F486910
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 963 | 424 | 914 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300020081|Ga0206354_10434341|Ga0206354_104343411 |
| Length | 280 |
| Sequence | MRGSRRRRGSTSTSPQPIVSVTRAVCGGCARPGYRRCVSRFVLLPAVDVADGQAVRLVQGEAGSETSYGDPLAAALAWQEQGAEWVHLVDLDAAFGRGSNRELLARIVGAVDVQVEMSGGIRDDESLEAAMAAGCRRVNIGTAALERPDWCAAAIASYGDRVAVGLDVRGRTLAARGWTRDGGDLYDVLARLEAEGCARYVVTDVNKDGMLQGPNLQLLRDVCAVTDRPVVASGGITELADLEALAGLVGDGVEGAIIGTALYEGRFTLEEALLRTGATS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 3 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 4 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 5 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 6 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 7 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 8 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 9 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 10 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 11 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 12 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 13 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 14 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 15 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 16 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 17 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 18 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 19 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 20 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 21 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 22 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 23 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 24 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 25 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 26 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 27 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 28 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 29 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 30 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 31 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 32 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 33 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 34 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 35 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 36 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 37 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 38 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 39 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 40 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 41 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 42 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 43 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 44 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 45 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 216 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 217 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 218 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 219 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 223 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 224 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 234 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 266 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 267 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 268 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 269 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 270 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 271 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 272 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 273 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 274 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 275 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 276 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 279 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 282 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 283 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 356 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 407 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 408 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 409 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 411 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 412 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 413 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 414 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 415 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 416 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 419 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 420 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 421 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 422 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 423 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 424 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.08 |
| Metatranscriptomes | 0.83 |
| Isolates | 5.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.1 |
| Nodule | 0.1 |
| Rhizoplane | 6.85 |
| Rhizosphere | 78.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10027302 | 3300002067 | Bacteria | 1711 |
| 2 | JGI25406J46586_10010786 | 3300003203 | Bacteria | 4033 |
| 3 | JGI25406J46586_10016391 | 3300003203 | Bacteria | 3090 |
| 4 | Ga0065714_10064450 | 3300005288 | Bacteria | 77548 |
| 5 | Ga0065712_10008640 | 3300005290 | Bacteria | 2578 |
| 6 | Ga0070658_10000487 | 3300005327 | Bacteria | 34469 |
| 7 | Ga0070658_10002446 | 3300005327 | Bacteria | 15530 |
| 8 | Ga0070658_10074477 | 3300005327 | Bacteria | 2784 |
| 9 | Ga0070658_10102337 | 3300005327 | Bacteria | 2369 |
| 10 | Ga0070683_100000788 | 3300005329 | Bacteria | 23382 |
| 11 | Ga0070683_100003754 | 3300005329 | Bacteria | 12392 |
| 12 | Ga0070666_10162507 | 3300005335 | Bacteria | 1561 |
| 13 | Ga0070680_100001431 | 3300005336 | Bacteria | 17274 |
| 14 | Ga0070680_100098517 | 3300005336 | Bacteria | 2425 |
| 15 | Ga0070682_100062608 | 3300005337 | Bacteria | 2357 |
| 16 | Ga0070682_100087650 | 3300005337 | Bacteria | 2030 |
| 17 | Ga0070682_100095566 | 3300005337 | Bacteria | 1951 |
| 18 | Ga0070682_100127614 | 3300005337 | Bacteria | 1717 |
| 19 | Ga0068868_100007705 | 3300005338 | Bacteria | 7680 |
| 20 | Ga0068868_100021449 | 3300005338 | Bacteria | 4864 |
| 21 | Ga0070660_100005438 | 3300005339 | Bacteria | 8822 |
| 22 | Ga0070660_100020239 | 3300005339 | Bacteria | 4888 |
| 23 | Ga0070660_100369661 | 3300005339 | Bacteria | 1183 |
| 24 | Ga0070660_100614894 | 3300005339 | Bacteria | 909 |
| 25 | Ga0070689_100379597 | 3300005340 | Bacteria | 1191 |
| 26 | Ga0070687_100256643 | 3300005343 | Bacteria | 1089 |
| 27 | Ga0070661_100678940 | 3300005344 | Bacteria | 838 |
| 28 | Ga0070692_10027293 | 3300005345 | Bacteria | 2829 |
| 29 | Ga0070692_10040097 | 3300005345 | Bacteria | 2393 |
| 30 | Ga0070668_100095611 | 3300005347 | Bacteria | 2347 |
| 31 | Ga0070668_100367586 | 3300005347 | Bacteria | 1221 |
| 32 | Ga0070671_100030886 | 3300005355 | Bacteria | 4422 |
| 33 | Ga0070671_100248582 | 3300005355 | Bacteria | 1510 |
| 34 | Ga0070671_100513148 | 3300005355 | Bacteria | 1032 |
| 35 | Ga0070674_100121364 | 3300005356 | Bacteria | 1935 |
| 36 | Ga0070673_100151454 | 3300005364 | Bacteria | 1964 |
| 37 | Ga0070673_100357746 | 3300005364 | Bacteria | 1297 |
| 38 | Ga0070659_100000614 | 3300005366 | Bacteria | 26134 |
| 39 | Ga0070667_100010113 | 3300005367 | Bacteria | 7805 |
| 40 | Ga0070667_100036420 | 3300005367 | Bacteria | 4125 |
| 41 | Ga0070667_100160987 | 3300005367 | Bacteria | 1977 |
| 42 | Ga0070667_100436861 | 3300005367 | Bacteria | 1195 |
| 43 | Ga0070667_100666974 | 3300005367 | Bacteria | 961 |
| 44 | Ga0070709_10107128 | 3300005434 | Bacteria | 1872 |
| 45 | Ga0070714_100325100 | 3300005435 | Bacteria | 1439 |
| 46 | Ga0070710_10103776 | 3300005437 | Bacteria | 1697 |
| 47 | Ga0070710_10444518 | 3300005437 | Bacteria | 877 |
| 48 | Ga0070701_10013530 | 3300005438 | Bacteria | 3715 |
| 49 | Ga0070711_100007809 | 3300005439 | Bacteria | 6517 |
| 50 | Ga0070711_100181917 | 3300005439 | Bacteria | 1609 |
| 51 | Ga0070711_100228695 | 3300005439 | Bacteria | 1449 |
| 52 | Ga0070700_100001727 | 3300005441 | Bacteria | 10973 |
| 53 | Ga0070708_100000330 | 3300005445 | Bacteria | 35639 |
| 54 | Ga0070708_100880566 | 3300005445 | Unclassified | 841 |
| 55 | Ga0070678_100222966 | 3300005456 | Bacteria | 1568 |
| 56 | Ga0070681_10003941 | 3300005458 | Bacteria | 13986 |
| 57 | Ga0070681_10266804 | 3300005458 | Bacteria | 1623 |
| 58 | Ga0070681_10506206 | 3300005458 | Bacteria | 1121 |
| 59 | Ga0068867_100008705 | 3300005459 | Bacteria | 7165 |
| 60 | Ga0070685_10031117 | 3300005466 | Bacteria | 2979 |
| 61 | Ga0070685_10374641 | 3300005466 | Bacteria | 979 |
| 62 | Ga0070706_100017306 | 3300005467 | Bacteria | 6652 |
| 63 | Ga0070706_100058871 | 3300005467 | Bacteria | 3545 |
| 64 | Ga0070707_100042667 | 3300005468 | Bacteria | 4343 |
| 65 | Ga0070707_100072910 | 3300005468 | Bacteria | 3310 |
| 66 | Ga0070698_100011699 | 3300005471 | Bacteria | 9308 |
| 67 | Ga0070698_100060163 | 3300005471 | Bacteria | 3833 |
| 68 | Ga0070698_100171381 | 3300005471 | Bacteria | 2111 |
| 69 | Ga0070699_100000914 | 3300005518 | Bacteria | 27512 |
| 70 | Ga0070699_100001377 | 3300005518 | Bacteria | 22335 |
| 71 | Ga0070679_100002183 | 3300005530 | Bacteria | 17662 |
| 72 | Ga0070679_100267296 | 3300005530 | Bacteria | 1665 |
| 73 | Ga0070679_100369016 | 3300005530 | Bacteria | 1382 |
| 74 | Ga0070679_100795516 | 3300005530 | Bacteria | 889 |
| 75 | Ga0070684_100003940 | 3300005535 | Bacteria | 11242 |
| 76 | Ga0070684_100008019 | 3300005535 | Bacteria | 8243 |
| 77 | Ga0070684_100054260 | 3300005535 | Bacteria | 3492 |
| 78 | Ga0070697_100043038 | 3300005536 | Bacteria | 3655 |
| 79 | Ga0068853_100040444 | 3300005539 | Bacteria | 3978 |
| 80 | Ga0070672_100213289 | 3300005543 | Bacteria | 1617 |
| 81 | Ga0070686_100384818 | 3300005544 | Bacteria | 1063 |
| 82 | Ga0070665_100001500 | 3300005548 | Bacteria | 27163 |
| 83 | Ga0070665_100020284 | 3300005548 | Bacteria | 6674 |
| 84 | Ga0070665_100054031 | 3300005548 | Bacteria | 4029 |
| 85 | Ga0070665_100070157 | 3300005548 | Bacteria | 3511 |
| 86 | Ga0068855_100034141 | 3300005563 | Bacteria | 6068 |
| 87 | Ga0068855_100141077 | 3300005563 | Bacteria | 2747 |
| 88 | Ga0068855_100184251 | 3300005563 | Bacteria | 2359 |
| 89 | Ga0068855_100227865 | 3300005563 | Bacteria | 2088 |
| 90 | Ga0068855_100294638 | 3300005563 | Bacteria | 1798 |
| 91 | Ga0068855_100415398 | 3300005563 | Bacteria | 1472 |
| 92 | Ga0068855_100777547 | 3300005563 | Bacteria | 1019 |
| 93 | Ga0070664_100168461 | 3300005564 | Bacteria | 1942 |
| 94 | Ga0070664_100324567 | 3300005564 | Bacteria | 1395 |
| 95 | Ga0068857_100017894 | 3300005577 | Bacteria | 6214 |
| 96 | Ga0068857_100032082 | 3300005577 | Bacteria | 4643 |
| 97 | Ga0068857_100036107 | 3300005577 | Bacteria | 4379 |
| 98 | Ga0068857_100218519 | 3300005577 | Bacteria | 1740 |
| 99 | Ga0068857_100338560 | 3300005577 | Bacteria | 1392 |
| 100 | Ga0068856_100020314 | 3300005614 | Bacteria | 6452 |
| 101 | Ga0068856_100189851 | 3300005614 | Bacteria | 2068 |
| 102 | Ga0068856_100456403 | 3300005614 | Bacteria | 1299 |
| 103 | Ga0068856_100528361 | 3300005614 | Bacteria | 1201 |
| 104 | Ga0070702_100071901 | 3300005615 | Bacteria | 2046 |
| 105 | Ga0070702_100104931 | 3300005615 | Bacteria | 1741 |
| 106 | Ga0068852_100010538 | 3300005616 | Bacteria | 6914 |
| 107 | Ga0068852_100053856 | 3300005616 | Bacteria | 3465 |
| 108 | Ga0068859_100004174 | 3300005617 | Bacteria | 14752 |
| 109 | Ga0068859_100190879 | 3300005617 | Bacteria | 2133 |
| 110 | Ga0068859_100394459 | 3300005617 | Bacteria | 1480 |
| 111 | Ga0068864_100031732 | 3300005618 | Unclassified | 4484 |
| 112 | Ga0068864_100305102 | 3300005618 | Bacteria | 1491 |
| 113 | Ga0068861_100346217 | 3300005719 | Bacteria | 1302 |
| 114 | Ga0068851_10000124 | 3300005834 | Bacteria | 41585 |
| 115 | Ga0068863_100001958 | 3300005841 | Bacteria | 20461 |
| 116 | Ga0068863_100124165 | 3300005841 | Bacteria | 2463 |
| 117 | Ga0068863_100600925 | 3300005841 | Bacteria | 1089 |
| 118 | Ga0068858_100000175 | 3300005842 | Bacteria | 68239 |
| 119 | Ga0068858_100034213 | 3300005842 | Bacteria | 4713 |
| 120 | Ga0068858_100035292 | 3300005842 | Unclassified | 4639 |
| 121 | Ga0068860_100000043 | 3300005843 | Bacteria | 225862 |
| 122 | Ga0068860_100044109 | 3300005843 | Bacteria | 4251 |
| 123 | Ga0081455_10000128 | 3300005937 | Bacteria | 88444 |
| 124 | Ga0081455_10001337 | 3300005937 | Bacteria | 30512 |
| 125 | Ga0081455_10009693 | 3300005937 | Bacteria | 9879 |
| 126 | Ga0081538_10000005 | 3300005981 | Bacteria | 187304 |
| 127 | Ga0081539_10000728 | 3300005985 | Bacteria | 65949 |
| 128 | Ga0081539_10001334 | 3300005985 | Bacteria | 42972 |
| 129 | Ga0081539_10022628 | 3300005985 | Bacteria | 4149 |
| 130 | Ga0081539_10048547 | 3300005985 | Bacteria | 2414 |
| 131 | Ga0081539_10092132 | 3300005985 | Bacteria | 1563 |
| 132 | Ga0070717_10041626 | 3300006028 | Bacteria | 3745 |
| 133 | Ga0075365_10000640 | 3300006038 | Bacteria | 13877 |
| 134 | Ga0075365_10007324 | 3300006038 | Bacteria | 6169 |
| 135 | Ga0075365_10009470 | 3300006038 | Bacteria | 5602 |
| 136 | Ga0075365_10020733 | 3300006038 | Bacteria | 4082 |
| 137 | Ga0075365_10025374 | 3300006038 | Bacteria | 3751 |
| 138 | Ga0075365_10028215 | 3300006038 | Bacteria | 3578 |
| 139 | Ga0075365_10173901 | 3300006038 | Bacteria | 1504 |
| 140 | Ga0075368_10004612 | 3300006042 | Bacteria | 4684 |
| 141 | Ga0075363_100000612 | 3300006048 | Bacteria | 11799 |
| 142 | Ga0075363_100005598 | 3300006048 | Bacteria | 5610 |
| 143 | Ga0075363_100009078 | 3300006048 | Bacteria | 4666 |
| 144 | Ga0075363_100043254 | 3300006048 | Bacteria | 2382 |
| 145 | Ga0075363_100079551 | 3300006048 | Bacteria | 1791 |
| 146 | Ga0075363_100084389 | 3300006048 | Bacteria | 1741 |
| 147 | Ga0075363_100150586 | 3300006048 | Bacteria | 1313 |
| 148 | Ga0075364_10002963 | 3300006051 | Bacteria | 9584 |
| 149 | Ga0075364_10009875 | 3300006051 | Bacteria | 5742 |
| 150 | Ga0075364_10011486 | 3300006051 | Bacteria | 5379 |
| 151 | Ga0075364_10033013 | 3300006051 | Bacteria | 3329 |
| 152 | Ga0075364_10087474 | 3300006051 | Bacteria | 2065 |
| 153 | Ga0075364_10115186 | 3300006051 | Bacteria | 1796 |
| 154 | Ga0075364_10134197 | 3300006051 | Bacteria | 1663 |
| 155 | Ga0075364_10143427 | 3300006051 | Bacteria | 1607 |
| 156 | Ga0075364_10157376 | 3300006051 | Bacteria | 1533 |
| 157 | Ga0075364_10209326 | 3300006051 | Bacteria | 1322 |
| 158 | Ga0070716_100139129 | 3300006173 | Bacteria | 1545 |
| 159 | Ga0070712_100038812 | 3300006175 | Bacteria | 3256 |
| 160 | Ga0070712_100187171 | 3300006175 | Bacteria | 1617 |
| 161 | Ga0075367_10057284 | 3300006178 | Bacteria | 2317 |
| 162 | Ga0075367_10076675 | 3300006178 | Bacteria | 2018 |
| 163 | Ga0075367_10078641 | 3300006178 | Bacteria | 1992 |
| 164 | Ga0075367_10082849 | 3300006178 | Bacteria | 1942 |
| 165 | Ga0075367_10087304 | 3300006178 | Bacteria | 1894 |
| 166 | Ga0097621_100028408 | 3300006237 | Bacteria | 4408 |
| 167 | Ga0075370_10006358 | 3300006353 | Bacteria | 5933 |
| 168 | Ga0075370_10039921 | 3300006353 | Bacteria | 2646 |
| 169 | Ga0075370_10084347 | 3300006353 | Bacteria | 1829 |
| 170 | Ga0068871_100021352 | 3300006358 | Bacteria | 4975 |
| 171 | Ga0075428_100007901 | 3300006844 | Bacteria | 11794 |
| 172 | Ga0075430_100008527 | 3300006846 | Bacteria | 8659 |
| 173 | Ga0075430_100035267 | 3300006846 | Bacteria | 4245 |
| 174 | Ga0075431_100000088 | 3300006847 | Bacteria | 56098 |
| 175 | Ga0075431_100007324 | 3300006847 | Bacteria | 10990 |
| 176 | Ga0075429_100002486 | 3300006880 | Bacteria | 15513 |
| 177 | Ga0075429_100009056 | 3300006880 | Bacteria | 8645 |
| 178 | Ga0075429_100050142 | 3300006880 | Bacteria | 3632 |
| 179 | Ga0068865_100114224 | 3300006881 | Bacteria | 1997 |
| 180 | Ga0097620_100004174 | 3300006931 | Bacteria | 14752 |
| 181 | Ga0097620_100190874 | 3300006931 | Bacteria | 2133 |
| 182 | Ga0097620_100394417 | 3300006931 | Bacteria | 1480 |
| 183 | Ga0075435_100277005 | 3300007076 | Bacteria | 1432 |
| 184 | Ga0105240_10003864 | 3300009093 | Bacteria | 23139 |
| 185 | Ga0105240_10131613 | 3300009093 | Bacteria | 3000 |
| 186 | Ga0105240_10335224 | 3300009093 | Bacteria | 1720 |
| 187 | Ga0105240_10751637 | 3300009093 | Bacteria | 1060 |
| 188 | Ga0105240_11192571 | 3300009093 | Bacteria | 806 |
| 189 | Ga0111539_10015597 | 3300009094 | Bacteria | 9448 |
| 190 | Ga0111539_10565023 | 3300009094 | Bacteria | 1325 |
| 191 | Ga0111539_10881613 | 3300009094 | Bacteria | 1041 |
| 192 | Ga0105245_10033293 | 3300009098 | Bacteria | 4566 |
| 193 | Ga0105245_10101974 | 3300009098 | Bacteria | 2657 |
| 194 | Ga0105245_10150434 | 3300009098 | Bacteria | 2200 |
| 195 | Ga0105245_10238939 | 3300009098 | Bacteria | 1760 |
| 196 | Ga0105245_10542452 | 3300009098 | Bacteria | 1184 |
| 197 | Ga0105247_10094621 | 3300009101 | Bacteria | 1901 |
| 198 | Ga0114129_10000059 | 3300009147 | Bacteria | 98984 |
| 199 | Ga0114129_10040088 | 3300009147 | Bacteria | 6604 |
| 200 | Ga0114129_10051139 | 3300009147 | Bacteria | 5802 |
| 201 | Ga0105243_10273621 | 3300009148 | Bacteria | 1517 |
| 202 | Ga0105243_10652321 | 3300009148 | Bacteria | 1020 |
| 203 | Ga0105241_10000211 | 3300009174 | Bacteria | 43844 |
| 204 | Ga0105241_10232294 | 3300009174 | Bacteria | 1555 |
| 205 | Ga0105242_10057516 | 3300009176 | Bacteria | 3185 |
| 206 | Ga0105242_10587153 | 3300009176 | Bacteria | 1074 |
| 207 | Ga0105242_10834030 | 3300009176 | Bacteria | 916 |
| 208 | Ga0105248_10013752 | 3300009177 | Bacteria | 8909 |
| 209 | Ga0105248_10082344 | 3300009177 | Bacteria | 3618 |
| 210 | Ga0105248_10093672 | 3300009177 | Bacteria | 3383 |
| 211 | Ga0105248_10172428 | 3300009177 | Bacteria | 2438 |
| 212 | Ga0105248_10194062 | 3300009177 | Bacteria | 2288 |
| 213 | Ga0105237_10005342 | 3300009545 | Bacteria | 14534 |
| 214 | Ga0105237_10007321 | 3300009545 | Bacteria | 12100 |
| 215 | Ga0105237_10094775 | 3300009545 | Bacteria | 2974 |
| 216 | Ga0105237_10138602 | 3300009545 | Bacteria | 2427 |
| 217 | Ga0105237_10868826 | 3300009545 | Bacteria | 909 |
| 218 | Ga0105238_10001857 | 3300009551 | Bacteria | 21165 |
| 219 | Ga0105238_10036361 | 3300009551 | Bacteria | 5005 |
| 220 | Ga0105238_10333455 | 3300009551 | Bacteria | 1504 |
| 221 | Ga0105238_10367295 | 3300009551 | Bacteria | 1429 |
| 222 | Ga0105238_10432732 | 3300009551 | Bacteria | 1311 |
| 223 | Ga0105238_10491700 | 3300009551 | Bacteria | 1227 |
| 224 | Ga0105238_10892819 | 3300009551 | Bacteria | 907 |
| 225 | Ga0105249_10058232 | 3300009553 | Bacteria | 3541 |
| 226 | Ga0105249_11172280 | 3300009553 | Bacteria | 839 |
| 227 | Ga0105239_10027190 | 3300010375 | Bacteria | 6298 |
| 228 | Ga0105239_10128443 | 3300010375 | Bacteria | 2818 |
| 229 | Ga0105239_10149110 | 3300010375 | Bacteria | 2610 |
| 230 | Ga0105239_10372671 | 3300010375 | Bacteria | 1613 |
| 231 | Ga0105246_10005341 | 3300011119 | Bacteria | 7820 |
| 232 | Ga0105246_10465775 | 3300011119 | Bacteria | 1066 |
| 233 | Ga0157371_10565524 | 3300013102 | Bacteria | 844 |
| 234 | Ga0157370_10643926 | 3300013104 | Bacteria | 969 |
| 235 | Ga0157369_10050387 | 3300013105 | Bacteria | 4510 |
| 236 | Ga0157369_10056590 | 3300013105 | Bacteria | 4231 |
| 237 | Ga0157369_10101724 | 3300013105 | Bacteria | 3062 |
| 238 | Ga0157369_10762532 | 3300013105 | Bacteria | 995 |
| 239 | Ga0157374_10099734 | 3300013296 | Bacteria | 2782 |
| 240 | Ga0157378_10304166 | 3300013297 | Bacteria | 1544 |
| 241 | Ga0157378_10498882 | 3300013297 | Unclassified | 1216 |
| 242 | Ga0163162_10000646 | 3300013306 | Bacteria | 32306 |
| 243 | Ga0157372_10226888 | 3300013307 | Bacteria | 2165 |
| 244 | Ga0157372_10603543 | 3300013307 | Bacteria | 1279 |
| 245 | Ga0157372_10712912 | 3300013307 | Bacteria | 1167 |
| 246 | Ga0157372_10788781 | 3300013307 | Bacteria | 1104 |
| 247 | Ga0157375_10006748 | 3300013308 | Bacteria | 9995 |
| 248 | Ga0157375_10028362 | 3300013308 | Bacteria | 5246 |
| 249 | Ga0157375_10041252 | 3300013308 | Bacteria | 4455 |
| 250 | Ga0157375_10199098 | 3300013308 | Bacteria | 2158 |
| 251 | Ga0157375_10275722 | 3300013308 | Bacteria | 1844 |
| 252 | Ga0157375_10538778 | 3300013308 | Bacteria | 1330 |
| 253 | Ga0157375_10603463 | 3300013308 | Bacteria | 1257 |
| 254 | Ga0163163_10023922 | 3300014325 | Bacteria | 5808 |
| 255 | Ga0163163_10117210 | 3300014325 | Bacteria | 2694 |
| 256 | Ga0163163_10173331 | 3300014325 | Bacteria | 2204 |
| 257 | Ga0163163_10256340 | 3300014325 | Bacteria | 1800 |
| 258 | Ga0163163_10320655 | 3300014325 | Bacteria | 1603 |
| 259 | Ga0163163_10422695 | 3300014325 | Bacteria | 1392 |
| 260 | Ga0163163_10464547 | 3300014325 | Bacteria | 1326 |
| 261 | Ga0163163_10606015 | 3300014325 | Bacteria | 1158 |
| 262 | Ga0163163_10862411 | 3300014325 | Bacteria | 969 |
| 263 | Ga0157380_10009167 | 3300014326 | Bacteria | 7081 |
| 264 | Ga0157380_10322101 | 3300014326 | Bacteria | 1433 |
| 265 | Ga0182008_10180367 | 3300014497 | Bacteria | 1068 |
| 266 | Ga0157377_10114815 | 3300014745 | Bacteria | 1624 |
| 267 | Ga0157377_10204939 | 3300014745 | Bacteria | 1254 |
| 268 | Ga0157379_10004102 | 3300014968 | Bacteria | 12432 |
| 269 | Ga0157379_10110172 | 3300014968 | Bacteria | 2473 |
| 270 | Ga0157379_10381489 | 3300014968 | Bacteria | 1293 |
| 271 | Ga0157376_10045102 | 3300014969 | Bacteria | 3628 |
| 272 | Ga0157376_10475073 | 3300014969 | Bacteria | 1224 |
| 273 | Ga0157376_10540297 | 3300014969 | Bacteria | 1152 |
| 274 | Ga0206354_10103529 | 3300020081 | Bacteria | 3182 |
| 275 | Ga0206354_10434341 | 3300020081 | Bacteria | 1185 |
| 276 | Ga0206354_10817771 | 3300020081 | Bacteria | 1057 |
| 277 | Ga0206353_10033622 | 3300020082 | Bacteria | 1735 |
| 278 | Ga0206353_10244667 | 3300020082 | Bacteria | 1918 |
| 279 | Ga0206353_10580619 | 3300020082 | Bacteria | 10814 |
| 280 | Ga0206353_11297471 | 3300020082 | Bacteria | 4907 |
| 281 | Ga0206353_11747993 | 3300020082 | Bacteria | 1763 |
| 282 | Ga0213876_10073807 | 3300021384 | Bacteria | 1802 |
| 283 | Ga0213876_10100757 | 3300021384 | Bacteria | 1531 |
| 284 | Ga0213875_10026616 | 3300021388 | Bacteria | 2751 |
| 285 | Ga0213875_10044625 | 3300021388 | Bacteria | 2081 |
| 286 | Ga0209148_1000830 | 3300025254 | Bacteria | 22075 |
| 287 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 288 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 289 | Ga0207692_10019279 | 3300025898 | Bacteria | 3080 |
| 290 | Ga0207692_10031456 | 3300025898 | Bacteria | 2542 |
| 291 | Ga0207710_10050534 | 3300025900 | Bacteria | 1866 |
| 292 | Ga0207710_10119330 | 3300025900 | Bacteria | 1258 |
| 293 | Ga0207688_10016189 | 3300025901 | Bacteria | 4043 |
| 294 | Ga0207688_10092825 | 3300025901 | Bacteria | 1735 |
| 295 | Ga0207680_10154452 | 3300025903 | Bacteria | 1533 |
| 296 | Ga0207647_10066052 | 3300025904 | Bacteria | 2194 |
| 297 | Ga0207699_10003210 | 3300025906 | Bacteria | 7783 |
| 298 | Ga0207699_10054845 | 3300025906 | Bacteria | 2369 |
| 299 | Ga0207645_10219615 | 3300025907 | Bacteria | 1253 |
| 300 | Ga0207643_10307348 | 3300025908 | Bacteria | 988 |
| 301 | Ga0207705_10004785 | 3300025909 | Bacteria | 10196 |
| 302 | Ga0207705_10004857 | 3300025909 | Bacteria | 10091 |
| 303 | Ga0207705_10043184 | 3300025909 | Bacteria | 3238 |
| 304 | Ga0207705_10058716 | 3300025909 | Bacteria | 2775 |
| 305 | Ga0207705_10142139 | 3300025909 | Bacteria | 1793 |
| 306 | Ga0207705_10237966 | 3300025909 | Bacteria | 1386 |
| 307 | Ga0207684_10168280 | 3300025910 | Bacteria | 1889 |
| 308 | Ga0207684_10489089 | 3300025910 | Bacteria | 1055 |
| 309 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 310 | Ga0207707_10001838 | 3300025912 | Bacteria | 19451 |
| 311 | Ga0207707_10244818 | 3300025912 | Bacteria | 1558 |
| 312 | Ga0207707_10414230 | 3300025912 | Bacteria | 1156 |
| 313 | Ga0207695_10019828 | 3300025913 | Bacteria | 7729 |
| 314 | Ga0207695_10035922 | 3300025913 | Bacteria | 5364 |
| 315 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 316 | Ga0207693_10034783 | 3300025915 | Bacteria | 3974 |
| 317 | Ga0207663_10022800 | 3300025916 | Bacteria | 3584 |
| 318 | Ga0207660_10000619 | 3300025917 | Bacteria | 23952 |
| 319 | Ga0207660_10075333 | 3300025917 | Bacteria | 2465 |
| 320 | Ga0207660_10270256 | 3300025917 | Bacteria | 1347 |
| 321 | Ga0207662_10153317 | 3300025918 | Bacteria | 1467 |
| 322 | Ga0207662_10275076 | 3300025918 | Bacteria | 1112 |
| 323 | Ga0207657_10014789 | 3300025919 | Bacteria | 7597 |
| 324 | Ga0207657_10032104 | 3300025919 | Bacteria | 4748 |
| 325 | Ga0207657_10098006 | 3300025919 | Bacteria | 2437 |
| 326 | Ga0207657_10098639 | 3300025919 | Bacteria | 2427 |
| 327 | Ga0207657_10338962 | 3300025919 | Bacteria | 1187 |
| 328 | Ga0207657_10409826 | 3300025919 | Bacteria | 1066 |
| 329 | Ga0207649_10166664 | 3300025920 | Bacteria | 1531 |
| 330 | Ga0207652_10003015 | 3300025921 | Bacteria | 14060 |
| 331 | Ga0207652_10527328 | 3300025921 | Bacteria | 1062 |
| 332 | Ga0207646_10282552 | 3300025922 | Bacteria | 1500 |
| 333 | Ga0207694_10000039 | 3300025924 | Bacteria | 186164 |
| 334 | Ga0207694_10047828 | 3300025924 | Bacteria | 3308 |
| 335 | Ga0207694_10263129 | 3300025924 | Bacteria | 1413 |
| 336 | Ga0207687_10045021 | 3300025927 | Bacteria | 3049 |
| 337 | Ga0207687_10063863 | 3300025927 | Bacteria | 2608 |
| 338 | Ga0207687_10153808 | 3300025927 | Bacteria | 1758 |
| 339 | Ga0207687_10458862 | 3300025927 | Bacteria | 1058 |
| 340 | Ga0207687_10627015 | 3300025927 | Bacteria | 908 |
| 341 | Ga0207700_10215306 | 3300025928 | Bacteria | 1626 |
| 342 | Ga0207664_10024940 | 3300025929 | Bacteria | 4497 |
| 343 | Ga0207664_10139174 | 3300025929 | Bacteria | 2051 |
| 344 | Ga0207664_10281671 | 3300025929 | Bacteria | 1459 |
| 345 | Ga0207664_10295976 | 3300025929 | Bacteria | 1423 |
| 346 | Ga0207664_10315233 | 3300025929 | Bacteria | 1379 |
| 347 | Ga0207644_10196350 | 3300025931 | Bacteria | 1589 |
| 348 | Ga0207644_10225731 | 3300025931 | Bacteria | 1486 |
| 349 | Ga0207690_10002300 | 3300025932 | Bacteria | 11646 |
| 350 | Ga0207690_10103316 | 3300025932 | Bacteria | 2039 |
| 351 | Ga0207690_10264837 | 3300025932 | Bacteria | 1333 |
| 352 | Ga0207709_10009370 | 3300025935 | Bacteria | 5387 |
| 353 | Ga0207670_10122393 | 3300025936 | Bacteria | 1893 |
| 354 | Ga0207669_10367607 | 3300025937 | Bacteria | 1117 |
| 355 | Ga0207704_10441113 | 3300025938 | Bacteria | 1037 |
| 356 | Ga0207665_10016104 | 3300025939 | Bacteria | 4908 |
| 357 | Ga0207691_10001309 | 3300025940 | Bacteria | 24825 |
| 358 | Ga0207711_10002075 | 3300025941 | Bacteria | 18101 |
| 359 | Ga0207711_10156093 | 3300025941 | Bacteria | 2062 |
| 360 | Ga0207711_10607072 | 3300025941 | Bacteria | 1021 |
| 361 | Ga0207689_10026504 | 3300025942 | Bacteria | 4854 |
| 362 | Ga0207661_10006300 | 3300025944 | Bacteria | 8395 |
| 363 | Ga0207661_10012912 | 3300025944 | Bacteria | 6091 |
| 364 | Ga0207661_10074007 | 3300025944 | Bacteria | 2792 |
| 365 | Ga0207661_10155490 | 3300025944 | Bacteria | 1980 |
| 366 | Ga0207661_10389118 | 3300025944 | Bacteria | 1263 |
| 367 | Ga0207661_10716558 | 3300025944 | Bacteria | 920 |
| 368 | Ga0207679_10009597 | 3300025945 | Bacteria | 6203 |
| 369 | Ga0207679_10111860 | 3300025945 | Bacteria | 2157 |
| 370 | Ga0207679_10605007 | 3300025945 | Bacteria | 988 |
| 371 | Ga0207667_10001963 | 3300025949 | Bacteria | 25773 |
| 372 | Ga0207667_10071396 | 3300025949 | Bacteria | 3610 |
| 373 | Ga0207667_10143189 | 3300025949 | Bacteria | 2461 |
| 374 | Ga0207667_10209304 | 3300025949 | Bacteria | 1999 |
| 375 | Ga0207651_10113870 | 3300025960 | Bacteria | 2036 |
| 376 | Ga0207712_10137742 | 3300025961 | Bacteria | 1869 |
| 377 | Ga0207668_10009134 | 3300025972 | Bacteria | 5927 |
| 378 | Ga0207668_10181597 | 3300025972 | Bacteria | 1660 |
| 379 | Ga0207640_10175773 | 3300025981 | Bacteria | 1600 |
| 380 | Ga0207658_10002264 | 3300025986 | Bacteria | 14243 |
| 381 | Ga0207658_10014394 | 3300025986 | Bacteria | 5417 |
| 382 | Ga0207658_10023727 | 3300025986 | Bacteria | 4285 |
| 383 | Ga0207658_10163271 | 3300025986 | Bacteria | 1827 |
| 384 | Ga0207658_10306908 | 3300025986 | Bacteria | 1369 |
| 385 | Ga0207677_10187853 | 3300026023 | Bacteria | 1632 |
| 386 | Ga0207703_10000131 | 3300026035 | Bacteria | 90186 |
| 387 | Ga0207703_10036156 | 3300026035 | Bacteria | 3929 |
| 388 | Ga0207639_10385870 | 3300026041 | Bacteria | 1259 |
| 389 | Ga0207708_10006405 | 3300026075 | Bacteria | 8722 |
| 390 | Ga0207708_10019070 | 3300026075 | Bacteria | 5164 |
| 391 | Ga0207702_10044597 | 3300026078 | Bacteria | 3727 |
| 392 | Ga0207702_10106187 | 3300026078 | Bacteria | 2488 |
| 393 | Ga0207702_10731019 | 3300026078 | Bacteria | 976 |
| 394 | Ga0207641_10010850 | 3300026088 | Bacteria | 7464 |
| 395 | Ga0207641_10120500 | 3300026088 | Bacteria | 2340 |
| 396 | Ga0207641_10964067 | 3300026088 | Bacteria | 849 |
| 397 | Ga0207648_10001262 | 3300026089 | Bacteria | 28251 |
| 398 | Ga0207676_10028744 | 3300026095 | Bacteria | 4156 |
| 399 | Ga0207676_10489901 | 3300026095 | Bacteria | 1166 |
| 400 | Ga0207676_10503859 | 3300026095 | Bacteria | 1150 |
| 401 | Ga0207674_10011490 | 3300026116 | Bacteria | 9946 |
| 402 | Ga0207674_10030152 | 3300026116 | Bacteria | 5705 |
| 403 | Ga0207674_10031495 | 3300026116 | Bacteria | 5571 |
| 404 | Ga0207674_10031793 | 3300026116 | Bacteria | 5540 |
| 405 | Ga0207674_10051815 | 3300026116 | Bacteria | 4187 |
| 406 | Ga0207674_10474475 | 3300026116 | Bacteria | 1209 |
| 407 | Ga0207675_100002583 | 3300026118 | Bacteria | 17935 |
| 408 | Ga0207675_100022886 | 3300026118 | Bacteria | 5812 |
| 409 | Ga0207698_10005106 | 3300026142 | Bacteria | 8063 |
| 410 | Ga0207698_10009635 | 3300026142 | Bacteria | 6167 |
| 411 | Ga0207698_10257452 | 3300026142 | Bacteria | 1601 |
| 412 | Ga0207698_10269546 | 3300026142 | Bacteria | 1569 |
| 413 | Ga0207698_10591408 | 3300026142 | Bacteria | 1093 |
| 414 | Ga0207698_10663147 | 3300026142 | Bacteria | 1035 |
| 415 | Ga0209813_10005935 | 3300027866 | Bacteria | 2997 |
| 416 | Ga0207428_10217109 | 3300027907 | Bacteria | 1435 |
| 417 | Ga0268266_10001099 | 3300028379 | Bacteria | 33884 |
| 418 | Ga0268266_10003454 | 3300028379 | Bacteria | 15758 |
| 419 | Ga0268266_10307389 | 3300028379 | Bacteria | 1481 |
| 420 | Ga0268265_10315832 | 3300028380 | Bacteria | 1413 |
| 421 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 422 | Ga0268264_10000775 | 3300028381 | Bacteria | 35258 |
| 423 | Ga0268264_10136939 | 3300028381 | Bacteria | 2178 |
| 424 | Ga0316176_1191746 | 3300030732 | Bacteria | 1676 |
| 425 | Ga0314311_1041561 | 3300030733 | Bacteria | 2195 |
| 426 | Ga0316179_1043364 | 3300030734 | Bacteria | 1731 |
| 427 | Ga0316181_1131546 | 3300030744 | Bacteria | 826 |
| 428 | Ga0265329_10057247 | 3300031242 | Bacteria | 1236 |
| 429 | Ga0307513_10172564 | 3300031456 | Bacteria | 2038 |
| 430 | Ga0307508_10043766 | 3300031616 | Bacteria | 4009 |
| 431 | Ga0307514_10139981 | 3300031649 | Bacteria | 1647 |
| 432 | Ga0316576_10073392 | 3300031727 | Bacteria | 2528 |
| 433 | Ga0316578_10206613 | 3300031728 | Bacteria | 1182 |
| 434 | Ga0307516_10204116 | 3300031730 | Bacteria | 1694 |
| 435 | Ga0307405_10080843 | 3300031731 | Bacteria | 2123 |
| 436 | Ga0307405_10193875 | 3300031731 | Bacteria | 1470 |
| 437 | Ga0307410_10320180 | 3300031852 | Bacteria | 1230 |
| 438 | Ga0307410_10343321 | 3300031852 | Bacteria | 1191 |
| 439 | Ga0307406_10215758 | 3300031901 | Bacteria | 1423 |
| 440 | Ga0307407_10048260 | 3300031903 | Bacteria | 2422 |
| 441 | Ga0307412_10021847 | 3300031911 | Bacteria | 3914 |
| 442 | Ga0307412_10065908 | 3300031911 | Bacteria | 2453 |
| 443 | Ga0307412_10642861 | 3300031911 | Bacteria | 904 |
| 444 | Ga0307409_100083762 | 3300031995 | Bacteria | 2587 |
| 445 | Ga0307409_100246486 | 3300031995 | Bacteria | 1630 |
| 446 | Ga0307409_100306105 | 3300031995 | Bacteria | 1481 |
| 447 | Ga0307409_100421865 | 3300031995 | Bacteria | 1280 |
| 448 | Ga0307416_100877097 | 3300032002 | Bacteria | 996 |
| 449 | Ga0307416_101030314 | 3300032002 | Bacteria | 927 |
| 450 | Ga0307414_10028339 | 3300032004 | Bacteria | 3631 |
| 451 | Ga0307414_10446127 | 3300032004 | Bacteria | 1134 |
| 452 | Ga0307414_10512980 | 3300032004 | Bacteria | 1063 |
| 453 | Ga0307414_10876483 | 3300032004 | Bacteria | 822 |
| 454 | Ga0307411_10968546 | 3300032005 | Bacteria | 760 |
| 455 | Ga0307415_100094377 | 3300032126 | Bacteria | 2175 |
| 456 | Ga0307415_100112687 | 3300032126 | Archaea | 2022 |
| 457 | Ga0307415_100307980 | 3300032126 | Bacteria | 1315 |
| 458 | Ga0307415_100611466 | 3300032126 | Bacteria | 971 |
| 459 | Ga0373926_0003223 | 3300035083 | Bacteria | 5242 |
| 460 | Ga0373934_0003231 | 3300035086 | Bacteria | 5958 |
| 461 | Ga0373944_0001493 | 3300035089 | Bacteria | 5916 |
| 462 | Ga0373944_0002001 | 3300035089 | Bacteria | 5167 |
| 463 | Ga0373923_0009413 | 3300035111 | Bacteria | 3525 |
| 464 | Ga0373936_0010006 | 3300035113 | Bacteria | 3579 |
| 465 | Ga0373945_0000297 | 3300035116 | Bacteria | 14137 |
| 466 | Ga0373945_0011275 | 3300035116 | Bacteria | 2955 |
| 467 | Ga0373954_0003219 | 3300035118 | Bacteria | 6903 |
| 468 | Ga0373954_0034272 | 3300035118 | Bacteria | 2351 |
| 469 | Ga0373956_0102199 | 3300035119 | Bacteria | 1330 |
| 470 | Ga0373957_0009188 | 3300035120 | Bacteria | 3227 |
| 471 | Ga0373943_0000586 | 3300035170 | Bacteria | 15773 |
| 472 | Ga0373943_0007254 | 3300035170 | Bacteria | 4974 |
| 473 | Ga0373943_0036836 | 3300035170 | Bacteria | 2344 |
| 474 | Ga0373946_0000057 | 3300035171 | Bacteria | 29670 |
| 475 | Ga0373946_0001085 | 3300035171 | Bacteria | 9378 |
| 476 | Ga0373955_0054523 | 3300035172 | Bacteria | 2186 |
| 477 | Ga0316574_0115910 | 3300035398 | Bacteria | 1718 |
| 478 | Ga0373924_0002621 | 3300035410 | Bacteria | 6071 |
| 479 | Ga0373924_0008137 | 3300035410 | Bacteria | 3799 |
| 480 | Ga0373935_0001547 | 3300035692 | Bacteria | 12811 |
| 481 | Ga0373935_0007043 | 3300035692 | Bacteria | 6711 |
| 482 | Ga0373927_0000281 | 3300035695 | Bacteria | 40043 |
| 483 | Ga0373927_0003517 | 3300035695 | Bacteria | 11206 |
| 484 | Ga0373927_0306994 | 3300035695 | Bacteria | 1044 |
| 485 | Ga0373933_0049458 | 3300035724 | Bacteria | 2506 |
| 486 | Ga0373947_0259726 | 3300035725 | Bacteria | 1150 |
| 487 | Ga0373937_0090054 | 3300036401 | Bacteria | 2841 |
| 488 | Ga0373937_0111267 | 3300036401 | Bacteria | 2547 |
| 489 | Ga0373925_0004092 | 3300037068 | Bacteria | 11068 |
| 490 | Ga0373925_0018182 | 3300037068 | Bacteria | 5106 |
| 491 | Ga0395899_0167194 | 3300037312 | Bacteria | 1551 |
| 492 | Ga0395900_0400287 | 3300037418 | Bacteria | 1337 |
| 493 | Ga0395900_0475010 | 3300037418 | Bacteria | 1203 |
| 494 | Ga0395898_0141403 | 3300037466 | Unclassified | 2304 |
| 495 | Ga0395898_0152562 | 3300037466 | Bacteria | 2210 |
| 496 | Ga0395898_0234068 | 3300037466 | Bacteria | 1752 |
| 497 | Ga0395898_0320330 | 3300037466 | Bacteria | 1479 |
| 498 | Ga0395905_0007654 | 3300037471 | Bacteria | 10723 |
| 499 | Ga0436364_1551954 | 3300037853 | Bacteria | 6411 |
| 500 | Ga0395901_0038724 | 3300038443 | Bacteria | 4932 |
| 501 | Ga0395901_0140828 | 3300038443 | Bacteria | 2535 |
| 502 | Ga0436365_0906829 | 3300039437 | Bacteria | 2269 |
| 503 | Ga0436365_1820644 | 3300039437 | Bacteria | 1686 |
| 504 | Ga0451793_0945671 | 3300041452 | Bacteria | 4802 |
| 505 | Ga0451802_0761233 | 3300041460 | Bacteria | 934 |
| 506 | Ga0451833_0532435 | 3300041491 | Bacteria | 8757 |
| 507 | Ga0451839_0500015 | 3300041496 | Bacteria | 5412 |
| 508 | Ga0451853_0001627 | 3300041512 | Bacteria | 1154 |
| 509 | Ga0439431_0005909 | 3300041997 | Bacteria | 2704 |
| 510 | Ga0450907_015927 | 3300042146 | Bacteria | 1253 |
| 511 | Ga0439446_0007150 | 3300042156 | Bacteria | 2928 |
| 512 | Ga0439434_0047335 | 3300042435 | Bacteria | 1328 |
| 513 | Ga0439464_0026721 | 3300042439 | Bacteria | 1602 |
| 514 | Ga0466969_0038176 | 3300044656 | Bacteria | 2418 |
| 515 | Ga0466969_0098588 | 3300044656 | Bacteria | 1378 |
| 516 | Ga0466972_0040707 | 3300044658 | Bacteria | 2263 |
| 517 | Ga0466972_0134952 | 3300044658 | Bacteria | 1162 |
| 518 | Ga0466972_0147407 | 3300044658 | Bacteria | 1107 |
| 519 | Ga0466965_0018748 | 3300044683 | Bacteria | 3320 |
| 520 | Ga0466965_0047295 | 3300044683 | Bacteria | 2130 |
| 521 | Ga0466965_0056454 | 3300044683 | Bacteria | 1955 |
| 522 | Ga0466965_0059510 | 3300044683 | Bacteria | 1907 |
| 523 | Ga0466966_0028816 | 3300044684 | Bacteria | 3615 |
| 524 | Ga0466966_0066102 | 3300044684 | Bacteria | 2273 |
| 525 | Ga0466966_0074133 | 3300044684 | Bacteria | 2128 |
| 526 | Ga0466961_0010808 | 3300044693 | Bacteria | 5830 |
| 527 | Ga0466961_0024561 | 3300044693 | Bacteria | 3877 |
| 528 | Ga0466961_0032099 | 3300044693 | Bacteria | 3375 |
| 529 | Ga0466961_0235003 | 3300044693 | Bacteria | 1127 |
| 530 | Ga0466961_0282228 | 3300044693 | Bacteria | 1016 |
| 531 | Ga0466963_0091226 | 3300044694 | Bacteria | 2075 |
| 532 | Ga0466963_0101303 | 3300044694 | Bacteria | 1972 |
| 533 | Ga0466963_0104822 | 3300044694 | Bacteria | 1938 |
| 534 | Ga0466963_0167581 | 3300044694 | Bacteria | 1530 |
| 535 | Ga0466964_0002463 | 3300044706 | Bacteria | 6577 |
| 536 | Ga0466964_0067283 | 3300044706 | Bacteria | 1506 |
| 537 | Ga0453684_0029935 | 3300044712 | Bacteria | 7709 |
| 538 | Ga0466971_0005451 | 3300044719 | Bacteria | 5521 |
| 539 | Ga0466971_0019229 | 3300044719 | Bacteria | 3032 |
| 540 | Ga0466968_0057896 | 3300044735 | Bacteria | 1667 |
| 541 | Ga0466970_0003597 | 3300044765 | Bacteria | 7558 |
| 542 | Ga0466970_0006898 | 3300044765 | Bacteria | 5686 |
| 543 | Ga0466970_0010213 | 3300044765 | Bacteria | 4758 |
| 544 | Ga0466970_0038490 | 3300044765 | Bacteria | 2537 |
| 545 | Ga0466970_0047490 | 3300044765 | Bacteria | 2288 |
| 546 | Ga0466970_0048238 | 3300044765 | Bacteria | 2270 |
| 547 | Ga0466970_0079816 | 3300044765 | Bacteria | 1767 |
| 548 | Ga0466970_0130462 | 3300044765 | Bacteria | 1380 |
| 549 | Ga0466970_0213390 | 3300044765 | Bacteria | 1076 |
| 550 | Ga0466970_0226034 | 3300044765 | Bacteria | 1045 |
| 551 | Ga0466957_0060381 | 3300044842 | Bacteria | 2325 |
| 552 | Ga0466957_0104957 | 3300044842 | Bacteria | 1785 |
| 553 | Ga0466957_0537814 | 3300044842 | Bacteria | 813 |
| 554 | Ga0466960_0000528 | 3300044901 | Bacteria | 13102 |
| 555 | Ga0466960_0004086 | 3300044901 | Bacteria | 5671 |
| 556 | Ga0466960_0018199 | 3300044901 | Bacteria | 3075 |
| 557 | Ga0466960_0020794 | 3300044901 | Bacteria | 2913 |
| 558 | Ga0466960_0179474 | 3300044901 | Bacteria | 1147 |
| 559 | Ga0466959_0002006 | 3300045049 | Bacteria | 12841 |
| 560 | Ga0466959_0071713 | 3300045049 | Bacteria | 2508 |
| 561 | Ga0466959_0092898 | 3300045049 | Bacteria | 2166 |
| 562 | Ga0466959_0322624 | 3300045049 | Bacteria | 1056 |
| 563 | Ga0466958_0087273 | 3300045836 | Bacteria | 1926 |
| 564 | Ga0466958_0188949 | 3300045836 | Bacteria | 1309 |
| 565 | Ga0466967_0060849 | 3300045976 | Bacteria | 3348 |
| 566 | Ga0466967_0087613 | 3300045976 | Bacteria | 2823 |
| 567 | Ga0466967_0107759 | 3300045976 | Bacteria | 2556 |
| 568 | Ga0466967_0180153 | 3300045976 | Bacteria | 1993 |
| 569 | Ga0466967_0210904 | 3300045976 | Bacteria | 1842 |
| 570 | Ga0466967_0241880 | 3300045976 | Bacteria | 1722 |
| 571 | Ga0466967_0491483 | 3300045976 | Bacteria | 1203 |
| 572 | Ga0466967_0522640 | 3300045976 | Bacteria | 1166 |
| 573 | Ga0495592_0014634 | 3300046454 | Bacteria | 5955 |
| 574 | Ga0495592_0120924 | 3300046454 | Bacteria | 1842 |
| 575 | Ga0495603_0001542 | 3300046455 | Bacteria | 13475 |
| 576 | Ga0495629_0009091 | 3300046459 | Bacteria | 7278 |
| 577 | Ga0495629_0095322 | 3300046459 | Bacteria | 2076 |
| 578 | Ga0495641_0009648 | 3300046461 | Bacteria | 5709 |
| 579 | Ga0495641_0015388 | 3300046461 | Bacteria | 4087 |
| 580 | Ga0495641_0039930 | 3300046461 | Bacteria | 2185 |
| 581 | Ga0495641_0093999 | 3300046461 | Bacteria | 1339 |
| 582 | Ga0495651_0059452 | 3300046462 | Bacteria | 2930 |
| 583 | Ga0495651_0080028 | 3300046462 | Bacteria | 2468 |
| 584 | Ga0495653_0029872 | 3300046463 | Bacteria | 4344 |
| 585 | Ga0495650_0000702 | 3300046471 | Bacteria | 42949 |
| 586 | Ga0495580_0092637 | 3300046472 | Bacteria | 2103 |
| 587 | Ga0495582_0033962 | 3300046473 | Bacteria | 2804 |
| 588 | Ga0495639_0001019 | 3300046475 | Bacteria | 12672 |
| 589 | Ga0495662_0001001 | 3300046476 | Bacteria | 13829 |
| 590 | Ga0495664_0001381 | 3300046477 | Bacteria | 12822 |
| 591 | Ga0495664_0066644 | 3300046477 | Bacteria | 2147 |
| 592 | Ga0495664_0305809 | 3300046477 | Bacteria | 960 |
| 593 | Ga0495594_0015381 | 3300046499 | Bacteria | 4019 |
| 594 | Ga0495608_0016336 | 3300046511 | Bacteria | 5135 |
| 595 | Ga0495618_0020849 | 3300046514 | Bacteria | 4034 |
| 596 | Ga0495618_0032056 | 3300046514 | Bacteria | 3291 |
| 597 | Ga0495618_0079458 | 3300046514 | Bacteria | 2092 |
| 598 | Ga0495618_0166591 | 3300046514 | Bacteria | 1403 |
| 599 | Ga0495628_0078730 | 3300046516 | Bacteria | 2563 |
| 600 | Ga0495628_0153270 | 3300046516 | Bacteria | 1754 |
| 601 | Ga0495628_0401921 | 3300046516 | Bacteria | 1000 |
| 602 | Ga0495630_0001525 | 3300046517 | Bacteria | 16047 |
| 603 | Ga0495630_0045401 | 3300046517 | Bacteria | 3283 |
| 604 | Ga0495666_0005147 | 3300046526 | Bacteria | 6608 |
| 605 | Ga0495652_0102575 | 3300046529 | Bacteria | 2317 |
| 606 | Ga0495652_0137957 | 3300046529 | Bacteria | 1921 |
| 607 | Ga0495665_0003599 | 3300046531 | Bacteria | 8410 |
| 608 | Ga0495665_0024404 | 3300046531 | Bacteria | 3248 |
| 609 | Ga0495640_0070817 | 3300046533 | Bacteria | 2341 |
| 610 | Ga0495640_0280571 | 3300046533 | Bacteria | 1037 |
| 611 | Ga0495586_0024803 | 3300046535 | Bacteria | 3206 |
| 612 | Ga0495587_0050043 | 3300046536 | Bacteria | 2472 |
| 613 | Ga0495587_0083884 | 3300046536 | Bacteria | 1846 |
| 614 | Ga0495645_0004607 | 3300046543 | Bacteria | 9411 |
| 615 | Ga0495645_0043472 | 3300046543 | Bacteria | 3277 |
| 616 | Ga0495667_0033861 | 3300046559 | Bacteria | 3417 |
| 617 | Ga0495667_0099489 | 3300046559 | Bacteria | 1882 |
| 618 | Ga0495634_0014957 | 3300046642 | Bacteria | 5579 |
| 619 | Ga0495634_0064680 | 3300046642 | Bacteria | 2424 |
| 620 | Ga0495634_0333711 | 3300046642 | Bacteria | 911 |
| 621 | Ga0495635_0001647 | 3300046663 | Bacteria | 15061 |
| 622 | Ga0495635_0071456 | 3300046663 | Bacteria | 2378 |
| 623 | Ga0495635_0078034 | 3300046663 | Bacteria | 2268 |
| 624 | Ga0495588_0067071 | 3300046674 | Bacteria | 1862 |
| 625 | Ga0495657_0033202 | 3300046675 | Bacteria | 3594 |
| 626 | Ga0495657_0034902 | 3300046675 | Bacteria | 3490 |
| 627 | Ga0495599_0092889 | 3300046678 | Bacteria | 1882 |
| 628 | Ga0495599_0132695 | 3300046678 | Bacteria | 1546 |
| 629 | Ga0495623_0006098 | 3300046679 | Bacteria | 7840 |
| 630 | Ga0495646_0091542 | 3300046680 | Bacteria | 1754 |
| 631 | Ga0495647_0003977 | 3300046681 | Bacteria | 4771 |
| 632 | Ga0495647_0099096 | 3300046681 | Bacteria | 1205 |
| 633 | Ga0495658_0001135 | 3300046683 | Bacteria | 14067 |
| 634 | Ga0495613_0039267 | 3300046689 | Bacteria | 3509 |
| 635 | Ga0495624_0010905 | 3300046690 | Bacteria | 6265 |
| 636 | Ga0495624_0019973 | 3300046690 | Bacteria | 4464 |
| 637 | Ga0495624_0357850 | 3300046690 | Bacteria | 878 |
| 638 | Ga0495670_0145463 | 3300046691 | Bacteria | 1242 |
| 639 | Ga0495600_0004762 | 3300046809 | Bacteria | 8140 |
| 640 | Ga0495581_0000621 | 3300047315 | Bacteria | 18604 |
| 641 | Ga0495581_0202462 | 3300047315 | Bacteria | 1161 |
| 642 | Ga0495604_0078764 | 3300047317 | Bacteria | 2472 |
| 643 | Ga0495604_0080068 | 3300047317 | Bacteria | 2448 |
| 644 | Ga0495674_0001430 | 3300047319 | Bacteria | 23388 |
| 645 | Ga0495674_0044503 | 3300047319 | Bacteria | 3946 |
| 646 | Ga0495674_0170653 | 3300047319 | Bacteria | 1815 |
| 647 | Ga0495676_0001791 | 3300047321 | Bacteria | 18771 |
| 648 | Ga0495676_0047778 | 3300047321 | Bacteria | 3456 |
| 649 | Ga0495680_0043195 | 3300047322 | Bacteria | 3570 |
| 650 | Ga0495680_0045877 | 3300047322 | Bacteria | 3448 |
| 651 | Ga0495680_0047836 | 3300047322 | Bacteria | 3361 |
| 652 | Ga0495680_0060752 | 3300047322 | Bacteria | 2911 |
| 653 | Ga0495675_0034315 | 3300047444 | Bacteria | 3239 |
| 654 | Ga0495675_0108117 | 3300047444 | Bacteria | 1737 |
| 655 | Ga0495684_0019054 | 3300047471 | Bacteria | 5283 |
| 656 | Ga0495684_0031990 | 3300047471 | Bacteria | 4038 |
| 657 | Ga0495684_0049805 | 3300047471 | Bacteria | 3200 |
| 658 | Ga0495593_0004888 | 3300047673 | Bacteria | 7952 |
| 659 | Ga0495602_0022328 | 3300048088 | Bacteria | 6196 |
| 660 | Ga0495602_0086282 | 3300048088 | Bacteria | 2620 |
| 661 | Ga0495602_0212140 | 3300048088 | Bacteria | 1468 |
| 662 | Ga0495614_0014075 | 3300048089 | Bacteria | 3507 |
| 663 | Ga0496100_0155326 | 3300048903 | Bacteria | 1636 |
| 664 | Ga0496100_0233110 | 3300048903 | Bacteria | 1355 |
| 665 | Ga0496100_0257311 | 3300048903 | Bacteria | 1293 |
| 666 | Ga0496100_0428566 | 3300048903 | Bacteria | 1011 |
| 667 | Ga0496101_0038871 | 3300048904 | Bacteria | 3381 |
| 668 | Ga0496101_0053929 | 3300048904 | Bacteria | 2902 |
| 669 | Ga0496101_0443424 | 3300048904 | Bacteria | 1024 |
| 670 | Ga0496102_0011688 | 3300048905 | Bacteria | 7577 |
| 671 | Ga0496102_0015865 | 3300048905 | Bacteria | 6570 |
| 672 | Ga0496102_0043775 | 3300048905 | Bacteria | 4061 |
| 673 | Ga0496102_0636600 | 3300048905 | Bacteria | 989 |
| 674 | Ga0496103_0002876 | 3300048906 | Bacteria | 10691 |
| 675 | Ga0496103_0058264 | 3300048906 | Bacteria | 2399 |
| 676 | Ga0496103_0293758 | 3300048906 | Bacteria | 1045 |
| 677 | Ga0496104_0041192 | 3300048907 | Bacteria | 4330 |
| 678 | Ga0496104_0080867 | 3300048907 | Bacteria | 3098 |
| 679 | Ga0496104_0758063 | 3300048907 | Bacteria | 877 |
| 680 | Ga0496104_0762041 | 3300048907 | Bacteria | 875 |
| 681 | Ga0496105_0085711 | 3300048908 | Bacteria | 2603 |
| 682 | Ga0496105_0100662 | 3300048908 | Bacteria | 2386 |
| 683 | Ga0496105_0228083 | 3300048908 | Bacteria | 1514 |
| 684 | Ga0496106_0218851 | 3300048909 | Bacteria | 1518 |
| 685 | Ga0496107_0184584 | 3300048910 | Bacteria | 1549 |
| 686 | Ga0496107_0253879 | 3300048910 | Bacteria | 1308 |
| 687 | Ga0496108_0032801 | 3300048911 | Bacteria | 4313 |
| 688 | Ga0496108_0034423 | 3300048911 | Bacteria | 4209 |
| 689 | Ga0496108_0183013 | 3300048911 | Bacteria | 1815 |
| 690 | Ga0496109_0012037 | 3300048912 | Bacteria | 7452 |
| 691 | Ga0496109_0106752 | 3300048912 | Bacteria | 2601 |
| 692 | Ga0496109_0148022 | 3300048912 | Bacteria | 2197 |
| 693 | Ga0496109_0176383 | 3300048912 | Bacteria | 2006 |
| 694 | Ga0496109_0289847 | 3300048912 | Bacteria | 1543 |
| 695 | Ga0496109_0370241 | 3300048912 | Bacteria | 1353 |
| 696 | Ga0496110_0024974 | 3300048913 | Bacteria | 5100 |
| 697 | Ga0496110_0051777 | 3300048913 | Bacteria | 3608 |
| 698 | Ga0496110_0106428 | 3300048913 | Bacteria | 2517 |
| 699 | Ga0496110_0462075 | 3300048913 | Bacteria | 1157 |
| 700 | Ga0496111_0009560 | 3300048914 | Bacteria | 6478 |
| 701 | Ga0496111_0092189 | 3300048914 | Bacteria | 2220 |
| 702 | Ga0496111_0177208 | 3300048914 | Bacteria | 1584 |
| 703 | Ga0496111_0289223 | 3300048914 | Bacteria | 1215 |
| 704 | Ga0496112_0006741 | 3300048915 | Bacteria | 10117 |
| 705 | Ga0496112_0047690 | 3300048915 | Bacteria | 4202 |
| 706 | Ga0496112_0238116 | 3300048915 | Bacteria | 1773 |
| 707 | Ga0496113_0238698 | 3300048916 | Bacteria | 1450 |
| 708 | Ga0496113_0427798 | 3300048916 | Bacteria | 1064 |
| 709 | Ga0496114_0005838 | 3300048917 | Bacteria | 9667 |
| 710 | Ga0496114_0006548 | 3300048917 | Bacteria | 9180 |
| 711 | Ga0496114_0018839 | 3300048917 | Bacteria | 5589 |
| 712 | Ga0496114_0057665 | 3300048917 | Bacteria | 3242 |
| 713 | Ga0496114_0096703 | 3300048917 | Bacteria | 2514 |
| 714 | Ga0496114_0137086 | 3300048917 | Bacteria | 2116 |
| 715 | Ga0496114_0143372 | 3300048917 | Bacteria | 2070 |
| 716 | Ga0496114_0179282 | 3300048917 | Bacteria | 1849 |
| 717 | Ga0496114_0306276 | 3300048917 | Bacteria | 1403 |
| 718 | Ga0496114_0329178 | 3300048917 | Bacteria | 1350 |
| 719 | Ga0496114_0356295 | 3300048917 | Bacteria | 1294 |
| 720 | Ga0496114_0385358 | 3300048917 | Bacteria | 1241 |
| 721 | Ga0496114_0440598 | 3300048917 | Bacteria | 1154 |
| 722 | Ga0496114_0462954 | 3300048917 | Bacteria | 1122 |
| 723 | Ga0496114_0466478 | 3300048917 | Bacteria | 1118 |
| 724 | Ga0496115_0043254 | 3300048918 | Bacteria | 3592 |
| 725 | Ga0496115_0090499 | 3300048918 | Bacteria | 2499 |
| 726 | Ga0496115_0186105 | 3300048918 | Bacteria | 1716 |
| 727 | Ga0496117_0029237 | 3300048920 | Bacteria | 4252 |
| 728 | Ga0496118_0035053 | 3300048921 | Bacteria | 4083 |
| 729 | Ga0496119_0001675 | 3300048922 | Bacteria | 25909 |
| 730 | Ga0496119_0032727 | 3300048922 | Bacteria | 3461 |
| 731 | Ga0496119_0102138 | 3300048922 | Bacteria | 1608 |
| 732 | Ga0496120_0024499 | 3300048923 | Bacteria | 3762 |
| 733 | Ga0496120_0093505 | 3300048923 | Bacteria | 1602 |
| 734 | Ga0496124_0253126 | 3300048927 | Bacteria | 1301 |
| 735 | Ga0496126_0239668 | 3300048929 | Bacteria | 1516 |
| 736 | Ga0496126_0298325 | 3300048929 | Bacteria | 1330 |
| 737 | Ga0496126_0426082 | 3300048929 | Bacteria | 1072 |
| 738 | Ga0501031_0015189 | 3300049568 | Bacteria | 4999 |
| 739 | Ga0501031_0212989 | 3300049568 | Bacteria | 1259 |
| 740 | Ga0501031_0232436 | 3300049568 | Bacteria | 1200 |
| 741 | Ga0501032_0140581 | 3300049569 | Bacteria | 1590 |
| 742 | Ga0501032_0271348 | 3300049569 | Bacteria | 1099 |
| 743 | Ga0501033_0003981 | 3300049570 | Bacteria | 11962 |
| 744 | Ga0501033_0200435 | 3300049570 | Bacteria | 1426 |
| 745 | Ga0501034_0005065 | 3300049571 | Bacteria | 14477 |
| 746 | Ga0501034_0008156 | 3300049571 | Bacteria | 11105 |
| 747 | Ga0501034_0019848 | 3300049571 | Bacteria | 6867 |
| 748 | Ga0501034_0646506 | 3300049571 | Bacteria | 960 |
| 749 | Ga0501036_0008211 | 3300049572 | Bacteria | 8559 |
| 750 | Ga0501036_0008607 | 3300049572 | Bacteria | 8371 |
| 751 | Ga0501036_0013280 | 3300049572 | Bacteria | 6838 |
| 752 | Ga0501036_0027720 | 3300049572 | Bacteria | 4787 |
| 753 | Ga0501036_0028967 | 3300049572 | Bacteria | 4679 |
| 754 | Ga0501036_0175033 | 3300049572 | Bacteria | 1807 |
| 755 | Ga0501036_0223756 | 3300049572 | Bacteria | 1580 |
| 756 | Ga0501036_0505710 | 3300049572 | Bacteria | 1005 |
| 757 | Ga0501037_0025612 | 3300049573 | Bacteria | 4358 |
| 758 | Ga0501037_0080981 | 3300049573 | Bacteria | 2354 |
| 759 | Ga0501037_0123987 | 3300049573 | Bacteria | 1856 |
| 760 | Ga0501037_0214994 | 3300049573 | Bacteria | 1354 |
| 761 | Ga0501038_0017389 | 3300049574 | Bacteria | 6499 |
| 762 | Ga0501038_0035695 | 3300049574 | Bacteria | 4364 |
| 763 | Ga0501038_0040013 | 3300049574 | Bacteria | 4097 |
| 764 | Ga0501038_0042352 | 3300049574 | Bacteria | 3965 |
| 765 | Ga0501038_0619217 | 3300049574 | Bacteria | 817 |
| 766 | Ga0501039_0037135 | 3300049575 | Bacteria | 3760 |
| 767 | Ga0501039_0043657 | 3300049575 | Bacteria | 3462 |
| 768 | Ga0501039_0087312 | 3300049575 | Bacteria | 2429 |
| 769 | Ga0501039_0355941 | 3300049575 | Bacteria | 1150 |
| 770 | Ga0501039_0430367 | 3300049575 | Bacteria | 1036 |
| 771 | Ga0501040_0234028 | 3300049576 | Bacteria | 1308 |
| 772 | Ga0501040_0267544 | 3300049576 | Bacteria | 1220 |
| 773 | Ga0501040_0356969 | 3300049576 | Bacteria | 1047 |
| 774 | Ga0501041_0245354 | 3300049577 | Bacteria | 1125 |
| 775 | Ga0501042_0009659 | 3300049578 | Bacteria | 6442 |
| 776 | Ga0501042_0116547 | 3300049578 | Bacteria | 1923 |
| 777 | Ga0501042_0136702 | 3300049578 | Bacteria | 1767 |
| 778 | Ga0501042_0139076 | 3300049578 | Bacteria | 1750 |
| 779 | Ga0501043_0010516 | 3300049579 | Bacteria | 7246 |
| 780 | Ga0501043_0106695 | 3300049579 | Bacteria | 2200 |
| 781 | Ga0501043_0110306 | 3300049579 | Bacteria | 2160 |
| 782 | Ga0501043_0134887 | 3300049579 | Bacteria | 1934 |
| 783 | Ga0501046_0000566 | 3300049580 | Bacteria | 36605 |
| 784 | Ga0501046_0002036 | 3300049580 | Bacteria | 19203 |
| 785 | Ga0501046_0004086 | 3300049580 | Bacteria | 13304 |
| 786 | Ga0501046_0108367 | 3300049580 | Bacteria | 2124 |
| 787 | Ga0501047_0017471 | 3300049581 | Bacteria | 6871 |
| 788 | Ga0501047_0081025 | 3300049581 | Bacteria | 3120 |
| 789 | Ga0501047_0122557 | 3300049581 | Bacteria | 2481 |
| 790 | Ga0501047_0523338 | 3300049581 | Bacteria | 1011 |
| 791 | Ga0501048_0010210 | 3300049582 | Bacteria | 7021 |
| 792 | Ga0501048_0027539 | 3300049582 | Bacteria | 4129 |
| 793 | Ga0501048_0032249 | 3300049582 | Bacteria | 3786 |
| 794 | Ga0501048_0054767 | 3300049582 | Bacteria | 2833 |
| 795 | Ga0501048_0111534 | 3300049582 | Bacteria | 1931 |
| 796 | Ga0501067_0000937 | 3300049583 | Bacteria | 15633 |
| 797 | Ga0501067_0001083 | 3300049583 | Bacteria | 14679 |
| 798 | Ga0501067_0043910 | 3300049583 | Bacteria | 2483 |
| 799 | Ga0501067_0072027 | 3300049583 | Bacteria | 1914 |
| 800 | Ga0501067_0211074 | 3300049583 | Bacteria | 1081 |
| 801 | Ga0501068_0032931 | 3300049584 | Bacteria | 3084 |
| 802 | Ga0501068_0116994 | 3300049584 | Bacteria | 1660 |
| 803 | Ga0501068_0189429 | 3300049584 | Bacteria | 1302 |
| 804 | Ga0501069_0061108 | 3300049585 | Bacteria | 2103 |
| 805 | Ga0501069_0117466 | 3300049585 | Bacteria | 1518 |
| 806 | Ga0501070_0004523 | 3300049586 | Bacteria | 11933 |
| 807 | Ga0501070_0014917 | 3300049586 | Bacteria | 6535 |
| 808 | Ga0501070_0025886 | 3300049586 | Bacteria | 4922 |
| 809 | Ga0501070_0092430 | 3300049586 | Bacteria | 2504 |
| 810 | Ga0501070_0156848 | 3300049586 | Bacteria | 1877 |
| 811 | Ga0501070_0347371 | 3300049586 | Bacteria | 1204 |
| 812 | Ga0501070_0405570 | 3300049586 | Bacteria | 1102 |
| 813 | Ga0501071_0012339 | 3300049587 | Bacteria | 5794 |
| 814 | Ga0501071_0365096 | 3300049587 | Bacteria | 1100 |
| 815 | Ga0501071_0440620 | 3300049587 | Bacteria | 997 |
| 816 | Ga0501072_0007300 | 3300049588 | Bacteria | 8382 |
| 817 | Ga0501072_0144642 | 3300049588 | Bacteria | 1896 |
| 818 | Ga0501072_0181169 | 3300049588 | Bacteria | 1680 |
| 819 | Ga0501073_0001438 | 3300049589 | Bacteria | 17600 |
| 820 | Ga0501073_0026638 | 3300049589 | Bacteria | 4140 |
| 821 | Ga0501074_0002081 | 3300049590 | Bacteria | 13828 |
| 822 | Ga0501074_0015528 | 3300049590 | Bacteria | 5535 |
| 823 | Ga0501074_0026756 | 3300049590 | Bacteria | 4182 |
| 824 | Ga0501074_0065720 | 3300049590 | Bacteria | 2610 |
| 825 | Ga0501076_0039234 | 3300049592 | Bacteria | 3718 |
| 826 | Ga0501076_0262274 | 3300049592 | Bacteria | 1415 |
| 827 | Ga0501076_0340354 | 3300049592 | Bacteria | 1231 |
| 828 | Ga0501077_0007040 | 3300049593 | Bacteria | 6936 |
| 829 | Ga0501077_0151572 | 3300049593 | Bacteria | 1471 |
| 830 | Ga0501079_0112992 | 3300049741 | Bacteria | 2111 |
| 831 | Ga0501079_0319524 | 3300049741 | Bacteria | 1215 |
| 832 | Ga0501080_0009062 | 3300049742 | Bacteria | 9057 |
| 833 | Ga0501080_0016540 | 3300049742 | Bacteria | 6815 |
| 834 | Ga0501080_0056688 | 3300049742 | Bacteria | 3648 |
| 835 | Ga0501080_0133283 | 3300049742 | Bacteria | 2300 |
| 836 | Ga0501080_0167300 | 3300049742 | Bacteria | 2029 |
| 837 | Ga0501081_0431911 | 3300049743 | Bacteria | 977 |
| 838 | Ga0501083_0033984 | 3300049744 | Bacteria | 3488 |
| 839 | Ga0501035_0007226 | 3300049822 | Bacteria | 10390 |
| 840 | Ga0501035_0043976 | 3300049822 | Bacteria | 4024 |
| 841 | Ga0501035_0047183 | 3300049822 | Bacteria | 3869 |
| 842 | Ga0501044_0001740 | 3300049823 | Bacteria | 25430 |
| 843 | Ga0501044_0027073 | 3300049823 | Bacteria | 6066 |
| 844 | Ga0501044_0046494 | 3300049823 | Bacteria | 4492 |
| 845 | Ga0501045_0007627 | 3300049824 | Bacteria | 7521 |
| 846 | Ga0501045_0045049 | 3300049824 | Bacteria | 3212 |
| 847 | Ga0501045_0305520 | 3300049824 | Bacteria | 1184 |
| 848 | nmdc:mga03n38_101440_c1 | 3300050490 | Bacteria | 1388 |
| 849 | nmdc:mga03n38_12549_c1 | 3300050490 | Bacteria | 3193 |
| 850 | nmdc:mga03n38_16877_c1 | 3300050490 | Bacteria | 2849 |
| 851 | nmdc:mga03n38_182_c1 | 3300050490 | Bacteria | 14160 |
| 852 | nmdc:mga03n38_52576_c1 | 3300050490 | Bacteria | 1824 |
| 853 | nmdc:mga03n38_83309_c1 | 3300050490 | Bacteria | 1508 |
| 854 | nmdc:mga00v17_103515_c1 | 3300050491 | Bacteria | 1799 |
| 855 | nmdc:mga00v17_15986_c1 | 3300050491 | Bacteria | 4224 |
| 856 | nmdc:mga00v17_222875_c1 | 3300050491 | Bacteria | 1221 |
| 857 | nmdc:mga00v17_4761_c1 | 3300050491 | Bacteria | 7102 |
| 858 | nmdc:mga00v17_76350_c1 | 3300050491 | Bacteria | 2084 |
| 859 | nmdc:mga00v17_84397_c1 | 3300050491 | Bacteria | 1988 |
| 860 | nmdc:mga00v17_938_c1 | 3300050491 | Bacteria | 15668 |
| 861 | nmdc:mga00v17_9434_c1 | 3300050491 | Bacteria | 5281 |
| 862 | nmdc:mga0yw44_23554_c1 | 3300050492 | Bacteria | 3471 |
| 863 | nmdc:mga0yw44_2602_c1 | 3300050492 | Bacteria | 7754 |
| 864 | nmdc:mga0yw44_30881_c1 | 3300050492 | Bacteria | 3111 |
| 865 | nmdc:mga0yw44_434524_c1 | 3300050492 | Bacteria | 889 |
| 866 | nmdc:mga0yw44_4605_c1 | 3300050492 | Bacteria | 6360 |
| 867 | nmdc:mga0yw44_73996_c1 | 3300050492 | Bacteria | 2121 |
| 868 | nmdc:mga0yw44_8410_c1 | 3300050492 | Bacteria | 5141 |
| 869 | nmdc:mga0yw44_97024_c1 | 3300050492 | Bacteria | 1872 |
| 870 | nmdc:mga06z11_101722_c1 | 3300050494 | Bacteria | 1578 |
| 871 | nmdc:mga06z11_59730_c1 | 3300050494 | Bacteria | 1983 |
| 872 | nmdc:mga06z11_81385_c1 | 3300050494 | Bacteria | 1738 |
| 873 | nmdc:mga04h51_7926_c1 | 3300050495 | Bacteria | 2825 |
| 874 | nmdc:mga07m45_16037_c1 | 3300050496 | Bacteria | 4010 |
| 875 | nmdc:mga07m45_20267_c1 | 3300050496 | Bacteria | 3612 |
| 876 | nmdc:mga07m45_43084_c2 | 3300050496 | Bacteria | 995 |
| 877 | nmdc:mga05p37_688_c1 | 3300050507 | Bacteria | 37481 |
| 878 | nmdc:mga05p37_947_c1 | 3300050507 | Bacteria | 32746 |
| 879 | nmdc:mga09592_38_c2 | 3300050508 | Bacteria | 42368 |
| 880 | nmdc:mga09592_48606_c1 | 3300050508 | Bacteria | 3576 |
| 881 | nmdc:mga0qj67_110810_c1 | 3300050509 | Bacteria | 2216 |
| 882 | nmdc:mga0qj67_31_c2 | 3300050509 | Bacteria | 11004 |
| 883 | nmdc:mga06r32_19_c1 | 3300050510 | Bacteria | 98901 |
| 884 | nmdc:mga06r32_282_c1 | 3300050510 | Bacteria | 42388 |
| 885 | Ga0495601_0009096 | 3300053077 | Bacteria | 5865 |
| 886 | Ga0495601_0040369 | 3300053077 | Bacteria | 2923 |
| 887 | Ga0495601_0070549 | 3300053077 | Bacteria | 2230 |
| 888 | Ga0495601_0192570 | 3300053077 | Bacteria | 1332 |
| 889 | Ga0495612_0025097 | 3300053078 | Bacteria | 2393 |
| 890 | Ga0495595_0028265 | 3300053084 | Bacteria | 2504 |
| 891 | Ga0495619_0007037 | 3300053085 | Bacteria | 7117 |
| 892 | Ga0495619_0016103 | 3300053085 | Bacteria | 4732 |
| 893 | Ga0495619_0457374 | 3300053085 | Bacteria | 880 |
| 894 | Ga0500644_0000009 | 3300053088 | Bacteria | 127269 |
| 895 | Ga0500651_0000647 | 3300053093 | Bacteria | 17374 |
| 896 | Ga0500660_164739 | 3300053100 | Bacteria | 832 |
| 897 | Ga0500554_030903 | 3300053102 | Bacteria | 1577 |
| 898 | Ga0500554_065185 | 3300053102 | Bacteria | 1176 |
| 899 | Ga0500556_0001531 | 3300053104 | Bacteria | 9469 |
| 900 | Ga0500593_000177 | 3300053117 | Bacteria | 25732 |
| 901 | Ga0500559_0045296 | 3300053136 | Bacteria | 1925 |
| 902 | Ga0500568_0001114 | 3300053139 | Bacteria | 18032 |
| 903 | Ga0500573_0049081 | 3300053140 | Bacteria | 2429 |
| 904 | Ga0500573_0102212 | 3300053140 | Bacteria | 1612 |
| 905 | Ga0500590_006392 | 3300053148 | Bacteria | 5740 |
| 906 | Ga0500616_0000463 | 3300053153 | Bacteria | 52811 |
| 907 | Ga0500616_0001506 | 3300053153 | Bacteria | 21995 |
| 908 | Ga0501084_0013685 | 3300054114 | Bacteria | 6716 |
| 909 | Ga0501082_0023488 | 3300060353 | Bacteria | 5320 |
| 910 | Ga0501082_0252637 | 3300060353 | Bacteria | 1534 |
| 911 | Ga0466962_0003718 | 3300061719 | Bacteria | 7279 |
| 912 | Ga0466962_0121126 | 3300061719 | Bacteria | 1262 |
| 913 | Ga0530510_0181576 | 3300061734 | Bacteria | 1561 |
| 914 | Ga0530510_0424942 | 3300061734 | Bacteria | 1003 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005288 | Ga0065714_10064450 | Ga0065714_1006445038 | 209 |
| 2 | 3300013297 | Ga0157378_10498882 | Ga0157378_104988821 | 216 |
| 3 | 3300031728 | Ga0316578_10206613 | Ga0316578_102066132 | 218 |
| 4 | 3300035398 | Ga0316574_0115910 | Ga0316574_0115910_131_880 | 218 |
| 5 | 3300005563 | Ga0068855_100777547 | Ga0068855_1007775471 | 223 |
| 6 | 3300032004 | Ga0307414_10028339 | Ga0307414_100283393 | 223 |
| 7 | 3300013308 | Ga0157375_10275722 | Ga0157375_102757222 | 228 |
| 8 | 3300048905 | Ga0496102_0015865 | Ga0496102_0015865_5655_6401 | 228 |
| 9 | 3300048906 | Ga0496103_0002876 | Ga0496103_0002876_154_900 | 228 |
| 10 | 3300048907 | Ga0496104_0080867 | Ga0496104_0080867_1102_1848 | 228 |
| 11 | 3300048908 | Ga0496105_0100662 | Ga0496105_0100662_958_1704 | 228 |
| 12 | 3300048917 | Ga0496114_0096703 | Ga0496114_0096703_1598_2344 | 228 |
| 13 | 3300048918 | Ga0496115_0090499 | Ga0496115_0090499_418_1164 | 228 |
| 14 | 3300048922 | Ga0496119_0032727 | Ga0496119_0032727_2654_3400 | 228 |
| 15 | 3300044712 | Ga0453684_0029935 | Ga0453684_0029935_861_1589 | 231 |
| 16 | 3300045976 | Ga0466967_0060849 | Ga0466967_0060849_1023_1733 | 231 |
| 17 | iso_pu_bacteria | 2643221576 | 2643888969 | 231 |
| 18 | iso_pu_bacteria | 2643221590 | 2643958024 | 231 |
| 19 | 3300005356 | Ga0070674_100121364 | Ga0070674_1001213641 | 232 |
| 20 | 3300025937 | Ga0207669_10367607 | Ga0207669_103676072 | 232 |
| 21 | 3300041512 | Ga0451853_0001627 | Ga0451853_0001627_59_784 | 232 |
| 22 | 3300005985 | Ga0081539_10092132 | Ga0081539_100921322 | 233 |
| 23 | 3300037418 | Ga0395900_0400287 | Ga0395900_0400287_63_782 | 233 |
| 24 | 3300037466 | Ga0395898_0141403 | Ga0395898_0141403_995_1714 | 233 |
| 25 | 3300037471 | Ga0395905_0007654 | Ga0395905_0007654_9228_9947 | 233 |
| 26 | 3300003203 | JGI25406J46586_10010786 | JGI25406J46586_100107863 | 234 |
| 27 | 3300003203 | JGI25406J46586_10016391 | JGI25406J46586_100163913 | 234 |
| 28 | 3300005985 | Ga0081539_10000728 | Ga0081539_100007288 | 234 |
| 29 | 3300005985 | Ga0081539_10001334 | Ga0081539_1000133412 | 234 |
| 30 | 3300021384 | Ga0213876_10100757 | Ga0213876_101007572 | 234 |
| 31 | 3300031911 | Ga0307412_10642861 | Ga0307412_106428612 | 234 |
| 32 | 3300032126 | Ga0307415_100112687 | Ga0307415_1001126872 | 234 |
| 33 | 3300039437 | Ga0436365_1820644 | Ga0436365_1820644_347_1069 | 234 |
| 34 | 3300053153 | Ga0500616_0001506 | Ga0500616_0001506_859_1581 | 234 |
| 35 | 3300005290 | Ga0065712_10008640 | Ga0065712_100086401 | 235 |
| 36 | 3300005338 | Ga0068868_100021449 | Ga0068868_1000214493 | 235 |
| 37 | 3300005355 | Ga0070671_100248582 | Ga0070671_1002485822 | 235 |
| 38 | 3300005364 | Ga0070673_100151454 | Ga0070673_1001514543 | 235 |
| 39 | 3300005445 | Ga0070708_100000330 | Ga0070708_10000033022 | 235 |
| 40 | 3300005456 | Ga0070678_100222966 | Ga0070678_1002229662 | 235 |
| 41 | 3300005466 | Ga0070685_10374641 | Ga0070685_103746412 | 235 |
| 42 | 3300005467 | Ga0070706_100017306 | Ga0070706_1000173061 | 235 |
| 43 | 3300005468 | Ga0070707_100042667 | Ga0070707_1000426674 | 235 |
| 44 | 3300005471 | Ga0070698_100171381 | Ga0070698_1001713811 | 235 |
| 45 | 3300005518 | Ga0070699_100000914 | Ga0070699_10000091415 | 235 |
| 46 | 3300005536 | Ga0070697_100043038 | Ga0070697_1000430384 | 235 |
| 47 | 3300005548 | Ga0070665_100070157 | Ga0070665_1000701573 | 235 |
| 48 | 3300005564 | Ga0070664_100168461 | Ga0070664_1001684611 | 235 |
| 49 | 3300005617 | Ga0068859_100004174 | Ga0068859_1000041744 | 235 |
| 50 | 3300005618 | Ga0068864_100031732 | Ga0068864_1000317326 | 235 |
| 51 | 3300005618 | Ga0068864_100305102 | Ga0068864_1003051022 | 235 |
| 52 | 3300005842 | Ga0068858_100035292 | Ga0068858_1000352925 | 235 |
| 53 | 3300005843 | Ga0068860_100044109 | Ga0068860_1000441094 | 235 |
| 54 | 3300006237 | Ga0097621_100028408 | Ga0097621_1000284083 | 235 |
| 55 | 3300006358 | Ga0068871_100021352 | Ga0068871_1000213524 | 235 |
| 56 | 3300006931 | Ga0097620_100004174 | Ga0097620_10000417415 | 235 |
| 57 | 3300009176 | Ga0105242_10587153 | Ga0105242_105871532 | 235 |
| 58 | 3300009177 | Ga0105248_10013752 | Ga0105248_100137526 | 235 |
| 59 | 3300013296 | Ga0157374_10099734 | Ga0157374_100997344 | 235 |
| 60 | 3300013297 | Ga0157378_10304166 | Ga0157378_103041662 | 235 |
| 61 | 3300013306 | Ga0163162_10000646 | Ga0163162_1000064615 | 235 |
| 62 | 3300013308 | Ga0157375_10006748 | Ga0157375_1000674810 | 235 |
| 63 | 3300013308 | Ga0157375_10538778 | Ga0157375_105387781 | 235 |
| 64 | 3300014325 | Ga0163163_10023922 | Ga0163163_100239224 | 235 |
| 65 | 3300014325 | Ga0163163_10117210 | Ga0163163_101172102 | 235 |
| 66 | 3300014969 | Ga0157376_10045102 | Ga0157376_100451022 | 235 |
| 67 | 3300014969 | Ga0157376_10475073 | Ga0157376_104750731 | 235 |
| 68 | 3300025910 | Ga0207684_10168280 | Ga0207684_101682802 | 235 |
| 69 | 3300025910 | Ga0207684_10489089 | Ga0207684_104890891 | 235 |
| 70 | 3300025931 | Ga0207644_10225731 | Ga0207644_102257313 | 235 |
| 71 | 3300025941 | Ga0207711_10156093 | Ga0207711_101560933 | 235 |
| 72 | 3300025942 | Ga0207689_10026504 | Ga0207689_100265045 | 235 |
| 73 | 3300025945 | Ga0207679_10605007 | Ga0207679_106050071 | 235 |
| 74 | 3300025960 | Ga0207651_10113870 | Ga0207651_101138702 | 235 |
| 75 | 3300025986 | Ga0207658_10023727 | Ga0207658_100237273 | 235 |
| 76 | 3300026095 | Ga0207676_10028744 | Ga0207676_100287443 | 235 |
| 77 | 3300028381 | Ga0268264_10136939 | Ga0268264_101369392 | 235 |
| 78 | 3300053085 | Ga0495619_0457374 | Ga0495619_0457374_19_744 | 235 |
| 79 | iso_pu_bacteria | 2675903060 | 2676487850 | 235 |
| 80 | iso_pu_bacteria | 2738541272 | 2738692305 | 235 |
| 81 | iso_pu_bacteria | 2738543027 | 2739323389 | 235 |
| 82 | iso_pu_bacteria | 2739367654 | 2739609165 | 235 |
| 83 | iso_pu_bacteria | 2758568522 | 2760303388 | 235 |
| 84 | iso_pu_bacteria | 2758568621 | 2760622716 | 235 |
| 85 | iso_pu_bacteria | 2808606394 | 2809027505 | 235 |
| 86 | iso_pu_bacteria | 2856741275 | 2856746553 | 235 |
| 87 | iso_pu_bacteria | 2856741275 | 2856747054 | 235 |
| 88 | iso_pu_bacteria | 2863067949 | 2863071322 | 235 |
| 89 | iso_pu_bacteria | 2866552031 | 2866552446 | 235 |
| 90 | iso_pu_bacteria | 2866612099 | 2866615166 | 235 |
| 91 | iso_pu_bacteria | 2873314349 | 2873320728 | 235 |
| 92 | iso_pu_bacteria | 2884693830 | 2884697623 | 235 |
| 93 | iso_pu_bacteria | 2891395885 | 2891403000 | 235 |
| 94 | iso_pu_bacteria | 2891554331 | 2891554677 | 235 |
| 95 | iso_pu_bacteria | 2891562705 | 2891569668 | 235 |
| 96 | iso_pu_bacteria | 2895427314 | 2895438187 | 235 |
| 97 | iso_pu_bacteria | 2895442618 | 2895447583 | 235 |
| 98 | iso_pu_bacteria | 8055066027 | 8055066854 | 235 |
| 99 | iso_pu_bacteria | 8055172936 | 8055178864 | 235 |
| 100 | iso_pu_bacteria | 8056207758 | 8056212386 | 235 |
| 101 | iso_pu_bacteria | 8056579771 | 8056584210 | 235 |
| 102 | 3300005445 | Ga0070708_100880566 | Ga0070708_1008805661 | 236 |
| 103 | 3300009551 | Ga0105238_10491700 | Ga0105238_104917002 | 236 |
| 104 | 3300026078 | Ga0207702_10106187 | Ga0207702_101061872 | 236 |
| 105 | 3300031727 | Ga0316576_10073392 | Ga0316576_100733922 | 236 |
| 106 | 3300044658 | Ga0466972_0040707 | Ga0466972_0040707_1244_1975 | 236 |
| 107 | 3300044683 | Ga0466965_0059510 | Ga0466965_0059510_31_762 | 236 |
| 108 | 3300044901 | Ga0466960_0004086 | Ga0466960_0004086_2750_3481 | 236 |
| 109 | 3300046471 | Ga0495650_0000702 | Ga0495650_0000702_20115_20852 | 236 |
| 110 | iso_pu_bacteria | 2643221572 | 2643877905 | 236 |
| 111 | iso_pu_bacteria | 2643221669 | 2644384960 | 236 |
| 112 | iso_pu_bacteria | 2852677369 | 2852680387 | 236 |
| 113 | 3300005530 | Ga0070679_100267296 | Ga0070679_1002672962 | 237 |
| 114 | 3300005548 | Ga0070665_100054031 | Ga0070665_1000540313 | 237 |
| 115 | 3300006048 | Ga0075363_100084389 | Ga0075363_1000843892 | 237 |
| 116 | 3300006051 | Ga0075364_10209326 | Ga0075364_102093261 | 237 |
| 117 | 3300006178 | Ga0075367_10087304 | Ga0075367_100873042 | 237 |
| 118 | 3300009177 | Ga0105248_10194062 | Ga0105248_101940622 | 237 |
| 119 | 3300014325 | Ga0163163_10464547 | Ga0163163_104645472 | 237 |
| 120 | 3300014326 | Ga0157380_10322101 | Ga0157380_103221012 | 237 |
| 121 | 3300020081 | Ga0206354_10817771 | Ga0206354_108177712 | 237 |
| 122 | 3300025900 | Ga0207710_10119330 | Ga0207710_101193302 | 237 |
| 123 | 3300025917 | Ga0207660_10270256 | Ga0207660_102702562 | 237 |
| 124 | 3300025921 | Ga0207652_10527328 | Ga0207652_105273282 | 237 |
| 125 | 3300025928 | Ga0207700_10215306 | Ga0207700_102153063 | 237 |
| 126 | 3300026088 | Ga0207641_10120500 | Ga0207641_101205003 | 237 |
| 127 | 3300028379 | Ga0268266_10307389 | Ga0268266_103073891 | 237 |
| 128 | 3300030732 | Ga0316176_1191746 | Ga0316176_11917462 | 237 |
| 129 | 3300030733 | Ga0314311_1041561 | Ga0314311_10415612 | 237 |
| 130 | 3300030734 | Ga0316179_1043364 | Ga0316179_10433642 | 237 |
| 131 | 3300030744 | Ga0316181_1131546 | Ga0316181_11315461 | 237 |
| 132 | 3300046459 | Ga0495629_0095322 | Ga0495629_0095322_935_1666 | 237 |
| 133 | 3300046642 | Ga0495634_0333711 | Ga0495634_0333711_59_787 | 237 |
| 134 | 3300048907 | Ga0496104_0758063 | Ga0496104_0758063_103_846 | 237 |
| 135 | 3300048915 | Ga0496112_0006741 | Ga0496112_0006741_2722_3465 | 237 |
| 136 | 3300048915 | Ga0496112_0047690 | Ga0496112_0047690_2326_3084 | 237 |
| 137 | 3300048916 | Ga0496113_0238698 | Ga0496113_0238698_137_880 | 237 |
| 138 | 3300049586 | Ga0501070_0405570 | Ga0501070_0405570_247_981 | 237 |
| 139 | 3300050490 | nmdc:mga03n38_83309_c1 | nmdc:mga03n38_83309_c1_596_1324 | 237 |
| 140 | 3300050491 | nmdc:mga00v17_84397_c1 | nmdc:mga00v17_84397_c1_468_1196 | 237 |
| 141 | 3300050492 | nmdc:mga0yw44_30881_c1 | nmdc:mga0yw44_30881_c1_999_1727 | 237 |
| 142 | iso_pu_bacteria | 2643221615 | 2644089564 | 237 |
| 143 | iso_pu_bacteria | 2643221617 | 2644098867 | 237 |
| 144 | iso_pu_bacteria | 2643221620 | 2644114748 | 237 |
| 145 | iso_pu_bacteria | 2643221657 | 2644319409 | 237 |
| 146 | iso_pu_bacteria | 2643221697 | 2644537298 | 237 |
| 147 | iso_pu_bacteria | 2738541305 | 2738868082 | 237 |
| 148 | iso_pu_bacteria | 2773857762 | 2774393363 | 237 |
| 149 | iso_pu_bacteria | 2808606439 | 2809195748 | 237 |
| 150 | iso_pu_bacteria | 2811994874 | 2812332403 | 237 |
| 151 | iso_pu_bacteria | 2811994878 | 2812350646 | 237 |
| 152 | iso_pu_bacteria | 2816332119 | 2816425411 | 237 |
| 153 | iso_pu_bacteria | 2891968417 | 2891971754 | 237 |
| 154 | iso_pu_bacteria | 2932431166 | 2932433626 | 237 |
| 155 | 3300005327 | Ga0070658_10002446 | Ga0070658_100024462 | 238 |
| 156 | 3300005327 | Ga0070658_10074477 | Ga0070658_100744774 | 238 |
| 157 | 3300005327 | Ga0070658_10102337 | Ga0070658_101023373 | 238 |
| 158 | 3300005329 | Ga0070683_100003754 | Ga0070683_10000375410 | 238 |
| 159 | 3300005336 | Ga0070680_100098517 | Ga0070680_1000985172 | 238 |
| 160 | 3300005337 | Ga0070682_100062608 | Ga0070682_1000626083 | 238 |
| 161 | 3300005337 | Ga0070682_100087650 | Ga0070682_1000876503 | 238 |
| 162 | 3300005337 | Ga0070682_100095566 | Ga0070682_1000955662 | 238 |
| 163 | 3300005338 | Ga0068868_100007705 | Ga0068868_1000077057 | 238 |
| 164 | 3300005339 | Ga0070660_100005438 | Ga0070660_1000054386 | 238 |
| 165 | 3300005339 | Ga0070660_100020239 | Ga0070660_1000202392 | 238 |
| 166 | 3300005339 | Ga0070660_100369661 | Ga0070660_1003696611 | 238 |
| 167 | 3300005339 | Ga0070660_100614894 | Ga0070660_1006148941 | 238 |
| 168 | 3300005343 | Ga0070687_100256643 | Ga0070687_1002566432 | 238 |
| 169 | 3300005345 | Ga0070692_10027293 | Ga0070692_100272934 | 238 |
| 170 | 3300005345 | Ga0070692_10040097 | Ga0070692_100400972 | 238 |
| 171 | 3300005347 | Ga0070668_100367586 | Ga0070668_1003675862 | 238 |
| 172 | 3300005355 | Ga0070671_100513148 | Ga0070671_1005131482 | 238 |
| 173 | 3300005366 | Ga0070659_100000614 | Ga0070659_10000061419 | 238 |
| 174 | 3300005367 | Ga0070667_100160987 | Ga0070667_1001609872 | 238 |
| 175 | 3300005367 | Ga0070667_100666974 | Ga0070667_1006669741 | 238 |
| 176 | 3300005438 | Ga0070701_10013530 | Ga0070701_100135302 | 238 |
| 177 | 3300005439 | Ga0070711_100228695 | Ga0070711_1002286952 | 238 |
| 178 | 3300005441 | Ga0070700_100001727 | Ga0070700_10000172710 | 238 |
| 179 | 3300005458 | Ga0070681_10266804 | Ga0070681_102668042 | 238 |
| 180 | 3300005459 | Ga0068867_100008705 | Ga0068867_1000087056 | 238 |
| 181 | 3300005466 | Ga0070685_10031117 | Ga0070685_100311172 | 238 |
| 182 | 3300005530 | Ga0070679_100369016 | Ga0070679_1003690162 | 238 |
| 183 | 3300005530 | Ga0070679_100795516 | Ga0070679_1007955161 | 238 |
| 184 | 3300005535 | Ga0070684_100003940 | Ga0070684_1000039409 | 238 |
| 185 | 3300005539 | Ga0068853_100040444 | Ga0068853_1000404446 | 238 |
| 186 | 3300005543 | Ga0070672_100213289 | Ga0070672_1002132893 | 238 |
| 187 | 3300005563 | Ga0068855_100034141 | Ga0068855_1000341414 | 238 |
| 188 | 3300005563 | Ga0068855_100141077 | Ga0068855_1001410774 | 238 |
| 189 | 3300005563 | Ga0068855_100184251 | Ga0068855_1001842514 | 238 |
| 190 | 3300005563 | Ga0068855_100227865 | Ga0068855_1002278652 | 238 |
| 191 | 3300005563 | Ga0068855_100294638 | Ga0068855_1002946382 | 238 |
| 192 | 3300005563 | Ga0068855_100415398 | Ga0068855_1004153982 | 238 |
| 193 | 3300005577 | Ga0068857_100017894 | Ga0068857_1000178944 | 238 |
| 194 | 3300005577 | Ga0068857_100036107 | Ga0068857_1000361074 | 238 |
| 195 | 3300005577 | Ga0068857_100338560 | Ga0068857_1003385602 | 238 |
| 196 | 3300005614 | Ga0068856_100020314 | Ga0068856_1000203148 | 238 |
| 197 | 3300005614 | Ga0068856_100189851 | Ga0068856_1001898513 | 238 |
| 198 | 3300005614 | Ga0068856_100456403 | Ga0068856_1004564032 | 238 |
| 199 | 3300005614 | Ga0068856_100528361 | Ga0068856_1005283612 | 238 |
| 200 | 3300005615 | Ga0070702_100071901 | Ga0070702_1000719012 | 238 |
| 201 | 3300005616 | Ga0068852_100010538 | Ga0068852_1000105387 | 238 |
| 202 | 3300005616 | Ga0068852_100053856 | Ga0068852_1000538563 | 238 |
| 203 | 3300005617 | Ga0068859_100190879 | Ga0068859_1001908793 | 238 |
| 204 | 3300005617 | Ga0068859_100394459 | Ga0068859_1003944591 | 238 |
| 205 | 3300005834 | Ga0068851_10000124 | Ga0068851_1000012421 | 238 |
| 206 | 3300005841 | Ga0068863_100124165 | Ga0068863_1001241653 | 238 |
| 207 | 3300005841 | Ga0068863_100600925 | Ga0068863_1006009252 | 238 |
| 208 | 3300005842 | Ga0068858_100000175 | Ga0068858_10000017545 | 238 |
| 209 | 3300006038 | Ga0075365_10000640 | Ga0075365_100006409 | 238 |
| 210 | 3300006881 | Ga0068865_100114224 | Ga0068865_1001142242 | 238 |
| 211 | 3300006931 | Ga0097620_100190874 | Ga0097620_1001908742 | 238 |
| 212 | 3300006931 | Ga0097620_100394417 | Ga0097620_1003944171 | 238 |
| 213 | 3300009093 | Ga0105240_10131613 | Ga0105240_101316133 | 238 |
| 214 | 3300009093 | Ga0105240_10751637 | Ga0105240_107516372 | 238 |
| 215 | 3300009093 | Ga0105240_11192571 | Ga0105240_111925711 | 238 |
| 216 | 3300009094 | Ga0111539_10015597 | Ga0111539_1001559711 | 238 |
| 217 | 3300009098 | Ga0105245_10033293 | Ga0105245_100332935 | 238 |
| 218 | 3300009098 | Ga0105245_10101974 | Ga0105245_101019744 | 238 |
| 219 | 3300009101 | Ga0105247_10094621 | Ga0105247_100946212 | 238 |
| 220 | 3300009174 | Ga0105241_10000211 | Ga0105241_1000021120 | 238 |
| 221 | 3300009174 | Ga0105241_10232294 | Ga0105241_102322942 | 238 |
| 222 | 3300009176 | Ga0105242_10057516 | Ga0105242_100575162 | 238 |
| 223 | 3300009177 | Ga0105248_10082344 | Ga0105248_100823446 | 238 |
| 224 | 3300009177 | Ga0105248_10093672 | Ga0105248_100936722 | 238 |
| 225 | 3300009177 | Ga0105248_10172428 | Ga0105248_101724282 | 238 |
| 226 | 3300009545 | Ga0105237_10005342 | Ga0105237_100053424 | 238 |
| 227 | 3300009545 | Ga0105237_10007321 | Ga0105237_1000732111 | 238 |
| 228 | 3300009545 | Ga0105237_10094775 | Ga0105237_100947754 | 238 |
| 229 | 3300009545 | Ga0105237_10868826 | Ga0105237_108688262 | 238 |
| 230 | 3300009551 | Ga0105238_10001857 | Ga0105238_1000185715 | 238 |
| 231 | 3300009551 | Ga0105238_10036361 | Ga0105238_100363614 | 238 |
| 232 | 3300009551 | Ga0105238_10333455 | Ga0105238_103334553 | 238 |
| 233 | 3300009551 | Ga0105238_10432732 | Ga0105238_104327322 | 238 |
| 234 | 3300009553 | Ga0105249_10058232 | Ga0105249_100582324 | 238 |
| 235 | 3300009553 | Ga0105249_11172280 | Ga0105249_111722801 | 238 |
| 236 | 3300010375 | Ga0105239_10027190 | Ga0105239_100271902 | 238 |
| 237 | 3300010375 | Ga0105239_10149110 | Ga0105239_101491104 | 238 |
| 238 | 3300011119 | Ga0105246_10005341 | Ga0105246_100053413 | 238 |
| 239 | 3300013105 | Ga0157369_10050387 | Ga0157369_100503874 | 238 |
| 240 | 3300013105 | Ga0157369_10762532 | Ga0157369_107625322 | 238 |
| 241 | 3300013307 | Ga0157372_10712912 | Ga0157372_107129121 | 238 |
| 242 | 3300013308 | Ga0157375_10041252 | Ga0157375_100412522 | 238 |
| 243 | 3300014325 | Ga0163163_10173331 | Ga0163163_101733312 | 238 |
| 244 | 3300014325 | Ga0163163_10256340 | Ga0163163_102563402 | 238 |
| 245 | 3300014325 | Ga0163163_10862411 | Ga0163163_108624112 | 238 |
| 246 | 3300014326 | Ga0157380_10009167 | Ga0157380_100091673 | 238 |
| 247 | 3300014497 | Ga0182008_10180367 | Ga0182008_101803672 | 238 |
| 248 | 3300014745 | Ga0157377_10204939 | Ga0157377_102049392 | 238 |
| 249 | 3300014968 | Ga0157379_10004102 | Ga0157379_100041028 | 238 |
| 250 | 3300014968 | Ga0157379_10381489 | Ga0157379_103814891 | 238 |
| 251 | 3300020081 | Ga0206354_10434341 | Ga0206354_104343411 | 238 |
| 252 | 3300020082 | Ga0206353_10244667 | Ga0206353_102446673 | 238 |
| 253 | 3300025254 | Ga0209148_1000830 | Ga0209148_100083012 | 238 |
| 254 | 3300025321 | Ga0207656_10000001 | Ga0207656_1000000129 | 238 |
| 255 | 3300025321 | Ga0207656_10000003 | Ga0207656_10000003135 | 238 |
| 256 | 3300025900 | Ga0207710_10050534 | Ga0207710_100505342 | 238 |
| 257 | 3300025901 | Ga0207688_10016189 | Ga0207688_100161894 | 238 |
| 258 | 3300025901 | Ga0207688_10092825 | Ga0207688_100928252 | 238 |
| 259 | 3300025904 | Ga0207647_10066052 | Ga0207647_100660522 | 238 |
| 260 | 3300025909 | Ga0207705_10004785 | Ga0207705_100047855 | 238 |
| 261 | 3300025909 | Ga0207705_10043184 | Ga0207705_100431844 | 238 |
| 262 | 3300025909 | Ga0207705_10058716 | Ga0207705_100587163 | 238 |
| 263 | 3300025909 | Ga0207705_10142139 | Ga0207705_101421391 | 238 |
| 264 | 3300025909 | Ga0207705_10237966 | Ga0207705_102379662 | 238 |
| 265 | 3300025911 | Ga0207654_10000003 | Ga0207654_10000003333 | 238 |
| 266 | 3300025912 | Ga0207707_10244818 | Ga0207707_102448182 | 238 |
| 267 | 3300025913 | Ga0207695_10019828 | Ga0207695_100198283 | 238 |
| 268 | 3300025913 | Ga0207695_10035922 | Ga0207695_100359223 | 238 |
| 269 | 3300025914 | Ga0207671_10000001 | Ga0207671_1000000127 | 238 |
| 270 | 3300025917 | Ga0207660_10075333 | Ga0207660_100753333 | 238 |
| 271 | 3300025918 | Ga0207662_10275076 | Ga0207662_102750762 | 238 |
| 272 | 3300025919 | Ga0207657_10014789 | Ga0207657_100147897 | 238 |
| 273 | 3300025919 | Ga0207657_10032104 | Ga0207657_100321044 | 238 |
| 274 | 3300025919 | Ga0207657_10098639 | Ga0207657_100986394 | 238 |
| 275 | 3300025919 | Ga0207657_10338962 | Ga0207657_103389622 | 238 |
| 276 | 3300025924 | Ga0207694_10000039 | Ga0207694_1000003915 | 238 |
| 277 | 3300025924 | Ga0207694_10047828 | Ga0207694_100478284 | 238 |
| 278 | 3300025924 | Ga0207694_10263129 | Ga0207694_102631292 | 238 |
| 279 | 3300025927 | Ga0207687_10045021 | Ga0207687_100450214 | 238 |
| 280 | 3300025927 | Ga0207687_10063863 | Ga0207687_100638634 | 238 |
| 281 | 3300025932 | Ga0207690_10002300 | Ga0207690_1000230010 | 238 |
| 282 | 3300025932 | Ga0207690_10103316 | Ga0207690_101033163 | 238 |
| 283 | 3300025935 | Ga0207709_10009370 | Ga0207709_100093706 | 238 |
| 284 | 3300025940 | Ga0207691_10001309 | Ga0207691_1000130919 | 238 |
| 285 | 3300025941 | Ga0207711_10002075 | Ga0207711_1000207517 | 238 |
| 286 | 3300025941 | Ga0207711_10607072 | Ga0207711_106070721 | 238 |
| 287 | 3300025944 | Ga0207661_10012912 | Ga0207661_100129125 | 238 |
| 288 | 3300025944 | Ga0207661_10155490 | Ga0207661_101554901 | 238 |
| 289 | 3300025944 | Ga0207661_10716558 | Ga0207661_107165581 | 238 |
| 290 | 3300025949 | Ga0207667_10001963 | Ga0207667_100019637 | 238 |
| 291 | 3300025949 | Ga0207667_10071396 | Ga0207667_100713963 | 238 |
| 292 | 3300025949 | Ga0207667_10143189 | Ga0207667_101431892 | 238 |
| 293 | 3300025949 | Ga0207667_10209304 | Ga0207667_102093043 | 238 |
| 294 | 3300025961 | Ga0207712_10137742 | Ga0207712_101377424 | 238 |
| 295 | 3300025981 | Ga0207640_10175773 | Ga0207640_101757732 | 238 |
| 296 | 3300025986 | Ga0207658_10163271 | Ga0207658_101632712 | 238 |
| 297 | 3300026035 | Ga0207703_10000131 | Ga0207703_1000013126 | 238 |
| 298 | 3300026041 | Ga0207639_10385870 | Ga0207639_103858702 | 238 |
| 299 | 3300026075 | Ga0207708_10006405 | Ga0207708_100064053 | 238 |
| 300 | 3300026078 | Ga0207702_10044597 | Ga0207702_100445974 | 238 |
| 301 | 3300026078 | Ga0207702_10731019 | Ga0207702_107310192 | 238 |
| 302 | 3300026089 | Ga0207648_10001262 | Ga0207648_1000126216 | 238 |
| 303 | 3300026095 | Ga0207676_10503859 | Ga0207676_105038592 | 238 |
| 304 | 3300026116 | Ga0207674_10011490 | Ga0207674_1001149010 | 238 |
| 305 | 3300026116 | Ga0207674_10030152 | Ga0207674_100301527 | 238 |
| 306 | 3300026116 | Ga0207674_10031793 | Ga0207674_100317937 | 238 |
| 307 | 3300026116 | Ga0207674_10051815 | Ga0207674_100518157 | 238 |
| 308 | 3300026116 | Ga0207674_10474475 | Ga0207674_104744752 | 238 |
| 309 | 3300026118 | Ga0207675_100002583 | Ga0207675_10000258313 | 238 |
| 310 | 3300026142 | Ga0207698_10005106 | Ga0207698_100051063 | 238 |
| 311 | 3300026142 | Ga0207698_10009635 | Ga0207698_100096358 | 238 |
| 312 | 3300026142 | Ga0207698_10257452 | Ga0207698_102574522 | 238 |
| 313 | 3300026142 | Ga0207698_10269546 | Ga0207698_102695462 | 238 |
| 314 | 3300027907 | Ga0207428_10217109 | Ga0207428_102171092 | 238 |
| 315 | 3300031649 | Ga0307514_10139981 | Ga0307514_101399811 | 238 |
| 316 | 3300031903 | Ga0307407_10048260 | Ga0307407_100482602 | 238 |
| 317 | 3300035089 | Ga0373944_0001493 | Ga0373944_0001493_2651_3376 | 238 |
| 318 | 3300035116 | Ga0373945_0000297 | Ga0373945_0000297_4285_5010 | 238 |
| 319 | 3300035118 | Ga0373954_0034272 | Ga0373954_0034272_202_927 | 238 |
| 320 | 3300035119 | Ga0373956_0102199 | Ga0373956_0102199_538_1263 | 238 |
| 321 | 3300035170 | Ga0373943_0000586 | Ga0373943_0000586_9379_10104 | 238 |
| 322 | 3300035170 | Ga0373943_0036836 | Ga0373943_0036836_528_1250 | 238 |
| 323 | 3300035171 | Ga0373946_0000057 | Ga0373946_0000057_20984_21709 | 238 |
| 324 | 3300035410 | Ga0373924_0008137 | Ga0373924_0008137_2460_3185 | 238 |
| 325 | 3300035692 | Ga0373935_0001547 | Ga0373935_0001547_8591_9316 | 238 |
| 326 | 3300035695 | Ga0373927_0000281 | Ga0373927_0000281_12624_13349 | 238 |
| 327 | 3300037068 | Ga0373925_0004092 | Ga0373925_0004092_6601_7326 | 238 |
| 328 | 3300041452 | Ga0451793_0945671 | Ga0451793_0945671_2411_3196 | 238 |
| 329 | 3300045976 | Ga0466967_0107759 | Ga0466967_0107759_1248_1982 | 238 |
| 330 | 3300045976 | Ga0466967_0180153 | Ga0466967_0180153_819_1544 | 238 |
| 331 | 3300046461 | Ga0495641_0015388 | Ga0495641_0015388_696_1421 | 238 |
| 332 | 3300046461 | Ga0495641_0039930 | Ga0495641_0039930_453_1229 | 238 |
| 333 | 3300046477 | Ga0495664_0001381 | Ga0495664_0001381_6833_7558 | 238 |
| 334 | 3300046477 | Ga0495664_0305809 | Ga0495664_0305809_32_763 | 238 |
| 335 | 3300046514 | Ga0495618_0020849 | Ga0495618_0020849_1053_1778 | 238 |
| 336 | 3300046517 | Ga0495630_0045401 | Ga0495630_0045401_1687_2412 | 238 |
| 337 | 3300046531 | Ga0495665_0024404 | Ga0495665_0024404_704_1429 | 238 |
| 338 | 3300046533 | Ga0495640_0280571 | Ga0495640_0280571_80_805 | 238 |
| 339 | 3300046642 | Ga0495634_0064680 | Ga0495634_0064680_364_1089 | 238 |
| 340 | 3300046663 | Ga0495635_0001647 | Ga0495635_0001647_2645_3370 | 238 |
| 341 | 3300046678 | Ga0495599_0132695 | Ga0495599_0132695_412_1137 | 238 |
| 342 | 3300046681 | Ga0495647_0099096 | Ga0495647_0099096_40_771 | 238 |
| 343 | 3300046690 | Ga0495624_0019973 | Ga0495624_0019973_811_1536 | 238 |
| 344 | 3300047315 | Ga0495581_0202462 | Ga0495581_0202462_143_868 | 238 |
| 345 | 3300047319 | Ga0495674_0001430 | Ga0495674_0001430_13655_14380 | 238 |
| 346 | 3300047321 | Ga0495676_0001791 | Ga0495676_0001791_15590_16315 | 238 |
| 347 | 3300047322 | Ga0495680_0060752 | Ga0495680_0060752_901_1626 | 238 |
| 348 | 3300048903 | Ga0496100_0155326 | Ga0496100_0155326_770_1501 | 238 |
| 349 | 3300048905 | Ga0496102_0011688 | Ga0496102_0011688_4732_5463 | 238 |
| 350 | 3300048906 | Ga0496103_0058264 | Ga0496103_0058264_1121_1852 | 238 |
| 351 | 3300048909 | Ga0496106_0218851 | Ga0496106_0218851_99_830 | 238 |
| 352 | 3300048911 | Ga0496108_0034423 | Ga0496108_0034423_1066_1797 | 238 |
| 353 | 3300048912 | Ga0496109_0106752 | Ga0496109_0106752_711_1457 | 238 |
| 354 | 3300048912 | Ga0496109_0176383 | Ga0496109_0176383_1129_1860 | 238 |
| 355 | 3300048912 | Ga0496109_0289847 | Ga0496109_0289847_630_1394 | 238 |
| 356 | 3300048913 | Ga0496110_0051777 | Ga0496110_0051777_1788_2519 | 238 |
| 357 | 3300048913 | Ga0496110_0106428 | Ga0496110_0106428_1105_1851 | 238 |
| 358 | 3300048914 | Ga0496111_0009560 | Ga0496111_0009560_4667_5398 | 238 |
| 359 | 3300048917 | Ga0496114_0018839 | Ga0496114_0018839_267_1094 | 238 |
| 360 | 3300048917 | Ga0496114_0137086 | Ga0496114_0137086_472_1218 | 238 |
| 361 | 3300048917 | Ga0496114_0306276 | Ga0496114_0306276_158_889 | 238 |
| 362 | 3300048920 | Ga0496117_0029237 | Ga0496117_0029237_1498_2241 | 238 |
| 363 | 3300048921 | Ga0496118_0035053 | Ga0496118_0035053_2421_3164 | 238 |
| 364 | 3300048922 | Ga0496119_0001675 | Ga0496119_0001675_823_1566 | 238 |
| 365 | 3300048922 | Ga0496119_0102138 | Ga0496119_0102138_583_1326 | 238 |
| 366 | 3300048923 | Ga0496120_0024499 | Ga0496120_0024499_863_1606 | 238 |
| 367 | 3300048923 | Ga0496120_0093505 | Ga0496120_0093505_123_860 | 238 |
| 368 | 3300048929 | Ga0496126_0239668 | Ga0496126_0239668_333_1076 | 238 |
| 369 | 3300048929 | Ga0496126_0298325 | Ga0496126_0298325_494_1237 | 238 |
| 370 | 3300049568 | Ga0501031_0015189 | Ga0501031_0015189_1017_1760 | 238 |
| 371 | 3300049569 | Ga0501032_0140581 | Ga0501032_0140581_159_887 | 238 |
| 372 | 3300049570 | Ga0501033_0003981 | Ga0501033_0003981_993_1727 | 238 |
| 373 | 3300049571 | Ga0501034_0005065 | Ga0501034_0005065_1766_2497 | 238 |
| 374 | 3300049571 | Ga0501034_0019848 | Ga0501034_0019848_4030_4773 | 238 |
| 375 | 3300049571 | Ga0501034_0646506 | Ga0501034_0646506_17_751 | 238 |
| 376 | 3300049572 | Ga0501036_0008211 | Ga0501036_0008211_1629_2363 | 238 |
| 377 | 3300049572 | Ga0501036_0028967 | Ga0501036_0028967_3447_4190 | 238 |
| 378 | 3300049573 | Ga0501037_0025612 | Ga0501037_0025612_3452_4195 | 238 |
| 379 | 3300049573 | Ga0501037_0080981 | Ga0501037_0080981_452_1186 | 238 |
| 380 | 3300049573 | Ga0501037_0214994 | Ga0501037_0214994_589_1317 | 238 |
| 381 | 3300049574 | Ga0501038_0017389 | Ga0501038_0017389_415_1149 | 238 |
| 382 | 3300049574 | Ga0501038_0042352 | Ga0501038_0042352_2712_3455 | 238 |
| 383 | 3300049575 | Ga0501039_0037135 | Ga0501039_0037135_616_1344 | 238 |
| 384 | 3300049575 | Ga0501039_0087312 | Ga0501039_0087312_525_1268 | 238 |
| 385 | 3300049578 | Ga0501042_0136702 | Ga0501042_0136702_218_961 | 238 |
| 386 | 3300049579 | Ga0501043_0110306 | Ga0501043_0110306_213_947 | 238 |
| 387 | 3300049579 | Ga0501043_0134887 | Ga0501043_0134887_258_986 | 238 |
| 388 | 3300049580 | Ga0501046_0000566 | Ga0501046_0000566_2034_2777 | 238 |
| 389 | 3300049580 | Ga0501046_0002036 | Ga0501046_0002036_12965_13699 | 238 |
| 390 | 3300049580 | Ga0501046_0004086 | Ga0501046_0004086_11640_12374 | 238 |
| 391 | 3300049581 | Ga0501047_0081025 | Ga0501047_0081025_1615_2349 | 238 |
| 392 | 3300049581 | Ga0501047_0122557 | Ga0501047_0122557_168_896 | 238 |
| 393 | 3300049581 | Ga0501047_0523338 | Ga0501047_0523338_37_780 | 238 |
| 394 | 3300049582 | Ga0501048_0010210 | Ga0501048_0010210_2805_3548 | 238 |
| 395 | 3300049582 | Ga0501048_0027539 | Ga0501048_0027539_1302_2036 | 238 |
| 396 | 3300049583 | Ga0501067_0001083 | Ga0501067_0001083_4395_5126 | 238 |
| 397 | 3300049584 | Ga0501068_0032931 | Ga0501068_0032931_135_878 | 238 |
| 398 | 3300049585 | Ga0501069_0117466 | Ga0501069_0117466_399_1145 | 238 |
| 399 | 3300049586 | Ga0501070_0004523 | Ga0501070_0004523_9168_9899 | 238 |
| 400 | 3300049586 | Ga0501070_0025886 | Ga0501070_0025886_977_1711 | 238 |
| 401 | 3300049586 | Ga0501070_0092430 | Ga0501070_0092430_528_1271 | 238 |
| 402 | 3300049587 | Ga0501071_0012339 | Ga0501071_0012339_2966_3697 | 238 |
| 403 | 3300049588 | Ga0501072_0007300 | Ga0501072_0007300_1649_2380 | 238 |
| 404 | 3300049589 | Ga0501073_0001438 | Ga0501073_0001438_9554_10285 | 238 |
| 405 | 3300049590 | Ga0501074_0002081 | Ga0501074_0002081_10014_10745 | 238 |
| 406 | 3300049590 | Ga0501074_0065720 | Ga0501074_0065720_859_1587 | 238 |
| 407 | 3300049742 | Ga0501080_0016540 | Ga0501080_0016540_5450_6184 | 238 |
| 408 | 3300049822 | Ga0501035_0043976 | Ga0501035_0043976_2995_3723 | 238 |
| 409 | 3300049822 | Ga0501035_0047183 | Ga0501035_0047183_203_946 | 238 |
| 410 | 3300049823 | Ga0501044_0046494 | Ga0501044_0046494_3585_4328 | 238 |
| 411 | 3300049824 | Ga0501045_0007627 | Ga0501045_0007627_2884_3627 | 238 |
| 412 | 3300050492 | nmdc:mga0yw44_8410_c1 | nmdc:mga0yw44_8410_c1_1744_2475 | 238 |
| 413 | 3300053077 | Ga0495601_0009096 | Ga0495601_0009096_428_1159 | 238 |
| 414 | 3300053093 | Ga0500651_0000647 | Ga0500651_0000647_9372_10115 | 238 |
| 415 | 3300053102 | Ga0500554_065185 | Ga0500554_065185_400_1143 | 238 |
| 416 | 3300053136 | Ga0500559_0045296 | Ga0500559_0045296_966_1700 | 238 |
| 417 | 3300053140 | Ga0500573_0049081 | Ga0500573_0049081_1665_2396 | 238 |
| 418 | 3300053148 | Ga0500590_006392 | Ga0500590_006392_3827_4570 | 238 |
| 419 | 3300053153 | Ga0500616_0000463 | Ga0500616_0000463_24633_25412 | 238 |
| 420 | 3300054114 | Ga0501084_0013685 | Ga0501084_0013685_351_1082 | 238 |
| 421 | iso_pu_bacteria | 2643221604 | 2644034509 | 238 |
| 422 | iso_pu_bacteria | 2893684298 | 2893684870 | 238 |
| 423 | 3300002067 | JGI24735J21928_10027302 | JGI24735J21928_100273022 | 239 |
| 424 | 3300005327 | Ga0070658_10000487 | Ga0070658_1000048718 | 239 |
| 425 | 3300005329 | Ga0070683_100000788 | Ga0070683_1000007881 | 239 |
| 426 | 3300005335 | Ga0070666_10162507 | Ga0070666_101625072 | 239 |
| 427 | 3300005336 | Ga0070680_100001431 | Ga0070680_10000143118 | 239 |
| 428 | 3300005337 | Ga0070682_100127614 | Ga0070682_1001276142 | 239 |
| 429 | 3300005340 | Ga0070689_100379597 | Ga0070689_1003795972 | 239 |
| 430 | 3300005344 | Ga0070661_100678940 | Ga0070661_1006789401 | 239 |
| 431 | 3300005347 | Ga0070668_100095611 | Ga0070668_1000956112 | 239 |
| 432 | 3300005355 | Ga0070671_100030886 | Ga0070671_1000308863 | 239 |
| 433 | 3300005364 | Ga0070673_100357746 | Ga0070673_1003577462 | 239 |
| 434 | 3300005367 | Ga0070667_100010113 | Ga0070667_1000101139 | 239 |
| 435 | 3300005367 | Ga0070667_100036420 | Ga0070667_1000364205 | 239 |
| 436 | 3300005367 | Ga0070667_100436861 | Ga0070667_1004368612 | 239 |
| 437 | 3300005434 | Ga0070709_10107128 | Ga0070709_101071283 | 239 |
| 438 | 3300005435 | Ga0070714_100325100 | Ga0070714_1003251002 | 239 |
| 439 | 3300005437 | Ga0070710_10103776 | Ga0070710_101037762 | 239 |
| 440 | 3300005437 | Ga0070710_10444518 | Ga0070710_104445181 | 239 |
| 441 | 3300005439 | Ga0070711_100007809 | Ga0070711_1000078094 | 239 |
| 442 | 3300005439 | Ga0070711_100181917 | Ga0070711_1001819171 | 239 |
| 443 | 3300005458 | Ga0070681_10003941 | Ga0070681_1000394115 | 239 |
| 444 | 3300005458 | Ga0070681_10506206 | Ga0070681_105062062 | 239 |
| 445 | 3300005467 | Ga0070706_100058871 | Ga0070706_1000588713 | 239 |
| 446 | 3300005468 | Ga0070707_100072910 | Ga0070707_1000729104 | 239 |
| 447 | 3300005471 | Ga0070698_100011699 | Ga0070698_1000116996 | 239 |
| 448 | 3300005471 | Ga0070698_100060163 | Ga0070698_1000601635 | 239 |
| 449 | 3300005518 | Ga0070699_100001377 | Ga0070699_10000137713 | 239 |
| 450 | 3300005530 | Ga0070679_100002183 | Ga0070679_10000218313 | 239 |
| 451 | 3300005535 | Ga0070684_100008019 | Ga0070684_1000080196 | 239 |
| 452 | 3300005535 | Ga0070684_100054260 | Ga0070684_1000542603 | 239 |
| 453 | 3300005544 | Ga0070686_100384818 | Ga0070686_1003848181 | 239 |
| 454 | 3300005548 | Ga0070665_100001500 | Ga0070665_10000150015 | 239 |
| 455 | 3300005548 | Ga0070665_100020284 | Ga0070665_1000202842 | 239 |
| 456 | 3300005564 | Ga0070664_100324567 | Ga0070664_1003245672 | 239 |
| 457 | 3300005577 | Ga0068857_100032082 | Ga0068857_1000320826 | 239 |
| 458 | 3300005577 | Ga0068857_100218519 | Ga0068857_1002185193 | 239 |
| 459 | 3300005615 | Ga0070702_100104931 | Ga0070702_1001049312 | 239 |
| 460 | 3300005719 | Ga0068861_100346217 | Ga0068861_1003462172 | 239 |
| 461 | 3300005841 | Ga0068863_100001958 | Ga0068863_10000195815 | 239 |
| 462 | 3300005842 | Ga0068858_100034213 | Ga0068858_1000342134 | 239 |
| 463 | 3300005843 | Ga0068860_100000043 | Ga0068860_100000043104 | 239 |
| 464 | 3300005937 | Ga0081455_10000128 | Ga0081455_1000012872 | 239 |
| 465 | 3300005937 | Ga0081455_10001337 | Ga0081455_100013374 | 239 |
| 466 | 3300005937 | Ga0081455_10009693 | Ga0081455_100096935 | 239 |
| 467 | 3300005981 | Ga0081538_10000005 | Ga0081538_10000005140 | 239 |
| 468 | 3300005985 | Ga0081539_10022628 | Ga0081539_100226283 | 239 |
| 469 | 3300005985 | Ga0081539_10048547 | Ga0081539_100485474 | 239 |
| 470 | 3300006028 | Ga0070717_10041626 | Ga0070717_100416265 | 239 |
| 471 | 3300006038 | Ga0075365_10007324 | Ga0075365_100073243 | 239 |
| 472 | 3300006038 | Ga0075365_10009470 | Ga0075365_100094704 | 239 |
| 473 | 3300006038 | Ga0075365_10020733 | Ga0075365_100207335 | 239 |
| 474 | 3300006038 | Ga0075365_10025374 | Ga0075365_100253744 | 239 |
| 475 | 3300006038 | Ga0075365_10028215 | Ga0075365_100282152 | 239 |
| 476 | 3300006038 | Ga0075365_10173901 | Ga0075365_101739012 | 239 |
| 477 | 3300006042 | Ga0075368_10004612 | Ga0075368_100046125 | 239 |
| 478 | 3300006048 | Ga0075363_100000612 | Ga0075363_1000006123 | 239 |
| 479 | 3300006048 | Ga0075363_100005598 | Ga0075363_1000055983 | 239 |
| 480 | 3300006048 | Ga0075363_100009078 | Ga0075363_1000090785 | 239 |
| 481 | 3300006048 | Ga0075363_100043254 | Ga0075363_1000432544 | 239 |
| 482 | 3300006048 | Ga0075363_100079551 | Ga0075363_1000795513 | 239 |
| 483 | 3300006048 | Ga0075363_100150586 | Ga0075363_1001505863 | 239 |
| 484 | 3300006051 | Ga0075364_10002963 | Ga0075364_1000296311 | 239 |
| 485 | 3300006051 | Ga0075364_10009875 | Ga0075364_100098754 | 239 |
| 486 | 3300006051 | Ga0075364_10011486 | Ga0075364_100114863 | 239 |
| 487 | 3300006051 | Ga0075364_10033013 | Ga0075364_100330133 | 239 |
| 488 | 3300006051 | Ga0075364_10087474 | Ga0075364_100874742 | 239 |
| 489 | 3300006051 | Ga0075364_10115186 | Ga0075364_101151863 | 239 |
| 490 | 3300006051 | Ga0075364_10134197 | Ga0075364_101341972 | 239 |
| 491 | 3300006051 | Ga0075364_10143427 | Ga0075364_101434272 | 239 |
| 492 | 3300006051 | Ga0075364_10157376 | Ga0075364_101573763 | 239 |
| 493 | 3300006173 | Ga0070716_100139129 | Ga0070716_1001391292 | 239 |
| 494 | 3300006175 | Ga0070712_100038812 | Ga0070712_1000388122 | 239 |
| 495 | 3300006175 | Ga0070712_100187171 | Ga0070712_1001871712 | 239 |
| 496 | 3300006178 | Ga0075367_10057284 | Ga0075367_100572843 | 239 |
| 497 | 3300006178 | Ga0075367_10076675 | Ga0075367_100766753 | 239 |
| 498 | 3300006178 | Ga0075367_10078641 | Ga0075367_100786412 | 239 |
| 499 | 3300006178 | Ga0075367_10082849 | Ga0075367_100828492 | 239 |
| 500 | 3300006353 | Ga0075370_10006358 | Ga0075370_100063582 | 239 |
| 501 | 3300006353 | Ga0075370_10039921 | Ga0075370_100399214 | 239 |
| 502 | 3300006353 | Ga0075370_10084347 | Ga0075370_100843472 | 239 |
| 503 | 3300006844 | Ga0075428_100007901 | Ga0075428_10000790112 | 239 |
| 504 | 3300006846 | Ga0075430_100008527 | Ga0075430_10000852710 | 239 |
| 505 | 3300006846 | Ga0075430_100035267 | Ga0075430_1000352676 | 239 |
| 506 | 3300006847 | Ga0075431_100000088 | Ga0075431_10000008817 | 239 |
| 507 | 3300006847 | Ga0075431_100007324 | Ga0075431_1000073243 | 239 |
| 508 | 3300006880 | Ga0075429_100002486 | Ga0075429_10000248610 | 239 |
| 509 | 3300006880 | Ga0075429_100009056 | Ga0075429_10000905610 | 239 |
| 510 | 3300006880 | Ga0075429_100050142 | Ga0075429_1000501426 | 239 |
| 511 | 3300007076 | Ga0075435_100277005 | Ga0075435_1002770052 | 239 |
| 512 | 3300009093 | Ga0105240_10003864 | Ga0105240_100038647 | 239 |
| 513 | 3300009093 | Ga0105240_10335224 | Ga0105240_103352242 | 239 |
| 514 | 3300009094 | Ga0111539_10565023 | Ga0111539_105650232 | 239 |
| 515 | 3300009094 | Ga0111539_10881613 | Ga0111539_108816132 | 239 |
| 516 | 3300009098 | Ga0105245_10150434 | Ga0105245_101504343 | 239 |
| 517 | 3300009098 | Ga0105245_10238939 | Ga0105245_102389392 | 239 |
| 518 | 3300009098 | Ga0105245_10542452 | Ga0105245_105424522 | 239 |
| 519 | 3300009147 | Ga0114129_10000059 | Ga0114129_1000005930 | 239 |
| 520 | 3300009147 | Ga0114129_10040088 | Ga0114129_100400889 | 239 |
| 521 | 3300009147 | Ga0114129_10051139 | Ga0114129_100511392 | 239 |
| 522 | 3300009148 | Ga0105243_10273621 | Ga0105243_102736212 | 239 |
| 523 | 3300009148 | Ga0105243_10652321 | Ga0105243_106523211 | 239 |
| 524 | 3300009176 | Ga0105242_10834030 | Ga0105242_108340302 | 239 |
| 525 | 3300009545 | Ga0105237_10138602 | Ga0105237_101386022 | 239 |
| 526 | 3300009551 | Ga0105238_10367295 | Ga0105238_103672952 | 239 |
| 527 | 3300009551 | Ga0105238_10892819 | Ga0105238_108928192 | 239 |
| 528 | 3300010375 | Ga0105239_10128443 | Ga0105239_101284433 | 239 |
| 529 | 3300010375 | Ga0105239_10372671 | Ga0105239_103726713 | 239 |
| 530 | 3300011119 | Ga0105246_10465775 | Ga0105246_104657752 | 239 |
| 531 | 3300013102 | Ga0157371_10565524 | Ga0157371_105655242 | 239 |
| 532 | 3300013104 | Ga0157370_10643926 | Ga0157370_106439262 | 239 |
| 533 | 3300013105 | Ga0157369_10056590 | Ga0157369_100565903 | 239 |
| 534 | 3300013105 | Ga0157369_10101724 | Ga0157369_101017243 | 239 |
| 535 | 3300013307 | Ga0157372_10226888 | Ga0157372_102268884 | 239 |
| 536 | 3300013307 | Ga0157372_10603543 | Ga0157372_106035432 | 239 |
| 537 | 3300013307 | Ga0157372_10788781 | Ga0157372_107887812 | 239 |
| 538 | 3300013308 | Ga0157375_10028362 | Ga0157375_100283623 | 239 |
| 539 | 3300013308 | Ga0157375_10199098 | Ga0157375_101990982 | 239 |
| 540 | 3300013308 | Ga0157375_10603463 | Ga0157375_106034632 | 239 |
| 541 | 3300014325 | Ga0163163_10320655 | Ga0163163_103206553 | 239 |
| 542 | 3300014325 | Ga0163163_10422695 | Ga0163163_104226952 | 239 |
| 543 | 3300014325 | Ga0163163_10606015 | Ga0163163_106060152 | 239 |
| 544 | 3300014745 | Ga0157377_10114815 | Ga0157377_101148152 | 239 |
| 545 | 3300014968 | Ga0157379_10110172 | Ga0157379_101101724 | 239 |
| 546 | 3300014969 | Ga0157376_10540297 | Ga0157376_105402971 | 239 |
| 547 | 3300020081 | Ga0206354_10103529 | Ga0206354_101035293 | 239 |
| 548 | 3300020082 | Ga0206353_10033622 | Ga0206353_100336222 | 239 |
| 549 | 3300020082 | Ga0206353_10580619 | Ga0206353_105806196 | 239 |
| 550 | 3300020082 | Ga0206353_11297471 | Ga0206353_112974712 | 239 |
| 551 | 3300020082 | Ga0206353_11747993 | Ga0206353_117479933 | 239 |
| 552 | 3300021384 | Ga0213876_10073807 | Ga0213876_100738072 | 239 |
| 553 | 3300021388 | Ga0213875_10026616 | Ga0213875_100266164 | 239 |
| 554 | 3300021388 | Ga0213875_10044625 | Ga0213875_100446252 | 239 |
| 555 | 3300025898 | Ga0207692_10019279 | Ga0207692_100192794 | 239 |
| 556 | 3300025898 | Ga0207692_10031456 | Ga0207692_100314563 | 239 |
| 557 | 3300025903 | Ga0207680_10154452 | Ga0207680_101544522 | 239 |
| 558 | 3300025906 | Ga0207699_10003210 | Ga0207699_100032108 | 239 |
| 559 | 3300025906 | Ga0207699_10054845 | Ga0207699_100548453 | 239 |
| 560 | 3300025907 | Ga0207645_10219615 | Ga0207645_102196152 | 239 |
| 561 | 3300025908 | Ga0207643_10307348 | Ga0207643_103073482 | 239 |
| 562 | 3300025909 | Ga0207705_10004857 | Ga0207705_100048576 | 239 |
| 563 | 3300025912 | Ga0207707_10001838 | Ga0207707_100018384 | 239 |
| 564 | 3300025912 | Ga0207707_10414230 | Ga0207707_104142302 | 239 |
| 565 | 3300025915 | Ga0207693_10034783 | Ga0207693_100347835 | 239 |
| 566 | 3300025916 | Ga0207663_10022800 | Ga0207663_100228003 | 239 |
| 567 | 3300025917 | Ga0207660_10000619 | Ga0207660_100006198 | 239 |
| 568 | 3300025918 | Ga0207662_10153317 | Ga0207662_101533173 | 239 |
| 569 | 3300025919 | Ga0207657_10098006 | Ga0207657_100980063 | 239 |
| 570 | 3300025919 | Ga0207657_10409826 | Ga0207657_104098262 | 239 |
| 571 | 3300025920 | Ga0207649_10166664 | Ga0207649_101666643 | 239 |
| 572 | 3300025921 | Ga0207652_10003015 | Ga0207652_1000301512 | 239 |
| 573 | 3300025922 | Ga0207646_10282552 | Ga0207646_102825521 | 239 |
| 574 | 3300025927 | Ga0207687_10153808 | Ga0207687_101538082 | 239 |
| 575 | 3300025927 | Ga0207687_10458862 | Ga0207687_104588622 | 239 |
| 576 | 3300025927 | Ga0207687_10627015 | Ga0207687_106270152 | 239 |
| 577 | 3300025929 | Ga0207664_10024940 | Ga0207664_100249403 | 239 |
| 578 | 3300025929 | Ga0207664_10139174 | Ga0207664_101391743 | 239 |
| 579 | 3300025929 | Ga0207664_10281671 | Ga0207664_102816712 | 239 |
| 580 | 3300025929 | Ga0207664_10295976 | Ga0207664_102959762 | 239 |
| 581 | 3300025929 | Ga0207664_10315233 | Ga0207664_103152332 | 239 |
| 582 | 3300025931 | Ga0207644_10196350 | Ga0207644_101963503 | 239 |
| 583 | 3300025932 | Ga0207690_10264837 | Ga0207690_102648372 | 239 |
| 584 | 3300025936 | Ga0207670_10122393 | Ga0207670_101223932 | 239 |
| 585 | 3300025938 | Ga0207704_10441113 | Ga0207704_104411132 | 239 |
| 586 | 3300025939 | Ga0207665_10016104 | Ga0207665_100161046 | 239 |
| 587 | 3300025944 | Ga0207661_10006300 | Ga0207661_100063003 | 239 |
| 588 | 3300025944 | Ga0207661_10074007 | Ga0207661_100740072 | 239 |
| 589 | 3300025944 | Ga0207661_10389118 | Ga0207661_103891182 | 239 |
| 590 | 3300025945 | Ga0207679_10009597 | Ga0207679_100095972 | 239 |
| 591 | 3300025945 | Ga0207679_10111860 | Ga0207679_101118601 | 239 |
| 592 | 3300025972 | Ga0207668_10009134 | Ga0207668_100091343 | 239 |
| 593 | 3300025972 | Ga0207668_10181597 | Ga0207668_101815972 | 239 |
| 594 | 3300025986 | Ga0207658_10002264 | Ga0207658_100022649 | 239 |
| 595 | 3300025986 | Ga0207658_10014394 | Ga0207658_100143943 | 239 |
| 596 | 3300025986 | Ga0207658_10306908 | Ga0207658_103069083 | 239 |
| 597 | 3300026023 | Ga0207677_10187853 | Ga0207677_101878532 | 239 |
| 598 | 3300026035 | Ga0207703_10036156 | Ga0207703_100361564 | 239 |
| 599 | 3300026075 | Ga0207708_10019070 | Ga0207708_100190704 | 239 |
| 600 | 3300026088 | Ga0207641_10010850 | Ga0207641_100108506 | 239 |
| 601 | 3300026088 | Ga0207641_10964067 | Ga0207641_109640671 | 239 |
| 602 | 3300026095 | Ga0207676_10489901 | Ga0207676_104899012 | 239 |
| 603 | 3300026116 | Ga0207674_10031495 | Ga0207674_100314952 | 239 |
| 604 | 3300026118 | Ga0207675_100022886 | Ga0207675_1000228862 | 239 |
| 605 | 3300026142 | Ga0207698_10591408 | Ga0207698_105914082 | 239 |
| 606 | 3300026142 | Ga0207698_10663147 | Ga0207698_106631472 | 239 |
| 607 | 3300027866 | Ga0209813_10005935 | Ga0209813_100059354 | 239 |
| 608 | 3300028379 | Ga0268266_10001099 | Ga0268266_1000109911 | 239 |
| 609 | 3300028379 | Ga0268266_10003454 | Ga0268266_100034549 | 239 |
| 610 | 3300028380 | Ga0268265_10315832 | Ga0268265_103158322 | 239 |
| 611 | 3300028381 | Ga0268264_10000027 | Ga0268264_10000027315 | 239 |
| 612 | 3300028381 | Ga0268264_10000775 | Ga0268264_1000077522 | 239 |
| 613 | 3300031242 | Ga0265329_10057247 | Ga0265329_100572472 | 239 |
| 614 | 3300031456 | Ga0307513_10172564 | Ga0307513_101725643 | 239 |
| 615 | 3300031616 | Ga0307508_10043766 | Ga0307508_100437662 | 239 |
| 616 | 3300031730 | Ga0307516_10204116 | Ga0307516_102041161 | 239 |
| 617 | 3300031731 | Ga0307405_10080843 | Ga0307405_100808435 | 239 |
| 618 | 3300031731 | Ga0307405_10193875 | Ga0307405_101938751 | 239 |
| 619 | 3300031852 | Ga0307410_10320180 | Ga0307410_103201802 | 239 |
| 620 | 3300031852 | Ga0307410_10343321 | Ga0307410_103433212 | 239 |
| 621 | 3300031901 | Ga0307406_10215758 | Ga0307406_102157582 | 239 |
| 622 | 3300031911 | Ga0307412_10021847 | Ga0307412_100218475 | 239 |
| 623 | 3300031911 | Ga0307412_10065908 | Ga0307412_100659082 | 239 |
| 624 | 3300031995 | Ga0307409_100083762 | Ga0307409_1000837623 | 239 |
| 625 | 3300031995 | Ga0307409_100246486 | Ga0307409_1002464862 | 239 |
| 626 | 3300031995 | Ga0307409_100306105 | Ga0307409_1003061053 | 239 |
| 627 | 3300031995 | Ga0307409_100421865 | Ga0307409_1004218652 | 239 |
| 628 | 3300032002 | Ga0307416_100877097 | Ga0307416_1008770971 | 239 |
| 629 | 3300032002 | Ga0307416_101030314 | Ga0307416_1010303141 | 239 |
| 630 | 3300032004 | Ga0307414_10446127 | Ga0307414_104461272 | 239 |
| 631 | 3300032004 | Ga0307414_10512980 | Ga0307414_105129801 | 239 |
| 632 | 3300032004 | Ga0307414_10876483 | Ga0307414_108764831 | 239 |
| 633 | 3300032005 | Ga0307411_10968546 | Ga0307411_109685461 | 239 |
| 634 | 3300032126 | Ga0307415_100094377 | Ga0307415_1000943772 | 239 |
| 635 | 3300032126 | Ga0307415_100307980 | Ga0307415_1003079802 | 239 |
| 636 | 3300032126 | Ga0307415_100611466 | Ga0307415_1006114662 | 239 |
| 637 | 3300035083 | Ga0373926_0003223 | Ga0373926_0003223_2359_3087 | 239 |
| 638 | 3300035086 | Ga0373934_0003231 | Ga0373934_0003231_607_1335 | 239 |
| 639 | 3300035089 | Ga0373944_0002001 | Ga0373944_0002001_2509_3237 | 239 |
| 640 | 3300035111 | Ga0373923_0009413 | Ga0373923_0009413_2092_2820 | 239 |
| 641 | 3300035113 | Ga0373936_0010006 | Ga0373936_0010006_2146_2874 | 239 |
| 642 | 3300035116 | Ga0373945_0011275 | Ga0373945_0011275_286_1014 | 239 |
| 643 | 3300035118 | Ga0373954_0003219 | Ga0373954_0003219_5581_6309 | 239 |
| 644 | 3300035120 | Ga0373957_0009188 | Ga0373957_0009188_2148_2876 | 239 |
| 645 | 3300035170 | Ga0373943_0007254 | Ga0373943_0007254_4211_4939 | 239 |
| 646 | 3300035171 | Ga0373946_0001085 | Ga0373946_0001085_6630_7358 | 239 |
| 647 | 3300035172 | Ga0373955_0054523 | Ga0373955_0054523_1239_1967 | 239 |
| 648 | 3300035410 | Ga0373924_0002621 | Ga0373924_0002621_596_1324 | 239 |
| 649 | 3300035692 | Ga0373935_0007043 | Ga0373935_0007043_2079_2807 | 239 |
| 650 | 3300035695 | Ga0373927_0003517 | Ga0373927_0003517_8402_9130 | 239 |
| 651 | 3300035695 | Ga0373927_0306994 | Ga0373927_0306994_32_757 | 239 |
| 652 | 3300035724 | Ga0373933_0049458 | Ga0373933_0049458_1036_1764 | 239 |
| 653 | 3300035725 | Ga0373947_0259726 | Ga0373947_0259726_387_1115 | 239 |
| 654 | 3300036401 | Ga0373937_0090054 | Ga0373937_0090054_708_1436 | 239 |
| 655 | 3300036401 | Ga0373937_0111267 | Ga0373937_0111267_1782_2510 | 239 |
| 656 | 3300037068 | Ga0373925_0018182 | Ga0373925_0018182_3343_4071 | 239 |
| 657 | 3300037312 | Ga0395899_0167194 | Ga0395899_0167194_442_1179 | 239 |
| 658 | 3300037418 | Ga0395900_0475010 | Ga0395900_0475010_199_936 | 239 |
| 659 | 3300037466 | Ga0395898_0152562 | Ga0395898_0152562_1279_2037 | 239 |
| 660 | 3300037466 | Ga0395898_0234068 | Ga0395898_0234068_614_1348 | 239 |
| 661 | 3300037466 | Ga0395898_0320330 | Ga0395898_0320330_538_1275 | 239 |
| 662 | 3300037853 | Ga0436364_1551954 | Ga0436364_1551954_5272_5997 | 239 |
| 663 | 3300038443 | Ga0395901_0038724 | Ga0395901_0038724_996_1718 | 239 |
| 664 | 3300038443 | Ga0395901_0140828 | Ga0395901_0140828_152_889 | 239 |
| 665 | 3300039437 | Ga0436365_0906829 | Ga0436365_0906829_1125_1853 | 239 |
| 666 | 3300041460 | Ga0451802_0761233 | Ga0451802_0761233_120_839 | 239 |
| 667 | 3300041491 | Ga0451833_0532435 | Ga0451833_0532435_6086_6817 | 239 |
| 668 | 3300041496 | Ga0451839_0500015 | Ga0451839_0500015_2842_3573 | 239 |
| 669 | 3300041997 | Ga0439431_0005909 | Ga0439431_0005909_885_1619 | 239 |
| 670 | 3300042146 | Ga0450907_015927 | Ga0450907_015927_207_941 | 239 |
| 671 | 3300042156 | Ga0439446_0007150 | Ga0439446_0007150_110_844 | 239 |
| 672 | 3300042435 | Ga0439434_0047335 | Ga0439434_0047335_579_1313 | 239 |
| 673 | 3300042439 | Ga0439464_0026721 | Ga0439464_0026721_520_1260 | 239 |
| 674 | 3300044656 | Ga0466969_0038176 | Ga0466969_0038176_170_889 | 239 |
| 675 | 3300044656 | Ga0466969_0098588 | Ga0466969_0098588_341_1072 | 239 |
| 676 | 3300044658 | Ga0466972_0134952 | Ga0466972_0134952_126_869 | 239 |
| 677 | 3300044658 | Ga0466972_0147407 | Ga0466972_0147407_168_902 | 239 |
| 678 | 3300044683 | Ga0466965_0018748 | Ga0466965_0018748_837_1580 | 239 |
| 679 | 3300044683 | Ga0466965_0047295 | Ga0466965_0047295_1088_1825 | 239 |
| 680 | 3300044683 | Ga0466965_0056454 | Ga0466965_0056454_257_1021 | 239 |
| 681 | 3300044684 | Ga0466966_0028816 | Ga0466966_0028816_2041_2760 | 239 |
| 682 | 3300044684 | Ga0466966_0066102 | Ga0466966_0066102_848_1585 | 239 |
| 683 | 3300044684 | Ga0466966_0074133 | Ga0466966_0074133_1316_2047 | 239 |
| 684 | 3300044693 | Ga0466961_0010808 | Ga0466961_0010808_1046_1777 | 239 |
| 685 | 3300044693 | Ga0466961_0024561 | Ga0466961_0024561_1480_2244 | 239 |
| 686 | 3300044693 | Ga0466961_0032099 | Ga0466961_0032099_239_988 | 239 |
| 687 | 3300044693 | Ga0466961_0235003 | Ga0466961_0235003_214_951 | 239 |
| 688 | 3300044693 | Ga0466961_0282228 | Ga0466961_0282228_171_923 | 239 |
| 689 | 3300044694 | Ga0466963_0091226 | Ga0466963_0091226_513_1262 | 239 |
| 690 | 3300044694 | Ga0466963_0101303 | Ga0466963_0101303_699_1439 | 239 |
| 691 | 3300044694 | Ga0466963_0104822 | Ga0466963_0104822_571_1323 | 239 |
| 692 | 3300044694 | Ga0466963_0167581 | Ga0466963_0167581_173_910 | 239 |
| 693 | 3300044706 | Ga0466964_0002463 | Ga0466964_0002463_5779_6516 | 239 |
| 694 | 3300044706 | Ga0466964_0067283 | Ga0466964_0067283_647_1411 | 239 |
| 695 | 3300044719 | Ga0466971_0005451 | Ga0466971_0005451_4505_5269 | 239 |
| 696 | 3300044719 | Ga0466971_0019229 | Ga0466971_0019229_1516_2253 | 239 |
| 697 | 3300044735 | Ga0466968_0057896 | Ga0466968_0057896_103_867 | 239 |
| 698 | 3300044765 | Ga0466970_0003597 | Ga0466970_0003597_606_1340 | 239 |
| 699 | 3300044765 | Ga0466970_0006898 | Ga0466970_0006898_255_1004 | 239 |
| 700 | 3300044765 | Ga0466970_0010213 | Ga0466970_0010213_1489_2253 | 239 |
| 701 | 3300044765 | Ga0466970_0038490 | Ga0466970_0038490_1700_2455 | 239 |
| 702 | 3300044765 | Ga0466970_0047490 | Ga0466970_0047490_906_1655 | 239 |
| 703 | 3300044765 | Ga0466970_0048238 | Ga0466970_0048238_693_1445 | 239 |
| 704 | 3300044765 | Ga0466970_0079816 | Ga0466970_0079816_466_1203 | 239 |
| 705 | 3300044765 | Ga0466970_0130462 | Ga0466970_0130462_257_994 | 239 |
| 706 | 3300044765 | Ga0466970_0213390 | Ga0466970_0213390_251_985 | 239 |
| 707 | 3300044765 | Ga0466970_0226034 | Ga0466970_0226034_40_789 | 239 |
| 708 | 3300044842 | Ga0466957_0060381 | Ga0466957_0060381_1171_1920 | 239 |
| 709 | 3300044842 | Ga0466957_0104957 | Ga0466957_0104957_82_846 | 239 |
| 710 | 3300044842 | Ga0466957_0537814 | Ga0466957_0537814_34_783 | 239 |
| 711 | 3300044901 | Ga0466960_0000528 | Ga0466960_0000528_7185_7919 | 239 |
| 712 | 3300044901 | Ga0466960_0018199 | Ga0466960_0018199_1703_2440 | 239 |
| 713 | 3300044901 | Ga0466960_0020794 | Ga0466960_0020794_2056_2805 | 239 |
| 714 | 3300044901 | Ga0466960_0179474 | Ga0466960_0179474_258_1016 | 239 |
| 715 | 3300045049 | Ga0466959_0002006 | Ga0466959_0002006_1210_1929 | 239 |
| 716 | 3300045049 | Ga0466959_0071713 | Ga0466959_0071713_653_1384 | 239 |
| 717 | 3300045049 | Ga0466959_0092898 | Ga0466959_0092898_192_956 | 239 |
| 718 | 3300045049 | Ga0466959_0322624 | Ga0466959_0322624_122_859 | 239 |
| 719 | 3300045836 | Ga0466958_0087273 | Ga0466958_0087273_950_1714 | 239 |
| 720 | 3300045836 | Ga0466958_0188949 | Ga0466958_0188949_98_826 | 239 |
| 721 | 3300045976 | Ga0466967_0087613 | Ga0466967_0087613_1930_2679 | 239 |
| 722 | 3300045976 | Ga0466967_0210904 | Ga0466967_0210904_705_1463 | 239 |
| 723 | 3300045976 | Ga0466967_0241880 | Ga0466967_0241880_97_849 | 239 |
| 724 | 3300045976 | Ga0466967_0491483 | Ga0466967_0491483_271_1002 | 239 |
| 725 | 3300045976 | Ga0466967_0522640 | Ga0466967_0522640_148_882 | 239 |
| 726 | 3300046454 | Ga0495592_0014634 | Ga0495592_0014634_3446_4174 | 239 |
| 727 | 3300046454 | Ga0495592_0120924 | Ga0495592_0120924_497_1222 | 239 |
| 728 | 3300046455 | Ga0495603_0001542 | Ga0495603_0001542_10771_11499 | 239 |
| 729 | 3300046459 | Ga0495629_0009091 | Ga0495629_0009091_36_764 | 239 |
| 730 | 3300046461 | Ga0495641_0009648 | Ga0495641_0009648_3437_4165 | 239 |
| 731 | 3300046461 | Ga0495641_0093999 | Ga0495641_0093999_468_1190 | 239 |
| 732 | 3300046462 | Ga0495651_0059452 | Ga0495651_0059452_674_1399 | 239 |
| 733 | 3300046462 | Ga0495651_0080028 | Ga0495651_0080028_705_1433 | 239 |
| 734 | 3300046463 | Ga0495653_0029872 | Ga0495653_0029872_1943_2671 | 239 |
| 735 | 3300046472 | Ga0495580_0092637 | Ga0495580_0092637_780_1508 | 239 |
| 736 | 3300046473 | Ga0495582_0033962 | Ga0495582_0033962_1942_2670 | 239 |
| 737 | 3300046475 | Ga0495639_0001019 | Ga0495639_0001019_9558_10286 | 239 |
| 738 | 3300046476 | Ga0495662_0001001 | Ga0495662_0001001_11015_11743 | 239 |
| 739 | 3300046477 | Ga0495664_0066644 | Ga0495664_0066644_908_1636 | 239 |
| 740 | 3300046499 | Ga0495594_0015381 | Ga0495594_0015381_652_1380 | 239 |
| 741 | 3300046511 | Ga0495608_0016336 | Ga0495608_0016336_1802_2530 | 239 |
| 742 | 3300046514 | Ga0495618_0032056 | Ga0495618_0032056_512_1240 | 239 |
| 743 | 3300046514 | Ga0495618_0079458 | Ga0495618_0079458_570_1298 | 239 |
| 744 | 3300046514 | Ga0495618_0166591 | Ga0495618_0166591_330_1055 | 239 |
| 745 | 3300046516 | Ga0495628_0078730 | Ga0495628_0078730_1342_2067 | 239 |
| 746 | 3300046516 | Ga0495628_0153270 | Ga0495628_0153270_908_1636 | 239 |
| 747 | 3300046516 | Ga0495628_0401921 | Ga0495628_0401921_168_893 | 239 |
| 748 | 3300046517 | Ga0495630_0001525 | Ga0495630_0001525_11590_12318 | 239 |
| 749 | 3300046526 | Ga0495666_0005147 | Ga0495666_0005147_1670_2398 | 239 |
| 750 | 3300046529 | Ga0495652_0102575 | Ga0495652_0102575_1094_1819 | 239 |
| 751 | 3300046529 | Ga0495652_0137957 | Ga0495652_0137957_286_1014 | 239 |
| 752 | 3300046531 | Ga0495665_0003599 | Ga0495665_0003599_2229_2957 | 239 |
| 753 | 3300046533 | Ga0495640_0070817 | Ga0495640_0070817_706_1434 | 239 |
| 754 | 3300046535 | Ga0495586_0024803 | Ga0495586_0024803_1688_2416 | 239 |
| 755 | 3300046536 | Ga0495587_0050043 | Ga0495587_0050043_1500_2225 | 239 |
| 756 | 3300046536 | Ga0495587_0083884 | Ga0495587_0083884_270_998 | 239 |
| 757 | 3300046543 | Ga0495645_0004607 | Ga0495645_0004607_7310_8038 | 239 |
| 758 | 3300046543 | Ga0495645_0043472 | Ga0495645_0043472_914_1642 | 239 |
| 759 | 3300046559 | Ga0495667_0033861 | Ga0495667_0033861_2368_3093 | 239 |
| 760 | 3300046559 | Ga0495667_0099489 | Ga0495667_0099489_247_975 | 239 |
| 761 | 3300046642 | Ga0495634_0014957 | Ga0495634_0014957_1802_2530 | 239 |
| 762 | 3300046663 | Ga0495635_0071456 | Ga0495635_0071456_743_1471 | 239 |
| 763 | 3300046663 | Ga0495635_0078034 | Ga0495635_0078034_456_1220 | 239 |
| 764 | 3300046674 | Ga0495588_0067071 | Ga0495588_0067071_127_855 | 239 |
| 765 | 3300046675 | Ga0495657_0033202 | Ga0495657_0033202_1959_2687 | 239 |
| 766 | 3300046675 | Ga0495657_0034902 | Ga0495657_0034902_2533_3258 | 239 |
| 767 | 3300046678 | Ga0495599_0092889 | Ga0495599_0092889_119_847 | 239 |
| 768 | 3300046679 | Ga0495623_0006098 | Ga0495623_0006098_6994_7722 | 239 |
| 769 | 3300046680 | Ga0495646_0091542 | Ga0495646_0091542_908_1636 | 239 |
| 770 | 3300046681 | Ga0495647_0003977 | Ga0495647_0003977_3740_4468 | 239 |
| 771 | 3300046683 | Ga0495658_0001135 | Ga0495658_0001135_11845_12573 | 239 |
| 772 | 3300046689 | Ga0495613_0039267 | Ga0495613_0039267_1578_2306 | 239 |
| 773 | 3300046690 | Ga0495624_0010905 | Ga0495624_0010905_2457_3185 | 239 |
| 774 | 3300046690 | Ga0495624_0357850 | Ga0495624_0357850_100_864 | 239 |
| 775 | 3300046691 | Ga0495670_0145463 | Ga0495670_0145463_283_1020 | 239 |
| 776 | 3300046809 | Ga0495600_0004762 | Ga0495600_0004762_1959_2687 | 239 |
| 777 | 3300047315 | Ga0495581_0000621 | Ga0495581_0000621_6247_6975 | 239 |
| 778 | 3300047317 | Ga0495604_0078764 | Ga0495604_0078764_1326_2054 | 239 |
| 779 | 3300047317 | Ga0495604_0080068 | Ga0495604_0080068_321_1046 | 239 |
| 780 | 3300047319 | Ga0495674_0044503 | Ga0495674_0044503_1545_2273 | 239 |
| 781 | 3300047319 | Ga0495674_0170653 | Ga0495674_0170653_830_1558 | 239 |
| 782 | 3300047321 | Ga0495676_0047778 | Ga0495676_0047778_1981_2709 | 239 |
| 783 | 3300047322 | Ga0495680_0043195 | Ga0495680_0043195_754_1482 | 239 |
| 784 | 3300047322 | Ga0495680_0045877 | Ga0495680_0045877_2527_3255 | 239 |
| 785 | 3300047322 | Ga0495680_0047836 | Ga0495680_0047836_718_1443 | 239 |
| 786 | 3300047444 | Ga0495675_0034315 | Ga0495675_0034315_531_1259 | 239 |
| 787 | 3300047444 | Ga0495675_0108117 | Ga0495675_0108117_183_908 | 239 |
| 788 | 3300047471 | Ga0495684_0019054 | Ga0495684_0019054_2181_2909 | 239 |
| 789 | 3300047471 | Ga0495684_0031990 | Ga0495684_0031990_1910_2638 | 239 |
| 790 | 3300047471 | Ga0495684_0049805 | Ga0495684_0049805_171_896 | 239 |
| 791 | 3300047673 | Ga0495593_0004888 | Ga0495593_0004888_5012_5740 | 239 |
| 792 | 3300048088 | Ga0495602_0022328 | Ga0495602_0022328_4009_4734 | 239 |
| 793 | 3300048088 | Ga0495602_0086282 | Ga0495602_0086282_1589_2317 | 239 |
| 794 | 3300048088 | Ga0495602_0212140 | Ga0495602_0212140_159_884 | 239 |
| 795 | 3300048089 | Ga0495614_0014075 | Ga0495614_0014075_1744_2472 | 239 |
| 796 | 3300048903 | Ga0496100_0233110 | Ga0496100_0233110_282_1016 | 239 |
| 797 | 3300048903 | Ga0496100_0257311 | Ga0496100_0257311_504_1241 | 239 |
| 798 | 3300048903 | Ga0496100_0428566 | Ga0496100_0428566_249_974 | 239 |
| 799 | 3300048904 | Ga0496101_0038871 | Ga0496101_0038871_217_954 | 239 |
| 800 | 3300048904 | Ga0496101_0053929 | Ga0496101_0053929_56_790 | 239 |
| 801 | 3300048904 | Ga0496101_0443424 | Ga0496101_0443424_151_888 | 239 |
| 802 | 3300048905 | Ga0496102_0043775 | Ga0496102_0043775_1279_2016 | 239 |
| 803 | 3300048905 | Ga0496102_0636600 | Ga0496102_0636600_223_957 | 239 |
| 804 | 3300048906 | Ga0496103_0293758 | Ga0496103_0293758_122_859 | 239 |
| 805 | 3300048907 | Ga0496104_0041192 | Ga0496104_0041192_3083_3820 | 239 |
| 806 | 3300048907 | Ga0496104_0762041 | Ga0496104_0762041_132_851 | 239 |
| 807 | 3300048908 | Ga0496105_0085711 | Ga0496105_0085711_1758_2480 | 239 |
| 808 | 3300048908 | Ga0496105_0228083 | Ga0496105_0228083_108_845 | 239 |
| 809 | 3300048910 | Ga0496107_0184584 | Ga0496107_0184584_492_1229 | 239 |
| 810 | 3300048910 | Ga0496107_0253879 | Ga0496107_0253879_522_1256 | 239 |
| 811 | 3300048911 | Ga0496108_0032801 | Ga0496108_0032801_2638_3375 | 239 |
| 812 | 3300048911 | Ga0496108_0183013 | Ga0496108_0183013_635_1360 | 239 |
| 813 | 3300048912 | Ga0496109_0012037 | Ga0496109_0012037_5916_6653 | 239 |
| 814 | 3300048912 | Ga0496109_0148022 | Ga0496109_0148022_1192_1926 | 239 |
| 815 | 3300048912 | Ga0496109_0370241 | Ga0496109_0370241_374_1108 | 239 |
| 816 | 3300048913 | Ga0496110_0024974 | Ga0496110_0024974_313_1047 | 239 |
| 817 | 3300048913 | Ga0496110_0462075 | Ga0496110_0462075_77_814 | 239 |
| 818 | 3300048914 | Ga0496111_0092189 | Ga0496111_0092189_339_1073 | 239 |
| 819 | 3300048914 | Ga0496111_0177208 | Ga0496111_0177208_413_1153 | 239 |
| 820 | 3300048914 | Ga0496111_0289223 | Ga0496111_0289223_227_961 | 239 |
| 821 | 3300048915 | Ga0496112_0238116 | Ga0496112_0238116_661_1395 | 239 |
| 822 | 3300048916 | Ga0496113_0427798 | Ga0496113_0427798_63_797 | 239 |
| 823 | 3300048917 | Ga0496114_0005838 | Ga0496114_0005838_8571_9290 | 239 |
| 824 | 3300048917 | Ga0496114_0006548 | Ga0496114_0006548_6050_6787 | 239 |
| 825 | 3300048917 | Ga0496114_0057665 | Ga0496114_0057665_294_1028 | 239 |
| 826 | 3300048917 | Ga0496114_0143372 | Ga0496114_0143372_53_790 | 239 |
| 827 | 3300048917 | Ga0496114_0179282 | Ga0496114_0179282_928_1665 | 239 |
| 828 | 3300048917 | Ga0496114_0329178 | Ga0496114_0329178_450_1184 | 239 |
| 829 | 3300048917 | Ga0496114_0356295 | Ga0496114_0356295_34_768 | 239 |
| 830 | 3300048917 | Ga0496114_0385358 | Ga0496114_0385358_220_969 | 239 |
| 831 | 3300048917 | Ga0496114_0440598 | Ga0496114_0440598_207_941 | 239 |
| 832 | 3300048917 | Ga0496114_0462954 | Ga0496114_0462954_264_1001 | 239 |
| 833 | 3300048917 | Ga0496114_0466478 | Ga0496114_0466478_378_1103 | 239 |
| 834 | 3300048918 | Ga0496115_0043254 | Ga0496115_0043254_2618_3352 | 239 |
| 835 | 3300048918 | Ga0496115_0186105 | Ga0496115_0186105_108_845 | 239 |
| 836 | 3300048927 | Ga0496124_0253126 | Ga0496124_0253126_387_1136 | 239 |
| 837 | 3300048929 | Ga0496126_0426082 | Ga0496126_0426082_223_948 | 239 |
| 838 | 3300049568 | Ga0501031_0212989 | Ga0501031_0212989_335_1075 | 239 |
| 839 | 3300049568 | Ga0501031_0232436 | Ga0501031_0232436_149_880 | 239 |
| 840 | 3300049569 | Ga0501032_0271348 | Ga0501032_0271348_313_1050 | 239 |
| 841 | 3300049570 | Ga0501033_0200435 | Ga0501033_0200435_78_815 | 239 |
| 842 | 3300049571 | Ga0501034_0008156 | Ga0501034_0008156_5137_5859 | 239 |
| 843 | 3300049572 | Ga0501036_0008607 | Ga0501036_0008607_2877_3617 | 239 |
| 844 | 3300049572 | Ga0501036_0013280 | Ga0501036_0013280_4378_5100 | 239 |
| 845 | 3300049572 | Ga0501036_0027720 | Ga0501036_0027720_3865_4602 | 239 |
| 846 | 3300049572 | Ga0501036_0175033 | Ga0501036_0175033_315_1058 | 239 |
| 847 | 3300049572 | Ga0501036_0223756 | Ga0501036_0223756_388_1164 | 239 |
| 848 | 3300049572 | Ga0501036_0505710 | Ga0501036_0505710_177_917 | 239 |
| 849 | 3300049573 | Ga0501037_0123987 | Ga0501037_0123987_363_1103 | 239 |
| 850 | 3300049574 | Ga0501038_0035695 | Ga0501038_0035695_489_1211 | 239 |
| 851 | 3300049574 | Ga0501038_0040013 | Ga0501038_0040013_491_1228 | 239 |
| 852 | 3300049574 | Ga0501038_0619217 | Ga0501038_0619217_52_792 | 239 |
| 853 | 3300049575 | Ga0501039_0043657 | Ga0501039_0043657_2355_3095 | 239 |
| 854 | 3300049575 | Ga0501039_0355941 | Ga0501039_0355941_163_897 | 239 |
| 855 | 3300049575 | Ga0501039_0430367 | Ga0501039_0430367_232_1008 | 239 |
| 856 | 3300049576 | Ga0501040_0234028 | Ga0501040_0234028_46_786 | 239 |
| 857 | 3300049576 | Ga0501040_0267544 | Ga0501040_0267544_192_932 | 239 |
| 858 | 3300049576 | Ga0501040_0356969 | Ga0501040_0356969_274_1017 | 239 |
| 859 | 3300049577 | Ga0501041_0245354 | Ga0501041_0245354_367_1107 | 239 |
| 860 | 3300049578 | Ga0501042_0009659 | Ga0501042_0009659_4321_5058 | 239 |
| 861 | 3300049578 | Ga0501042_0116547 | Ga0501042_0116547_783_1511 | 239 |
| 862 | 3300049578 | Ga0501042_0139076 | Ga0501042_0139076_449_1189 | 239 |
| 863 | 3300049579 | Ga0501043_0010516 | Ga0501043_0010516_5691_6413 | 239 |
| 864 | 3300049579 | Ga0501043_0106695 | Ga0501043_0106695_158_895 | 239 |
| 865 | 3300049580 | Ga0501046_0108367 | Ga0501046_0108367_1343_2080 | 239 |
| 866 | 3300049581 | Ga0501047_0017471 | Ga0501047_0017471_964_1686 | 239 |
| 867 | 3300049582 | Ga0501048_0032249 | Ga0501048_0032249_896_1636 | 239 |
| 868 | 3300049582 | Ga0501048_0054767 | Ga0501048_0054767_963_1685 | 239 |
| 869 | 3300049582 | Ga0501048_0111534 | Ga0501048_0111534_759_1487 | 239 |
| 870 | 3300049583 | Ga0501067_0000937 | Ga0501067_0000937_9845_10585 | 239 |
| 871 | 3300049583 | Ga0501067_0043910 | Ga0501067_0043910_1073_1813 | 239 |
| 872 | 3300049583 | Ga0501067_0072027 | Ga0501067_0072027_269_1000 | 239 |
| 873 | 3300049583 | Ga0501067_0211074 | Ga0501067_0211074_180_917 | 239 |
| 874 | 3300049584 | Ga0501068_0116994 | Ga0501068_0116994_414_1154 | 239 |
| 875 | 3300049584 | Ga0501068_0189429 | Ga0501068_0189429_375_1115 | 239 |
| 876 | 3300049585 | Ga0501069_0061108 | Ga0501069_0061108_972_1712 | 239 |
| 877 | 3300049586 | Ga0501070_0014917 | Ga0501070_0014917_4226_4981 | 239 |
| 878 | 3300049586 | Ga0501070_0156848 | Ga0501070_0156848_363_1085 | 239 |
| 879 | 3300049586 | Ga0501070_0347371 | Ga0501070_0347371_325_1071 | 239 |
| 880 | 3300049587 | Ga0501071_0365096 | Ga0501071_0365096_147_887 | 239 |
| 881 | 3300049587 | Ga0501071_0440620 | Ga0501071_0440620_27_761 | 239 |
| 882 | 3300049588 | Ga0501072_0144642 | Ga0501072_0144642_202_942 | 239 |
| 883 | 3300049588 | Ga0501072_0181169 | Ga0501072_0181169_905_1645 | 239 |
| 884 | 3300049589 | Ga0501073_0026638 | Ga0501073_0026638_2692_3414 | 239 |
| 885 | 3300049590 | Ga0501074_0015528 | Ga0501074_0015528_2384_3124 | 239 |
| 886 | 3300049590 | Ga0501074_0026756 | Ga0501074_0026756_3258_3998 | 239 |
| 887 | 3300049592 | Ga0501076_0039234 | Ga0501076_0039234_85_825 | 239 |
| 888 | 3300049592 | Ga0501076_0262274 | Ga0501076_0262274_52_792 | 239 |
| 889 | 3300049592 | Ga0501076_0340354 | Ga0501076_0340354_264_992 | 239 |
| 890 | 3300049593 | Ga0501077_0007040 | Ga0501077_0007040_5001_5741 | 239 |
| 891 | 3300049593 | Ga0501077_0151572 | Ga0501077_0151572_203_943 | 239 |
| 892 | 3300049741 | Ga0501079_0112992 | Ga0501079_0112992_832_1572 | 239 |
| 893 | 3300049741 | Ga0501079_0319524 | Ga0501079_0319524_255_983 | 239 |
| 894 | 3300049742 | Ga0501080_0009062 | Ga0501080_0009062_7881_8621 | 239 |
| 895 | 3300049742 | Ga0501080_0056688 | Ga0501080_0056688_72_812 | 239 |
| 896 | 3300049742 | Ga0501080_0133283 | Ga0501080_0133283_573_1328 | 239 |
| 897 | 3300049742 | Ga0501080_0167300 | Ga0501080_0167300_1138_1869 | 239 |
| 898 | 3300049743 | Ga0501081_0431911 | Ga0501081_0431911_217_957 | 239 |
| 899 | 3300049744 | Ga0501083_0033984 | Ga0501083_0033984_1582_2322 | 239 |
| 900 | 3300049822 | Ga0501035_0007226 | Ga0501035_0007226_9150_9887 | 239 |
| 901 | 3300049823 | Ga0501044_0001740 | Ga0501044_0001740_11056_11793 | 239 |
| 902 | 3300049823 | Ga0501044_0027073 | Ga0501044_0027073_5167_5889 | 239 |
| 903 | 3300049824 | Ga0501045_0045049 | Ga0501045_0045049_2409_3137 | 239 |
| 904 | 3300049824 | Ga0501045_0305520 | Ga0501045_0305520_345_1097 | 239 |
| 905 | 3300050490 | nmdc:mga03n38_101440_c1 | nmdc:mga03n38_101440_c1_349_1089 | 239 |
| 906 | 3300050490 | nmdc:mga03n38_12549_c1 | nmdc:mga03n38_12549_c1_2213_2968 | 239 |
| 907 | 3300050490 | nmdc:mga03n38_16877_c1 | nmdc:mga03n38_16877_c1_1469_2215 | 239 |
| 908 | 3300050490 | nmdc:mga03n38_182_c1 | nmdc:mga03n38_182_c1_1385_2116 | 239 |
| 909 | 3300050490 | nmdc:mga03n38_52576_c1 | nmdc:mga03n38_52576_c1_871_1617 | 239 |
| 910 | 3300050491 | nmdc:mga00v17_103515_c1 | nmdc:mga00v17_103515_c1_532_1263 | 239 |
| 911 | 3300050491 | nmdc:mga00v17_15986_c1 | nmdc:mga00v17_15986_c1_2767_3522 | 239 |
| 912 | 3300050491 | nmdc:mga00v17_222875_c1 | nmdc:mga00v17_222875_c1_28_777 | 239 |
| 913 | 3300050491 | nmdc:mga00v17_4761_c1 | nmdc:mga00v17_4761_c1_5470_6201 | 239 |
| 914 | 3300050491 | nmdc:mga00v17_76350_c1 | nmdc:mga00v17_76350_c1_354_1094 | 239 |
| 915 | 3300050491 | nmdc:mga00v17_938_c1 | nmdc:mga00v17_938_c1_13604_14335 | 239 |
| 916 | 3300050491 | nmdc:mga00v17_9434_c1 | nmdc:mga00v17_9434_c1_2522_3268 | 239 |
| 917 | 3300050492 | nmdc:mga0yw44_23554_c1 | nmdc:mga0yw44_23554_c1_2485_3225 | 239 |
| 918 | 3300050492 | nmdc:mga0yw44_2602_c1 | nmdc:mga0yw44_2602_c1_113_847 | 239 |
| 919 | 3300050492 | nmdc:mga0yw44_434524_c1 | nmdc:mga0yw44_434524_c1_110_829 | 239 |
| 920 | 3300050492 | nmdc:mga0yw44_4605_c1 | nmdc:mga0yw44_4605_c1_5399_6148 | 239 |
| 921 | 3300050492 | nmdc:mga0yw44_73996_c1 | nmdc:mga0yw44_73996_c1_645_1376 | 239 |
| 922 | 3300050492 | nmdc:mga0yw44_97024_c1 | nmdc:mga0yw44_97024_c1_292_1047 | 239 |
| 923 | 3300050494 | nmdc:mga06z11_101722_c1 | nmdc:mga06z11_101722_c1_703_1458 | 239 |
| 924 | 3300050494 | nmdc:mga06z11_59730_c1 | nmdc:mga06z11_59730_c1_524_1270 | 239 |
| 925 | 3300050494 | nmdc:mga06z11_81385_c1 | nmdc:mga06z11_81385_c1_962_1693 | 239 |
| 926 | 3300050495 | nmdc:mga04h51_7926_c1 | nmdc:mga04h51_7926_c1_674_1420 | 239 |
| 927 | 3300050496 | nmdc:mga07m45_16037_c1 | nmdc:mga07m45_16037_c1_68_814 | 239 |
| 928 | 3300050496 | nmdc:mga07m45_20267_c1 | nmdc:mga07m45_20267_c1_1339_2070 | 239 |
| 929 | 3300050496 | nmdc:mga07m45_43084_c2 | nmdc:mga07m45_43084_c2_227_961 | 239 |
| 930 | 3300050507 | nmdc:mga05p37_688_c1 | nmdc:mga05p37_688_c1_30830_31576 | 239 |
| 931 | 3300050507 | nmdc:mga05p37_947_c1 | nmdc:mga05p37_947_c1_970_1689 | 239 |
| 932 | 3300050508 | nmdc:mga09592_38_c2 | nmdc:mga09592_38_c2_32334_33053 | 239 |
| 933 | 3300050508 | nmdc:mga09592_48606_c1 | nmdc:mga09592_48606_c1_347_1066 | 239 |
| 934 | 3300050509 | nmdc:mga0qj67_110810_c1 | nmdc:mga0qj67_110810_c1_430_1176 | 239 |
| 935 | 3300050509 | nmdc:mga0qj67_31_c2 | nmdc:mga0qj67_31_c2_9316_10035 | 239 |
| 936 | 3300050510 | nmdc:mga06r32_19_c1 | nmdc:mga06r32_19_c1_67116_67835 | 239 |
| 937 | 3300050510 | nmdc:mga06r32_282_c1 | nmdc:mga06r32_282_c1_10160_10906 | 239 |
| 938 | 3300053077 | Ga0495601_0040369 | Ga0495601_0040369_2023_2754 | 239 |
| 939 | 3300053077 | Ga0495601_0070549 | Ga0495601_0070549_86_814 | 239 |
| 940 | 3300053077 | Ga0495601_0192570 | Ga0495601_0192570_478_1203 | 239 |
| 941 | 3300053078 | Ga0495612_0025097 | Ga0495612_0025097_758_1486 | 239 |
| 942 | 3300053084 | Ga0495595_0028265 | Ga0495595_0028265_862_1590 | 239 |
| 943 | 3300053085 | Ga0495619_0007037 | Ga0495619_0007037_1205_1933 | 239 |
| 944 | 3300053085 | Ga0495619_0016103 | Ga0495619_0016103_595_1329 | 239 |
| 945 | 3300053088 | Ga0500644_0000009 | Ga0500644_0000009_20790_21533 | 239 |
| 946 | 3300053100 | Ga0500660_164739 | Ga0500660_164739_83_805 | 239 |
| 947 | 3300053102 | Ga0500554_030903 | Ga0500554_030903_625_1359 | 239 |
| 948 | 3300053104 | Ga0500556_0001531 | Ga0500556_0001531_5652_6407 | 239 |
| 949 | 3300053117 | Ga0500593_000177 | Ga0500593_000177_22945_23691 | 239 |
| 950 | 3300053139 | Ga0500568_0001114 | Ga0500568_0001114_13471_14229 | 239 |
| 951 | 3300053140 | Ga0500573_0102212 | Ga0500573_0102212_331_1065 | 239 |
| 952 | 3300060353 | Ga0501082_0023488 | Ga0501082_0023488_3864_4604 | 239 |
| 953 | 3300060353 | Ga0501082_0252637 | Ga0501082_0252637_217_957 | 239 |
| 954 | 3300061719 | Ga0466962_0003718 | Ga0466962_0003718_3632_4396 | 239 |
| 955 | 3300061719 | Ga0466962_0121126 | Ga0466962_0121126_48_785 | 239 |
| 956 | 3300061734 | Ga0530510_0181576 | Ga0530510_0181576_171_905 | 239 |
| 957 | 3300061734 | Ga0530510_0424942 | Ga0530510_0424942_92_844 | 239 |
| 958 | iso_pu_bacteria | 2537561592 | 2537898576 | 239 |
| 959 | iso_pu_bacteria | 2643221641 | 2644228905 | 239 |
| 960 | iso_pu_bacteria | 2739367898 | 2740167025 | 239 |
| 961 | iso_pu_bacteria | 2808606700 | 2810363493 | 239 |
| 962 | iso_pu_bacteria | 2857481737 | 2857482642 | 239 |
| 963 | iso_pu_bacteria | 8054609563 | 8054612764 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4w9t-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sp. mg1 | 0.9924 | 1 | 239 |
| 4u28-assembly1.cif.gz_A | crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 | 0.9887 | 1 | 239 |
| 2vep-assembly1.cif.gz_A | crystal structure of the full length bifunctional enzyme pria | 0.9846 | 2 | 239 |
| 4w9t-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sp. mg1 | 0.9841 | 1 | 239 |
| 4x2r-assembly1.cif.gz_A | crystal structure of pria from actinomyces urogenitalis | 0.9837 | 1 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9837 | 1 | 238 | 3.20.20.70 |
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9554 | 1 | 238 | 3.20.20.70 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9397 | 4 | 237 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9346 | 3 | 238 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9233 | 3 | 238 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I2XYG1-F1-model_v4 | Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) | 1.001 | 114 | 239 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |
| AF-A0A6L6R4J1-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 1 | 129 | 239 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A6J7TZ86-F1-model_v4 | Unannotated protein | 0.9971 | 127 | 239 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A132MPP7-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.9965 | 21 | 239 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |
| AF-A0A7K0R1I8-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.9949 | 2 | 238 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar