F486903
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 962 | 496 | 1924 | 498 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221699|2644547923 |
| Length | 572 |
| Sequence | PXILSVVTFLPLVGAGLILLARLFNKGSADGAARWIALITTVAVLAVSAVLVMQFKPELATYQFVERYDWFAAAQYHMGVDGISILFVLLTAFLMPICIVASWXTIXXRVVDYMIAFLVLETLVIGVFTSLDLXXFYIFFEGTLVPMFIIIGVWGGANRIYASYKFFLYTLLGSVLMLLAMLWISVLMLLAMLWIEHFLVLETLVIGVFTSLDLFLFYIFFEGTLVPMFIIIGVWGGANRIYASYKFFLYTLLGSVLMLLAMLWMAAETGTTSIPALKDYAFSPTVQPLLWLAFFASFAVKMPMWPVHTWLPDAHVQAPTAGSVILAGILLKLGGYGFILFNLPMFPAASKMFAPLVFVLSAVAIVYTSLVAFRQTDMKKLIAYSSVAHMGFVTMGIFAGNALGVQGAVFQMLSHGLISGALFLCVGVVYDRMHTREIALYGGLTARMPWFAAIFLLFTMANVGLPGTSGFIGEILTMTGVYGVSTWTALFAATGVIFSAVYALTLYRNVMFGEITNPAMKAITDVDRRELLIFVPLIIGTLWLGVQPGLVLDYTAASVEALTSAFQLAIGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 103 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 164 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 167 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 213 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 275 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 276 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 277 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 324 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 334 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 335 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 336 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 338 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 339 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 340 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 342 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 343 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 344 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 349 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 354 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 356 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 357 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 358 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 359 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 362 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 365 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 366 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 367 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 368 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 369 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 370 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 371 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 372 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 373 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 374 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 375 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 376 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 377 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 378 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 379 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 380 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 381 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 382 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 383 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 384 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 385 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 386 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 387 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 388 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 389 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 390 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 391 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 392 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 393 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 394 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 395 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 396 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 397 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 398 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 399 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 400 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 401 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 402 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 403 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 404 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 405 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 406 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 407 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 408 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 409 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 410 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 411 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 412 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 413 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 414 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 415 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 416 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 417 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 418 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 419 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 420 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 421 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 422 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 423 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 424 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 425 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 426 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 427 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 428 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 429 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 430 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 431 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 432 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 433 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 434 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 435 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 436 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 437 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 438 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 439 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 440 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 441 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 442 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 443 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 444 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 445 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 446 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 447 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 448 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 449 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 450 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 451 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 452 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 453 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 454 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 455 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 456 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 457 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 458 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 459 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 460 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 461 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 462 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 463 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 464 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 465 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 466 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 467 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 468 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 469 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 470 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 471 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 472 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 473 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 474 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 475 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 476 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 477 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 478 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 479 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 480 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 481 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 482 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 483 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 484 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 485 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 486 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 487 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 488 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 489 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 490 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 491 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 492 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 493 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 494 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 495 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
| 496 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.28 |
| Metatranscriptomes | 0.1 |
| Isolates | 13.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.24 |
| Nodule | 5.82 |
| Rhizoplane | 4.05 |
| Rhizosphere | 65.18 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000469 | 3300001904 | Bacteria | 7572 |
| 2 | JGI24740J21852_10002149 | 3300001979 | Bacteria | 9011 |
| 3 | JGI24740J21852_10011083 | 3300001979 | Bacteria | 3444 |
| 4 | JGI24735J21928_10001159 | 3300002067 | Bacteria | 9419 |
| 5 | JGI24735J21928_10001163 | 3300002067 | Bacteria | 9410 |
| 6 | JGI24738J21930_10003997 | 3300002075 | Bacteria | 3661 |
| 7 | JGI25157J39369_1000707 | 3300002741 | Bacteria | 17999 |
| 8 | Ga0055537_1005923 | 3300003773 | Bacteria | 3193 |
| 9 | Ga0055536_1005242 | 3300003781 | Bacteria | 6390 |
| 10 | Ga0055536_1005282 | 3300003781 | Bacteria | 6360 |
| 11 | Ga0055536_1008966 | 3300003781 | Bacteria | 4214 |
| 12 | Ga0055528_1005371 | 3300003790 | Bacteria | 5980 |
| 13 | Ga0055530_10000647 | 3300003791 | Bacteria | 29932 |
| 14 | Ga0055530_10001148 | 3300003791 | Bacteria | 20593 |
| 15 | Ga0055530_10006282 | 3300003791 | Bacteria | 5346 |
| 16 | Ga0055530_10011836 | 3300003791 | Bacteria | 3096 |
| 17 | Ga0055531_10003600 | 3300003794 | Bacteria | 9796 |
| 18 | Ga0055531_10008745 | 3300003794 | Bacteria | 5283 |
| 19 | Ga0055531_10014013 | 3300003794 | Bacteria | 3647 |
| 20 | Ga0065165_1000845 | 3300005262 | Bacteria | 40173 |
| 21 | Ga0065165_1003786 | 3300005262 | Bacteria | 10124 |
| 22 | Ga0065165_1005117 | 3300005262 | Bacteria | 7595 |
| 23 | Ga0065704_10070237 | 3300005289 | Bacteria | 52535 |
| 24 | Ga0065707_10000608 | 3300005295 | Bacteria | 19207 |
| 25 | Ga0070658_10000125 | 3300005327 | Bacteria | 68211 |
| 26 | Ga0070658_10013254 | 3300005327 | Bacteria | 6613 |
| 27 | Ga0070658_10083602 | 3300005327 | Bacteria | 2624 |
| 28 | Ga0070658_10093326 | 3300005327 | Bacteria | 2482 |
| 29 | Ga0070658_10172058 | 3300005327 | Bacteria | 1820 |
| 30 | Ga0070683_100019454 | 3300005329 | Bacteria | 6031 |
| 31 | Ga0070670_100000037 | 3300005331 | Bacteria | 156070 |
| 32 | Ga0070677_10000656 | 3300005333 | Bacteria | 11544 |
| 33 | Ga0070680_100002884 | 3300005336 | Bacteria | 12785 |
| 34 | Ga0070680_100003695 | 3300005336 | Bacteria | 11429 |
| 35 | Ga0070680_100029645 | 3300005336 | Bacteria | 4394 |
| 36 | Ga0070680_100030844 | 3300005336 | Bacteria | 4307 |
| 37 | Ga0070680_100072505 | 3300005336 | Bacteria | 2830 |
| 38 | Ga0070680_100102079 | 3300005336 | Bacteria | 2381 |
| 39 | Ga0070682_100012466 | 3300005337 | Bacteria | 4877 |
| 40 | Ga0068868_100000001 | 3300005338 | Bacteria | 282170 |
| 41 | Ga0070660_100003034 | 3300005339 | Bacteria | 11561 |
