070670_100000037
994 Ga0070677_10000656
995 Ga0070680_100002884
996 Ga0070680_100003695
997 Ga0070680_100029645
998 Ga0070680_100030844
999 Ga0070680_100072505
1000 Ga0070680_100102079
1001 Ga0070682_100012466
1002 Ga0068868_100000001
1003 Ga0070660_100003034
1004 Ga0070660_100005715
1005 Ga0070660_100028150
1006 Ga0070660_100114842
1007 Ga0070689_100072270
1008 Ga0070691_10002895
1009 Ga0070691_10019229
1010 Ga0070691_10026589
1011 Ga0070661_100014744
1012 Ga0070661_100026358
1013 Ga0070668_100000018
1014 Ga0070668_100002188
1015 Ga0070668_100074951
1016 Ga0070669_100000329
1017 Ga0070669_100023151
1018 Ga0070675_100127929
1019 Ga0070671_100001250
1020 Ga0070671_100024938
1021 Ga0070671_100026330
1022 Ga0070659_100000001
1023 Ga0070659_100026185
1024 Ga0070659_100067276
1025 Ga0070659_100096585
1026 Ga0070659_100104104
1027 Ga0070667_100000083
1028 Ga0070667_100010505
1029 Ga0070714_100016732
1030 Ga0070713_100001498
1031 Ga0070705_100041450
1032 Ga0070663_100000958
1033 Ga0070663_100001663
1034 Ga0070663_100008703
1035 Ga0070663_100018515
1036 Ga0070663_100032434
1037 Ga0070681_10020073
1038 Ga0070681_10032415
1039 Ga0070681_10227695
1040 Ga0070679_100005502
1041 Ga0070679_100006911
1042 Ga0070679_100022016
1043 Ga0070679_100050766
1044 Ga0070679_100063706
1045 Ga0070684_100002726
1046 Ga0068853_100005921
1047 Ga0068853_100010858
1048 Ga0068853_100015961
1049 Ga0068853_100022761
1050 Ga0068853_100025697
1051 Ga0068853_100081486
1052 Ga0068853_100127855
1053 Ga0070686_100000597
1054 Ga0070695_100032791
1055 Ga0070665_100000116
1056 Ga0070665_100000334
1057 Ga0070665_100000883
1058 Ga0070665_100005159
1059 Ga0070704_100025527
1060 Ga0068855_100031052
1061 Ga0068855_100051832
1062 Ga0068855_100059691
1063 Ga0068855_100060289
1064 Ga0068855_100066595
1065 Ga0068855_100092635
1066 Ga0068855_100160596
1067 Ga0070664_100003103
1068 Ga0070664_100065815
1069 Ga0068857_100068835
1070 Ga0068857_100108075
1071 Ga0068857_100179160
1072 Ga0068854_100010766
1073 Ga0068854_100011856
1074 Ga0068856_100012156
1075 Ga0068852_100000387
1076 Ga0068852_100006174
1077 Ga0068852_100007731
1078 Ga0068852_100134989
1079 Ga0068852_100145389
1080 Ga0068859_100021262
1081 Ga0068859_100057359
1082 Ga0068864_100000116
1083 Ga0068864_100000363
1084 Ga0068861_100097602
1085 Ga0068861_100116950
1086 Ga0068851_10011399
1087 Ga0068851_10019055
1088 Ga0068863_100000007
1089 Ga0068863_100000122
1090 Ga0068863_100003837
1091 Ga0068863_100014998
1092 Ga0068863_100039222
1093 Ga0068863_100059984
1094 Ga0068863_100060215
1095 Ga0068863_100075817
1096 Ga0068858_100000853
1097 Ga0068858_100004079
1098 Ga0068858_100012038
1099 Ga0068858_100043412
1100 Ga0068858_100144316
1101 Ga0068860_100000348
1102 Ga0068860_100001231
1103 Ga0068860_100063874
1104 Ga0068860_100066828
1105 Ga0068862_100000067
1106 Ga0068862_100000235
1107 Ga0068862_100026581
1108 Ga0081455_10001031
1109 Ga0081455_10006263
1110 Ga0081455_10014607
1111 Ga0081540_1001263
1112 Ga0081540_1001383
1113 Ga0070717_10024295
1114 Ga0075365_10000227
1115 Ga0075365_10022854
1116 Ga0075368_10000991
1117 Ga0075368_10006977
1118 Ga0075363_100000062
1119 Ga0075363_100026434
1120 Ga0075363_100038716
1121 Ga0075364_10000935
1122 Ga0075364_10001197
1123 Ga0075364_10013747
1124 Ga0075364_10078826
1125 Ga0075432_10000094
1126 Ga0075362_10002672
1127 Ga0075362_10015878
1128 Ga0075367_10000119
1129 Ga0075367_10009476
1130 Ga0075367_10094182
1131 Ga0075369_10000060
1132 Ga0075369_10014705
1133 Ga0075427_10000023
1134 Ga0075366_10000596
1135 Ga0075366_10005099
1136 Ga0075366_10051698
1137 Ga0075370_10000043
1138 Ga0075370_10000066
1139 Ga0075370_10020413
1140 Ga0075370_10023778
1141 Ga0075370_10056584
1142 Ga0075433_10026622
1143 Ga0075434_100122090
1144 Ga0075429_100006297
1145 Ga0075436_100012782
1146 Ga0097620_100021262
1147 Ga0097620_100057357
1148 Ga0075435_100016479
1149 Ga0075435_100125914
1150 Ga0105250_10002835
1151 Ga0105250_10005265
1152 Ga0105240_10000305
1153 Ga0105240_10010558
1154 Ga0105240_10019011
1155 Ga0105240_10041126
1156 Ga0105240_10133888
1157 Ga0105245_10085797
1158 Ga0105247_10003856
1159 Ga0114129_10370390
1160 Ga0105241_10060054
1161 Ga0105248_10000059
1162 Ga0105248_10000071
1163 Ga0105248_10000438
1164 Ga0105248_10045112
1165 Ga0105248_10090660
1166 Ga0105237_10003515
1167 Ga0105237_10074969
1168 Ga0105238_10011427
1169 Ga0105238_10014487
1170 Ga0105238_10027868
1171 Ga0105238_10028949
1172 Ga0105238_10029957
1173 Ga0105238_10049267
1174 Ga0105249_10000105
1175 Ga0105249_10009441
1176 Ga0105249_10011902
1177 Ga0105249_10046170
1178 Ga0105239_10000037
1179 Ga0105239_10107230
1180 Ga0105246_10017989
1181 Ga0157373_10019439
1182 Ga0157373_10030864
1183 Ga0157373_10060215
1184 Ga0157370_10018896
1185 Ga0157370_10028965
1186 Ga0157370_10037299
1187 Ga0157370_10046511
1188 Ga0157370_10064818
1189 Ga0157370_10214112
1190 Ga0157369_10066871
1191 Ga0157369_10088770
1192 Ga0157369_10149285
1193 Ga0163162_10090862
1194 Ga0157372_10013006
1195 Ga0157372_10029019
1196 Ga0157372_10202608
1197 Ga0157375_10171314
1198 Ga0183365_10002
1199 Ga0163161_10060355
1200 Ga0213873_10001565
1201 Ga0213872_10001454
1202 Ga0213872_10005154
1203 Ga0213874_10025668
1204 Ga0213876_10000544
1205 Ga0213876_10000716
1206 Ga0213876_10003346
1207 Ga0213875_10016246
1208 Ga0213871_10006931
1209 Ga0209566_100542
1210 Ga0209674_101649
1211 Ga0209148_1000465
1212 Ga0209759_1000057
1213 Ga0209565_1000332
1214 Ga0209676_1000327
1215 Ga0209676_1000409
1216 Ga0209758_1002592
1217 Ga0209758_1005274
1218 Ga0209050_1000101
1219 Ga0209050_1000217
1220 Ga0209050_1004277
1221 Ga0209050_1005272
1222 Ga0209050_1013083
1223 Ga0209256_1002189
1224 Ga0209256_1003655
1225 Ga0209257_1000178
1226 Ga0209257_1000220
1227 Ga0209257_1000386
1228 Ga0209257_1005253
1229 Ga0209257_1005921
1230 Ga0209257_1009127
1231 Ga0207682_10000833
1232 Ga0207710_10004304
1233 Ga0207647_10001078
1234 Ga0207647_10007591
1235 Ga0207647_10027206
1236 Ga0207645_10006878
1237 Ga0207705_10000004
1238 Ga0207705_10001414
1239 Ga0207705_10005634
1240 Ga0207705_10007304
1241 Ga0207705_10019624
1242 Ga0207705_10041040
1243 Ga0207705_10067491
1244 Ga0207707_10001296
1245 Ga0207707_10034921
1246 Ga0207707_10054709
1247 Ga0207695_10000718
1248 Ga0207695_10001017
1249 Ga0207695_10001195
1250 Ga0207695_10003313
1251 Ga0207695_10007252
1252 Ga0207695_10014240
1253 Ga0207695_10040465
1254 Ga0207671_10007045
1255 Ga0207660_10003153
1256 Ga0207660_10008412
1257 Ga0207657_10001137
1258 Ga0207657_10001303
1259 Ga0207657_10001904
1260 Ga0207657_10008828
1261 Ga0207657_10024687
1262 Ga0207657_10042588
1263 Ga0207649_10021111
1264 Ga0207652_10003865
1265 Ga0207652_10020568
1266 Ga0207652_10047102
1267 Ga0207652_10052024
1268 Ga0207681_10000448
1269 Ga0207694_10008152
1270 Ga0207694_10011507
1271 Ga0207694_10022405
1272 Ga0207694_10042460
1273 Ga0207694_10056099
1274 Ga0207694_10078125
1275 Ga0207650_10000062
1276 Ga0207659_10106133
1277 Ga0207687_10027427
1278 Ga0207644_10000003
1279 Ga0207644_10000602
1280 Ga0207644_10006348
1281 Ga0207644_10021731
1282 Ga0207644_10022690
1283 Ga0207690_10000051
1284 Ga0207690_10000053
1285 Ga0207690_10003079
1286 Ga0207690_10005435
1287 Ga0207690_10008542
1288 Ga0207706_10046633
1289 Ga0207706_10123176
1290 Ga0207670_10038590
1291 Ga0207711_10001604
1292 Ga0207711_10016191
1293 Ga0207679_10005151
1294 Ga0207667_10007334
1295 Ga0207667_10008988
1296 Ga0207667_10043233
1297 Ga0207667_10092888
1298 Ga0207667_10107443
1299 Ga0207667_10151876
1300 Ga0207667_10198713
1301 Ga0207651_10017670
1302 Ga0207712_10000015
1303 Ga0207712_10003975
1304 Ga0207712_10017866
1305 Ga0207712_10018228
1306 Ga0207712_10030942
1307 Ga0207668_10000342
1308 Ga0207668_10001123
1309 Ga0207668_10003651
1310 Ga0207668_10066068
1311 Ga0207640_10000535
1312 Ga0207640_10021214
1313 Ga0207640_10043541
1314 Ga0207658_10000218
1315 Ga0207658_10001134
1316 Ga0207658_10023073
1317 Ga0207658_10033721
1318 Ga0207677_10000013
1319 Ga0207677_10004145
1320 Ga0207677_10107112
1321 Ga0207703_10000038
1322 Ga0207703_10002707
1323 Ga0207703_10005677
1324 Ga0207639_10000260
1325 Ga0207639_10031700
1326 Ga0207639_10042224
1327 Ga0207678_10000104
1328 Ga0207678_10000716
1329 Ga0207678_10051842
1330 Ga0207702_10015322
1331 Ga0207641_10000001
1332 Ga0207641_10000012
1333 Ga0207641_10005823
1334 Ga0207641_10021395
1335 Ga0207641_10052619
1336 Ga0207676_10000179
1337 Ga0207676_10000437
1338 Ga0207676_10045215
1339 Ga0207674_10003125
1340 Ga0207674_10024869
1341 Ga0207675_100025874
1342 Ga0207675_100079812
1343 Ga0207675_100094527
1344 Ga0207675_100137525
1345 Ga0207683_10184130
1346 Ga0207698_10000193
1347 Ga0207698_10003399
1348 Ga0207698_10003964
1349 Ga0207698_10010338
1350 Ga0207698_10046164
1351 Ga0209389_1000117
1352 Ga0209489_109135
1353 Ga0209700_100021
1354 Ga0209813_10000053
1355 Ga0209813_10000873
1356 Ga0209813_10002965
1357 Ga0207428_10035873
1358 Ga0268266_10000064
1359 Ga0268266_10001119
1360 Ga0268266_10003430
1361 Ga0268266_10008959
1362 Ga0268265_10000021
1363 Ga0268265_10000600
1364 Ga0268265_10045113
1365 Ga0268264_10000046
1366 Ga0268264_10000059
1367 Ga0268264_10000330
1368 Ga0268264_10032863
1369 Ga0268264_10046476
1370 Ga0268264_10098912
1371 Ga0265337_1001337
1372 Ga0265334_10001279
1373 Ga0307517_10006007
1374 Ga0307515_10101092
1375 Ga0265338_10033178
1376 Ga0265338_10038295
1377 Ga0265338_10095129
1378 Ga0307511_10053071
1379 Ga0265330_10006479
1380 Ga0265330_10046044
1381 Ga0265330_10064138
1382 Ga0265332_10000016
1383 Ga0265329_10006065
1384 Ga0265340_10031218
1385 Ga0265339_10034446
1386 Ga0265339_10069712
1387 Ga0265331_10000695
1388 Ga0265331_10008614
1389 Ga0265331_10010985
1390 Ga0265331_10011789
1391 Ga0265327_10000588
1392 Ga0265327_10000602
1393 Ga0265327_10002222
1394 Ga0265327_10004643
1395 Ga0265327_10019344
1396 Ga0265327_10041024
1397 Ga0265327_10062793
1398 Ga0265316_10000169
1399 Ga0307513_10000261
1400 Ga0307513_10004825
1401 Ga0307513_10014216
1402 Ga0307513_10021686
1403 Ga0307408_100025242
1404 Ga0316575_10000032
1405 Ga0265342_10088293
1406 Ga0316576_10016359
1407 Ga0316578_10017916
1408 Ga0307516_10000352
1409 Ga0307405_10026182
1410 Ga0307413_10019680
1411 Ga0307413_10044707
1412 Ga0307410_10000957
1413 Ga0307406_10002549
1414 Ga0307406_10031861
1415 Ga0307412_10148330
1416 Ga0307409_100030371
1417 Ga0307409_100145419
1418 Ga0307416_100034538
1419 Ga0307414_10040568
1420 Ga0307414_10061493
1421 Ga0307411_10001513
1422 Ga0307411_10007647
1423 Ga0307415_100013094
1424 Ga0316583_10028121
1425 Ga0316593_10000364
1426 Ga0373953_0009093
1427 Ga0373946_0015362
1428 Ga0373955_0001026
1429 Ga0373961_0003522
1430 Ga0316574_0000274
1431 Ga0373931_0053499
1432 Ga0373935_0046449
1433 Ga0373927_0103826
1434 Ga0373933_0024125
1435 Ga0373937_0002849
1436 Ga0316584_0029523
1437 Ga0373925_0000061
1438 Ga0395899_0000013
1439 Ga0395899_0000151
1440 Ga0395899_0000167
1441 Ga0395899_0000804
1442 Ga0395899_0000885
1443 Ga0395899_0009300
1444 Ga0395899_0012431
1445 Ga0395899_0022192
1446 Ga0395899_0086958
1447 Ga0395900_0000009
1448 Ga0395900_0000020
1449 Ga0395900_0000031
1450 Ga0395900_0001255
1451 Ga0395900_0002764
1452 Ga0395900_0029097
1453 Ga0395900_0059667
1454 Ga0395900_0121552
1455 Ga0395900_0147150
1456 Ga0395900_0191156
1457 Ga0395898_0000104
1458 Ga0395898_0006464
1459 Ga0395898_0018445
1460 Ga0395898_0027194
1461 Ga0395898_0032773
1462 Ga0395898_0049253
1463 Ga0395905_0000019
1464 Ga0395905_0000271
1465 Ga0395905_0000458
1466 Ga0395905_0001765
1467 Ga0395905_0007899
1468 Ga0395905_0073033
1469 Ga0395905_0105913
1470 Ga0395905_0184082
1471 Ga0436364_0238815
1472 Ga0436364_0414769
1473 Ga0395901_0000014
1474 Ga0395901_0000016
1475 Ga0395901_0000035
1476 Ga0395901_0001264
1477 Ga0395901_0006984
1478 Ga0395901_0008542
1479 Ga0395901_0043872
1480 Ga0395901_0147294
1481 Ga0395901_0217321
1482 Ga0395901_0220860
1483 Ga0400485_03094
1484 Ga0400483_135188
1485 Ga0400483_198091
1486 Ga0436365_0400394
1487 Ga0436365_0835883
1488 Ga0436365_0886091
1489 Ga0436360_0197367
1490 Ga0436361_0496775
1491 Ga0436361_0917304
1492 Ga0436363_0609059
1493 Ga0436363_1027775
1494 Ga0436363_1720929
1495 Ga0436362_0516986
1496 Ga0439446_0015224
1497 Ga0439460_0012638
1498 Ga0450901_002064
1499 Ga0466969_0000193
1500 Ga0466966_0000688
1501 Ga0466966_0031712
1502 Ga0466966_0076533
1503 Ga0466961_0003224
1504 Ga0466963_0001435
1505 Ga0466963_0043037
1506 Ga0466963_0100827
1507 Ga0466963_0128588
1508 Ga0466971_0002179
1509 Ga0466970_0065108
1510 Ga0466957_0002794
1511 Ga0466959_0000118
1512 Ga0451576_0000034
1513 Ga0451576_0059690
1514 Ga0466958_0000398
1515 Ga0466958_0036198
1516 Ga0495627_001043
1517 Ga0495590_0019068
1518 Ga0495650_0000017
1519 Ga0495584_0015466
1520 Ga0495585_0077303
1521 Ga0495596_0000288
1522 Ga0495583_0000020
1523 Ga0495583_0000426
1524 Ga0495606_0023713
1525 Ga0495610_0000030
1526 Ga0495610_0000908
1527 Ga0495610_0007741
1528 Ga0495616_0001591
1529 Ga0495620_0017326
1530 Ga0495632_0060259
1531 Ga0495637_0002075
1532 Ga0495648_0000948
1533 Ga0495648_0003360
1534 Ga0495654_0000216
1535 Ga0495621_0014749
1536 Ga0495597_0047282
1537 Ga0495633_0002271
1538 Ga0495668_0000092
1539 Ga0495668_0006535
1540 Ga0495668_0015161
1541 Ga0495668_0016490
1542 Ga0495669_0000003
1543 Ga0495669_0000234
1544 Ga0495649_0000345
1545 Ga0495672_0001561
1546 Ga0495677_0005616
1547 Ga0495679_005032
1548 Ga0495673_0000078
1549 Ga0495673_0000401
1550 Ga0495681_0000011
1551 Ga0495686_0003214
1552 Ga0495686_0011256
1553 Ga0496101_0034152
1554 Ga0496102_0062324
1555 Ga0496103_0008642
1556 Ga0496103_0103884
1557 Ga0496104_0009696
1558 Ga0496105_0006289
1559 Ga0496106_0002158
1560 Ga0496106_0002226
1561 Ga0496106_0005334
1562 Ga0496106_0179652
1563 Ga0496107_0001868
1564 Ga0496107_0060523
1565 Ga0496107_0084790
1566 Ga0496107_0131617
1567 Ga0496108_0002227
1568 Ga0496108_0034941
1569 Ga0496109_0002047
1570 Ga0496109_0023339
1571 Ga0496109_0060051
1572 Ga0496110_0026758
1573 Ga0496110_0097858
1574 Ga0496111_0008316
1575 Ga0496111_0014620
1576 Ga0496112_0003678
1577 Ga0496112_0025671
1578 Ga0496112_0036881
1579 Ga0496112_0045422
1580 Ga0496112_0068585
1581 Ga0496113_0001823
1582 Ga0496113_0001984
1583 Ga0496113_0076057
1584 Ga0496114_0007532
1585 Ga0496114_0024978
1586 Ga0496114_0094783
1587 Ga0496115_0000571
1588 Ga0496115_0000794
1589 Ga0496115_0001409
1590 Ga0496116_0000019
1591 Ga0496116_0000039
1592 Ga0496117_0054267
1593 Ga0496118_0020178
1594 Ga0496119_0003333
1595 Ga0496119_0011136
1596 Ga0496120_0036784
1597 Ga0496121_0000001
1598 Ga0496121_0000009
1599 Ga0496121_0000018
1600 Ga0496121_0001392
1601 Ga0496121_0004259
1602 Ga0496121_0030838
1603 Ga0496121_0035073
1604 Ga0496122_0015650
1605 Ga0496122_0066534
1606 Ga0496123_0003680
1607 Ga0496123_0005251
1608 Ga0496124_0002764
1609 Ga0496125_0000001
1610 Ga0496125_0000749
1611 Ga0496125_0002786
1612 Ga0496125_0007529
1613 Ga0496125_0078257
1614 Ga0496126_0000041
1615 Ga0496126_0001877
1616 Ga0496126_0071794
1617 Ga0495678_001720
1618 Ga0501031_0000019
1619 Ga0501032_0000009
1620 Ga0501032_0003255
1621 Ga0501033_0000019
1622 Ga0501033_0002053
1623 Ga0501033_0041719
1624 Ga0501033_0074012
1625 Ga0501034_0000044
1626 Ga0501034_0000176
1627 Ga0501034_0014235
1628 Ga0501034_0072566
1629 Ga0501034_0090118
1630 Ga0501034_0105144
1631 Ga0501034_0198704
1632 Ga0501036_0000008
1633 Ga0501036_0025756
1634 Ga0501036_0039031
1635 Ga0501036_0089461
1636 Ga0501037_0000055
1637 Ga0501038_0000006
1638 Ga0501038_0011223
1639 Ga0501038_0160191
1640 Ga0501038_0181333
1641 Ga0501039_0000014
1642 Ga0501039_0016254
1643 Ga0501039_0085206
1644 Ga0501040_0010441
1645 Ga0501040_0057621
1646 Ga0501041_0024027
1647 Ga0501041_0053334
1648 Ga0501042_0007634
1649 Ga0501042_0025516
1650 Ga0501043_0021029
1651 Ga0501043_0071258
1652 Ga0501046_0001115
1653 Ga0501046_0003242
1654 Ga0501047_0000290
1655 Ga0501047_0008388
1656 Ga0501047_0036257
1657 Ga0501047_0085685
1658 Ga0501047_0210013
1659 Ga0501048_0021203
1660 Ga0501048_0050050
1661 Ga0501048_0059997
1662 Ga0501067_0000905
1663 Ga0501067_0001682
1664 Ga0501070_0002529
1665 Ga0501070_0063518
1666 Ga0501070_0111973
1667 Ga0501071_0005547
1668 Ga0501071_0100061
1669 Ga0501072_0004184
1670 Ga0501073_0000018
1671 Ga0501073_0003442
1672 Ga0501074_0044326
1673 Ga0501074_0081192
1674 Ga0501075_0009175
1675 Ga0501075_0105082
1676 Ga0501076_0010765
1677 Ga0501076_0049755
1678 Ga0501077_0000026
1679 Ga0501077_0027418
1680 Ga0501257_000095
1681 Ga0501079_0004232
1682 Ga0501079_0017813
1683 Ga0501079_0056185
1684 Ga0501080_0000003
1685 Ga0501080_0001057
1686 Ga0501080_0005874
1687 Ga0501080_0045353
1688 Ga0501080_0050525
1689 Ga0501080_0061944
1690 Ga0501081_0008312
1691 Ga0501081_0009224
1692 Ga0501083_0021296
1693 Ga0501280_002283
1694 Ga0501035_0000096
1695 Ga0501035_0000384
1696 Ga0501035_0051742
1697 Ga0501035_0054473
1698 Ga0501035_0077431
1699 Ga0501035_0208548
1700 Ga0501044_0000017
1701 Ga0501044_0000570
1702 Ga0501044_0013529
1703 Ga0501044_0030476
1704 Ga0501044_0083632
1705 Ga0501045_0049169
1706 Ga0501045_0124006
1707 nmdc:mga03683_625_c1
1708 nmdc:mga03683_6_c1
1709 nmdc:mga03n38_114044_c1
1710 nmdc:mga03n38_61_c1
1711 nmdc:mga00v17_146_c1
1712 nmdc:mga00v17_322_c1
1713 nmdc:mga00v17_505_c1
1714 nmdc:mga00v17_934_c1
1715 nmdc:mga00v17_99467_c1
1716 nmdc:mga0yw44_57_c1
1717 nmdc:mga0k408_6_c1
1718 nmdc:mga06z11_105_c1
1719 nmdc:mga06z11_12375_c1
1720 nmdc:mga06z11_147_c1
1721 nmdc:mga06z11_52078_c1
1722 nmdc:mga04h51_24_c1
1723 nmdc:mga04h51_2624_c1
1724 nmdc:mga07m45_187_c2
1725 nmdc:mga07m45_32659_c1
1726 nmdc:mga07m45_3_c1
1727 nmdc:mga07m45_4_c1
1728 nmdc:mga07m45_66_c1
1729 nmdc:mga09592_40497_c1
1730 nmdc:mga08y16_134810_c1
1731 nmdc:mga08y16_33263_c1
1732 nmdc:mga0n895_207881_c1
1733 nmdc:mga0rr50_39858_c1
1734 nmdc:mga08x19_14_c1
1735 nmdc:mga0sz30_118_c1
1736 nmdc:mga0sz30_29578_c1
1737 nmdc:mga0sz30_44_c1
1738 Ga0500635_0000489
1739 Ga0500635_0001292
1740 Ga0500578_0000420
1741 Ga0500643_008792
1742 Ga0500643_009931
1743 Ga0500643_011734
1744 Ga0500643_022035
1745 Ga0500644_0000274
1746 Ga0500646_0007952
1747 Ga0500641_0000486
1748 Ga0500641_0010426
1749 Ga0500641_0010581
1750 Ga0500554_001836
1751 Ga0500556_0000587
1752 Ga0500556_0001909
1753 Ga0500557_000050
1754 Ga0500562_000021
1755 Ga0500562_000519
1756 Ga0500562_002122
1757 Ga0500593_000050
1758 Ga0500594_0003103
1759 Ga0500595_002565
1760 Ga0500595_007222
1761 Ga0500608_000080
1762 Ga0500608_000397
1763 Ga0500608_002327
1764 Ga0500618_000112
1765 Ga0500642_0000065
1766 Ga0500658_0001458
1767 Ga0500559_0000077
1768 Ga0500559_0000111
1769 Ga0500564_000021
1770 Ga0500568_0000001
1771 Ga0500588_0005049
1772 Ga0500590_021481
1773 Ga0500604_0000078
1774 Ga0500616_0018371
1775 Ga0500622_0000526
1776 Ga0500622_0007443
1777 Ga0500624_000001
1778 Ga0500624_000045
1779 Ga0500627_0009954
1780 Ga0500645_000353
1781 Ga0500645_000461
1782 Ga0500645_001891
1783 Ga0500645_002164
1784 Ga0500596_000572
1785 Ga0501084_0018508
1786 Ga0501084_0049834
1787 Ga0501084_0098628
1788 Ga0501082_0004153
1789 Ga0501082_0054287
1790 Ga0501082_0258071
1791 Ga0466962_0000345
1792 Ga0530510_0013704
1793 Ga0530510_0017724
1794 2644547923
1795 2509387515
1796 2510840150
1797 2511125408
1798 2511127112
1799 2512033972
1800 2513592719
1801 2514420062
1802 2515111463
1803 2548846988
1804 2585148510
1805 2585153099
1806 2585196661
1807 2587916721
1808 2599741020
1809 2600201021
1810 2643751417
1811 2643778207
1812 2643883259
1813 2643923489
1814 2643928414
1815 2644000277
1816 2644040207
1817 2644084959
1818 2644225747
1819 2644235236
1820 2644342511
1821 2644351902
1822 2644365811
1823 2644510530
1824 2715499639
1825 2723575579
1826 2738946388
1827 2739791273
1828 2740030137
1829 2753765313
1830 2778123689
1831 2792460622
1832 2819536600
1833 2819550569
1834 2819645761
1835 2828310123
1836 2834579933
1837 2840883813
1838 2841739465
1839 2841865299
1840 2842334877
1841 2842343423
1842 2842365437
1843 2842696911
1844 2843747775
1845 2847675781
1846 2847692427
1847 2849565354
1848 2849578417
1849 2851153806
1850 2854682736
1851 2855022844
1852 2856319718
1853 2857506365
1854 2871501218
1855 2874107506
1856 2874123865
1857 2876375664
1858 2876398626
1859 2878040901
1860 2878765198
1861 2878772905
1862 2881151701
1863 2881167719
1864 2882636462
1865 2882807681
1866 2884965114
1867 2885309608
1868 2885330632
1869 2885338941
1870 2894818408
1871 2895886317
1872 2896430526
1873 2898329521
1874 2898796198
1875 2899261570
1876 2899275703
1877 2899807898
1878 2903546029
1879 2904665181
1880 2906329840
1881 2906420438
1882 2913310801
1883 2917557042
1884 2919680996
1885 2919710013
1886 2922160460
1887 2924732323
1888 2924767191
1889 2928535387
1890 2928975122
1891 2929139680
1892 2937824663
1893 2937893650
1894 2937999887
1895 2941488429
1896 2958118626
1897 2958170350
1898 2961120182
1899 2961168805
1900 2965024092
1901 2968096441
1902 2968101179
1903 2968116539
1904 2968132231
1905 2968177199
1906 2970560045
1907 2977241885
1908 2977861097
1909 2977866911
1910 2979780168
1911 2987664836
1912 2987669045
1913 3000409113
1914 3004193893
1915 8002063545
1916 8004447518
1917 8004709528
1918 8005462109
1919 8021123174
1920 8045865199
1921 8046769344
1922 8054307344
1923 8057133051
1924 8057577135

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

211

499

0.97

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

130

199

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8beh-assembly1.cif.gz_M cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane tip) 0.986 262 480
8e73-assembly1.cif.gz_4M vigna radiata supercomplex i+iii2 (full bridge) 0.9774 7 482
7ar7-assembly1.cif.gz_M cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.9722 7 482
7zmh-assembly1.cif.gz_4 cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.9673 6 479
8e9g-assembly1.cif.gz_M mycobacterial respiratory complex i with both quinone positions modelled 0.9643 4 484
ID Description Score Start End Superfamily
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9237 6 126 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9062 1 126 1.20.1070.10
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8867 2 128 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8733 1 126 1.20.1070.10
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8433 6 126 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A3B9EFA4-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9947 111 486 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A7Y2PBL1-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9917 270 485 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-K1YWP4-F1-model_v4 Proton-translocating NADH-quinone oxidoreductase, chain M 0.9896 76 485 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A3M1XWU0-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.986 93 486 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A4Q5QT70-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9859 1 242 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039

Map