| 42 | Ga0070660_100005715 | 3300005339 | Bacteria | 8612 |
| 43 | Ga0070660_100028150 | 3300005339 | Bacteria | 4202 |
| 44 | Ga0070660_100114842 | 3300005339 | Bacteria | 2145 |
| 45 | Ga0070689_100072270 | 3300005340 | Bacteria | 2696 |
| 46 | Ga0070691_10002895 | 3300005341 | Bacteria | 7695 |
| 47 | Ga0070691_10019229 | 3300005341 | Bacteria | 3150 |
| 48 | Ga0070691_10026589 | 3300005341 | Bacteria | 2698 |
| 49 | Ga0070661_100014744 | 3300005344 | Bacteria | 5512 |
| 50 | Ga0070661_100026358 | 3300005344 | Bacteria | 4180 |
| 51 | Ga0070668_100000018 | 3300005347 | Bacteria | 99142 |
| 52 | Ga0070668_100002188 | 3300005347 | Bacteria | 14336 |
| 53 | Ga0070668_100074951 | 3300005347 | Bacteria | 2641 |
| 54 | Ga0070669_100000329 | 3300005353 | Bacteria | 36963 |
| 55 | Ga0070669_100023151 | 3300005353 | Bacteria | 4446 |
| 56 | Ga0070675_100127929 | 3300005354 | Bacteria | 2163 |
| 57 | Ga0070671_100001250 | 3300005355 | Bacteria | 19045 |
| 58 | Ga0070671_100024938 | 3300005355 | Bacteria | 4900 |
| 59 | Ga0070671_100026330 | 3300005355 | Bacteria | 4779 |
| 60 | Ga0070659_100000001 | 3300005366 | Bacteria | 576390 |
| 61 | Ga0070659_100026185 | 3300005366 | Bacteria | 4486 |
| 62 | Ga0070659_100067276 | 3300005366 | Bacteria | 2841 |
| 63 | Ga0070659_100096585 | 3300005366 | Bacteria | 2374 |
| 64 | Ga0070659_100104104 | 3300005366 | Bacteria | 2286 |
| 65 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 66 | Ga0070667_100010505 | 3300005367 | Bacteria | 7646 |
| 67 | Ga0070714_100016732 | 3300005435 | Bacteria | 5929 |
| 68 | Ga0070713_100001498 | 3300005436 | Bacteria | 14893 |
| 69 | Ga0070705_100041450 | 3300005440 | Bacteria | 2625 |
| 70 | Ga0070663_100000958 | 3300005455 | Bacteria | 15673 |
| 71 | Ga0070663_100001663 | 3300005455 | Bacteria | 12303 |
| 72 | Ga0070663_100008703 | 3300005455 | Bacteria | 6257 |
| 73 | Ga0070663_100018515 | 3300005455 | Bacteria | 4569 |
| 74 | Ga0070663_100032434 | 3300005455 | Bacteria | 3600 |
| 75 | Ga0070681_10020073 | 3300005458 | Bacteria | 6696 |
| 76 | Ga0070681_10032415 | 3300005458 | Bacteria | 5244 |
| 77 | Ga0070681_10227695 | 3300005458 | Bacteria | 1779 |
| 78 | Ga0070679_100005502 | 3300005530 | Bacteria | 11741 |
| 79 | Ga0070679_100006911 | 3300005530 | Bacteria | 10585 |
| 80 | Ga0070679_100022016 | 3300005530 | Bacteria | 6226 |
| 81 | Ga0070679_100050766 | 3300005530 | Bacteria | 4131 |
| 82 | Ga0070679_100063706 | 3300005530 | Bacteria | 3675 |
| 83 | Ga0070684_100002726 | 3300005535 | Bacteria | 13054 |
| 84 | Ga0068853_100005921 | 3300005539 | Bacteria | 9651 |
| 85 | Ga0068853_100010858 | 3300005539 | Bacteria | 7379 |
| 86 | Ga0068853_100015961 | 3300005539 | Bacteria | 6174 |
| 87 | Ga0068853_100022761 | 3300005539 | Bacteria | 5237 |
| 88 | Ga0068853_100025697 | 3300005539 | Bacteria | 4942 |
| 89 | Ga0068853_100081486 | 3300005539 | Bacteria | 2834 |
| 90 | Ga0068853_100127855 | 3300005539 | Bacteria | 2271 |
| 91 | Ga0070686_100000597 | 3300005544 | Bacteria | 21352 |
| 92 | Ga0070695_100032791 | 3300005545 | Bacteria | 3247 |
| 93 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 94 | Ga0070665_100000334 | 3300005548 | Bacteria | 72297 |
| 95 | Ga0070665_100000883 | 3300005548 | Bacteria | 38439 |
| 96 | Ga0070665_100005159 | 3300005548 | Bacteria | 13516 |
| 97 | Ga0070704_100025527 | 3300005549 | Bacteria | 3892 |
| 98 | Ga0068855_100031052 | 3300005563 | Bacteria | 6383 |
| 99 | Ga0068855_100051832 | 3300005563 | Bacteria | 4833 |
| 100 | Ga0068855_100059691 | 3300005563 | Bacteria | 4462 |
| 101 | Ga0068855_100060289 | 3300005563 | Bacteria | 4438 |
| 102 | Ga0068855_100066595 | 3300005563 | Bacteria | 4199 |
| 103 | Ga0068855_100092635 | 3300005563 | Bacteria | 3485 |
| 104 | Ga0068855_100160596 | 3300005563 | Bacteria | 2551 |
| 105 | Ga0070664_100003103 | 3300005564 | Bacteria | 13439 |
| 106 | Ga0070664_100065815 | 3300005564 | Bacteria | 3094 |
| 107 | Ga0068857_100068835 | 3300005577 | Bacteria | 3151 |
| 108 | Ga0068857_100108075 | 3300005577 | Bacteria | 2499 |
| 109 | Ga0068857_100179160 | 3300005577 | Bacteria | 1928 |
| 110 | Ga0068854_100010766 | 3300005578 | Bacteria | 5934 |
| 111 | Ga0068854_100011856 | 3300005578 | Bacteria | 5693 |
| 112 | Ga0068856_100012156 | 3300005614 | Bacteria | 8339 |
| 113 | Ga0068852_100000387 | 3300005616 | Bacteria | 29490 |
| 114 | Ga0068852_100006174 | 3300005616 | Bacteria | 8640 |
| 115 | Ga0068852_100007731 | 3300005616 | Bacteria | 7862 |
| 116 | Ga0068852_100134989 | 3300005616 | Bacteria | 2277 |
| 117 | Ga0068852_100145389 | 3300005616 | Bacteria | 2199 |
| 118 | Ga0068859_100021262 | 3300005617 | Bacteria | 6511 |
| 119 | Ga0068859_100057359 | 3300005617 | Bacteria | 3922 |
| 120 | Ga0068864_100000116 | 3300005618 | Bacteria | 79213 |
| 121 | Ga0068864_100000363 | 3300005618 | Bacteria | 39706 |
| 122 | Ga0068861_100097602 | 3300005719 | Bacteria | 2331 |
| 123 | Ga0068861_100116950 | 3300005719 | Bacteria | 2145 |
| 124 | Ga0068851_10011399 | 3300005834 | Bacteria | 4168 |
| 125 | Ga0068851_10019055 | 3300005834 | Bacteria | 3315 |
| 126 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 127 | Ga0068863_100000122 | 3300005841 | Bacteria | 81534 |
| 128 | Ga0068863_100003837 | 3300005841 | Bacteria | 14865 |
| 129 | Ga0068863_100014998 | 3300005841 | Bacteria | 7444 |
| 130 | Ga0068863_100039222 | 3300005841 | Bacteria | 4507 |
| 131 | Ga0068863_100059984 | 3300005841 | Bacteria | 3599 |
| 132 | Ga0068863_100060215 | 3300005841 | Bacteria | 3590 |
| 133 | Ga0068863_100075817 | 3300005841 | Bacteria | 3182 |
| 134 | Ga0068858_100000853 | 3300005842 | Bacteria | 31569 |
| 135 | Ga0068858_100004079 | 3300005842 | Bacteria | 14391 |
| 136 | Ga0068858_100012038 | 3300005842 | Bacteria | 8154 |
| 137 | Ga0068858_100043412 | 3300005842 | Bacteria | 4168 |
| 138 | Ga0068858_100144316 | 3300005842 | Bacteria | 2235 |
| 139 | Ga0068860_100000348 | 3300005843 | Bacteria | 62147 |
| 140 | Ga0068860_100001231 | 3300005843 | Bacteria | 27931 |
| 141 | Ga0068860_100063874 | 3300005843 | Bacteria | 3497 |
| 142 | Ga0068860_100066828 | 3300005843 | Bacteria | 3416 |
| 143 | Ga0068862_100000067 | 3300005844 | Bacteria | 123668 |
| 144 | Ga0068862_100000235 | 3300005844 | Bacteria | 61301 |
| 145 | Ga0068862_100026581 | 3300005844 | Bacteria | 4865 |
| 146 | Ga0081455_10001031 | 3300005937 | Bacteria | 35153 |
| 147 | Ga0081455_10006263 | 3300005937 | Bacteria | 12803 |
| 148 | Ga0081455_10014607 | 3300005937 | Bacteria | 7684 |
| 149 | Ga0081540_1001263 | 3300005983 | Bacteria | 22058 |
| 150 | Ga0081540_1001383 | 3300005983 | Bacteria | 21036 |
| 151 | Ga0070717_10024295 | 3300006028 | Bacteria | 4810 |
| 152 | Ga0075365_10000227 | 3300006038 | Bacteria | 19112 |
| 153 | Ga0075365_10022854 | 3300006038 | Bacteria | 3924 |
| 154 | Ga0075368_10000991 | 3300006042 | Bacteria | 8873 |
| 155 | Ga0075368_10006977 | 3300006042 | Bacteria | 3973 |
| 156 | Ga0075363_100000062 | 3300006048 | Bacteria | 21873 |
| 157 | Ga0075363_100026434 | 3300006048 | Bacteria | 2969 |
| 158 | Ga0075363_100038716 | 3300006048 | Bacteria | 2508 |
| 159 | Ga0075364_10000935 | 3300006051 | Bacteria | 15418 |
| 160 | Ga0075364_10001197 | 3300006051 | Bacteria | 13931 |
| 161 | Ga0075364_10013747 | 3300006051 | Bacteria | 4985 |
| 162 | Ga0075364_10078826 | 3300006051 | Bacteria | 2176 |
| 163 | Ga0075432_10000094 | 3300006058 | Bacteria | 18657 |
| 164 | Ga0075362_10002672 | 3300006177 | Bacteria | 6057 |
| 165 | Ga0075362_10015878 | 3300006177 | Bacteria | 3072 |
| 166 | Ga0075367_10000119 | 3300006178 | Bacteria | 22688 |
| 167 | Ga0075367_10009476 | 3300006178 | Bacteria | 5091 |
| 168 | Ga0075367_10094182 | 3300006178 | Bacteria | 1825 |
| 169 | Ga0075369_10000060 | 3300006186 | Bacteria | 28160 |
| 170 | Ga0075369_10014705 | 3300006186 | Bacteria | 3131 |
| 171 | Ga0075427_10000023 | 3300006194 | Bacteria | 10265 |
| 172 | Ga0075366_10000596 | 3300006195 | Bacteria | 16937 |
| 173 | Ga0075366_10005099 | 3300006195 | Bacteria | 7103 |
| 174 | Ga0075366_10051698 | 3300006195 | Bacteria | 2441 |
| 175 | Ga0075370_10000043 | 3300006353 | Bacteria | 38612 |
| 176 | Ga0075370_10000066 | 3300006353 | Bacteria | 31728 |
| 177 | Ga0075370_10020413 | 3300006353 | Bacteria | 3621 |
| 178 | Ga0075370_10023778 | 3300006353 | Bacteria | 3378 |
| 179 | Ga0075370_10056584 | 3300006353 | Bacteria | 2229 |
| 180 | Ga0075433_10026622 | 3300006852 | Bacteria | 4899 |
| 181 | Ga0075434_100122090 | 3300006871 | Bacteria | 2621 |
| 182 | Ga0075429_100006297 | 3300006880 | Bacteria | 10275 |
| 183 | Ga0075436_100012782 | 3300006914 | Bacteria | 5756 |
| 184 | Ga0097620_100021262 | 3300006931 | Bacteria | 6511 |
| 185 | Ga0097620_100057357 | 3300006931 | Bacteria | 3922 |
| 186 | Ga0075435_100016479 | 3300007076 | Bacteria | 5573 |
| 187 | Ga0075435_100125914 | 3300007076 | Bacteria | 2141 |
| 188 | Ga0105250_10002835 | 3300009092 | Bacteria | 8495 |
| 189 | Ga0105250_10005265 | 3300009092 | Bacteria | 5816 |
| 190 | Ga0105240_10000305 | 3300009093 | Bacteria | 94979 |
| 191 | Ga0105240_10010558 | 3300009093 | Bacteria | 12971 |
| 192 | Ga0105240_10019011 | 3300009093 | Bacteria | 9198 |
| 193 | Ga0105240_10041126 | 3300009093 | Bacteria | 5903 |
| 194 | Ga0105240_10133888 | 3300009093 | Bacteria | 2969 |
| 195 | Ga0105245_10085797 | 3300009098 | Bacteria | 2886 |
| 196 | Ga0105247_10003856 | 3300009101 | Bacteria | 9704 |
| 197 | Ga0114129_10370390 | 3300009147 | Bacteria | 1893 |
| 198 | Ga0105241_10060054 | 3300009174 | Bacteria | 2924 |
| 199 | Ga0105248_10000059 | 3300009177 | Bacteria | 137176 |
| 200 | Ga0105248_10000071 | 3300009177 | Bacteria | 118281 |
| 201 | Ga0105248_10000438 | 3300009177 | Bacteria | 47263 |
| 202 | Ga0105248_10045112 | 3300009177 | Bacteria | 4943 |
| 203 | Ga0105248_10090660 | 3300009177 | Bacteria | 3442 |
| 204 | Ga0105237_10003515 | 3300009545 | Bacteria | 18584 |
| 205 | Ga0105237_10074969 | 3300009545 | Bacteria | 3375 |
| 206 | Ga0105238_10011427 | 3300009551 | Bacteria | 8942 |
| 207 | Ga0105238_10014487 | 3300009551 | Bacteria | 7973 |
| 208 | Ga0105238_10027868 | 3300009551 | Bacteria | 5757 |
| 209 | Ga0105238_10028949 | 3300009551 | Bacteria | 5642 |
| 210 | Ga0105238_10029957 | 3300009551 | Bacteria | 5541 |
| 211 | Ga0105238_10049267 | 3300009551 | Bacteria | 4243 |
| 212 | Ga0105249_10000105 | 3300009553 | Bacteria | 117181 |
| 213 | Ga0105249_10009441 | 3300009553 | Bacteria | 8541 |
| 214 | Ga0105249_10011902 | 3300009553 | Bacteria | 7652 |
| 215 | Ga0105249_10046170 | 3300009553 | Bacteria | 3964 |
| 216 | Ga0105239_10000037 | 3300010375 | Bacteria | 206779 |
| 217 | Ga0105239_10107230 | 3300010375 | Bacteria | 3095 |
| 218 | Ga0105246_10017989 | 3300011119 | Bacteria | 4500 |
| 219 | Ga0157373_10019439 | 3300013100 | Bacteria | 4943 |
| 220 | Ga0157373_10030864 | 3300013100 | Bacteria | 3856 |
| 221 | Ga0157373_10060215 | 3300013100 | Bacteria | 2690 |
| 222 | Ga0157370_10018896 | 3300013104 | Bacteria | 6930 |
| 223 | Ga0157370_10028965 | 3300013104 | Bacteria | 5441 |
| 224 | Ga0157370_10037299 | 3300013104 | Bacteria | 4712 |
| 225 | Ga0157370_10046511 | 3300013104 | Bacteria | 4161 |
| 226 | Ga0157370_10064818 | 3300013104 | Bacteria | 3458 |
| 227 | Ga0157370_10214112 | 3300013104 | Bacteria | 1785 |
| 228 | Ga0157369_10066871 | 3300013105 | Bacteria | 3866 |
| 229 | Ga0157369_10088770 | 3300013105 | Bacteria | 3300 |
| 230 | Ga0157369_10149285 | 3300013105 | Bacteria | 2471 |
| 231 | Ga0163162_10090862 | 3300013306 | Bacteria | 3135 |
| 232 | Ga0157372_10013006 | 3300013307 | Bacteria | 8879 |
| 233 | Ga0157372_10029019 | 3300013307 | Bacteria | 6036 |
| 234 | Ga0157372_10202608 | 3300013307 | Bacteria | 2299 |
| 235 | Ga0157375_10171314 | 3300013308 | Bacteria | 2319 |
| 236 | Ga0183365_10002 | 3300015684 | Bacteria | 545891 |
| 237 | Ga0163161_10060355 | 3300017792 | Bacteria | 2760 |
| 238 | Ga0213873_10001565 | 3300021358 | Bacteria | 3823 |
| 239 | Ga0213872_10001454 | 3300021361 | Bacteria | 15422 |
| 240 | Ga0213872_10005154 | 3300021361 | Bacteria | 6770 |
| 241 | Ga0213874_10025668 | 3300021377 | Bacteria | 1664 |
| 242 | Ga0213876_10000544 | 3300021384 | Bacteria | 28326 |
| 243 | Ga0213876_10000716 | 3300021384 | Bacteria | 23196 |
| 244 | Ga0213876_10003346 | 3300021384 | Bacteria | 9180 |
| 245 | Ga0213875_10016246 | 3300021388 | Bacteria | 3611 |
| 246 | Ga0213871_10006931 | 3300021441 | Bacteria | 2424 |
| 247 | Ga0209566_100542 | 3300025225 | Bacteria | 25524 |
| 248 | Ga0209674_101649 | 3300025226 | Bacteria | 5579 |
| 249 | Ga0209148_1000465 | 3300025254 | Bacteria | 43292 |
| 250 | Ga0209759_1000057 | 3300025256 | Bacteria | 205181 |
| 251 | Ga0209565_1000332 | 3300025263 | Bacteria | 42136 |
| 252 | Ga0209676_1000327 | 3300025292 | Bacteria | 91596 |
| 253 | Ga0209676_1000409 | 3300025292 | Bacteria | 77127 |
| 254 | Ga0209758_1002592 | 3300025297 | Bacteria | 18133 |
| 255 | Ga0209758_1005274 | 3300025297 | Bacteria | 10105 |
| 256 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 257 | Ga0209050_1000217 | 3300025298 | Bacteria | 128833 |
| 258 | Ga0209050_1004277 | 3300025298 | Bacteria | 9792 |
| 259 | Ga0209050_1005272 | 3300025298 | Bacteria | 8226 |
| 260 | Ga0209050_1013083 | 3300025298 | Bacteria | 3731 |
| 261 | Ga0209256_1002189 | 3300025299 | Bacteria | 16751 |
| 262 | Ga0209256_1003655 | 3300025299 | Bacteria | 10519 |
| 263 | Ga0209257_1000178 | 3300025304 | Bacteria | 160969 |
| 264 | Ga0209257_1000220 | 3300025304 | Bacteria | 135116 |
| 265 | Ga0209257_1000386 | 3300025304 | Bacteria | 88085 |
| 266 | Ga0209257_1005253 | 3300025304 | Bacteria | 9242 |
| 267 | Ga0209257_1005921 | 3300025304 | Bacteria | 8228 |
| 268 | Ga0209257_1009127 | 3300025304 | Bacteria | 5409 |
| 269 | Ga0207682_10000833 | 3300025893 | Bacteria | 14256 |
| 270 | Ga0207710_10004304 | 3300025900 | Bacteria | 6232 |
| 271 | Ga0207647_10001078 | 3300025904 | Bacteria | 21029 |
| 272 | Ga0207647_10007591 | 3300025904 | Bacteria | 7815 |
| 273 | Ga0207647_10027206 | 3300025904 | Bacteria | 3731 |
| 274 | Ga0207645_10006878 | 3300025907 | Bacteria | 8111 |
| 275 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 276 | Ga0207705_10001414 | 3300025909 | Bacteria | 19120 |
| 277 | Ga0207705_10005634 | 3300025909 | Bacteria | 9354 |
| 278 | Ga0207705_10007304 | 3300025909 | Bacteria | 8125 |
| 279 | Ga0207705_10019624 | 3300025909 | Bacteria | 4833 |
| 280 | Ga0207705_10041040 | 3300025909 | Bacteria | 3319 |
| 281 | Ga0207705_10067491 | 3300025909 | Bacteria | 2588 |
| 282 | Ga0207707_10001296 | 3300025912 | Bacteria | 23280 |
| 283 | Ga0207707_10034921 | 3300025912 | Bacteria | 4398 |
| 284 | Ga0207707_10054709 | 3300025912 | Bacteria | 3474 |
| 285 | Ga0207695_10000718 | 3300025913 | Bacteria | 64451 |
| 286 | Ga0207695_10001017 | 3300025913 | Bacteria | 49429 |
| 287 | Ga0207695_10001195 | 3300025913 | Bacteria | 44633 |
| 288 | Ga0207695_10003313 | 3300025913 | Bacteria | 22832 |
| 289 | Ga0207695_10007252 | 3300025913 | Bacteria | 14157 |
| 290 | Ga0207695_10014240 | 3300025913 | Bacteria | 9433 |
| 291 | Ga0207695_10040465 | 3300025913 | Bacteria | 4996 |
| 292 | Ga0207671_10007045 | 3300025914 | Bacteria | 9848 |
| 293 | Ga0207660_10003153 | 3300025917 | Bacteria | 10795 |
| 294 | Ga0207660_10008412 | 3300025917 | Bacteria | 6676 |
| 295 | Ga0207657_10001137 | 3300025919 | Bacteria | 28234 |
| 296 | Ga0207657_10001303 | 3300025919 | Bacteria | 26487 |
| 297 | Ga0207657_10001904 | 3300025919 | Bacteria | 22544 |
| 298 | Ga0207657_10008828 | 3300025919 | Bacteria | 10195 |
| 299 | Ga0207657_10024687 | 3300025919 | Bacteria | 5558 |
| 300 | Ga0207657_10042588 | 3300025919 | Bacteria | 4004 |
| 301 | Ga0207649_10021111 | 3300025920 | Bacteria | 3743 |
| 302 | Ga0207652_10003865 | 3300025921 | Bacteria | 12269 |
| 303 | Ga0207652_10020568 | 3300025921 | Bacteria | 5438 |
| 304 | Ga0207652_10047102 | 3300025921 | Bacteria | 3682 |
| 305 | Ga0207652_10052024 | 3300025921 | Bacteria | 3514 |
| 306 | Ga0207681_10000448 | 3300025923 | Bacteria | 28899 |
| 307 | Ga0207694_10008152 | 3300025924 | Bacteria | 7917 |
| 308 | Ga0207694_10011507 | 3300025924 | Bacteria | 6678 |
| 309 | Ga0207694_10022405 | 3300025924 | Bacteria | 4791 |
| 310 | Ga0207694_10042460 | 3300025924 | Bacteria | 3508 |
| 311 | Ga0207694_10056099 | 3300025924 | Bacteria | 3059 |
| 312 | Ga0207694_10078125 | 3300025924 | Bacteria | 2594 |
| 313 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 314 | Ga0207659_10106133 | 3300025926 | Bacteria | 2126 |
| 315 | Ga0207687_10027427 | 3300025927 | Bacteria | 3821 |
| 316 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 317 | Ga0207644_10000602 | 3300025931 | Bacteria | 22923 |
| 318 | Ga0207644_10006348 | 3300025931 | Bacteria | 7698 |
| 319 | Ga0207644_10021731 | 3300025931 | Bacteria | 4375 |
| 320 | Ga0207644_10022690 | 3300025931 | Bacteria | 4290 |
| 321 | Ga0207690_10000051 | 3300025932 | Bacteria | 107367 |
| 322 | Ga0207690_10000053 | 3300025932 | Bacteria | 105125 |
| 323 | Ga0207690_10003079 | 3300025932 | Bacteria | 10047 |
| 324 | Ga0207690_10005435 | 3300025932 | Bacteria | 7507 |
| 325 | Ga0207690_10008542 | 3300025932 | Bacteria | 6078 |
| 326 | Ga0207706_10046633 | 3300025933 | Bacteria | 3837 |
| 327 | Ga0207706_10123176 | 3300025933 | Bacteria | 2281 |
| 328 | Ga0207670_10038590 | 3300025936 | Bacteria | 3121 |
| 329 | Ga0207711_10001604 | 3300025941 | Bacteria | 20913 |
| 330 | Ga0207711_10016191 | 3300025941 | Bacteria | 6190 |
| 331 | Ga0207679_10005151 | 3300025945 | Bacteria | 8185 |
| 332 | Ga0207667_10007334 | 3300025949 | Bacteria | 13274 |
| 333 | Ga0207667_10008988 | 3300025949 | Bacteria | 11821 |
| 334 | Ga0207667_10043233 | 3300025949 | Bacteria | 4782 |
| 335 | Ga0207667_10092888 | 3300025949 | Bacteria | 3116 |
| 336 | Ga0207667_10107443 | 3300025949 | Bacteria | 2879 |
| 337 | Ga0207667_10151876 | 3300025949 | Bacteria | 2383 |
| 338 | Ga0207667_10198713 | 3300025949 | Bacteria | 2057 |
| 339 | Ga0207651_10017670 | 3300025960 | Bacteria | 4220 |
| 340 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 341 | Ga0207712_10003975 | 3300025961 | Bacteria | 9334 |
| 342 | Ga0207712_10017866 | 3300025961 | Bacteria | 4614 |
| 343 | Ga0207712_10018228 | 3300025961 | Bacteria | 4569 |
| 344 | Ga0207712_10030942 | 3300025961 | Bacteria | 3602 |
| 345 | Ga0207668_10000342 | 3300025972 | Bacteria | 30270 |
| 346 | Ga0207668_10001123 | 3300025972 | Bacteria | 15955 |
| 347 | Ga0207668_10003651 | 3300025972 | Bacteria | 9043 |
| 348 | Ga0207668_10066068 | 3300025972 | Bacteria | 2562 |
| 349 | Ga0207640_10000535 | 3300025981 | Bacteria | 22763 |
| 350 | Ga0207640_10021214 | 3300025981 | Bacteria | 3868 |
| 351 | Ga0207640_10043541 | 3300025981 | Bacteria | 2870 |
| 352 | Ga0207658_10000218 | 3300025986 | Bacteria | 60270 |
| 353 | Ga0207658_10001134 | 3300025986 | Bacteria | 21429 |
| 354 | Ga0207658_10023073 | 3300025986 | Bacteria | 4338 |
| 355 | Ga0207658_10033721 | 3300025986 | Bacteria | 3653 |
| 356 | Ga0207677_10000013 | 3300026023 | Bacteria | 186519 |
| 357 | Ga0207677_10004145 | 3300026023 | Bacteria | 7757 |
| 358 | Ga0207677_10107112 | 3300026023 | Bacteria | 2072 |
| 359 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 360 | Ga0207703_10002707 | 3300026035 | Bacteria | 15178 |
| 361 | Ga0207703_10005677 | 3300026035 | Bacteria | 10017 |
| 362 | Ga0207639_10000260 | 3300026041 | Bacteria | 38302 |
| 363 | Ga0207639_10031700 | 3300026041 | Bacteria | 3886 |
| 364 | Ga0207639_10042224 | 3300026041 | Bacteria | 3416 |
| 365 | Ga0207678_10000104 | 3300026067 | Bacteria | 69027 |
| 366 | Ga0207678_10000716 | 3300026067 | Bacteria | 30304 |
| 367 | Ga0207678_10051842 | 3300026067 | Bacteria | 3541 |
| 368 | Ga0207702_10015322 | 3300026078 | Bacteria | 6355 |
| 369 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 370 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 371 | Ga0207641_10005823 | 3300026088 | Bacteria | 10457 |
| 372 | Ga0207641_10021395 | 3300026088 | Bacteria | 5315 |
| 373 | Ga0207641_10052619 | 3300026088 | Bacteria | 3449 |
| 374 | Ga0207676_10000179 | 3300026095 | Bacteria | 55697 |
| 375 | Ga0207676_10000437 | 3300026095 | Bacteria | 35190 |
| 376 | Ga0207676_10045215 | 3300026095 | Bacteria | 3401 |
| 377 | Ga0207674_10003125 | 3300026116 | Bacteria | 20421 |
| 378 | Ga0207674_10024869 | 3300026116 | Bacteria | 6391 |
| 379 | Ga0207675_100025874 | 3300026118 | Bacteria | 5459 |
| 380 | Ga0207675_100079812 | 3300026118 | Bacteria | 3067 |
| 381 | Ga0207675_100094527 | 3300026118 | Bacteria | 2812 |
| 382 | Ga0207675_100137525 | 3300026118 | Bacteria | 2319 |
| 383 | Ga0207683_10184130 | 3300026121 | Bacteria | 1894 |
| 384 | Ga0207698_10000193 | 3300026142 | Bacteria | 38052 |
| 385 | Ga0207698_10003399 | 3300026142 | Bacteria | 9579 |
| 386 | Ga0207698_10003964 | 3300026142 | Bacteria | 8973 |
| 387 | Ga0207698_10010338 | 3300026142 | Bacteria | 5987 |
| 388 | Ga0207698_10046164 | 3300026142 | Bacteria | 3287 |
| 389 | Ga0209389_1000117 | 3300027296 | Bacteria | 71506 |
| 390 | Ga0209489_109135 | 3300027361 | Bacteria | 12644 |
| 391 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 392 | Ga0209813_10000053 | 3300027866 | Bacteria | 47000 |
| 393 | Ga0209813_10000873 | 3300027866 | Bacteria | 6787 |
| 394 | Ga0209813_10002965 | 3300027866 | Bacteria | 3931 |
| 395 | Ga0207428_10035873 | 3300027907 | Bacteria | 4050 |
| 396 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 397 | Ga0268266_10001119 | 3300028379 | Bacteria | 33470 |
| 398 | Ga0268266_10003430 | 3300028379 | Bacteria | 15845 |
| 399 | Ga0268266_10008959 | 3300028379 | Bacteria | 8858 |
| 400 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 401 | Ga0268265_10000600 | 3300028380 | Bacteria | 36213 |
| 402 | Ga0268265_10045113 | 3300028380 | Bacteria | 3287 |
| 403 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 404 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 405 | Ga0268264_10000330 | 3300028381 | Bacteria | 74311 |
| 406 | Ga0268264_10032863 | 3300028381 | Bacteria | 4258 |
| 407 | Ga0268264_10046476 | 3300028381 | Bacteria | 3605 |
| 408 | Ga0268264_10098912 | 3300028381 | Bacteria | 2531 |
| 409 | Ga0265337_1001337 | 3300028556 | Bacteria | 12227 |
| 410 | Ga0265334_10001279 | 3300028573 | Bacteria | 12182 |
| 411 | Ga0307517_10006007 | 3300028786 | Bacteria | 18094 |
| 412 | Ga0307515_10101092 | 3300028794 | Bacteria | 3484 |
| 413 | Ga0265338_10033178 | 3300028800 | Bacteria | 5016 |
| 414 | Ga0265338_10038295 | 3300028800 | Bacteria | 4546 |
| 415 | Ga0265338_10095129 | 3300028800 | Bacteria | 2448 |
| 416 | Ga0307511_10053071 | 3300030521 | Bacteria | 3219 |
| 417 | Ga0265330_10006479 | 3300031235 | Bacteria | 5788 |
| 418 | Ga0265330_10046044 | 3300031235 | Bacteria | 1922 |
| 419 | Ga0265330_10064138 | 3300031235 | Bacteria | 1596 |
| 420 | Ga0265332_10000016 | 3300031238 | Bacteria | 229887 |
| 421 | Ga0265329_10006065 | 3300031242 | Bacteria | 4827 |
| 422 | Ga0265340_10031218 | 3300031247 | Bacteria | 2665 |
| 423 | Ga0265339_10034446 | 3300031249 | Bacteria | 2845 |
| 424 | Ga0265339_10069712 | 3300031249 | Bacteria | 1876 |
| 425 | Ga0265331_10000695 | 3300031250 | Bacteria | 28793 |
| 426 | Ga0265331_10008614 | 3300031250 | Bacteria | 5788 |
| 427 | Ga0265331_10010985 | 3300031250 | Bacteria | 4972 |
| 428 | Ga0265331_10011789 | 3300031250 | Bacteria | 4771 |
| 429 | Ga0265327_10000588 | 3300031251 | Bacteria | 61029 |
| 430 | Ga0265327_10000602 | 3300031251 | Bacteria | 59632 |
| 431 | Ga0265327_10002222 | 3300031251 | Bacteria | 21132 |
| 432 | Ga0265327_10004643 | 3300031251 | Bacteria | 12048 |
| 433 | Ga0265327_10019344 | 3300031251 | Bacteria | 4190 |
| 434 | Ga0265327_10041024 | 3300031251 | Bacteria | 2498 |
| 435 | Ga0265327_10062793 | 3300031251 | Bacteria | 1889 |
| 436 | Ga0265316_10000169 | 3300031344 | Bacteria | 73902 |
| 437 | Ga0307513_10000261 | 3300031456 | Bacteria | 76045 |
| 438 | Ga0307513_10004825 | 3300031456 | Bacteria | 17901 |
| 439 | Ga0307513_10014216 | 3300031456 | Bacteria | 9734 |
| 440 | Ga0307513_10021686 | 3300031456 | Bacteria | 7577 |
| 441 | Ga0307408_100025242 | 3300031548 | Bacteria | 4069 |
| 442 | Ga0316575_10000032 | 3300031665 | Bacteria | 33845 |
| 443 | Ga0265342_10088293 | 3300031712 | Bacteria | 1781 |
| 444 | Ga0316576_10016359 | 3300031727 | Bacteria | 5006 |
| 445 | Ga0316578_10017916 | 3300031728 | Bacteria | 3867 |
| 446 | Ga0307516_10000352 | 3300031730 | Bacteria | 59644 |
| 447 | Ga0307405_10026182 | 3300031731 | Bacteria | 3362 |
| 448 | Ga0307413_10019680 | 3300031824 | Bacteria | 3573 |
| 449 | Ga0307413_10044707 | 3300031824 | Bacteria | 2620 |
| 450 | Ga0307410_10000957 | 3300031852 | Bacteria | 12384 |
| 451 | Ga0307406_10002549 | 3300031901 | Bacteria | 9931 |
| 452 | Ga0307406_10031861 | 3300031901 | Bacteria | 3213 |
| 453 | Ga0307412_10148330 | 3300031911 | Bacteria | 1727 |
| 454 | Ga0307409_100030371 | 3300031995 | Bacteria | 3881 |
| 455 | Ga0307409_100145419 | 3300031995 | Bacteria | 2049 |
| 456 | Ga0307416_100034538 | 3300032002 | Bacteria | 3849 |
| 457 | Ga0307414_10040568 | 3300032004 | Bacteria | 3146 |
| 458 | Ga0307414_10061493 | 3300032004 | Bacteria | 2660 |
| 459 | Ga0307411_10001513 | 3300032005 | Bacteria | 9568 |
| 460 | Ga0307411_10007647 | 3300032005 | Bacteria | 5527 |
| 461 | Ga0307415_100013094 | 3300032126 | Bacteria | 4826 |
| 462 | Ga0316583_10028121 | 3300032133 | Bacteria | 2005 |
| 463 | Ga0316593_10000364 | 3300032168 | Bacteria | 7995 |
| 464 | Ga0373953_0009093 | 3300035117 | Bacteria | 3399 |
| 465 | Ga0373946_0015362 | 3300035171 | Bacteria | 2902 |
| 466 | Ga0373955_0001026 | 3300035172 | Bacteria | 11850 |
| 467 | Ga0373961_0003522 | 3300035241 | Bacteria | 3865 |
| 468 | Ga0316574_0000274 | 3300035398 | Bacteria | 19146 |
| 469 | Ga0373931_0053499 | 3300035691 | Bacteria | 2154 |
| 470 | Ga0373935_0046449 | 3300035692 | Bacteria | 2743 |
| 471 | Ga0373927_0103826 | 3300035695 | Bacteria | 1850 |
| 472 | Ga0373933_0024125 | 3300035724 | Bacteria | 3481 |
| 473 | Ga0373937_0002849 | 3300036401 | Bacteria | 14447 |
| 474 | Ga0316584_0029523 | 3300036712 | Bacteria | 4048 |
| 475 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 476 | Ga0395899_0000013 | 3300037312 | Bacteria | 510397 |
| 477 | Ga0395899_0000151 | 3300037312 | Bacteria | 105368 |
| 478 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 479 | Ga0395899_0000804 | 3300037312 | Bacteria | 30745 |
| 480 | Ga0395899_0000885 | 3300037312 | Bacteria | 28458 |
| 481 | Ga0395899_0009300 | 3300037312 | Bacteria | 7546 |
| 482 | Ga0395899_0012431 | 3300037312 | Bacteria | 6522 |
| 483 | Ga0395899_0022192 | 3300037312 | Bacteria | 4813 |
| 484 | Ga0395899_0086958 | 3300037312 | Bacteria | 2269 |
| 485 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 486 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 487 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 488 | Ga0395900_0001255 | 3300037418 | Bacteria | 31098 |
| 489 | Ga0395900_0002764 | 3300037418 | Bacteria | 19179 |
| 490 | Ga0395900_0029097 | 3300037418 | Bacteria | 5666 |
| 491 | Ga0395900_0059667 | 3300037418 | Bacteria | 3927 |
| 492 | Ga0395900_0121552 | 3300037418 | Bacteria | 2679 |
| 493 | Ga0395900_0147150 | 3300037418 | Bacteria | 2408 |
| 494 | Ga0395900_0191156 | 3300037418 | Bacteria | 2076 |
| 495 | Ga0395898_0000104 | 3300037466 | Bacteria | 223462 |
| 496 | Ga0395898_0006464 | 3300037466 | Bacteria | 12517 |
| 497 | Ga0395898_0018445 | 3300037466 | Bacteria | 7115 |
| 498 | Ga0395898_0027194 | 3300037466 | Bacteria | 5745 |
| 499 | Ga0395898_0032773 | 3300037466 | Bacteria | 5188 |
| 500 | Ga0395898_0049253 | 3300037466 | Bacteria | 4128 |
| 501 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 502 | Ga0395905_0000271 | 3300037471 | Bacteria | 77040 |
| 503 | Ga0395905_0000458 | 3300037471 | Bacteria | 57029 |
| 504 | Ga0395905_0001765 | 3300037471 | Bacteria | 25140 |
| 505 | Ga0395905_0007899 | 3300037471 | Bacteria | 10523 |
| 506 | Ga0395905_0073033 | 3300037471 | Bacteria | 3215 |
| 507 | Ga0395905_0105913 | 3300037471 | Bacteria | 2640 |
| 508 | Ga0395905_0184082 | 3300037471 | Bacteria | 1961 |
| 509 | Ga0436364_0238815 | 3300037853 | Bacteria | 8510 |
| 510 | Ga0436364_0414769 | 3300037853 | Bacteria | 4611 |
| 511 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 512 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 513 | Ga0395901_0000035 | 3300038443 | Bacteria | 223888 |
| 514 | Ga0395901_0001264 | 3300038443 | Bacteria | 26810 |
| 515 | Ga0395901_0006984 | 3300038443 | Bacteria | 11409 |
| 516 | Ga0395901_0008542 | 3300038443 | Bacteria | 10349 |
| 517 | Ga0395901_0043872 | 3300038443 | Bacteria | 4638 |
| 518 | Ga0395901_0147294 | 3300038443 | Bacteria | 2474 |
| 519 | Ga0395901_0217321 | 3300038443 | Bacteria | 1998 |
| 520 | Ga0395901_0220860 | 3300038443 | Bacteria | 1981 |
| 521 | Ga0400485_03094 | 3300038735 | Bacteria | 3386 |
| 522 | Ga0400483_135188 | 3300039062 | Bacteria | 2125 |
| 523 | Ga0400483_198091 | 3300039062 | Bacteria | 2110 |
| 524 | Ga0436365_0400394 | 3300039437 | Bacteria | 25450 |
| 525 | Ga0436365_0835883 | 3300039437 | Bacteria | 3507 |
| 526 | Ga0436365_0886091 | 3300039437 | Bacteria | 43353 |
| 527 | Ga0436360_0197367 | 3300039438 | Bacteria | 2151 |
| 528 | Ga0436361_0496775 | 3300039447 | Bacteria | 11116 |
| 529 | Ga0436361_0917304 | 3300039447 | Bacteria | 39295 |
| 530 | Ga0436363_0609059 | 3300039450 | Bacteria | 20913 |
| 531 | Ga0436363_1027775 | 3300039450 | Bacteria | 2521 |
| 532 | Ga0436363_1720929 | 3300039450 | Bacteria | 8555 |
| 533 | Ga0436362_0516986 | 3300039453 | Bacteria | 11871 |
| 534 | Ga0439446_0015224 | 3300042156 | Bacteria | 2132 |
| 535 | Ga0439460_0012638 | 3300042461 | Bacteria | 2195 |
| 536 | Ga0450901_002064 | 3300042533 | Bacteria | 2221 |
| 537 | Ga0466969_0000193 | 3300044656 | Bacteria | 32883 |
| 538 | Ga0466966_0000688 | 3300044684 | Bacteria | 21491 |
| 539 | Ga0466966_0031712 | 3300044684 | Bacteria | 3427 |
| 540 | Ga0466966_0076533 | 3300044684 | Bacteria | 2089 |
| 541 | Ga0466961_0003224 | 3300044693 | Bacteria | 10143 |
| 542 | Ga0466963_0001435 | 3300044694 | Bacteria | 12837 |
| 543 | Ga0466963_0043037 | 3300044694 | Bacteria | 2967 |
| 544 | Ga0466963_0100827 | 3300044694 | Bacteria | 1976 |
| 545 | Ga0466963_0128588 | 3300044694 | Bacteria | 1748 |
| 546 | Ga0466971_0002179 | 3300044719 | Bacteria | 8282 |
| 547 | Ga0466970_0065108 | 3300044765 | Bacteria | 1955 |
| 548 | Ga0466957_0002794 | 3300044842 | Bacteria | 9442 |
| 549 | Ga0466959_0000118 | 3300045049 | Bacteria | 51145 |
| 550 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 551 | Ga0451576_0059690 | 3300045051 | Bacteria | 3981 |
| 552 | Ga0466958_0000398 | 3300045836 | Bacteria | 17799 |
| 553 | Ga0466958_0036198 | 3300045836 | Bacteria | 2953 |
| 554 | Ga0495627_001043 | 3300046453 | Bacteria | 18449 |
| 555 | Ga0495590_0019068 | 3300046457 | Bacteria | 2448 |
| 556 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 557 | Ga0495584_0015466 | 3300046491 | Bacteria | 3888 |
| 558 | Ga0495585_0077303 | 3300046492 | Bacteria | 1807 |
| 559 | Ga0495596_0000288 | 3300046500 | Bacteria | 33511 |
| 560 | Ga0495583_0000020 | 3300046506 | Bacteria | 296185 |
| 561 | Ga0495583_0000426 | 3300046506 | Bacteria | 63627 |
| 562 | Ga0495606_0023713 | 3300046507 | Bacteria | 4438 |
| 563 | Ga0495610_0000030 | 3300046512 | Bacteria | 265950 |
| 564 | Ga0495610_0000908 | 3300046512 | Bacteria | 27545 |
| 565 | Ga0495610_0007741 | 3300046512 | Bacteria | 7091 |
| 566 | Ga0495616_0001591 | 3300046513 | Bacteria | 15584 |
| 567 | Ga0495620_0017326 | 3300046515 | Bacteria | 3594 |
| 568 | Ga0495632_0060259 | 3300046519 | Bacteria | 1844 |
| 569 | Ga0495637_0002075 | 3300046520 | Bacteria | 11270 |
| 570 | Ga0495648_0000948 | 3300046524 | Bacteria | 30025 |
| 571 | Ga0495648_0003360 | 3300046524 | Bacteria | 14095 |
| 572 | Ga0495654_0000216 | 3300046530 | Bacteria | 54273 |
| 573 | Ga0495621_0014749 | 3300046539 | Bacteria | 2480 |
| 574 | Ga0495597_0047282 | 3300046542 | Bacteria | 1905 |
| 575 | Ga0495633_0002271 | 3300046558 | Bacteria | 13754 |
| 576 | Ga0495668_0000092 | 3300046616 | Bacteria | 142835 |
| 577 | Ga0495668_0006535 | 3300046616 | Bacteria | 7617 |
| 578 | Ga0495668_0015161 | 3300046616 | Bacteria | 4506 |
| 579 | Ga0495668_0016490 | 3300046616 | Bacteria | 4293 |
| 580 | Ga0495669_0000003 | 3300046684 | Bacteria | 267741 |
| 581 | Ga0495669_0000234 | 3300046684 | Bacteria | 32800 |
| 582 | Ga0495649_0000345 | 3300046694 | Bacteria | 39827 |
| 583 | Ga0495672_0001561 | 3300047320 | Bacteria | 22420 |
| 584 | Ga0495677_0005616 | 3300047445 | Bacteria | 4754 |
| 585 | Ga0495679_005032 | 3300047446 | Bacteria | 5945 |
| 586 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 587 | Ga0495673_0000401 | 3300047469 | Bacteria | 50743 |
| 588 | Ga0495681_0000011 | 3300047470 | Bacteria | 201843 |
| 589 | Ga0495686_0003214 | 3300047472 | Bacteria | 14390 |
| 590 | Ga0495686_0011256 | 3300047472 | Bacteria | 6308 |
| 591 | Ga0496101_0034152 | 3300048904 | Bacteria | 3591 |
| 592 | Ga0496102_0062324 | 3300048905 | Bacteria | 3414 |
| 593 | Ga0496103_0008642 | 3300048906 | Bacteria | 6050 |
| 594 | Ga0496103_0103884 | 3300048906 | Bacteria | 1800 |
| 595 | Ga0496104_0009696 | 3300048907 | Bacteria | 8580 |
| 596 | Ga0496105_0006289 | 3300048908 | Bacteria | 9118 |
| 597 | Ga0496106_0002158 | 3300048909 | Bacteria | 14703 |
| 598 | Ga0496106_0002226 | 3300048909 | Bacteria | 14458 |
| 599 | Ga0496106_0005334 | 3300048909 | Bacteria | 9514 |
| 600 | Ga0496106_0179652 | 3300048909 | Bacteria | 1680 |
| 601 | Ga0496107_0001868 | 3300048910 | Bacteria | 13316 |
| 602 | Ga0496107_0060523 | 3300048910 | Bacteria | 2741 |
| 603 | Ga0496107_0084790 | 3300048910 | Bacteria | 2312 |
| 604 | Ga0496107_0131617 | 3300048910 | Bacteria | 1847 |
| 605 | Ga0496108_0002227 | 3300048911 | Bacteria | 15527 |
| 606 | Ga0496108_0034941 | 3300048911 | Bacteria | 4176 |
| 607 | Ga0496109_0002047 | 3300048912 | Bacteria | 16717 |
| 608 | Ga0496109_0023339 | 3300048912 | Bacteria | 5490 |
| 609 | Ga0496109_0060051 | 3300048912 | Bacteria | 3474 |
| 610 | Ga0496110_0026758 | 3300048913 | Bacteria | 4939 |
| 611 | Ga0496110_0097858 | 3300048913 | Bacteria | 2629 |
| 612 | Ga0496111_0008316 | 3300048914 | Bacteria | 6859 |
| 613 | Ga0496111_0014620 | 3300048914 | Bacteria | 5369 |
| 614 | Ga0496112_0003678 | 3300048915 | Bacteria | 12783 |
| 615 | Ga0496112_0025671 | 3300048915 | Bacteria | 5660 |
| 616 | Ga0496112_0036881 | 3300048915 | Bacteria | 4769 |
| 617 | Ga0496112_0045422 | 3300048915 | Bacteria | 4306 |
| 618 | Ga0496112_0068585 | 3300048915 | Bacteria | 3502 |
| 619 | Ga0496113_0001823 | 3300048916 | Bacteria | 12118 |
| 620 | Ga0496113_0001984 | 3300048916 | Bacteria | 11730 |
| 621 | Ga0496113_0076057 | 3300048916 | Bacteria | 2564 |
| 622 | Ga0496114_0007532 | 3300048917 | Bacteria | 8611 |
| 623 | Ga0496114_0024978 | 3300048917 | Bacteria | 4880 |
| 624 | Ga0496114_0094783 | 3300048917 | Bacteria | 2539 |
| 625 | Ga0496115_0000571 | 3300048918 | Bacteria | 28486 |
| 626 | Ga0496115_0000794 | 3300048918 | Bacteria | 23158 |
| 627 | Ga0496115_0001409 | 3300048918 | Bacteria | 17195 |
| 628 | Ga0496116_0000019 | 3300048919 | Bacteria | 533227 |
| 629 | Ga0496116_0000039 | 3300048919 | Bacteria | 349134 |
| 630 | Ga0496117_0054267 | 3300048920 | Bacteria | 2808 |
| 631 | Ga0496118_0020178 | 3300048921 | Bacteria | 5920 |
| 632 | Ga0496119_0003333 | 3300048922 | Bacteria | 16734 |
| 633 | Ga0496119_0011136 | 3300048922 | Bacteria | 7491 |
| 634 | Ga0496120_0036784 | 3300048923 | Bacteria | 2909 |
| 635 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 636 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 637 | Ga0496121_0000018 | 3300048924 | Bacteria | 542045 |
| 638 | Ga0496121_0001392 | 3300048924 | Bacteria | 40941 |
| 639 | Ga0496121_0004259 | 3300048924 | Bacteria | 19444 |
| 640 | Ga0496121_0030838 | 3300048924 | Bacteria | 4916 |
| 641 | Ga0496121_0035073 | 3300048924 | Bacteria | 4501 |
| 642 | Ga0496122_0015650 | 3300048925 | Bacteria | 7236 |
| 643 | Ga0496122_0066534 | 3300048925 | Bacteria | 2602 |
| 644 | Ga0496123_0003680 | 3300048926 | Bacteria | 16906 |
| 645 | Ga0496123_0005251 | 3300048926 | Bacteria | 13145 |
| 646 | Ga0496124_0002764 | 3300048927 | Bacteria | 22312 |
| 647 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 648 | Ga0496125_0000749 | 3300048928 | Bacteria | 53580 |
| 649 | Ga0496125_0002786 | 3300048928 | Bacteria | 22105 |
| 650 | Ga0496125_0007529 | 3300048928 | Bacteria | 11573 |
| 651 | Ga0496125_0078257 | 3300048928 | Bacteria | 2543 |
| 652 | Ga0496126_0000041 | 3300048929 | Bacteria | 340389 |
| 653 | Ga0496126_0001877 | 3300048929 | Bacteria | 30562 |
| 654 | Ga0496126_0071794 | 3300048929 | Bacteria | 3081 |
| 655 | Ga0495678_001720 | 3300049459 | Bacteria | 16374 |
| 656 | Ga0501031_0000019 | 3300049568 | Bacteria | 104793 |
| 657 | Ga0501032_0000009 | 3300049569 | Bacteria | 228107 |
| 658 | Ga0501032_0003255 | 3300049569 | Bacteria | 12491 |
| 659 | Ga0501033_0000019 | 3300049570 | Bacteria | 204699 |
| 660 | Ga0501033_0002053 | 3300049570 | Bacteria | 17511 |
| 661 | Ga0501033_0041719 | 3300049570 | Bacteria | 3423 |
| 662 | Ga0501033_0074012 | 3300049570 | Bacteria | 2501 |
| 663 | Ga0501034_0000044 | 3300049571 | Bacteria | 227982 |
| 664 | Ga0501034_0000176 | 3300049571 | Bacteria | 119228 |
| 665 | Ga0501034_0014235 | 3300049571 | Bacteria | 8199 |
| 666 | Ga0501034_0072566 | 3300049571 | Bacteria | 3451 |
| 667 | Ga0501034_0090118 | 3300049571 | Bacteria | 3065 |
| 668 | Ga0501034_0105144 | 3300049571 | Bacteria | 2816 |
| 669 | Ga0501034_0198704 | 3300049571 | Bacteria | 1964 |
| 670 | Ga0501036_0000008 | 3300049572 | Bacteria | 228106 |
| 671 | Ga0501036_0025756 | 3300049572 | Bacteria | 4964 |
| 672 | Ga0501036_0039031 | 3300049572 | Bacteria | 4021 |
| 673 | Ga0501036_0089461 | 3300049572 | Bacteria | 2601 |
| 674 | Ga0501037_0000055 | 3300049573 | Bacteria | 109790 |
| 675 | Ga0501038_0000006 | 3300049574 | Bacteria | 228107 |
| 676 | Ga0501038_0011223 | 3300049574 | Bacteria | 8179 |
| 677 | Ga0501038_0160191 | 3300049574 | Bacteria | 1829 |
| 678 | Ga0501038_0181333 | 3300049574 | Bacteria | 1699 |
| 679 | Ga0501039_0000014 | 3300049575 | Bacteria | 228107 |
| 680 | Ga0501039_0016254 | 3300049575 | Bacteria | 5700 |
| 681 | Ga0501039_0085206 | 3300049575 | Bacteria | 2462 |
| 682 | Ga0501040_0010441 | 3300049576 | Bacteria | 6073 |
| 683 | Ga0501040_0057621 | 3300049576 | Bacteria | 2668 |
| 684 | Ga0501041_0024027 | 3300049577 | Bacteria | 3657 |
| 685 | Ga0501041_0053334 | 3300049577 | Bacteria | 2466 |
| 686 | Ga0501042_0007634 | 3300049578 | Bacteria | 7095 |
| 687 | Ga0501042_0025516 | 3300049578 | Bacteria | 4151 |
| 688 | Ga0501043_0021029 | 3300049579 | Bacteria | 5116 |
| 689 | Ga0501043_0071258 | 3300049579 | Bacteria | 2730 |
| 690 | Ga0501046_0001115 | 3300049580 | Bacteria | 26209 |
| 691 | Ga0501046_0003242 | 3300049580 | Bacteria | 14954 |
| 692 | Ga0501047_0000290 | 3300049581 | Bacteria | 57649 |
| 693 | Ga0501047_0008388 | 3300049581 | Bacteria | 9752 |
| 694 | Ga0501047_0036257 | 3300049581 | Bacteria | 4766 |
| 695 | Ga0501047_0085685 | 3300049581 | Bacteria | 3027 |
| 696 | Ga0501047_0210013 | 3300049581 | Bacteria | 1805 |
| 697 | Ga0501048_0021203 | 3300049582 | Bacteria | 4757 |
| 698 | Ga0501048_0050050 | 3300049582 | Bacteria | 2976 |
| 699 | Ga0501048_0059997 | 3300049582 | Bacteria | 2695 |
| 700 | Ga0501067_0000905 | 3300049583 | Bacteria | 15942 |
| 701 | Ga0501067_0001682 | 3300049583 | Bacteria | 12159 |
| 702 | Ga0501070_0002529 | 3300049586 | Bacteria | 16034 |
| 703 | Ga0501070_0063518 | 3300049586 | Bacteria | 3058 |
| 704 | Ga0501070_0111973 | 3300049586 | Bacteria | 2256 |
| 705 | Ga0501071_0005547 | 3300049587 | Bacteria | 8126 |
| 706 | Ga0501071_0100061 | 3300049587 | Bacteria | 2136 |
| 707 | Ga0501072_0004184 | 3300049588 | Bacteria | 10934 |
| 708 | Ga0501073_0000018 | 3300049589 | Bacteria | 155244 |
| 709 | Ga0501073_0003442 | 3300049589 | Bacteria | 11879 |
| 710 | Ga0501074_0044326 | 3300049590 | Bacteria | 3220 |
| 711 | Ga0501074_0081192 | 3300049590 | Bacteria | 2325 |
| 712 | Ga0501075_0009175 | 3300049591 | Bacteria | 6914 |
| 713 | Ga0501075_0105082 | 3300049591 | Bacteria | 2146 |
| 714 | Ga0501076_0010765 | 3300049592 | Bacteria | 6799 |
| 715 | Ga0501076_0049755 | 3300049592 | Bacteria | 3315 |
| 716 | Ga0501077_0000026 | 3300049593 | Bacteria | 76023 |
| 717 | Ga0501077_0027418 | 3300049593 | Bacteria | 3617 |
| 718 | Ga0501257_000095 | 3300049686 | Bacteria | 21617 |
| 719 | Ga0501079_0004232 | 3300049741 | Bacteria | 10642 |
| 720 | Ga0501079_0017813 | 3300049741 | Bacteria | 5426 |
| 721 | Ga0501079_0056185 | 3300049741 | Bacteria | 3037 |
| 722 | Ga0501080_0000003 | 3300049742 | Bacteria | 214890 |
| 723 | Ga0501080_0001057 | 3300049742 | Bacteria | 22628 |
| 724 | Ga0501080_0005874 | 3300049742 | Bacteria | 10994 |
| 725 | Ga0501080_0045353 | 3300049742 | Bacteria | 4092 |
| 726 | Ga0501080_0050525 | 3300049742 | Bacteria | 3869 |
| 727 | Ga0501080_0061944 | 3300049742 | Bacteria | 3482 |
| 728 | Ga0501081_0008312 | 3300049743 | Bacteria | 6736 |
| 729 | Ga0501081_0009224 | 3300049743 | Bacteria | 6426 |
| 730 | Ga0501083_0021296 | 3300049744 | Bacteria | 4505 |
| 731 | Ga0501280_002283 | 3300049776 | Bacteria | 3247 |
| 732 | Ga0501035_0000096 | 3300049822 | Bacteria | 110635 |
| 733 | Ga0501035_0000384 | 3300049822 | Bacteria | 50737 |
| 734 | Ga0501035_0051742 | 3300049822 | Bacteria | 3676 |
| 735 | Ga0501035_0054473 | 3300049822 | Bacteria | 3574 |
| 736 | Ga0501035_0077431 | 3300049822 | Bacteria | 2939 |
| 737 | Ga0501035_0208548 | 3300049822 | Bacteria | 1673 |
| 738 | Ga0501044_0000017 | 3300049823 | Bacteria | 228107 |
| 739 | Ga0501044_0000570 | 3300049823 | Bacteria | 44794 |
| 740 | Ga0501044_0013529 | 3300049823 | Bacteria | 8821 |
| 741 | Ga0501044_0030476 | 3300049823 | Bacteria | 5685 |
| 742 | Ga0501044_0083632 | 3300049823 | Bacteria | 3227 |
| 743 | Ga0501045_0049169 | 3300049824 | Bacteria | 3074 |
| 744 | Ga0501045_0124006 | 3300049824 | Bacteria | 1918 |
| 745 | nmdc:mga03683_625_c1 | 3300050489 | Bacteria | 10155 |
| 746 | nmdc:mga03683_6_c1 | 3300050489 | Bacteria | 141493 |
| 747 | nmdc:mga03n38_114044_c1 | 3300050490 | Bacteria | 1320 |
| 748 | nmdc:mga03n38_61_c1 | 3300050490 | Bacteria | 22538 |
| 749 | nmdc:mga00v17_146_c1 | 3300050491 | Bacteria | 40788 |
| 750 | nmdc:mga00v17_322_c1 | 3300050491 | Bacteria | 27155 |
| 751 | nmdc:mga00v17_505_c1 | 3300050491 | Bacteria | 21902 |
| 752 | nmdc:mga00v17_934_c1 | 3300050491 | Bacteria | 15691 |
| 753 | nmdc:mga00v17_99467_c1 | 3300050491 | Bacteria | 1835 |
| 754 | nmdc:mga0yw44_57_c1 | 3300050492 | Bacteria | 40136 |
| 755 | nmdc:mga0k408_6_c1 | 3300050493 | Bacteria | 200443 |
| 756 | nmdc:mga06z11_105_c1 | 3300050494 | Bacteria | 34898 |
| 757 | nmdc:mga06z11_12375_c1 | 3300050494 | Bacteria | 3710 |
| 758 | nmdc:mga06z11_147_c1 | 3300050494 | Bacteria | 27767 |
| 759 | nmdc:mga06z11_52078_c1 | 3300050494 | Bacteria | 2098 |
| 760 | nmdc:mga04h51_24_c1 | 3300050495 | Bacteria | 59995 |
| 761 | nmdc:mga04h51_2624_c1 | 3300050495 | Bacteria | 4279 |
| 762 | nmdc:mga07m45_187_c2 | 3300050496 | Bacteria | 10171 |
| 763 | nmdc:mga07m45_32659_c1 | 3300050496 | Bacteria | 2886 |
| 764 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 765 | nmdc:mga07m45_4_c1 | 3300050496 | Bacteria | 409607 |
| 766 | nmdc:mga07m45_66_c1 | 3300050496 | Bacteria | 40757 |
| 767 | nmdc:mga09592_40497_c1 | 3300050508 | Bacteria | 3914 |
| 768 | nmdc:mga08y16_134810_c1 | 3300050511 | Bacteria | 2566 |
| 769 | nmdc:mga08y16_33263_c1 | 3300050511 | Bacteria | 5415 |
| 770 | nmdc:mga0n895_207881_c1 | 3300050512 | Bacteria | 1988 |
| 771 | nmdc:mga0rr50_39858_c1 | 3300050513 | Bacteria | 3410 |
| 772 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 773 | nmdc:mga0sz30_118_c1 | 3300050516 | Bacteria | 29758 |
| 774 | nmdc:mga0sz30_29578_c1 | 3300050516 | Bacteria | 2259 |
| 775 | nmdc:mga0sz30_44_c1 | 3300050516 | Bacteria | 44851 |
| 776 | Ga0500635_0000489 | 3300053080 | Bacteria | 11028 |
| 777 | Ga0500635_0001292 | 3300053080 | Bacteria | 5983 |
| 778 | Ga0500578_0000420 | 3300053086 | Bacteria | 51926 |
| 779 | Ga0500643_008792 | 3300053087 | Bacteria | 3926 |
| 780 | Ga0500643_009931 | 3300053087 | Bacteria | 3590 |
| 781 | Ga0500643_011734 | 3300053087 | Bacteria | 3177 |
| 782 | Ga0500643_022035 | 3300053087 | Bacteria | 2057 |
| 783 | Ga0500644_0000274 | 3300053088 | Bacteria | 28730 |
| 784 | Ga0500646_0007952 | 3300053090 | Bacteria | 2711 |
| 785 | Ga0500641_0000486 | 3300053096 | Bacteria | 14448 |
| 786 | Ga0500641_0010426 | 3300053096 | Bacteria | 3358 |
| 787 | Ga0500641_0010581 | 3300053096 | Bacteria | 3336 |
| 788 | Ga0500554_001836 | 3300053102 | Bacteria | 4100 |
| 789 | Ga0500556_0000587 | 3300053104 | Bacteria | 23997 |
| 790 | Ga0500556_0001909 | 3300053104 | Bacteria | 7444 |
| 791 | Ga0500557_000050 | 3300053105 | Bacteria | 54589 |
| 792 | Ga0500562_000021 | 3300053108 | Bacteria | 112425 |
| 793 | Ga0500562_000519 | 3300053108 | Bacteria | 9336 |
| 794 | Ga0500562_002122 | 3300053108 | Bacteria | 4955 |
| 795 | Ga0500593_000050 | 3300053117 | Bacteria | 42339 |
| 796 | Ga0500594_0003103 | 3300053118 | Bacteria | 3634 |
| 797 | Ga0500595_002565 | 3300053119 | Bacteria | 8893 |
| 798 | Ga0500595_007222 | 3300053119 | Bacteria | 4625 |
| 799 | Ga0500608_000080 | 3300053122 | Bacteria | 40873 |
| 800 | Ga0500608_000397 | 3300053122 | Bacteria | 16687 |
| 801 | Ga0500608_002327 | 3300053122 | Bacteria | 6895 |
| 802 | Ga0500618_000112 | 3300053125 | Bacteria | 65643 |
| 803 | Ga0500642_0000065 | 3300053130 | Bacteria | 57974 |
| 804 | Ga0500658_0001458 | 3300053134 | Bacteria | 9461 |
| 805 | Ga0500559_0000077 | 3300053136 | Bacteria | 76287 |
| 806 | Ga0500559_0000111 | 3300053136 | Bacteria | 64064 |
| 807 | Ga0500564_000021 | 3300053138 | Bacteria | 47765 |
| 808 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 809 | Ga0500588_0005049 | 3300053146 | Bacteria | 2903 |
| 810 | Ga0500590_021481 | 3300053148 | Bacteria | 3350 |
| 811 | Ga0500604_0000078 | 3300053151 | Bacteria | 34635 |
| 812 | Ga0500616_0018371 | 3300053153 | Bacteria | 3955 |
| 813 | Ga0500622_0000526 | 3300053156 | Bacteria | 35500 |
| 814 | Ga0500622_0007443 | 3300053156 | Bacteria | 6218 |
| 815 | Ga0500624_000001 | 3300053157 | Bacteria | 284974 |
| 816 | Ga0500624_000045 | 3300053157 | Bacteria | 89838 |
| 817 | Ga0500627_0009954 | 3300053158 | Bacteria | 3447 |
| 818 | Ga0500645_000353 | 3300053730 | Bacteria | 32638 |
| 819 | Ga0500645_000461 | 3300053730 | Bacteria | 27834 |
| 820 | Ga0500645_001891 | 3300053730 | Bacteria | 9997 |
| 821 | Ga0500645_002164 | 3300053730 | Bacteria | 9004 |
| 822 | Ga0500596_000572 | 3300053735 | Bacteria | 7020 |
| 823 | Ga0501084_0018508 | 3300054114 | Bacteria | 5798 |
| 824 | Ga0501084_0049834 | 3300054114 | Bacteria | 3505 |
| 825 | Ga0501084_0098628 | 3300054114 | Bacteria | 2453 |
| 826 | Ga0501082_0004153 | 3300060353 | Bacteria | 12655 |
| 827 | Ga0501082_0054287 | 3300060353 | Bacteria | 3453 |
| 828 | Ga0501082_0258071 | 3300060353 | Bacteria | 1516 |
| 829 | Ga0466962_0000345 | 3300061719 | Bacteria | 19915 |
| 830 | Ga0530510_0013704 | 3300061734 | Bacteria | 5706 |
| 831 | Ga0530510_0017724 | 3300061734 | Bacteria | 5046 |
| 832 | 2644547923 | 2643221699 | Bacteria | 5731501 |
| 833 | 2509387515 | 2509276021 | Bacteria | 7634384 |
| 834 | 2510840150 | 2510461069 | Bacteria | 5505000 |
| 835 | 2511125408 | 2510917020 | Bacteria | 5657507 |
| 836 | 2511127112 | 2510917021 | Bacteria | 5705459 |
| 837 | 2512033972 | 2511231221 | Bacteria | 6846400 |
| 838 | 2513592719 | 2513237087 | Bacteria | 5817514 |
| 839 | 2514420062 | 2513237305 | Bacteria | 7293571 |
| 840 | 2515111463 | 2515075009 | Bacteria | 7288508 |
| 841 | 2548846988 | 2547132512 | Bacteria | 3416496 |
| 842 | 2585148510 | 2582581279 | Bacteria | 4980720 |
| 843 | 2585153099 | 2582581280 | Bacteria | 5994497 |
| 844 | 2585196661 | 2582581293 | Bacteria | 5907401 |
| 845 | 2587916721 | 2585428106 | Bacteria | 5179711 |
| 846 | 2599741020 | 2599185239 | Bacteria | 8686614 |
| 847 | 2600201021 | 2599185354 | Bacteria | 4398675 |
| 848 | 2643751417 | 2643221545 | Bacteria | 5083237 |
| 849 | 2643778207 | 2643221552 | Bacteria | 5708754 |
| 850 | 2643883259 | 2643221574 | Bacteria | 2789653 |
| 851 | 2643923489 | 2643221583 | Bacteria | 5218014 |
| 852 | 2643928414 | 2643221584 | Bacteria | 5511711 |
| 853 | 2644000277 | 2643221598 | Bacteria | 4578346 |
| 854 | 2644040207 | 2643221605 | Bacteria | 4772303 |
| 855 | 2644084959 | 2643221614 | Bacteria | 4260023 |
| 856 | 2644225747 | 2643221640 | Bacteria | 5258820 |
| 857 | 2644235236 | 2643221642 | Bacteria | 5357871 |
| 858 | 2644342511 | 2643221661 | Bacteria | 4267604 |
| 859 | 2644351902 | 2643221663 | Bacteria | 3425771 |
| 860 | 2644365811 | 2643221666 | Bacteria | 4265935 |
| 861 | 2644510530 | 2643221691 | Bacteria | 5093099 |
| 862 | 2715499639 | 2713897090 | Bacteria | 3353799 |
| 863 | 2723575579 | 2721755686 | Bacteria | 7343952 |
| 864 | 2738946388 | 2738541317 | Bacteria | 5340176 |
| 865 | 2739791273 | 2739367756 | Bacteria | 4553612 |
| 866 | 2740030137 | 2739367865 | Bacteria | 4114482 |
| 867 | 2753765313 | 2751185897 | Bacteria | 5322941 |
| 868 | 2778123689 | 2775507255 | Bacteria | 3945731 |
| 869 | 2792460622 | 2791355048 | Bacteria | 5832535 |
| 870 | 2819536600 | 2818991435 | Bacteria | 5433759 |
| 871 | 2819550569 | 2818991438 | Bacteria | 5793701 |
| 872 | 2819645761 | 2818991454 | Bacteria | 5563326 |
| 873 | 2828310123 | 2828305725 | Bacteria | 4916900 |
| 874 | 2834579933 | 2834578030 | Bacteria | 3530182 |
| 875 | 2840883813 | 2840878972 | Bacteria | 5483153 |
| 876 | 2841739465 | 2841734538 | Bacteria | 6784580 |
| 877 | 2841865299 | 2841864319 | Bacteria | 6742987 |
| 878 | 2842334877 | 2842333319 | Bacteria | 8899485 |
| 879 | 2842343423 | 2842341865 | Bacteria | 7003929 |
| 880 | 2842365437 | 2842363717 | Bacteria | 6844742 |
| 881 | 2842696911 | 2842694124 | Bacteria | 4063419 |
| 882 | 2843747775 | 2843744320 | Bacteria | 5659202 |
| 883 | 2847675781 | 2847670302 | Bacteria | 6165597 |
| 884 | 2847692427 | 2847686936 | Bacteria | 6278406 |
| 885 | 2849565354 | 2849560528 | Bacteria | 5393480 |
| 886 | 2849578417 | 2849573788 | Bacteria | 5421256 |
| 887 | 2851153806 | 2851153111 | Bacteria | 5542585 |
| 888 | 2854682736 | 2854681122 | Bacteria | 4548679 |
| 889 | 2855022844 | 2855020534 | Bacteria | 3204685 |
| 890 | 2856319718 | 2856314179 | Bacteria | 6477897 |
| 891 | 2857506365 | 2857504554 | Bacteria | 5369913 |
| 892 | 2871501218 | 2871495908 | Bacteria | 6935695 |
| 893 | 2874107506 | 2874102143 | Bacteria | 6342645 |
| 894 | 2874123865 | 2874123672 | Bacteria | 7238285 |
| 895 | 2876375664 | 2876369609 | Bacteria | 6807521 |
| 896 | 2876398626 | 2876392853 | Bacteria | 6660880 |
| 897 | 2878040901 | 2878035449 | Bacteria | 6555736 |
| 898 | 2878765198 | 2878760144 | Bacteria | 6823465 |
| 899 | 2878772905 | 2878767105 | Bacteria | 6898628 |
| 900 | 2881151701 | 2881147464 | Bacteria | 7779814 |
| 901 | 2881167719 | 2881161766 | Bacteria | 7127907 |
| 902 | 2882636462 | 2882632389 | Bacteria | 8154593 |
| 903 | 2882807681 | 2882806704 | Bacteria | 3007728 |
| 904 | 2884965114 | 2884960567 | Bacteria | 5437054 |
| 905 | 2885309608 | 2885305155 | Bacteria | 7348390 |
| 906 | 2885330632 | 2885326080 | Bacteria | 7134805 |
| 907 | 2885338941 | 2885334103 | Bacteria | 7216818 |
| 908 | 2894818408 | 2894817345 | Bacteria | 4892941 |
| 909 | 2895886317 | 2895880812 | Bacteria | 11255272 |
| 910 | 2896430526 | 2896429255 | Bacteria | 2557483 |
| 911 | 2898329521 | 2898329390 | Bacteria | 5168154 |
| 912 | 2898796198 | 2898795034 | Bacteria | 4294459 |
| 913 | 2899261570 | 2899259804 | Bacteria | 3320927 |
| 914 | 2899275703 | 2899275550 | Bacteria | 3958688 |
| 915 | 2899807898 | 2899803654 | Bacteria | 5577784 |
| 916 | 2903546029 | 2903540706 | Bacteria | 7062119 |
| 917 | 2904665181 | 2904659560 | Bacteria | 6685615 |
| 918 | 2906329840 | 2906328253 | Bacteria | 6585166 |
| 919 | 2906420438 | 2906414383 | Bacteria | 6580790 |
| 920 | 2913310801 | 2913308742 | Bacteria | 5350706 |
| 921 | 2917557042 | 2917554339 | Bacteria | 4987857 |
| 922 | 2919680996 | 2919679072 | Bacteria | 4629602 |
| 923 | 2919710013 | 2919709256 | Bacteria | 4318106 |
| 924 | 2922160460 | 2922158528 | Bacteria | 6573167 |
| 925 | 2924732323 | 2924726620 | Bacteria | 6271473 |
| 926 | 2924767191 | 2924762789 | Bacteria | 6561353 |
| 927 | 2928535387 | 2928531327 | Bacteria | 5101314 |
| 928 | 2928975122 | 2928972540 | Bacteria | 3058286 |
| 929 | 2929139680 | 2929138655 | Bacteria | 5810547 |
| 930 | 2937824663 | 2937822353 | Bacteria | 7290551 |
| 931 | 2937893650 | 2937891427 | Bacteria | 6357007 |
| 932 | 2937999887 | 2937994558 | Bacteria | 7036190 |
| 933 | 2941488429 | 2941485952 | Bacteria | 3591484 |
| 934 | 2958118626 | 2958115193 | Bacteria | 6923548 |
| 935 | 2958170350 | 2958165035 | Bacteria | 6906348 |
| 936 | 2961120182 | 2961114664 | Bacteria | 6680456 |
| 937 | 2961168805 | 2961163497 | Bacteria | 6901077 |
| 938 | 2965024092 | 2965018300 | Bacteria | 6883036 |
| 939 | 2968096441 | 2968091066 | Bacteria | 6052692 |
| 940 | 2968101179 | 2968097103 | Bacteria | 6107094 |
| 941 | 2968116539 | 2968110612 | Bacteria | 6814636 |
| 942 | 2968132231 | 2968128360 | Bacteria | 6270294 |
| 943 | 2968177199 | 2968171901 | Bacteria | 6894245 |
| 944 | 2970560045 | 2970554993 | Bacteria | 6814252 |
| 945 | 2977241885 | 2977240413 | Bacteria | 3191065 |
| 946 | 2977861097 | 2977858184 | Bacteria | 6215359 |
| 947 | 2977866911 | 2977864932 | Bacteria | 7534097 |
| 948 | 2979780168 | 2979779861 | Bacteria | 6219781 |
| 949 | 2987664836 | 2987659509 | Bacteria | 6966464 |
| 950 | 2987669045 | 2987666974 | Bacteria | 6509233 |
| 951 | 3000409113 | 3000405567 | Bacteria | 3779330 |
| 952 | 3004193893 | 3004188549 | Bacteria | 6952365 |
| 953 | 8002063545 | 8002060224 | Bacteria | 4026565 |
| 954 | 8004447518 | 8004445564 | Bacteria | 6322258 |
| 955 | 8004709528 | 8004703790 | Bacteria | 8006957 |
| 956 | 8005462109 | 8005460587 | Bacteria | 7157962 |
| 957 | 8021123174 | 8021120328 | Bacteria | 8782274 |
| 958 | 8045865199 | 8045864390 | Bacteria | 5043873 |
| 959 | 8046769344 | 8046767195 | Bacteria | 7547379 |
| 960 | 8054307344 | 8054302542 | Bacteria | 5698134 |
| 961 | 8057133051 | 8057132660 | Bacteria | 4061191 |
| 962 | 8057577135 | 8057575449 | Bacteria | 7367519 |
| 963 | JGI24736J21556_1000469 | |||
| 964 | JGI24740J21852_10002149 | |||
| 965 | JGI24740J21852_10011083 | |||
| 966 | JGI24735J21928_10001159 | |||
| 967 | JGI24735J21928_10001163 | |||
| 968 | JGI24738J21930_10003997 | |||
| 969 | JGI25157J39369_1000707 | |||
| 970 | Ga0055537_1005923 | |||
| 971 | Ga0055536_1005242 | |||
| 972 | Ga0055536_1005282 | |||
| 973 | Ga0055536_1008966 | |||
| 974 | Ga0055528_1005371 | |||
| 975 | Ga0055530_10000647 | |||
| 976 | Ga0055530_10001148 | |||
| 977 | Ga0055530_10006282 | |||
| 978 | Ga0055530_10011836 | |||
| 979 | Ga0055531_10003600 | |||
| 980 | Ga0055531_10008745 | |||
| 981 | Ga0055531_10014013 | |||
| 982 | Ga0065165_1000845 | |||
| 983 | Ga0065165_1003786 | |||
| 984 | Ga0065165_1005117 | |||
| 985 | Ga0065704_10070237 | |||
| 986 | Ga0065707_10000608 | |||
| 987 | Ga0070658_10000125 | |||
| 988 | Ga0070658_10013254 | |||
| 989 | Ga0070658_10083602 | |||
| 990 | Ga0070658_10093326 | |||
| 991 | Ga0070658_10172058 | |||
| 992 | Ga0070683_100019454 | |||
| 993 | Ga0070670_100000037 | |||
| 994 | Ga0070677_10000656 | |||
| 995 | Ga0070680_100002884 | |||
| 996 | Ga0070680_100003695 | |||
| 997 | Ga0070680_100029645 | |||
| 998 | Ga0070680_100030844 | |||
| 999 | Ga0070680_100072505 | |||
| 1000 | Ga0070680_100102079 | |||
| 1001 | Ga0070682_100012466 | |||
| 1002 | Ga0068868_100000001 | |||
| 1003 | Ga0070660_100003034 | |||
| 1004 | Ga0070660_100005715 | |||
| 1005 | Ga0070660_100028150 | |||
| 1006 | Ga0070660_100114842 | |||
| 1007 | Ga0070689_100072270 | |||
| 1008 | Ga0070691_10002895 | |||
| 1009 | Ga0070691_10019229 | |||
| 1010 | Ga0070691_10026589 | |||
| 1011 | Ga0070661_100014744 | |||
| 1012 | Ga0070661_100026358 | |||
| 1013 | Ga0070668_100000018 | |||
| 1014 | Ga0070668_100002188 | |||
| 1015 | Ga0070668_100074951 | |||
| 1016 | Ga0070669_100000329 | |||
| 1017 | Ga0070669_100023151 | |||
| 1018 | Ga0070675_100127929 | |||
| 1019 | Ga0070671_100001250 | |||
| 1020 | Ga0070671_100024938 | |||
| 1021 | Ga0070671_100026330 | |||
| 1022 | Ga0070659_100000001 | |||
| 1023 | Ga0070659_100026185 | |||
| 1024 | Ga0070659_100067276 | |||
| 1025 | Ga0070659_100096585 | |||
| 1026 | Ga0070659_100104104 | |||
| 1027 | Ga0070667_100000083 | |||
| 1028 | Ga0070667_100010505 | |||
| 1029 | Ga0070714_100016732 | |||
| 1030 | Ga0070713_100001498 | |||
| 1031 | Ga0070705_100041450 | |||
| 1032 | Ga0070663_100000958 | |||
| 1033 | Ga0070663_100001663 | |||
| 1034 | Ga0070663_100008703 | |||
| 1035 | Ga0070663_100018515 | |||
| 1036 | Ga0070663_100032434 | |||
| 1037 | Ga0070681_10020073 | |||
| 1038 | Ga0070681_10032415 | |||
| 1039 | Ga0070681_10227695 | |||
| 1040 | Ga0070679_100005502 | |||
| 1041 | Ga0070679_100006911 | |||
| 1042 | Ga0070679_100022016 | |||
| 1043 | Ga0070679_100050766 | |||
| 1044 | Ga0070679_100063706 | |||
| 1045 | Ga0070684_100002726 | |||
| 1046 | Ga0068853_100005921 | |||
| 1047 | Ga0068853_100010858 | |||
| 1048 | Ga0068853_100015961 | |||
| 1049 | Ga0068853_100022761 | |||
| 1050 | Ga0068853_100025697 | |||
| 1051 | Ga0068853_100081486 | |||
| 1052 | Ga0068853_100127855 | |||
| 1053 | Ga0070686_100000597 | |||
| 1054 | Ga0070695_100032791 | |||
| 1055 | Ga0070665_100000116 | |||
| 1056 | Ga0070665_100000334 | |||
| 1057 | Ga0070665_100000883 | |||
| 1058 | Ga0070665_100005159 | |||
| 1059 | Ga0070704_100025527 | |||
| 1060 | Ga0068855_100031052 | |||
| 1061 | Ga0068855_100051832 | |||
| 1062 | Ga0068855_100059691 | |||
| 1063 | Ga0068855_100060289 | |||
| 1064 | Ga0068855_100066595 | |||
| 1065 | Ga0068855_100092635 | |||
| 1066 | Ga0068855_100160596 | |||
| 1067 | Ga0070664_100003103 | |||
| 1068 | Ga0070664_100065815 | |||
| 1069 | Ga0068857_100068835 | |||
| 1070 | Ga0068857_100108075 | |||
| 1071 | Ga0068857_100179160 | |||
| 1072 | Ga0068854_100010766 | |||
| 1073 | Ga0068854_100011856 | |||
| 1074 | Ga0068856_100012156 | |||
| 1075 | Ga0068852_100000387 | |||
| 1076 | Ga0068852_100006174 | |||
| 1077 | Ga0068852_100007731 | |||
| 1078 | Ga0068852_100134989 | |||
| 1079 | Ga0068852_100145389 | |||
| 1080 | Ga0068859_100021262 | |||
| 1081 | Ga0068859_100057359 | |||
| 1082 | Ga0068864_100000116 | |||
| 1083 | Ga0068864_100000363 | |||
| 1084 | Ga0068861_100097602 | |||
| 1085 | Ga0068861_100116950 | |||
| 1086 | Ga0068851_10011399 | |||
| 1087 | Ga0068851_10019055 | |||
| 1088 | Ga0068863_100000007 | |||
| 1089 | Ga0068863_100000122 | |||
| 1090 | Ga0068863_100003837 | |||
| 1091 | Ga0068863_100014998 | |||
| 1092 | Ga0068863_100039222 | |||
| 1093 | Ga0068863_100059984 | |||
| 1094 | Ga0068863_100060215 | |||
| 1095 | Ga0068863_100075817 | |||
| 1096 | Ga0068858_100000853 | |||
| 1097 | Ga0068858_100004079 | |||
| 1098 | Ga0068858_100012038 | |||
| 1099 | Ga0068858_100043412 | |||
| 1100 | Ga0068858_100144316 | |||
| 1101 | Ga0068860_100000348 | |||
| 1102 | Ga0068860_100001231 | |||
| 1103 | Ga0068860_100063874 | |||
| 1104 | Ga0068860_100066828 | |||
| 1105 | Ga0068862_100000067 | |||
| 1106 | Ga0068862_100000235 | |||
| 1107 | Ga0068862_100026581 | |||
| 1108 | Ga0081455_10001031 | |||
| 1109 | Ga0081455_10006263 | |||
| 1110 | Ga0081455_10014607 | |||
| 1111 | Ga0081540_1001263 | |||
| 1112 | Ga0081540_1001383 | |||
| 1113 | Ga0070717_10024295 | |||
| 1114 | Ga0075365_10000227 | |||
| 1115 | Ga0075365_10022854 | |||
| 1116 | Ga0075368_10000991 | |||
| 1117 | Ga0075368_10006977 | |||
| 1118 | Ga0075363_100000062 | |||
| 1119 | Ga0075363_100026434 | |||
| 1120 | Ga0075363_100038716 | |||
| 1121 | Ga0075364_10000935 | |||
| 1122 | Ga0075364_10001197 | |||
| 1123 | Ga0075364_10013747 | |||
| 1124 | Ga0075364_10078826 | |||
| 1125 | Ga0075432_10000094 | |||
| 1126 | Ga0075362_10002672 | |||
| 1127 | Ga0075362_10015878 | |||
| 1128 | Ga0075367_10000119 | |||
| 1129 | Ga0075367_10009476 | |||
| 1130 | Ga0075367_10094182 | |||
| 1131 | Ga0075369_10000060 | |||
| 1132 | Ga0075369_10014705 | |||
| 1133 | Ga0075427_10000023 | |||
| 1134 | Ga0075366_10000596 | |||
| 1135 | Ga0075366_10005099 | |||
| 1136 | Ga0075366_10051698 | |||
| 1137 | Ga0075370_10000043 | |||
| 1138 | Ga0075370_10000066 | |||
| 1139 | Ga0075370_10020413 | |||
| 1140 | Ga0075370_10023778 | |||
| 1141 | Ga0075370_10056584 | |||
| 1142 | Ga0075433_10026622 | |||
| 1143 | Ga0075434_100122090 | |||
| 1144 | Ga0075429_100006297 | |||
| 1145 | Ga0075436_100012782 | |||
| 1146 | Ga0097620_100021262 | |||
| 1147 | Ga0097620_100057357 | |||
| 1148 | Ga0075435_100016479 | |||
| 1149 | Ga0075435_100125914 | |||
| 1150 | Ga0105250_10002835 | |||
| 1151 | Ga0105250_10005265 | |||
| 1152 | Ga0105240_10000305 | |||
| 1153 | Ga0105240_10010558 | |||
| 1154 | Ga0105240_10019011 | |||
| 1155 | Ga0105240_10041126 | |||
| 1156 | Ga0105240_10133888 | |||
| 1157 | Ga0105245_10085797 | |||
| 1158 | Ga0105247_10003856 | |||
| 1159 | Ga0114129_10370390 | |||
| 1160 | Ga0105241_10060054 | |||
| 1161 | Ga0105248_10000059 | |||
| 1162 | Ga0105248_10000071 | |||
| 1163 | Ga0105248_10000438 | |||
| 1164 | Ga0105248_10045112 | |||
| 1165 | Ga0105248_10090660 | |||
| 1166 | Ga0105237_10003515 | |||
| 1167 | Ga0105237_10074969 | |||
| 1168 | Ga0105238_10011427 | |||
| 1169 | Ga0105238_10014487 | |||
| 1170 | Ga0105238_10027868 | |||
| 1171 | Ga0105238_10028949 | |||
| 1172 | Ga0105238_10029957 | |||
| 1173 | Ga0105238_10049267 | |||
| 1174 | Ga0105249_10000105 | |||
| 1175 | Ga0105249_10009441 | |||
| 1176 | Ga0105249_10011902 | |||
| 1177 | Ga0105249_10046170 | |||
| 1178 | Ga0105239_10000037 | |||
| 1179 | Ga0105239_10107230 | |||
| 1180 | Ga0105246_10017989 | |||
| 1181 | Ga0157373_10019439 | |||
| 1182 | Ga0157373_10030864 | |||
| 1183 | Ga0157373_10060215 | |||
| 1184 | Ga0157370_10018896 | |||
| 1185 | Ga0157370_10028965 | |||
| 1186 | Ga0157370_10037299 | |||
| 1187 | Ga0157370_10046511 | |||
| 1188 | Ga0157370_10064818 | |||
| 1189 | Ga0157370_10214112 | |||
| 1190 | Ga0157369_10066871 | |||
| 1191 | Ga0157369_10088770 | |||
| 1192 | Ga0157369_10149285 | |||
| 1193 | Ga0163162_10090862 | |||
| 1194 | Ga0157372_10013006 | |||
| 1195 | Ga0157372_10029019 | |||
| 1196 | Ga0157372_10202608 | |||
| 1197 | Ga0157375_10171314 | |||
| 1198 | Ga0183365_10002 | |||
| 1199 | Ga0163161_10060355 | |||
| 1200 | Ga0213873_10001565 | |||
| 1201 | Ga0213872_10001454 | |||
| 1202 | Ga0213872_10005154 | |||
| 1203 | Ga0213874_10025668 | |||
| 1204 | Ga0213876_10000544 | |||
| 1205 | Ga0213876_10000716 | |||
| 1206 | Ga0213876_10003346 | |||
| 1207 | Ga0213875_10016246 | |||
| 1208 | Ga0213871_10006931 | |||
| 1209 | Ga0209566_100542 | |||
| 1210 | Ga0209674_101649 | |||
| 1211 | Ga0209148_1000465 | |||
| 1212 | Ga0209759_1000057 | |||
| 1213 | Ga0209565_1000332 | |||
| 1214 | Ga0209676_1000327 | |||
| 1215 | Ga0209676_1000409 | |||
| 1216 | Ga0209758_1002592 | |||
| 1217 | Ga0209758_1005274 | |||
| 1218 | Ga0209050_1000101 | |||
| 1219 | Ga0209050_1000217 | |||
| 1220 | Ga0209050_1004277 | |||
| 1221 | Ga0209050_1005272 | |||
| 1222 | Ga0209050_1013083 | |||
| 1223 | Ga0209256_1002189 | |||
| 1224 | Ga0209256_1003655 | |||
| 1225 | Ga0209257_1000178 | |||
| 1226 | Ga0209257_1000220 | |||
| 1227 | Ga0209257_1000386 | |||
| 1228 | Ga0209257_1005253 | |||
| 1229 | Ga0209257_1005921 | |||
| 1230 | Ga0209257_1009127 | |||
| 1231 | Ga0207682_10000833 | |||
| 1232 | Ga0207710_10004304 | |||
| 1233 | Ga0207647_10001078 | |||
| 1234 | Ga0207647_10007591 | |||
| 1235 | Ga0207647_10027206 | |||
| 1236 | Ga0207645_10006878 | |||
| 1237 | Ga0207705_10000004 | |||
| 1238 | Ga0207705_10001414 | |||
| 1239 | Ga0207705_10005634 | |||
| 1240 | Ga0207705_10007304 | |||
| 1241 | Ga0207705_10019624 | |||
| 1242 | Ga0207705_10041040 | |||
| 1243 | Ga0207705_10067491 | |||
| 1244 | Ga0207707_10001296 | |||
| 1245 | Ga0207707_10034921 | |||
| 1246 | Ga0207707_10054709 | |||
| 1247 | Ga0207695_10000718 | |||
| 1248 | Ga0207695_10001017 | |||
| 1249 | Ga0207695_10001195 | |||
| 1250 | Ga0207695_10003313 | |||
| 1251 | Ga0207695_10007252 | |||
| 1252 | Ga0207695_10014240 | |||
| 1253 | Ga0207695_10040465 | |||
| 1254 | Ga0207671_10007045 | |||
| 1255 | Ga0207660_10003153 | |||
| 1256 | Ga0207660_10008412 | |||
| 1257 | Ga0207657_10001137 | |||
| 1258 | Ga0207657_10001303 | |||
| 1259 | Ga0207657_10001904 | |||
| 1260 | Ga0207657_10008828 | |||
| 1261 | Ga0207657_10024687 | |||
| 1262 | Ga0207657_10042588 | |||
| 1263 | Ga0207649_10021111 | |||
| 1264 | Ga0207652_10003865 | |||
| 1265 | Ga0207652_10020568 | |||
| 1266 | Ga0207652_10047102 | |||
| 1267 | Ga0207652_10052024 | |||
| 1268 | Ga0207681_10000448 | |||
| 1269 | Ga0207694_10008152 | |||
| 1270 | Ga0207694_10011507 | |||
| 1271 | Ga0207694_10022405 | |||
| 1272 | Ga0207694_10042460 | |||
| 1273 | Ga0207694_10056099 | |||
| 1274 | Ga0207694_10078125 | |||
| 1275 | Ga0207650_10000062 | |||
| 1276 | Ga0207659_10106133 | |||
| 1277 | Ga0207687_10027427 | |||
| 1278 | Ga0207644_10000003 | |||
| 1279 | Ga0207644_10000602 | |||
| 1280 | Ga0207644_10006348 | |||
| 1281 | Ga0207644_10021731 | |||
| 1282 | Ga0207644_10022690 | |||
| 1283 | Ga0207690_10000051 | |||
| 1284 | Ga0207690_10000053 | |||
| 1285 | Ga0207690_10003079 | |||
| 1286 | Ga0207690_10005435 | |||
| 1287 | Ga0207690_10008542 | |||
| 1288 | Ga0207706_10046633 | |||
| 1289 | Ga0207706_10123176 | |||
| 1290 | Ga0207670_10038590 | |||
| 1291 | Ga0207711_10001604 | |||
| 1292 | Ga0207711_10016191 | |||
| 1293 | Ga0207679_10005151 | |||
| 1294 | Ga0207667_10007334 | |||
| 1295 | Ga0207667_10008988 | |||
| 1296 | Ga0207667_10043233 | |||
| 1297 | Ga0207667_10092888 | |||
| 1298 | Ga0207667_10107443 | |||
| 1299 | Ga0207667_10151876 | |||
| 1300 | Ga0207667_10198713 | |||
| 1301 | Ga0207651_10017670 | |||
| 1302 | Ga0207712_10000015 | |||
| 1303 | Ga0207712_10003975 | |||
| 1304 | Ga0207712_10017866 | |||
| 1305 | Ga0207712_10018228 | |||
| 1306 | Ga0207712_10030942 | |||
| 1307 | Ga0207668_10000342 | |||
| 1308 | Ga0207668_10001123 | |||
| 1309 | Ga0207668_10003651 | |||
| 1310 | Ga0207668_10066068 | |||
| 1311 | Ga0207640_10000535 | |||
| 1312 | Ga0207640_10021214 | |||
| 1313 | Ga0207640_10043541 | |||
| 1314 | Ga0207658_10000218 | |||
| 1315 | Ga0207658_10001134 | |||
| 1316 | Ga0207658_10023073 | |||
| 1317 | Ga0207658_10033721 | |||
| 1318 | Ga0207677_10000013 | |||
| 1319 | Ga0207677_10004145 | |||
| 1320 | Ga0207677_10107112 | |||
| 1321 | Ga0207703_10000038 | |||
| 1322 | Ga0207703_10002707 | |||
| 1323 | Ga0207703_10005677 | |||
| 1324 | Ga0207639_10000260 | |||
| 1325 | Ga0207639_10031700 | |||
| 1326 | Ga0207639_10042224 | |||
| 1327 | Ga0207678_10000104 | |||
| 1328 | Ga0207678_10000716 | |||
| 1329 | Ga0207678_10051842 | |||
| 1330 | Ga0207702_10015322 | |||
| 1331 | Ga0207641_10000001 | |||
| 1332 | Ga0207641_10000012 | |||
| 1333 | Ga0207641_10005823 | |||
| 1334 | Ga0207641_10021395 | |||
| 1335 | Ga0207641_10052619 | |||
| 1336 | Ga0207676_10000179 | |||
| 1337 | Ga0207676_10000437 | |||
| 1338 | Ga0207676_10045215 | |||
| 1339 | Ga0207674_10003125 | |||
| 1340 | Ga0207674_10024869 | |||
| 1341 | Ga0207675_100025874 | |||
| 1342 | Ga0207675_100079812 | |||
| 1343 | Ga0207675_100094527 | |||
| 1344 | Ga0207675_100137525 | |||
| 1345 | Ga0207683_10184130 | |||
| 1346 | Ga0207698_10000193 | |||
| 1347 | Ga0207698_10003399 | |||
| 1348 | Ga0207698_10003964 | |||
| 1349 | Ga0207698_10010338 | |||
| 1350 | Ga0207698_10046164 | |||
| 1351 | Ga0209389_1000117 | |||
| 1352 | Ga0209489_109135 | |||
| 1353 | Ga0209700_100021 | |||
| 1354 | Ga0209813_10000053 | |||
| 1355 | Ga0209813_10000873 | |||
| 1356 | Ga0209813_10002965 | |||
| 1357 | Ga0207428_10035873 | |||
| 1358 | Ga0268266_10000064 | |||
| 1359 | Ga0268266_10001119 | |||
| 1360 | Ga0268266_10003430 | |||
| 1361 | Ga0268266_10008959 | |||
| 1362 | Ga0268265_10000021 | |||
| 1363 | Ga0268265_10000600 | |||
| 1364 | Ga0268265_10045113 | |||
| 1365 | Ga0268264_10000046 | |||
| 1366 | Ga0268264_10000059 | |||
| 1367 | Ga0268264_10000330 | |||
| 1368 | Ga0268264_10032863 | |||
| 1369 | Ga0268264_10046476 | |||
| 1370 | Ga0268264_10098912 | |||
| 1371 | Ga0265337_1001337 | |||
| 1372 | Ga0265334_10001279 | |||
| 1373 | Ga0307517_10006007 | |||
| 1374 | Ga0307515_10101092 | |||
| 1375 | Ga0265338_10033178 | |||
| 1376 | Ga0265338_10038295 | |||
| 1377 | Ga0265338_10095129 | |||
| 1378 | Ga0307511_10053071 | |||
| 1379 | Ga0265330_10006479 | |||
| 1380 | Ga0265330_10046044 | |||
| 1381 | Ga0265330_10064138 | |||
| 1382 | Ga0265332_10000016 | |||
| 1383 | Ga0265329_10006065 | |||
| 1384 | Ga0265340_10031218 | |||
| 1385 | Ga0265339_10034446 | |||
| 1386 | Ga0265339_10069712 | |||
| 1387 | Ga0265331_10000695 | |||
| 1388 | Ga0265331_10008614 | |||
| 1389 | Ga0265331_10010985 | |||
| 1390 | Ga0265331_10011789 | |||
| 1391 | Ga0265327_10000588 | |||
| 1392 | Ga0265327_10000602 | |||
| 1393 | Ga0265327_10002222 | |||
| 1394 | Ga0265327_10004643 | |||
| 1395 | Ga0265327_10019344 | |||
| 1396 | Ga0265327_10041024 | |||
| 1397 | Ga0265327_10062793 | |||
| 1398 | Ga0265316_10000169 | |||
| 1399 | Ga0307513_10000261 | |||
| 1400 | Ga0307513_10004825 | |||
| 1401 | Ga0307513_10014216 | |||
| 1402 | Ga0307513_10021686 | |||
| 1403 | Ga0307408_100025242 | |||
| 1404 | Ga0316575_10000032 | |||
| 1405 | Ga0265342_10088293 | |||
| 1406 | Ga0316576_10016359 | |||
| 1407 | Ga0316578_10017916 | |||
| 1408 | Ga0307516_10000352 | |||
| 1409 | Ga0307405_10026182 | |||
| 1410 | Ga0307413_10019680 | |||
| 1411 | Ga0307413_10044707 | |||
| 1412 | Ga0307410_10000957 | |||
| 1413 | Ga0307406_10002549 | |||
| 1414 | Ga0307406_10031861 | |||
| 1415 | Ga0307412_10148330 | |||
| 1416 | Ga0307409_100030371 | |||
| 1417 | Ga0307409_100145419 | |||
| 1418 | Ga0307416_100034538 | |||
| 1419 | Ga0307414_10040568 | |||
| 1420 | Ga0307414_10061493 | |||
| 1421 | Ga0307411_10001513 | |||
| 1422 | Ga0307411_10007647 | |||
| 1423 | Ga0307415_100013094 | |||
| 1424 | Ga0316583_10028121 | |||
| 1425 | Ga0316593_10000364 | |||
| 1426 | Ga0373953_0009093 | |||
| 1427 | Ga0373946_0015362 | |||
| 1428 | Ga0373955_0001026 | |||
| 1429 | Ga0373961_0003522 | |||
| 1430 | Ga0316574_0000274 | |||
| 1431 | Ga0373931_0053499 | |||
| 1432 | Ga0373935_0046449 | |||
| 1433 | Ga0373927_0103826 | |||
| 1434 | Ga0373933_0024125 | |||
| 1435 | Ga0373937_0002849 | |||
| 1436 | Ga0316584_0029523 | |||
| 1437 | Ga0373925_0000061 | |||
| 1438 | Ga0395899_0000013 | |||
| 1439 | Ga0395899_0000151 | |||
| 1440 | Ga0395899_0000167 | |||
| 1441 | Ga0395899_0000804 | |||
| 1442 | Ga0395899_0000885 | |||
| 1443 | Ga0395899_0009300 | |||
| 1444 | Ga0395899_0012431 | |||
| 1445 | Ga0395899_0022192 | |||
| 1446 | Ga0395899_0086958 | |||
| 1447 | Ga0395900_0000009 | |||
| 1448 | Ga0395900_0000020 | |||
| 1449 | Ga0395900_0000031 | |||
| 1450 | Ga0395900_0001255 | |||
| 1451 | Ga0395900_0002764 | |||
| 1452 | Ga0395900_0029097 | |||
| 1453 | Ga0395900_0059667 | |||
| 1454 | Ga0395900_0121552 | |||
| 1455 | Ga0395900_0147150 | |||
| 1456 | Ga0395900_0191156 | |||
| 1457 | Ga0395898_0000104 | |||
| 1458 | Ga0395898_0006464 | |||
| 1459 | Ga0395898_0018445 | |||
| 1460 | Ga0395898_0027194 | |||
| 1461 | Ga0395898_0032773 | |||
| 1462 | Ga0395898_0049253 | |||
| 1463 | Ga0395905_0000019 | |||
| 1464 | Ga0395905_0000271 | |||
| 1465 | Ga0395905_0000458 | |||
| 1466 | Ga0395905_0001765 | |||
| 1467 | Ga0395905_0007899 | |||
| 1468 | Ga0395905_0073033 | |||
| 1469 | Ga0395905_0105913 | |||
| 1470 | Ga0395905_0184082 | |||
| 1471 | Ga0436364_0238815 | |||
| 1472 | Ga0436364_0414769 | |||
| 1473 | Ga0395901_0000014 | |||
| 1474 | Ga0395901_0000016 | |||
| 1475 | Ga0395901_0000035 | |||
| 1476 | Ga0395901_0001264 | |||
| 1477 | Ga0395901_0006984 | |||
| 1478 | Ga0395901_0008542 | |||
| 1479 | Ga0395901_0043872 | |||
| 1480 | Ga0395901_0147294 | |||
| 1481 | Ga0395901_0217321 | |||
| 1482 | Ga0395901_0220860 | |||
| 1483 | Ga0400485_03094 | |||
| 1484 | Ga0400483_135188 | |||
| 1485 | Ga0400483_198091 | |||
| 1486 | Ga0436365_0400394 | |||
| 1487 | Ga0436365_0835883 | |||
| 1488 | Ga0436365_0886091 | |||
| 1489 | Ga0436360_0197367 | |||
| 1490 | Ga0436361_0496775 | |||
| 1491 | Ga0436361_0917304 | |||
| 1492 | Ga0436363_0609059 | |||
| 1493 | Ga0436363_1027775 | |||
| 1494 | Ga0436363_1720929 | |||
| 1495 | Ga0436362_0516986 | |||
| 1496 | Ga0439446_0015224 | |||
| 1497 | Ga0439460_0012638 | |||
| 1498 | Ga0450901_002064 | |||
| 1499 | Ga0466969_0000193 | |||
| 1500 | Ga0466966_0000688 | |||
| 1501 | Ga0466966_0031712 | |||
| 1502 | Ga0466966_0076533 | |||
| 1503 | Ga0466961_0003224 | |||
| 1504 | Ga0466963_0001435 | |||
| 1505 | Ga0466963_0043037 | |||
| 1506 | Ga0466963_0100827 | |||
| 1507 | Ga0466963_0128588 | |||
| 1508 | Ga0466971_0002179 | |||
| 1509 | Ga0466970_0065108 | |||
| 1510 | Ga0466957_0002794 | |||
| 1511 | Ga0466959_0000118 | |||
| 1512 | Ga0451576_0000034 | |||
| 1513 | Ga0451576_0059690 | |||
| 1514 | Ga0466958_0000398 | |||
| 1515 | Ga0466958_0036198 | |||
| 1516 | Ga0495627_001043 | |||
| 1517 | Ga0495590_0019068 | |||
| 1518 | Ga0495650_0000017 | |||
| 1519 | Ga0495584_0015466 | |||
| 1520 | Ga0495585_0077303 | |||
| 1521 | Ga0495596_0000288 | |||
| 1522 | Ga0495583_0000020 | |||
| 1523 | Ga0495583_0000426 | |||
| 1524 | Ga0495606_0023713 | |||
| 1525 | Ga0495610_0000030 | |||
| 1526 | Ga0495610_0000908 | |||
| 1527 | Ga0495610_0007741 | |||
| 1528 | Ga0495616_0001591 | |||
| 1529 | Ga0495620_0017326 | |||
| 1530 | Ga0495632_0060259 | |||
| 1531 | Ga0495637_0002075 | |||
| 1532 | Ga0495648_0000948 | |||
| 1533 | Ga0495648_0003360 | |||
| 1534 | Ga0495654_0000216 | |||
| 1535 | Ga0495621_0014749 | |||
| 1536 | Ga0495597_0047282 | |||
| 1537 | Ga0495633_0002271 | |||
| 1538 | Ga0495668_0000092 | |||
| 1539 | Ga0495668_0006535 | |||
| 1540 | Ga0495668_0015161 | |||
| 1541 | Ga0495668_0016490 | |||
| 1542 | Ga0495669_0000003 | |||
| 1543 | Ga0495669_0000234 | |||
| 1544 | Ga0495649_0000345 | |||
| 1545 | Ga0495672_0001561 | |||
| 1546 | Ga0495677_0005616 | |||
| 1547 | Ga0495679_005032 | |||
| 1548 | Ga0495673_0000078 | |||
| 1549 | Ga0495673_0000401 | |||
| 1550 | Ga0495681_0000011 | |||
| 1551 | Ga0495686_0003214 | |||
| 1552 | Ga0495686_0011256 | |||
| 1553 | Ga0496101_0034152 | |||
| 1554 | Ga0496102_0062324 | |||
| 1555 | Ga0496103_0008642 | |||
| 1556 | Ga0496103_0103884 | |||
| 1557 | Ga0496104_0009696 | |||
| 1558 | Ga0496105_0006289 | |||
| 1559 | Ga0496106_0002158 | |||
| 1560 | Ga0496106_0002226 | |||
| 1561 | Ga0496106_0005334 | |||
| 1562 | Ga0496106_0179652 | |||
| 1563 | Ga0496107_0001868 | |||
| 1564 | Ga0496107_0060523 | |||
| 1565 | Ga0496107_0084790 | |||
| 1566 | Ga0496107_0131617 | |||
| 1567 | Ga0496108_0002227 | |||
| 1568 | Ga0496108_0034941 | |||
| 1569 | Ga0496109_0002047 | |||
| 1570 | Ga0496109_0023339 | |||
| 1571 | Ga0496109_0060051 | |||
| 1572 | Ga0496110_0026758 | |||
| 1573 | Ga0496110_0097858 | |||
| 1574 | Ga0496111_0008316 | |||
| 1575 | Ga0496111_0014620 | |||
| 1576 | Ga0496112_0003678 | |||
| 1577 | Ga0496112_0025671 | |||
| 1578 | Ga0496112_0036881 | |||
| 1579 | Ga0496112_0045422 | |||
| 1580 | Ga0496112_0068585 | |||
| 1581 | Ga0496113_0001823 | |||
| 1582 | Ga0496113_0001984 | |||
| 1583 | Ga0496113_0076057 | |||
| 1584 | Ga0496114_0007532 | |||
| 1585 | Ga0496114_0024978 | |||
| 1586 | Ga0496114_0094783 | |||
| 1587 | Ga0496115_0000571 | |||
| 1588 | Ga0496115_0000794 | |||
| 1589 | Ga0496115_0001409 | |||
| 1590 | Ga0496116_0000019 | |||
| 1591 | Ga0496116_0000039 | |||
| 1592 | Ga0496117_0054267 | |||
| 1593 | Ga0496118_0020178 | |||
| 1594 | Ga0496119_0003333 | |||
| 1595 | Ga0496119_0011136 | |||
| 1596 | Ga0496120_0036784 | |||
| 1597 | Ga0496121_0000001 | |||
| 1598 | Ga0496121_0000009 | |||
| 1599 | Ga0496121_0000018 | |||
| 1600 | Ga0496121_0001392 | |||
| 1601 | Ga0496121_0004259 | |||
| 1602 | Ga0496121_0030838 | |||
| 1603 | Ga0496121_0035073 | |||
| 1604 | Ga0496122_0015650 | |||
| 1605 | Ga0496122_0066534 | |||
| 1606 | Ga0496123_0003680 | |||
| 1607 | Ga0496123_0005251 | |||
| 1608 | Ga0496124_0002764 | |||
| 1609 | Ga0496125_0000001 | |||
| 1610 | Ga0496125_0000749 | |||
| 1611 | Ga0496125_0002786 | |||
| 1612 | Ga0496125_0007529 | |||
| 1613 | Ga0496125_0078257 | |||
| 1614 | Ga0496126_0000041 | |||
| 1615 | Ga0496126_0001877 | |||
| 1616 | Ga0496126_0071794 | |||
| 1617 | Ga0495678_001720 | |||
| 1618 | Ga0501031_0000019 | |||
| 1619 | Ga0501032_0000009 | |||
| 1620 | Ga0501032_0003255 | |||
| 1621 | Ga0501033_0000019 | |||
| 1622 | Ga0501033_0002053 | |||
| 1623 | Ga0501033_0041719 | |||
| 1624 | Ga0501033_0074012 | |||
| 1625 | Ga0501034_0000044 | |||
| 1626 | Ga0501034_0000176 | |||
| 1627 | Ga0501034_0014235 | |||
| 1628 | Ga0501034_0072566 | |||
| 1629 | Ga0501034_0090118 | |||
| 1630 | Ga0501034_0105144 | |||
| 1631 | Ga0501034_0198704 | |||
| 1632 | Ga0501036_0000008 | |||
| 1633 | Ga0501036_0025756 | |||
| 1634 | Ga0501036_0039031 | |||
| 1635 | Ga0501036_0089461 | |||
| 1636 | Ga0501037_0000055 | |||
| 1637 | Ga0501038_0000006 | |||
| 1638 | Ga0501038_0011223 | |||
| 1639 | Ga0501038_0160191 | |||
| 1640 | Ga0501038_0181333 | |||
| 1641 | Ga0501039_0000014 | |||
| 1642 | Ga0501039_0016254 | |||
| 1643 | Ga0501039_0085206 | |||
| 1644 | Ga0501040_0010441 | |||
| 1645 | Ga0501040_0057621 | |||
| 1646 | Ga0501041_0024027 | |||
| 1647 | Ga0501041_0053334 | |||
| 1648 | Ga0501042_0007634 | |||
| 1649 | Ga0501042_0025516 | |||
| 1650 | Ga0501043_0021029 | |||
| 1651 | Ga0501043_0071258 | |||
| 1652 | Ga0501046_0001115 | |||
| 1653 | Ga0501046_0003242 | |||
| 1654 | Ga0501047_0000290 | |||
| 1655 | Ga0501047_0008388 | |||
| 1656 | Ga0501047_0036257 | |||
| 1657 | Ga0501047_0085685 | |||
| 1658 | Ga0501047_0210013 | |||
| 1659 | Ga0501048_0021203 | |||
| 1660 | Ga0501048_0050050 | |||
| 1661 | Ga0501048_0059997 | |||
| 1662 | Ga0501067_0000905 | |||
| 1663 | Ga0501067_0001682 | |||
| 1664 | Ga0501070_0002529 | |||
| 1665 | Ga0501070_0063518 | |||
| 1666 | Ga0501070_0111973 | |||
| 1667 | Ga0501071_0005547 | |||
| 1668 | Ga0501071_0100061 | |||
| 1669 | Ga0501072_0004184 | |||
| 1670 | Ga0501073_0000018 | |||
| 1671 | Ga0501073_0003442 | |||
| 1672 | Ga0501074_0044326 | |||
| 1673 | Ga0501074_0081192 | |||
| 1674 | Ga0501075_0009175 | |||
| 1675 | Ga0501075_0105082 | |||
| 1676 | Ga0501076_0010765 | |||
| 1677 | Ga0501076_0049755 | |||
| 1678 | Ga0501077_0000026 | |||
| 1679 | Ga0501077_0027418 | |||
| 1680 | Ga0501257_000095 | |||
| 1681 | Ga0501079_0004232 | |||
| 1682 | Ga0501079_0017813 | |||
| 1683 | Ga0501079_0056185 | |||
| 1684 | Ga0501080_0000003 | |||
| 1685 | Ga0501080_0001057 | |||
| 1686 | Ga0501080_0005874 | |||
| 1687 | Ga0501080_0045353 | |||
| 1688 | Ga0501080_0050525 | |||
| 1689 | Ga0501080_0061944 | |||
| 1690 | Ga0501081_0008312 | |||
| 1691 | Ga0501081_0009224 | |||
| 1692 | Ga0501083_0021296 | |||
| 1693 | Ga0501280_002283 | |||
| 1694 | Ga0501035_0000096 | |||
| 1695 | Ga0501035_0000384 | |||
| 1696 | Ga0501035_0051742 | |||
| 1697 | Ga0501035_0054473 | |||
| 1698 | Ga0501035_0077431 | |||
| 1699 | Ga0501035_0208548 | |||
| 1700 | Ga0501044_0000017 | |||
| 1701 | Ga0501044_0000570 | |||
| 1702 | Ga0501044_0013529 | |||
| 1703 | Ga0501044_0030476 | |||
| 1704 | Ga0501044_0083632 | |||
| 1705 | Ga0501045_0049169 | |||
| 1706 | Ga0501045_0124006 | |||
| 1707 | nmdc:mga03683_625_c1 | |||
| 1708 | nmdc:mga03683_6_c1 | |||
| 1709 | nmdc:mga03n38_114044_c1 | |||
| 1710 | nmdc:mga03n38_61_c1 | |||
| 1711 | nmdc:mga00v17_146_c1 | |||
| 1712 | nmdc:mga00v17_322_c1 | |||
| 1713 | nmdc:mga00v17_505_c1 | |||
| 1714 | nmdc:mga00v17_934_c1 | |||
| 1715 | nmdc:mga00v17_99467_c1 | |||
| 1716 | nmdc:mga0yw44_57_c1 | |||
| 1717 | nmdc:mga0k408_6_c1 | |||
| 1718 | nmdc:mga06z11_105_c1 | |||
| 1719 | nmdc:mga06z11_12375_c1 | |||
| 1720 | nmdc:mga06z11_147_c1 | |||
| 1721 | nmdc:mga06z11_52078_c1 | |||
| 1722 | nmdc:mga04h51_24_c1 | |||
| 1723 | nmdc:mga04h51_2624_c1 | |||
| 1724 | nmdc:mga07m45_187_c2 | |||
| 1725 | nmdc:mga07m45_32659_c1 | |||
| 1726 | nmdc:mga07m45_3_c1 | |||
| 1727 | nmdc:mga07m45_4_c1 | |||
| 1728 | nmdc:mga07m45_66_c1 | |||
| 1729 | nmdc:mga09592_40497_c1 | |||
| 1730 | nmdc:mga08y16_134810_c1 | |||
| 1731 | nmdc:mga08y16_33263_c1 | |||
| 1732 | nmdc:mga0n895_207881_c1 | |||
| 1733 | nmdc:mga0rr50_39858_c1 | |||
| 1734 | nmdc:mga08x19_14_c1 | |||
| 1735 | nmdc:mga0sz30_118_c1 | |||
| 1736 | nmdc:mga0sz30_29578_c1 | |||
| 1737 | nmdc:mga0sz30_44_c1 | |||
| 1738 | Ga0500635_0000489 | |||
| 1739 | Ga0500635_0001292 | |||
| 1740 | Ga0500578_0000420 | |||
| 1741 | Ga0500643_008792 | |||
| 1742 | Ga0500643_009931 | |||
| 1743 | Ga0500643_011734 | |||
| 1744 | Ga0500643_022035 | |||
| 1745 | Ga0500644_0000274 | |||
| 1746 | Ga0500646_0007952 | |||
| 1747 | Ga0500641_0000486 | |||
| 1748 | Ga0500641_0010426 | |||
| 1749 | Ga0500641_0010581 | |||
| 1750 | Ga0500554_001836 | |||
| 1751 | Ga0500556_0000587 | |||
| 1752 | Ga0500556_0001909 | |||
| 1753 | Ga0500557_000050 | |||
| 1754 | Ga0500562_000021 | |||
| 1755 | Ga0500562_000519 | |||
| 1756 | Ga0500562_002122 | |||
| 1757 | Ga0500593_000050 | |||
| 1758 | Ga0500594_0003103 | |||
| 1759 | Ga0500595_002565 | |||
| 1760 | Ga0500595_007222 | |||
| 1761 | Ga0500608_000080 | |||
| 1762 | Ga0500608_000397 | |||
| 1763 | Ga0500608_002327 | |||
| 1764 | Ga0500618_000112 | |||
| 1765 | Ga0500642_0000065 | |||
| 1766 | Ga0500658_0001458 | |||
| 1767 | Ga0500559_0000077 | |||
| 1768 | Ga0500559_0000111 | |||
| 1769 | Ga0500564_000021 | |||
| 1770 | Ga0500568_0000001 | |||
| 1771 | Ga0500588_0005049 | |||
| 1772 | Ga0500590_021481 | |||
| 1773 | Ga0500604_0000078 | |||
| 1774 | Ga0500616_0018371 | |||
| 1775 | Ga0500622_0000526 | |||
| 1776 | Ga0500622_0007443 | |||
| 1777 | Ga0500624_000001 | |||
| 1778 | Ga0500624_000045 | |||
| 1779 | Ga0500627_0009954 | |||
| 1780 | Ga0500645_000353 | |||
| 1781 | Ga0500645_000461 | |||
| 1782 | Ga0500645_001891 | |||
| 1783 | Ga0500645_002164 | |||
| 1784 | Ga0500596_000572 | |||
| 1785 | Ga0501084_0018508 | |||
| 1786 | Ga0501084_0049834 | |||
| 1787 | Ga0501084_0098628 | |||
| 1788 | Ga0501082_0004153 | |||
| 1789 | Ga0501082_0054287 | |||
| 1790 | Ga0501082_0258071 | |||
| 1791 | Ga0466962_0000345 | |||
| 1792 | Ga0530510_0013704 | |||
| 1793 | Ga0530510_0017724 | |||
| 1794 | 2644547923 | |||
| 1795 | 2509387515 | |||
| 1796 | 2510840150 | |||
| 1797 | 2511125408 | |||
| 1798 | 2511127112 | |||
| 1799 | 2512033972 | |||
| 1800 | 2513592719 | |||
| 1801 | 2514420062 | |||
| 1802 | 2515111463 | |||
| 1803 | 2548846988 | |||
| 1804 | 2585148510 | |||
| 1805 | 2585153099 | |||
| 1806 | 2585196661 | |||
| 1807 | 2587916721 | |||
| 1808 | 2599741020 | |||
| 1809 | 2600201021 | |||
| 1810 | 2643751417 | |||
| 1811 | 2643778207 | |||
| 1812 | 2643883259 | |||
| 1813 | 2643923489 | |||
| 1814 | 2643928414 | |||
| 1815 | 2644000277 | |||
| 1816 | 2644040207 | |||
| 1817 | 2644084959 | |||
| 1818 | 2644225747 | |||
| 1819 | 2644235236 | |||
| 1820 | 2644342511 | |||
| 1821 | 2644351902 | |||
| 1822 | 2644365811 | |||
| 1823 | 2644510530 | |||
| 1824 | 2715499639 | |||
| 1825 | 2723575579 | |||
| 1826 | 2738946388 | |||
| 1827 | 2739791273 | |||
| 1828 | 2740030137 | |||
| 1829 | 2753765313 | |||
| 1830 | 2778123689 | |||
| 1831 | 2792460622 | |||
| 1832 | 2819536600 | |||
| 1833 | 2819550569 | |||
| 1834 | 2819645761 | |||
| 1835 | 2828310123 | |||
| 1836 | 2834579933 | |||
| 1837 | 2840883813 | |||
| 1838 | 2841739465 | |||
| 1839 | 2841865299 | |||
| 1840 | 2842334877 | |||
| 1841 | 2842343423 | |||
| 1842 | 2842365437 | |||
| 1843 | 2842696911 | |||
| 1844 | 2843747775 | |||
| 1845 | 2847675781 | |||
| 1846 | 2847692427 | |||
| 1847 | 2849565354 | |||
| 1848 | 2849578417 | |||
| 1849 | 2851153806 | |||
| 1850 | 2854682736 | |||
| 1851 | 2855022844 | |||
| 1852 | 2856319718 | |||
| 1853 | 2857506365 | |||
| 1854 | 2871501218 | |||
| 1855 | 2874107506 | |||
| 1856 | 2874123865 | |||
| 1857 | 2876375664 | |||
| 1858 | 2876398626 | |||
| 1859 | 2878040901 | |||
| 1860 | 2878765198 | |||
| 1861 | 2878772905 | |||
| 1862 | 2881151701 | |||
| 1863 | 2881167719 | |||
| 1864 | 2882636462 | |||
| 1865 | 2882807681 | |||
| 1866 | 2884965114 | |||
| 1867 | 2885309608 | |||
| 1868 | 2885330632 | |||
| 1869 | 2885338941 | |||
| 1870 | 2894818408 | |||
| 1871 | 2895886317 | |||
| 1872 | 2896430526 | |||
| 1873 | 2898329521 | |||
| 1874 | 2898796198 | |||
| 1875 | 2899261570 | |||
| 1876 | 2899275703 | |||
| 1877 | 2899807898 | |||
| 1878 | 2903546029 | |||
| 1879 | 2904665181 | |||
| 1880 | 2906329840 | |||
| 1881 | 2906420438 | |||
| 1882 | 2913310801 | |||
| 1883 | 2917557042 | |||
| 1884 | 2919680996 | |||
| 1885 | 2919710013 | |||
| 1886 | 2922160460 | |||
| 1887 | 2924732323 | |||
| 1888 | 2924767191 | |||
| 1889 | 2928535387 | |||
| 1890 | 2928975122 | |||
| 1891 | 2929139680 | |||
| 1892 | 2937824663 | |||
| 1893 | 2937893650 | |||
| 1894 | 2937999887 | |||
| 1895 | 2941488429 | |||
| 1896 | 2958118626 | |||
| 1897 | 2958170350 | |||
| 1898 | 2961120182 | |||
| 1899 | 2961168805 | |||
| 1900 | 2965024092 | |||
| 1901 | 2968096441 | |||
| 1902 | 2968101179 | |||
| 1903 | 2968116539 | |||
| 1904 | 2968132231 | |||
| 1905 | 2968177199 | |||
| 1906 | 2970560045 | |||
| 1907 | 2977241885 | |||
| 1908 | 2977861097 | |||
| 1909 | 2977866911 | |||
| 1910 | 2979780168 | |||
| 1911 | 2987664836 | |||
| 1912 | 2987669045 | |||
| 1913 | 3000409113 | |||
| 1914 | 3004193893 | |||
| 1915 | 8002063545 | |||
| 1916 | 8004447518 | |||
| 1917 | 8004709528 | |||
| 1918 | 8005462109 | |||
| 1919 | 8021123174 | |||
| 1920 | 8045865199 | |||
| 1921 | 8046769344 | |||
| 1922 | 8054307344 | |||
| 1923 | 8057133051 | |||
| 1924 | 8057577135 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8beh-assembly1.cif.gz_M | cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane tip) | 0.986 | 262 | 480 |
| 8e73-assembly1.cif.gz_4M | vigna radiata supercomplex i+iii2 (full bridge) | 0.9774 | 7 | 482 |
| 7ar7-assembly1.cif.gz_M | cryo-em structure of arabidopsis thaliana complex-i (open conformation) | 0.9722 | 7 | 482 |
| 7zmh-assembly1.cif.gz_4 | cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm | 0.9673 | 6 | 479 |
| 8e9g-assembly1.cif.gz_M | mycobacterial respiratory complex i with both quinone positions modelled | 0.9643 | 4 | 484 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFE8_1_132_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.9237 | 6 | 126 | 1.20.1070.10 |
| af_P26288_1_130_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.9062 | 1 | 126 | 1.20.1070.10 |
| af_M1FQK6_1_136_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8867 | 2 | 128 | 1.20.1070.10 |
| af_P26288_1_130_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8733 | 1 | 126 | 1.20.1070.10 |
| af_P0AFE8_1_132_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8433 | 6 | 126 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9EFA4-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9947 | 111 | 486 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A7Y2PBL1-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9917 | 270 | 485 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-K1YWP4-F1-model_v4 | Proton-translocating NADH-quinone oxidoreductase, chain M | 0.9896 | 76 | 485 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A3M1XWU0-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.986 | 93 | 486 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A4Q5QT70-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9859 | 1 | 242 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |