F486910

General Info

Members Datasets Scaffolds Average Seq Length
963 424 914 244

Family's Representative Sequence

Representative Sequence 3300020081|Ga0206354_10434341|Ga0206354_104343411
Length 280
Sequence MRGSRRRRGSTSTSPQPIVSVTRAVCGGCARPGYRRCVSRFVLLPAVDVADGQAVRLVQGEAGSETSYGDPLAAALAWQEQGAEWVHLVDLDAAFGRGSNRELLARIVGAVDVQVEMSGGIRDDESLEAAMAAGCRRVNIGTAALERPDWCAAAIASYGDRVAVGLDVRGRTLAARGWTRDGGDLYDVLARLEAEGCARYVVTDVNKDGMLQGPNLQLLRDVCAVTDRPVVASGGITELADLEALAGLVGDGVEGAIIGTALYEGRFTLEEALLRTGATS

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2643221572 Leifsonia sp. Root60 Isolate Unclassified
3 2643221576 Nocardioides sp. Root614 Isolate Unclassified
4 2643221590 Nocardioides sp. Root682 Isolate Unclassified
5 2643221604 Nocardioides sp. Root190 Isolate Unclassified
6 2643221615 Nocardioides sp. Root224 Isolate Unclassified
7 2643221617 Nocardioides sp. Root79 Isolate Unclassified
8 2643221620 Nocardioides sp. Root240 Isolate Unclassified
9 2643221641 Nocardioides sp. Root122 Isolate Unclassified
10 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
11 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
12 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
13 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
14 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
15 2738541305 Nocardioides sp. CF167 Isolate Unclassified
16 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
17 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
18 2739367898 Nocardioides sp. CF479 Isolate Unclassified
19 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
20 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
21 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
22 2808606394 Promicromonospora sp. C35 Isolate Unclassified
23 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
24 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
25 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
26 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
27 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
28 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
29 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
30 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
31 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
32 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
33 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
34 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
35 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
36 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
37 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
38 2891562705 Microbispora tritici MT50 Isolate Unclassified
39 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
40 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
41 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
42 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
43 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
44 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
45 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
216 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
217 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
218 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
219 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
223 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
224 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
265 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
266 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
269 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
270 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
271 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
272 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
273 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
274 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
275 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
279 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
282 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
283 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
379 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
380 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
391 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
398 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
399 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
400 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
408 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
409 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
410 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
414 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
415 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
416 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
419 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
420 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
421 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
422 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
423 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
424 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.08
Metatranscriptomes 0.83
Isolates 5.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.1
Nodule 0.1
Rhizoplane 6.85
Rhizosphere 78.5
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10027302 3300002067 Bacteria 1711
2 JGI25406J46586_10010786 3300003203 Bacteria 4033
3 JGI25406J46586_10016391 3300003203 Bacteria 3090
4 Ga0065714_10064450 3300005288 Bacteria 77548
5 Ga0065712_10008640 3300005290 Bacteria 2578
6 Ga0070658_10000487 3300005327 Bacteria 34469
7 Ga0070658_10002446 3300005327 Bacteria 15530
8 Ga0070658_10074477 3300005327 Bacteria 2784
9 Ga0070658_10102337 3300005327 Bacteria 2369
10 Ga0070683_100000788 3300005329 Bacteria 23382
11 Ga0070683_100003754 3300005329 Bacteria 12392
12 Ga0070666_10162507 3300005335 Bacteria 1561
13 Ga0070680_100001431 3300005336 Bacteria 17274
14 Ga0070680_100098517 3300005336 Bacteria 2425
15 Ga0070682_100062608 3300005337 Bacteria 2357
16 Ga0070682_100087650 3300005337 Bacteria 2030
17 Ga0070682_100095566 3300005337 Bacteria 1951
18 Ga0070682_100127614 3300005337 Bacteria 1717
19 Ga0068868_100007705 3300005338 Bacteria 7680
20 Ga0068868_100021449 3300005338 Bacteria 4864
21 Ga0070660_100005438 3300005339 Bacteria 8822
22 Ga0070660_100020239 3300005339 Bacteria 4888
23 Ga0070660_100369661 3300005339 Bacteria 1183
24 Ga0070660_100614894 3300005339 Bacteria 909
25 Ga0070689_100379597 3300005340 Bacteria 1191
26 Ga0070687_100256643 3300005343 Bacteria 1089
27 Ga0070661_100678940 3300005344 Bacteria 838
28 Ga0070692_10027293 3300005345 Bacteria 2829
29 Ga0070692_10040097 3300005345 Bacteria 2393
30 Ga0070668_100095611 3300005347 Bacteria 2347
31 Ga0070668_100367586 3300005347 Bacteria 1221
32 Ga0070671_100030886 3300005355 Bacteria 4422
33 Ga0070671_100248582 3300005355 Bacteria 1510
34 Ga0070671_100513148 3300005355 Bacteria 1032
35 Ga0070674_100121364 3300005356 Bacteria 1935
36 Ga0070673_100151454 3300005364 Bacteria 1964
37 Ga0070673_100357746 3300005364 Bacteria 1297
38 Ga0070659_100000614 3300005366 Bacteria 26134
39 Ga0070667_100010113 3300005367 Bacteria 7805
40 Ga0070667_100036420 3300005367 Bacteria 4125
41 Ga0070667_100160987 3300005367 Bacteria 1977
42 Ga0070667_100436861 3300005367 Bacteria 1195
43 Ga0070667_100666974 3300005367 Bacteria 961
44 Ga0070709_10107128 3300005434 Bacteria 1872
45 Ga0070714_100325100 3300005435 Bacteria 1439
46 Ga0070710_10103776 3300005437 Bacteria 1697
47 Ga0070710_10444518 3300005437 Bacteria 877
48 Ga0070701_10013530 3300005438 Bacteria 3715
49 Ga0070711_100007809 3300005439 Bacteria 6517
50 Ga0070711_100181917 3300005439 Bacteria 1609
51 Ga0070711_100228695 3300005439 Bacteria 1449
52 Ga0070700_100001727 3300005441 Bacteria 10973
53 Ga0070708_100000330 3300005445 Bacteria 35639
54 Ga0070708_100880566 3300005445 Unclassified 841
55 Ga0070678_100222966 3300005456 Bacteria 1568
56 Ga0070681_10003941 3300005458 Bacteria 13986
57 Ga0070681_10266804 3300005458 Bacteria 1623
58 Ga0070681_10506206 3300005458 Bacteria 1121
59 Ga0068867_100008705 3300005459 Bacteria 7165
60 Ga0070685_10031117 3300005466 Bacteria 2979
61 Ga0070685_10374641 3300005466 Bacteria 979
62 Ga0070706_100017306 3300005467 Bacteria 6652
63 Ga0070706_100058871 3300005467 Bacteria 3545
64 Ga0070707_100042667 3300005468 Bacteria 4343
65 Ga0070707_100072910 3300005468 Bacteria 3310
66 Ga0070698_100011699 3300005471 Bacteria 9308
67 Ga0070698_100060163 3300005471 Bacteria 3833
68 Ga0070698_100171381 3300005471 Bacteria 2111
69 Ga0070699_100000914 3300005518 Bacteria 27512
70 Ga0070699_100001377 3300005518 Bacteria 22335
71 Ga0070679_100002183 3300005530 Bacteria 17662
72 Ga0070679_100267296 3300005530 Bacteria 1665
73 Ga0070679_100369016 3300005530 Bacteria 1382
74 Ga0070679_100795516 3300005530 Bacteria 889
75 Ga0070684_100003940 3300005535 Bacteria 11242
76 Ga0070684_100008019 3300005535 Bacteria 8243
77 Ga0070684_100054260 3300005535 Bacteria 3492
78 Ga0070697_100043038 3300005536 Bacteria 3655
79 Ga0068853_100040444 3300005539 Bacteria 3978
80 Ga0070672_100213289 3300005543 Bacteria 1617
81 Ga0070686_100384818 3300005544 Bacteria 1063
82 Ga0070665_100001500 3300005548 Bacteria 27163
83 Ga0070665_100020284 3300005548 Bacteria 6674
84 Ga0070665_100054031 3300005548 Bacteria 4029
85 Ga0070665_100070157 3300005548 Bacteria 3511
86 Ga0068855_100034141 3300005563 Bacteria 6068
87 Ga0068855_100141077 3300005563 Bacteria 2747
88 Ga0068855_100184251 3300005563 Bacteria 2359
89 Ga0068855_100227865 3300005563 Bacteria 2088
90 Ga0068855_100294638 3300005563 Bacteria 1798
91 Ga0068855_100415398 3300005563 Bacteria 1472
92 Ga0068855_100777547 3300005563 Bacteria 1019
93 Ga0070664_100168461 3300005564 Bacteria 1942
94 Ga0070664_100324567 3300005564 Bacteria 1395
95 Ga0068857_100017894 3300005577 Bacteria 6214
96 Ga0068857_100032082 3300005577 Bacteria 4643
97 Ga0068857_100036107 3300005577 Bacteria 4379
98 Ga0068857_100218519 3300005577 Bacteria 1740
99 Ga0068857_100338560 3300005577 Bacteria 1392
100 Ga0068856_100020314 3300005614 Bacteria 6452
101 Ga0068856_100189851 3300005614 Bacteria 2068
102 Ga0068856_100456403 3300005614 Bacteria 1299
103 Ga0068856_100528361 3300005614 Bacteria 1201
104 Ga0070702_100071901 3300005615 Bacteria 2046
105 Ga0070702_100104931 3300005615 Bacteria 1741
106 Ga0068852_100010538 3300005616 Bacteria 6914
107 Ga0068852_100053856 3300005616 Bacteria 3465
108 Ga0068859_100004174 3300005617 Bacteria 14752
109 Ga0068859_100190879 3300005617 Bacteria 2133
110 Ga0068859_100394459 3300005617 Bacteria 1480
111 Ga0068864_100031732 3300005618 Unclassified 4484
112 Ga0068864_100305102 3300005618 Bacteria 1491
113 Ga0068861_100346217 3300005719 Bacteria 1302
114 Ga0068851_10000124 3300005834 Bacteria 41585
115 Ga0068863_100001958 3300005841 Bacteria 20461
116 Ga0068863_100124165 3300005841 Bacteria 2463
117 Ga0068863_100600925 3300005841 Bacteria 1089
118 Ga0068858_100000175 3300005842 Bacteria 68239
119 Ga0068858_100034213 3300005842 Bacteria 4713
120 Ga0068858_100035292 3300005842 Unclassified 4639
121 Ga0068860_100000043 3300005843 Bacteria 225862
122 Ga0068860_100044109 3300005843 Bacteria 4251
123 Ga0081455_10000128 3300005937 Bacteria 88444
124 Ga0081455_10001337 3300005937 Bacteria 30512
125 Ga0081455_10009693 3300005937 Bacteria 9879
126 Ga0081538_10000005 3300005981 Bacteria 187304
127 Ga0081539_10000728 3300005985 Bacteria 65949
128 Ga0081539_10001334 3300005985 Bacteria 42972
129 Ga0081539_10022628 3300005985 Bacteria 4149
130 Ga0081539_10048547 3300005985 Bacteria 2414
131 Ga0081539_10092132 3300005985 Bacteria 1563
132 Ga0070717_10041626 3300006028 Bacteria 3745
133 Ga0075365_10000640 3300006038 Bacteria 13877
134 Ga0075365_10007324 3300006038 Bacteria 6169
135 Ga0075365_10009470 3300006038 Bacteria 5602
136 Ga0075365_10020733 3300006038 Bacteria 4082
137 Ga0075365_10025374 3300006038 Bacteria 3751
138 Ga0075365_10028215 3300006038 Bacteria 3578
139 Ga0075365_10173901 3300006038 Bacteria 1504
140 Ga0075368_10004612 3300006042 Bacteria 4684
141 Ga0075363_100000612 3300006048 Bacteria 11799
142 Ga0075363_100005598 3300006048 Bacteria 5610
143 Ga0075363_100009078 3300006048 Bacteria 4666
144 Ga0075363_100043254 3300006048 Bacteria 2382
145 Ga0075363_100079551 3300006048 Bacteria 1791
146 Ga0075363_100084389 3300006048 Bacteria 1741
147 Ga0075363_100150586 3300006048 Bacteria 1313
148 Ga0075364_10002963 3300006051 Bacteria 9584
149 Ga0075364_10009875 3300006051 Bacteria 5742
150 Ga0075364_10011486 3300006051 Bacteria 5379
151 Ga0075364_10033013 3300006051 Bacteria 3329
152 Ga0075364_10087474 3300006051 Bacteria 2065
153 Ga0075364_10115186 3300006051 Bacteria 1796
154 Ga0075364_10134197 3300006051 Bacteria 1663
155 Ga0075364_10143427 3300006051 Bacteria 1607
156 Ga0075364_10157376 3300006051 Bacteria 1533
157 Ga0075364_10209326 3300006051 Bacteria 1322
158 Ga0070716_100139129 3300006173 Bacteria 1545
159 Ga0070712_100038812 3300006175 Bacteria 3256
160 Ga0070712_100187171 3300006175 Bacteria 1617
161 Ga0075367_10057284 3300006178 Bacteria 2317
162 Ga0075367_10076675 3300006178 Bacteria 2018
163 Ga0075367_10078641 3300006178 Bacteria 1992
164 Ga0075367_10082849 3300006178 Bacteria 1942
165 Ga0075367_10087304 3300006178 Bacteria 1894
166 Ga0097621_100028408 3300006237 Bacteria 4408
167 Ga0075370_10006358 3300006353 Bacteria 5933
168 Ga0075370_10039921 3300006353 Bacteria 2646
169 Ga0075370_10084347 3300006353 Bacteria 1829
170 Ga0068871_100021352 3300006358 Bacteria 4975
171 Ga0075428_100007901 3300006844 Bacteria 11794
172 Ga0075430_100008527 3300006846 Bacteria 8659
173 Ga0075430_100035267 3300006846 Bacteria 4245
174 Ga0075431_100000088 3300006847 Bacteria 56098
175 Ga0075431_100007324 3300006847 Bacteria 10990
176 Ga0075429_100002486 3300006880 Bacteria 15513
177 Ga0075429_100009056 3300006880 Bacteria 8645
178 Ga0075429_100050142 3300006880 Bacteria 3632
179 Ga0068865_100114224 3300006881 Bacteria 1997
180 Ga0097620_100004174 3300006931 Bacteria 14752
181 Ga0097620_100190874 3300006931 Bacteria 2133
182 Ga0097620_100394417 3300006931 Bacteria 1480
183 Ga0075435_100277005 3300007076 Bacteria 1432
184 Ga0105240_10003864 3300009093 Bacteria 23139
185 Ga0105240_10131613 3300009093 Bacteria 3000
186 Ga0105240_10335224 3300009093 Bacteria 1720
187 Ga0105240_10751637 3300009093 Bacteria 1060
188 Ga0105240_11192571 3300009093 Bacteria 806
189 Ga0111539_10015597 3300009094 Bacteria 9448
190 Ga0111539_10565023 3300009094 Bacteria 1325
191 Ga0111539_10881613 3300009094 Bacteria 1041
192 Ga0105245_10033293 3300009098 Bacteria 4566
193 Ga0105245_10101974 3300009098 Bacteria 2657
194 Ga0105245_10150434 3300009098 Bacteria 2200
195 Ga0105245_10238939 3300009098 Bacteria 1760
196 Ga0105245_10542452 3300009098 Bacteria 1184
197 Ga0105247_10094621 3300009101 Bacteria 1901
198 Ga0114129_10000059 3300009147 Bacteria 98984
199 Ga0114129_10040088 3300009147 Bacteria 6604
200 Ga0114129_10051139 3300009147 Bacteria 5802
201 Ga0105243_10273621 3300009148 Bacteria 1517
202 Ga0105243_10652321 3300009148 Bacteria 1020
203 Ga0105241_10000211 3300009174 Bacteria 43844
204 Ga0105241_10232294 3300009174 Bacteria 1555
205 Ga0105242_10057516 3300009176 Bacteria 3185
206 Ga0105242_10587153 3300009176 Bacteria 1074
207 Ga0105242_10834030 3300009176 Bacteria 916
208 Ga0105248_10013752 3300009177 Bacteria 8909
209 Ga0105248_10082344 3300009177 Bacteria 3618
210 Ga0105248_10093672 3300009177 Bacteria 3383
211 Ga0105248_10172428 3300009177 Bacteria 2438
212 Ga0105248_10194062 3300009177 Bacteria 2288
213 Ga0105237_10005342 3300009545 Bacteria 14534
214 Ga0105237_10007321 3300009545 Bacteria 12100
215 Ga0105237_10094775 3300009545 Bacteria 2974
216 Ga0105237_10138602 3300009545 Bacteria 2427
217 Ga0105237_10868826 3300009545 Bacteria 909
218 Ga0105238_10001857 3300009551 Bacteria 21165
219 Ga0105238_10036361 3300009551 Bacteria 5005
220 Ga0105238_10333455 3300009551 Bacteria 1504
221 Ga0105238_10367295 3300009551 Bacteria 1429
222 Ga0105238_10432732 3300009551 Bacteria 1311
223 Ga0105238_10491700 3300009551 Bacteria 1227
224 Ga0105238_10892819 3300009551 Bacteria 907
225 Ga0105249_10058232 3300009553 Bacteria 3541
226 Ga0105249_11172280 3300009553 Bacteria 839
227 Ga0105239_10027190 3300010375 Bacteria 6298
228 Ga0105239_10128443 3300010375 Bacteria 2818
229 Ga0105239_10149110 3300010375 Bacteria 2610
230 Ga0105239_10372671 3300010375 Bacteria 1613
231 Ga0105246_10005341 3300011119 Bacteria 7820
232 Ga0105246_10465775 3300011119 Bacteria 1066
233 Ga0157371_10565524 3300013102 Bacteria 844
234 Ga0157370_10643926 3300013104 Bacteria 969
235 Ga0157369_10050387 3300013105 Bacteria 4510
236 Ga0157369_10056590 3300013105 Bacteria 4231
237 Ga0157369_10101724 3300013105 Bacteria 3062
238 Ga0157369_10762532 3300013105 Bacteria 995
239 Ga0157374_10099734 3300013296 Bacteria 2782
240 Ga0157378_10304166 3300013297 Bacteria 1544
241 Ga0157378_10498882 3300013297 Unclassified 1216
242 Ga0163162_10000646 3300013306 Bacteria 32306
243 Ga0157372_10226888 3300013307 Bacteria 2165
244 Ga0157372_10603543 3300013307 Bacteria 1279
245 Ga0157372_10712912 3300013307 Bacteria 1167
246 Ga0157372_10788781 3300013307 Bacteria 1104
247 Ga0157375_10006748 3300013308 Bacteria 9995
248 Ga0157375_10028362 3300013308 Bacteria 5246
249 Ga0157375_10041252 3300013308 Bacteria 4455
250 Ga0157375_10199098 3300013308 Bacteria 2158
251 Ga0157375_10275722 3300013308 Bacteria 1844
252 Ga0157375_10538778 3300013308 Bacteria 1330
253 Ga0157375_10603463 3300013308 Bacteria 1257
254 Ga0163163_10023922 3300014325 Bacteria 5808
255 Ga0163163_10117210 3300014325 Bacteria 2694
256 Ga0163163_10173331 3300014325 Bacteria 2204
257 Ga0163163_10256340 3300014325 Bacteria 1800
258 Ga0163163_10320655 3300014325 Bacteria 1603
259 Ga0163163_10422695 3300014325 Bacteria 1392
260 Ga0163163_10464547 3300014325 Bacteria 1326
261 Ga0163163_10606015 3300014325 Bacteria 1158
262 Ga0163163_10862411 3300014325 Bacteria 969
263 Ga0157380_10009167 3300014326 Bacteria 7081
264 Ga0157380_10322101 3300014326 Bacteria 1433
265 Ga0182008_10180367 3300014497 Bacteria 1068
266 Ga0157377_10114815 3300014745 Bacteria 1624
267 Ga0157377_10204939 3300014745 Bacteria 1254
268 Ga0157379_10004102 3300014968 Bacteria 12432
269 Ga0157379_10110172 3300014968 Bacteria 2473
270 Ga0157379_10381489 3300014968 Bacteria 1293
271 Ga0157376_10045102 3300014969 Bacteria 3628
272 Ga0157376_10475073 3300014969 Bacteria 1224
273 Ga0157376_10540297 3300014969 Bacteria 1152
274 Ga0206354_10103529 3300020081 Bacteria 3182
275 Ga0206354_10434341 3300020081 Bacteria 1185
276 Ga0206354_10817771 3300020081 Bacteria 1057
277 Ga0206353_10033622 3300020082 Bacteria 1735
278 Ga0206353_10244667 3300020082 Bacteria 1918
279 Ga0206353_10580619 3300020082 Bacteria 10814
280 Ga0206353_11297471 3300020082 Bacteria 4907
281 Ga0206353_11747993 3300020082 Bacteria 1763
282 Ga0213876_10073807 3300021384 Bacteria 1802
283 Ga0213876_10100757 3300021384 Bacteria 1531
284 Ga0213875_10026616 3300021388 Bacteria 2751
285 Ga0213875_10044625 3300021388 Bacteria 2081
286 Ga0209148_1000830 3300025254 Bacteria 22075
287 Ga0207656_10000001 3300025321 Bacteria 1323684
288 Ga0207656_10000003 3300025321 Bacteria 771644
289 Ga0207692_10019279 3300025898 Bacteria 3080
290 Ga0207692_10031456 3300025898 Bacteria 2542
291 Ga0207710_10050534 3300025900 Bacteria 1866
292 Ga0207710_10119330 3300025900 Bacteria 1258
293 Ga0207688_10016189 3300025901 Bacteria 4043
294 Ga0207688_10092825 3300025901 Bacteria 1735
295 Ga0207680_10154452 3300025903 Bacteria 1533
296 Ga0207647_10066052 3300025904 Bacteria 2194
297 Ga0207699_10003210 3300025906 Bacteria 7783
298 Ga0207699_10054845 3300025906 Bacteria 2369
299 Ga0207645_10219615 3300025907 Bacteria 1253
300 Ga0207643_10307348 3300025908 Bacteria 988
301 Ga0207705_10004785 3300025909 Bacteria 10196
302 Ga0207705_10004857 3300025909 Bacteria 10091
303 Ga0207705_10043184 3300025909 Bacteria 3238
304 Ga0207705_10058716 3300025909 Bacteria 2775
305 Ga0207705_10142139 3300025909 Bacteria 1793
306 Ga0207705_10237966 3300025909 Bacteria 1386
307 Ga0207684_10168280 3300025910 Bacteria 1889
308 Ga0207684_10489089 3300025910 Bacteria 1055
309 Ga0207654_10000003 3300025911 Bacteria 1030378
310 Ga0207707_10001838 3300025912 Bacteria 19451
311 Ga0207707_10244818 3300025912 Bacteria 1558
312 Ga0207707_10414230 3300025912 Bacteria 1156
313 Ga0207695_10019828 3300025913 Bacteria 7729
314 Ga0207695_10035922 3300025913 Bacteria 5364
315 Ga0207671_10000001 3300025914 Bacteria 1318881
316 Ga0207693_10034783 3300025915 Bacteria 3974
317 Ga0207663_10022800 3300025916 Bacteria 3584
318 Ga0207660_10000619 3300025917 Bacteria 23952
319 Ga0207660_10075333 3300025917 Bacteria 2465
320 Ga0207660_10270256 3300025917 Bacteria 1347
321 Ga0207662_10153317 3300025918 Bacteria 1467
322 Ga0207662_10275076 3300025918 Bacteria 1112
323 Ga0207657_10014789 3300025919 Bacteria 7597
324 Ga0207657_10032104 3300025919 Bacteria 4748
325 Ga0207657_10098006 3300025919 Bacteria 2437
326 Ga0207657_10098639 3300025919 Bacteria 2427
327 Ga0207657_10338962 3300025919 Bacteria 1187
328 Ga0207657_10409826 3300025919 Bacteria 1066
329 Ga0207649_10166664 3300025920 Bacteria 1531
330 Ga0207652_10003015 3300025921 Bacteria 14060
331 Ga0207652_10527328 3300025921 Bacteria 1062
332 Ga0207646_10282552 3300025922 Bacteria 1500
333 Ga0207694_10000039 3300025924 Bacteria 186164
334 Ga0207694_10047828 3300025924 Bacteria 3308
335 Ga0207694_10263129 3300025924 Bacteria 1413
336 Ga0207687_10045021 3300025927 Bacteria 3049
337 Ga0207687_10063863 3300025927 Bacteria 2608
338 Ga0207687_10153808 3300025927 Bacteria 1758
339 Ga0207687_10458862 3300025927 Bacteria 1058
340 Ga0207687_10627015 3300025927 Bacteria 908
341 Ga0207700_10215306 3300025928 Bacteria 1626
342 Ga0207664_10024940 3300025929 Bacteria 4497
343 Ga0207664_10139174 3300025929 Bacteria 2051
344 Ga0207664_10281671 3300025929 Bacteria 1459
345 Ga0207664_10295976 3300025929 Bacteria 1423
346 Ga0207664_10315233 3300025929 Bacteria 1379
347 Ga0207644_10196350 3300025931 Bacteria 1589
348 Ga0207644_10225731 3300025931 Bacteria 1486
349 Ga0207690_10002300 3300025932 Bacteria 11646
350 Ga0207690_10103316 3300025932 Bacteria 2039
351 Ga0207690_10264837 3300025932 Bacteria 1333
352 Ga0207709_10009370 3300025935 Bacteria 5387
353 Ga0207670_10122393 3300025936 Bacteria 1893
354 Ga0207669_10367607 3300025937 Bacteria 1117
355 Ga0207704_10441113 3300025938 Bacteria 1037
356 Ga0207665_10016104 3300025939 Bacteria 4908
357 Ga0207691_10001309 3300025940 Bacteria 24825
358 Ga0207711_10002075 3300025941 Bacteria 18101
359 Ga0207711_10156093 3300025941 Bacteria 2062
360 Ga0207711_10607072 3300025941 Bacteria 1021
361 Ga0207689_10026504 3300025942 Bacteria 4854
362 Ga0207661_10006300 3300025944 Bacteria 8395
363 Ga0207661_10012912 3300025944 Bacteria 6091
364 Ga0207661_10074007 3300025944 Bacteria 2792
365 Ga0207661_10155490 3300025944 Bacteria 1980
366 Ga0207661_10389118 3300025944 Bacteria 1263
367 Ga0207661_10716558 3300025944 Bacteria 920
368 Ga0207679_10009597 3300025945 Bacteria 6203
369 Ga0207679_10111860 3300025945 Bacteria 2157
370 Ga0207679_10605007 3300025945 Bacteria 988
371 Ga0207667_10001963 3300025949 Bacteria 25773
372 Ga0207667_10071396 3300025949 Bacteria 3610
373 Ga0207667_10143189 3300025949 Bacteria 2461
374 Ga0207667_10209304 3300025949 Bacteria 1999
375 Ga0207651_10113870 3300025960 Bacteria 2036
376 Ga0207712_10137742 3300025961 Bacteria 1869
377 Ga0207668_10009134 3300025972 Bacteria 5927
378 Ga0207668_10181597 3300025972 Bacteria 1660
379 Ga0207640_10175773 3300025981 Bacteria 1600
380 Ga0207658_10002264 3300025986 Bacteria 14243
381 Ga0207658_10014394 3300025986 Bacteria 5417
382 Ga0207658_10023727 3300025986 Bacteria 4285
383 Ga0207658_10163271 3300025986 Bacteria 1827
384 Ga0207658_10306908 3300025986 Bacteria 1369
385 Ga0207677_10187853 3300026023 Bacteria 1632
386 Ga0207703_10000131 3300026035 Bacteria 90186
387 Ga0207703_10036156 3300026035 Bacteria 3929
388 Ga0207639_10385870 3300026041 Bacteria 1259
389 Ga0207708_10006405 3300026075 Bacteria 8722
390 Ga0207708_10019070 3300026075 Bacteria 5164
391 Ga0207702_10044597 3300026078 Bacteria 3727
392 Ga0207702_10106187 3300026078 Bacteria 2488
393 Ga0207702_10731019 3300026078 Bacteria 976
394 Ga0207641_10010850 3300026088 Bacteria 7464
395 Ga0207641_10120500 3300026088 Bacteria 2340
396 Ga0207641_10964067 3300026088 Bacteria 849
397 Ga0207648_10001262 3300026089 Bacteria 28251
398 Ga0207676_10028744 3300026095 Bacteria 4156
399 Ga0207676_10489901 3300026095 Bacteria 1166
400 Ga0207676_10503859 3300026095 Bacteria 1150
401 Ga0207674_10011490 3300026116 Bacteria 9946
402 Ga0207674_10030152 3300026116 Bacteria 5705
403 Ga0207674_10031495 3300026116 Bacteria 5571
404 Ga0207674_10031793 3300026116 Bacteria 5540
405 Ga0207674_10051815 3300026116 Bacteria 4187
406 Ga0207674_10474475 3300026116 Bacteria 1209
407 Ga0207675_100002583 3300026118 Bacteria 17935
408 Ga0207675_100022886 3300026118 Bacteria 5812
409 Ga0207698_10005106 3300026142 Bacteria 8063
410 Ga0207698_10009635 3300026142 Bacteria 6167
411 Ga0207698_10257452 3300026142 Bacteria 1601
412 Ga0207698_10269546 3300026142 Bacteria 1569
413 Ga0207698_10591408 3300026142 Bacteria 1093
414 Ga0207698_10663147 3300026142 Bacteria 1035
415 Ga0209813_10005935 3300027866 Bacteria 2997
416 Ga0207428_10217109 3300027907 Bacteria 1435
417 Ga0268266_10001099 3300028379 Bacteria 33884
418 Ga0268266_10003454 3300028379 Bacteria 15758
419 Ga0268266_10307389 3300028379 Bacteria 1481
420 Ga0268265_10315832 3300028380 Bacteria 1413
421 Ga0268264_10000027 3300028381 Bacteria 440852
422 Ga0268264_10000775 3300028381 Bacteria 35258
423 Ga0268264_10136939 3300028381 Bacteria 2178
424 Ga0316176_1191746 3300030732 Bacteria 1676
425 Ga0314311_1041561 3300030733 Bacteria 2195
426 Ga0316179_1043364 3300030734 Bacteria 1731
427 Ga0316181_1131546 3300030744 Bacteria 826
428 Ga0265329_10057247 3300031242 Bacteria 1236
429 Ga0307513_10172564 3300031456 Bacteria 2038
430 Ga0307508_10043766 3300031616 Bacteria 4009
431 Ga0307514_10139981 3300031649 Bacteria 1647
432 Ga0316576_10073392 3300031727 Bacteria 2528
433 Ga0316578_10206613 3300031728 Bacteria 1182
434 Ga0307516_10204116 3300031730 Bacteria 1694
435 Ga0307405_10080843 3300031731 Bacteria 2123
436 Ga0307405_10193875 3300031731 Bacteria 1470
437 Ga0307410_10320180 3300031852 Bacteria 1230
438 Ga0307410_10343321 3300031852 Bacteria 1191
439 Ga0307406_10215758 3300031901 Bacteria 1423
440 Ga0307407_10048260 3300031903 Bacteria 2422
441 Ga0307412_10021847 3300031911 Bacteria 3914
442 Ga0307412_10065908 3300031911 Bacteria 2453
443 Ga0307412_10642861 3300031911 Bacteria 904
444 Ga0307409_100083762 3300031995 Bacteria 2587
445 Ga0307409_100246486 3300031995 Bacteria 1630
446 Ga0307409_100306105 3300031995 Bacteria 1481
447 Ga0307409_100421865 3300031995 Bacteria 1280
448 Ga0307416_100877097 3300032002 Bacteria 996
449 Ga0307416_101030314 3300032002 Bacteria 927
450 Ga0307414_10028339 3300032004 Bacteria 3631
451 Ga0307414_10446127 3300032004 Bacteria 1134
452 Ga0307414_10512980 3300032004 Bacteria 1063
453 Ga0307414_10876483 3300032004 Bacteria 822
454 Ga0307411_10968546 3300032005 Bacteria 760
455 Ga0307415_100094377 3300032126 Bacteria 2175
456 Ga0307415_100112687 3300032126 Archaea 2022
457 Ga0307415_100307980 3300032126 Bacteria 1315
458 Ga0307415_100611466 3300032126 Bacteria 971
459 Ga0373926_0003223 3300035083 Bacteria 5242
460 Ga0373934_0003231 3300035086 Bacteria 5958
461 Ga0373944_0001493 3300035089 Bacteria 5916
462 Ga0373944_0002001 3300035089 Bacteria 5167
463 Ga0373923_0009413 3300035111 Bacteria 3525
464 Ga0373936_0010006 3300035113 Bacteria 3579
465 Ga0373945_0000297 3300035116 Bacteria 14137
466 Ga0373945_0011275 3300035116 Bacteria 2955
467 Ga0373954_0003219 3300035118 Bacteria 6903
468 Ga0373954_0034272 3300035118 Bacteria 2351
469 Ga0373956_0102199 3300035119 Bacteria 1330
470 Ga0373957_0009188 3300035120 Bacteria 3227
471 Ga0373943_0000586 3300035170 Bacteria 15773
472 Ga0373943_0007254 3300035170 Bacteria 4974
473 Ga0373943_0036836 3300035170 Bacteria 2344
474 Ga0373946_0000057 3300035171 Bacteria 29670
475 Ga0373946_0001085 3300035171 Bacteria 9378
476 Ga0373955_0054523 3300035172 Bacteria 2186
477 Ga0316574_0115910 3300035398 Bacteria 1718
478 Ga0373924_0002621 3300035410 Bacteria 6071
479 Ga0373924_0008137 3300035410 Bacteria 3799
480 Ga0373935_0001547 3300035692 Bacteria 12811
481 Ga0373935_0007043 3300035692 Bacteria 6711
482 Ga0373927_0000281 3300035695 Bacteria 40043
483 Ga0373927_0003517 3300035695 Bacteria 11206
484 Ga0373927_0306994 3300035695 Bacteria 1044
485 Ga0373933_0049458 3300035724 Bacteria 2506
486 Ga0373947_0259726 3300035725 Bacteria 1150
487 Ga0373937_0090054 3300036401 Bacteria 2841
488 Ga0373937_0111267 3300036401 Bacteria 2547
489 Ga0373925_0004092 3300037068 Bacteria 11068
490 Ga0373925_0018182 3300037068 Bacteria 5106
491 Ga0395899_0167194 3300037312 Bacteria 1551
492 Ga0395900_0400287 3300037418 Bacteria 1337
493 Ga0395900_0475010 3300037418 Bacteria 1203
494 Ga0395898_0141403 3300037466 Unclassified 2304
495 Ga0395898_0152562 3300037466 Bacteria 2210
496 Ga0395898_0234068 3300037466 Bacteria 1752
497 Ga0395898_0320330 3300037466 Bacteria 1479
498 Ga0395905_0007654 3300037471 Bacteria 10723
499 Ga0436364_1551954 3300037853 Bacteria 6411
500 Ga0395901_0038724 3300038443 Bacteria 4932
501 Ga0395901_0140828 3300038443 Bacteria 2535
502 Ga0436365_0906829 3300039437 Bacteria 2269
503 Ga0436365_1820644 3300039437 Bacteria 1686
504 Ga0451793_0945671 3300041452 Bacteria 4802
505 Ga0451802_0761233 3300041460 Bacteria 934
506 Ga0451833_0532435 3300041491 Bacteria 8757
507 Ga0451839_0500015 3300041496 Bacteria 5412
508 Ga0451853_0001627 3300041512 Bacteria 1154
509 Ga0439431_0005909 3300041997 Bacteria 2704
510 Ga0450907_015927 3300042146 Bacteria 1253
511 Ga0439446_0007150 3300042156 Bacteria 2928
512 Ga0439434_0047335 3300042435 Bacteria 1328
513 Ga0439464_0026721 3300042439 Bacteria 1602
514 Ga0466969_0038176 3300044656 Bacteria 2418
515 Ga0466969_0098588 3300044656 Bacteria 1378
516 Ga0466972_0040707 3300044658 Bacteria 2263
517 Ga0466972_0134952 3300044658 Bacteria 1162
518 Ga0466972_0147407 3300044658 Bacteria 1107
519 Ga0466965_0018748 3300044683 Bacteria 3320
520 Ga0466965_0047295 3300044683 Bacteria 2130
521 Ga0466965_0056454 3300044683 Bacteria 1955
522 Ga0466965_0059510 3300044683 Bacteria 1907
523 Ga0466966_0028816 3300044684 Bacteria 3615
524 Ga0466966_0066102 3300044684 Bacteria 2273
525 Ga0466966_0074133 3300044684 Bacteria 2128
526 Ga0466961_0010808 3300044693 Bacteria 5830
527 Ga0466961_0024561 3300044693 Bacteria 3877
528 Ga0466961_0032099 3300044693 Bacteria 3375
529 Ga0466961_0235003 3300044693 Bacteria 1127
530 Ga0466961_0282228 3300044693 Bacteria 1016
531 Ga0466963_0091226 3300044694 Bacteria 2075
532 Ga0466963_0101303 3300044694 Bacteria 1972
533 Ga0466963_0104822 3300044694 Bacteria 1938
534 Ga0466963_0167581 3300044694 Bacteria 1530
535 Ga0466964_0002463 3300044706 Bacteria 6577
536 Ga0466964_0067283 3300044706 Bacteria 1506
537 Ga0453684_0029935 3300044712 Bacteria 7709
538 Ga0466971_0005451 3300044719 Bacteria 5521
539 Ga0466971_0019229 3300044719 Bacteria 3032
540 Ga0466968_0057896 3300044735 Bacteria 1667
541 Ga0466970_0003597 3300044765 Bacteria 7558
542 Ga0466970_0006898 3300044765 Bacteria 5686
543 Ga0466970_0010213 3300044765 Bacteria 4758
544 Ga0466970_0038490 3300044765 Bacteria 2537
545 Ga0466970_0047490 3300044765 Bacteria 2288
546 Ga0466970_0048238 3300044765 Bacteria 2270
547 Ga0466970_0079816 3300044765 Bacteria 1767
548 Ga0466970_0130462 3300044765 Bacteria 1380
549 Ga0466970_0213390 3300044765 Bacteria 1076
550 Ga0466970_0226034 3300044765 Bacteria 1045
551 Ga0466957_0060381 3300044842 Bacteria 2325
552 Ga0466957_0104957 3300044842 Bacteria 1785
553 Ga0466957_0537814 3300044842 Bacteria 813
554 Ga0466960_0000528 3300044901 Bacteria 13102
555 Ga0466960_0004086 3300044901 Bacteria 5671
556 Ga0466960_0018199 3300044901 Bacteria 3075
557 Ga0466960_0020794 3300044901 Bacteria 2913
558 Ga0466960_0179474 3300044901 Bacteria 1147
559 Ga0466959_0002006 3300045049 Bacteria 12841
560 Ga0466959_0071713 3300045049 Bacteria 2508
561 Ga0466959_0092898 3300045049 Bacteria 2166
562 Ga0466959_0322624 3300045049 Bacteria 1056
563 Ga0466958_0087273 3300045836 Bacteria 1926
564 Ga0466958_0188949 3300045836 Bacteria 1309
565 Ga0466967_0060849 3300045976 Bacteria 3348
566 Ga0466967_0087613 3300045976 Bacteria 2823
567 Ga0466967_0107759 3300045976 Bacteria 2556
568 Ga0466967_0180153 3300045976 Bacteria 1993
569 Ga0466967_0210904 3300045976 Bacteria 1842
570 Ga0466967_0241880 3300045976 Bacteria 1722
571 Ga0466967_0491483 3300045976 Bacteria 1203
572 Ga0466967_0522640 3300045976 Bacteria 1166
573 Ga0495592_0014634 3300046454 Bacteria 5955
574 Ga0495592_0120924 3300046454 Bacteria 1842
575 Ga0495603_0001542 3300046455 Bacteria 13475
576 Ga0495629_0009091 3300046459 Bacteria 7278
577 Ga0495629_0095322 3300046459 Bacteria 2076
578 Ga0495641_0009648 3300046461 Bacteria 5709
579 Ga0495641_0015388 3300046461 Bacteria 4087
580 Ga0495641_0039930 3300046461 Bacteria 2185
581 Ga0495641_0093999 3300046461 Bacteria 1339
582 Ga0495651_0059452 3300046462 Bacteria 2930
583 Ga0495651_0080028 3300046462 Bacteria 2468
584 Ga0495653_0029872 3300046463 Bacteria 4344
585 Ga0495650_0000702 3300046471 Bacteria 42949
586 Ga0495580_0092637 3300046472 Bacteria 2103
587 Ga0495582_0033962 3300046473 Bacteria 2804
588 Ga0495639_0001019 3300046475 Bacteria 12672
589 Ga0495662_0001001 3300046476 Bacteria 13829
590 Ga0495664_0001381 3300046477 Bacteria 12822
591 Ga0495664_0066644 3300046477 Bacteria 2147
592 Ga0495664_0305809 3300046477 Bacteria 960
593 Ga0495594_0015381 3300046499 Bacteria 4019
594 Ga0495608_0016336 3300046511 Bacteria 5135
595 Ga0495618_0020849 3300046514 Bacteria 4034
596 Ga0495618_0032056 3300046514 Bacteria 3291
597 Ga0495618_0079458 3300046514 Bacteria 2092
598 Ga0495618_0166591 3300046514 Bacteria 1403
599 Ga0495628_0078730 3300046516 Bacteria 2563
600 Ga0495628_0153270 3300046516 Bacteria 1754
601 Ga0495628_0401921 3300046516 Bacteria 1000
602 Ga0495630_0001525 3300046517 Bacteria 16047
603 Ga0495630_0045401 3300046517 Bacteria 3283
604 Ga0495666_0005147 3300046526 Bacteria 6608
605 Ga0495652_0102575 3300046529 Bacteria 2317
606 Ga0495652_0137957 3300046529 Bacteria 1921
607 Ga0495665_0003599 3300046531 Bacteria 8410
608 Ga0495665_0024404 3300046531 Bacteria 3248
609 Ga0495640_0070817 3300046533 Bacteria 2341
610 Ga0495640_0280571 3300046533 Bacteria 1037
611 Ga0495586_0024803 3300046535 Bacteria 3206
612 Ga0495587_0050043 3300046536 Bacteria 2472
613 Ga0495587_0083884 3300046536 Bacteria 1846
614 Ga0495645_0004607 3300046543 Bacteria 9411
615 Ga0495645_0043472 3300046543 Bacteria 3277
616 Ga0495667_0033861 3300046559 Bacteria 3417
617 Ga0495667_0099489 3300046559 Bacteria 1882
618 Ga0495634_0014957 3300046642 Bacteria 5579
619 Ga0495634_0064680 3300046642 Bacteria 2424
620 Ga0495634_0333711 3300046642 Bacteria 911
621 Ga0495635_0001647 3300046663 Bacteria 15061
622 Ga0495635_0071456 3300046663 Bacteria 2378
623 Ga0495635_0078034 3300046663 Bacteria 2268
624 Ga0495588_0067071 3300046674 Bacteria 1862
625 Ga0495657_0033202 3300046675 Bacteria 3594
626 Ga0495657_0034902 3300046675 Bacteria 3490
627 Ga0495599_0092889 3300046678 Bacteria 1882
628 Ga0495599_0132695 3300046678 Bacteria 1546
629 Ga0495623_0006098 3300046679 Bacteria 7840
630 Ga0495646_0091542 3300046680 Bacteria 1754
631 Ga0495647_0003977 3300046681 Bacteria 4771
632 Ga0495647_0099096 3300046681 Bacteria 1205
633 Ga0495658_0001135 3300046683 Bacteria 14067
634 Ga0495613_0039267 3300046689 Bacteria 3509
635 Ga0495624_0010905 3300046690 Bacteria 6265
636 Ga0495624_0019973 3300046690 Bacteria 4464
637 Ga0495624_0357850 3300046690 Bacteria 878
638 Ga0495670_0145463 3300046691 Bacteria 1242
639 Ga0495600_0004762 3300046809 Bacteria 8140
640 Ga0495581_0000621 3300047315 Bacteria 18604
641 Ga0495581_0202462 3300047315 Bacteria 1161
642 Ga0495604_0078764 3300047317 Bacteria 2472
643 Ga0495604_0080068 3300047317 Bacteria 2448
644 Ga0495674_0001430 3300047319 Bacteria 23388
645 Ga0495674_0044503 3300047319 Bacteria 3946
646 Ga0495674_0170653 3300047319 Bacteria 1815
647 Ga0495676_0001791 3300047321 Bacteria 18771
648 Ga0495676_0047778 3300047321 Bacteria 3456
649 Ga0495680_0043195 3300047322 Bacteria 3570
650 Ga0495680_0045877 3300047322 Bacteria 3448
651 Ga0495680_0047836 3300047322 Bacteria 3361
652 Ga0495680_0060752 3300047322 Bacteria 2911
653 Ga0495675_0034315 3300047444 Bacteria 3239
654 Ga0495675_0108117 3300047444 Bacteria 1737
655 Ga0495684_0019054 3300047471 Bacteria 5283
656 Ga0495684_0031990 3300047471 Bacteria 4038
657 Ga0495684_0049805 3300047471 Bacteria 3200
658 Ga0495593_0004888 3300047673 Bacteria 7952
659 Ga0495602_0022328 3300048088 Bacteria 6196
660 Ga0495602_0086282 3300048088 Bacteria 2620
661 Ga0495602_0212140 3300048088 Bacteria 1468
662 Ga0495614_0014075 3300048089 Bacteria 3507
663 Ga0496100_0155326 3300048903 Bacteria 1636
664 Ga0496100_0233110 3300048903 Bacteria 1355
665 Ga0496100_0257311 3300048903 Bacteria 1293
666 Ga0496100_0428566 3300048903 Bacteria 1011
667 Ga0496101_0038871 3300048904 Bacteria 3381
668 Ga0496101_0053929 3300048904 Bacteria 2902
669 Ga0496101_0443424 3300048904 Bacteria 1024
670 Ga0496102_0011688 3300048905 Bacteria 7577
671 Ga0496102_0015865 3300048905 Bacteria 6570
672 Ga0496102_0043775 3300048905 Bacteria 4061
673 Ga0496102_0636600 3300048905 Bacteria 989
674 Ga0496103_0002876 3300048906 Bacteria 10691
675 Ga0496103_0058264 3300048906 Bacteria 2399
676 Ga0496103_0293758 3300048906 Bacteria 1045
677 Ga0496104_0041192 3300048907 Bacteria 4330
678 Ga0496104_0080867 3300048907 Bacteria 3098
679 Ga0496104_0758063 3300048907 Bacteria 877
680 Ga0496104_0762041 3300048907 Bacteria 875
681 Ga0496105_0085711 3300048908 Bacteria 2603
682 Ga0496105_0100662 3300048908 Bacteria 2386
683 Ga0496105_0228083 3300048908 Bacteria 1514
684 Ga0496106_0218851 3300048909 Bacteria 1518
685 Ga0496107_0184584 3300048910 Bacteria 1549
686 Ga0496107_0253879 3300048910 Bacteria 1308
687 Ga0496108_0032801 3300048911 Bacteria 4313
688 Ga0496108_0034423 3300048911 Bacteria 4209
689 Ga0496108_0183013 3300048911 Bacteria 1815
690 Ga0496109_0012037 3300048912 Bacteria 7452
691 Ga0496109_0106752 3300048912 Bacteria 2601
692 Ga0496109_0148022 3300048912 Bacteria 2197
693 Ga0496109_0176383 3300048912 Bacteria 2006
694 Ga0496109_0289847 3300048912 Bacteria 1543
695 Ga0496109_0370241 3300048912 Bacteria 1353
696 Ga0496110_0024974 3300048913 Bacteria 5100
697 Ga0496110_0051777 3300048913 Bacteria 3608
698 Ga0496110_0106428 3300048913 Bacteria 2517
699 Ga0496110_0462075 3300048913 Bacteria 1157
700 Ga0496111_0009560 3300048914 Bacteria 6478
701 Ga0496111_0092189 3300048914 Bacteria 2220
702 Ga0496111_0177208 3300048914 Bacteria 1584
703 Ga0496111_0289223 3300048914 Bacteria 1215
704 Ga0496112_0006741 3300048915 Bacteria 10117
705 Ga0496112_0047690 3300048915 Bacteria 4202
706 Ga0496112_0238116 3300048915 Bacteria 1773
707 Ga0496113_0238698 3300048916 Bacteria 1450
708 Ga0496113_0427798 3300048916 Bacteria 1064
709 Ga0496114_0005838 3300048917 Bacteria 9667
710 Ga0496114_0006548 3300048917 Bacteria 9180
711 Ga0496114_0018839 3300048917 Bacteria 5589
712 Ga0496114_0057665 3300048917 Bacteria 3242
713 Ga0496114_0096703 3300048917 Bacteria 2514
714 Ga0496114_0137086 3300048917 Bacteria 2116
715 Ga0496114_0143372 3300048917 Bacteria 2070
716 Ga0496114_0179282 3300048917 Bacteria 1849
717 Ga0496114_0306276 3300048917 Bacteria 1403
718 Ga0496114_0329178 3300048917 Bacteria 1350
719 Ga0496114_0356295 3300048917 Bacteria 1294
720 Ga0496114_0385358 3300048917 Bacteria 1241
721 Ga0496114_0440598 3300048917 Bacteria 1154
722 Ga0496114_0462954 3300048917 Bacteria 1122
723 Ga0496114_0466478 3300048917 Bacteria 1118
724 Ga0496115_0043254 3300048918 Bacteria 3592
725 Ga0496115_0090499 3300048918 Bacteria 2499
726 Ga0496115_0186105 3300048918 Bacteria 1716
727 Ga0496117_0029237 3300048920 Bacteria 4252
728 Ga0496118_0035053 3300048921 Bacteria 4083
729 Ga0496119_0001675 3300048922 Bacteria 25909
730 Ga0496119_0032727 3300048922 Bacteria 3461
731 Ga0496119_0102138 3300048922 Bacteria 1608
732 Ga0496120_0024499 3300048923 Bacteria 3762
733 Ga0496120_0093505 3300048923 Bacteria 1602
734 Ga0496124_0253126 3300048927 Bacteria 1301
735 Ga0496126_0239668 3300048929 Bacteria 1516
736 Ga0496126_0298325 3300048929 Bacteria 1330
737 Ga0496126_0426082 3300048929 Bacteria 1072
738 Ga0501031_0015189 3300049568 Bacteria 4999
739 Ga0501031_0212989 3300049568 Bacteria 1259
740 Ga0501031_0232436 3300049568 Bacteria 1200
741 Ga0501032_0140581 3300049569 Bacteria 1590
742 Ga0501032_0271348 3300049569 Bacteria 1099
743 Ga0501033_0003981 3300049570 Bacteria 11962
744 Ga0501033_0200435 3300049570 Bacteria 1426
745 Ga0501034_0005065 3300049571 Bacteria 14477
746 Ga0501034_0008156 3300049571 Bacteria 11105
747 Ga0501034_0019848 3300049571 Bacteria 6867
748 Ga0501034_0646506 3300049571 Bacteria 960
749 Ga0501036_0008211 3300049572 Bacteria 8559
750 Ga0501036_0008607 3300049572 Bacteria 8371
751 Ga0501036_0013280 3300049572 Bacteria 6838
752 Ga0501036_0027720 3300049572 Bacteria 4787
753 Ga0501036_0028967 3300049572 Bacteria 4679
754 Ga0501036_0175033 3300049572 Bacteria 1807
755 Ga0501036_0223756 3300049572 Bacteria 1580
756 Ga0501036_0505710 3300049572 Bacteria 1005
757 Ga0501037_0025612 3300049573 Bacteria 4358
758 Ga0501037_0080981 3300049573 Bacteria 2354
759 Ga0501037_0123987 3300049573 Bacteria 1856
760 Ga0501037_0214994 3300049573 Bacteria 1354
761 Ga0501038_0017389 3300049574 Bacteria 6499
762 Ga0501038_0035695 3300049574 Bacteria 4364
763 Ga0501038_0040013 3300049574 Bacteria 4097
764 Ga0501038_0042352 3300049574 Bacteria 3965
765 Ga0501038_0619217 3300049574 Bacteria 817
766 Ga0501039_0037135 3300049575 Bacteria 3760
767 Ga0501039_0043657 3300049575 Bacteria 3462
768 Ga0501039_0087312 3300049575 Bacteria 2429
769 Ga0501039_0355941 3300049575 Bacteria 1150
770 Ga0501039_0430367 3300049575 Bacteria 1036
771 Ga0501040_0234028 3300049576 Bacteria 1308
772 Ga0501040_0267544 3300049576 Bacteria 1220
773 Ga0501040_0356969 3300049576 Bacteria 1047
774 Ga0501041_0245354 3300049577 Bacteria 1125
775 Ga0501042_0009659 3300049578 Bacteria 6442
776 Ga0501042_0116547 3300049578 Bacteria 1923
777 Ga0501042_0136702 3300049578 Bacteria 1767
778 Ga0501042_0139076 3300049578 Bacteria 1750
779 Ga0501043_0010516 3300049579 Bacteria 7246
780 Ga0501043_0106695 3300049579 Bacteria 2200
781 Ga0501043_0110306 3300049579 Bacteria 2160
782 Ga0501043_0134887 3300049579 Bacteria 1934
783 Ga0501046_0000566 3300049580 Bacteria 36605
784 Ga0501046_0002036 3300049580 Bacteria 19203
785 Ga0501046_0004086 3300049580 Bacteria 13304
786 Ga0501046_0108367 3300049580 Bacteria 2124
787 Ga0501047_0017471 3300049581 Bacteria 6871
788 Ga0501047_0081025 3300049581 Bacteria 3120
789 Ga0501047_0122557 3300049581 Bacteria 2481
790 Ga0501047_0523338 3300049581 Bacteria 1011
791 Ga0501048_0010210 3300049582 Bacteria 7021
792 Ga0501048_0027539 3300049582 Bacteria 4129
793 Ga0501048_0032249 3300049582 Bacteria 3786
794 Ga0501048_0054767 3300049582 Bacteria 2833
795 Ga0501048_0111534 3300049582 Bacteria 1931
796 Ga0501067_0000937 3300049583 Bacteria 15633
797 Ga0501067_0001083 3300049583 Bacteria 14679
798 Ga0501067_0043910 3300049583 Bacteria 2483
799 Ga0501067_0072027 3300049583 Bacteria 1914
800 Ga0501067_0211074 3300049583 Bacteria 1081
801 Ga0501068_0032931 3300049584 Bacteria 3084
802 Ga0501068_0116994 3300049584 Bacteria 1660
803 Ga0501068_0189429 3300049584 Bacteria 1302
804 Ga0501069_0061108 3300049585 Bacteria 2103
805 Ga0501069_0117466 3300049585 Bacteria 1518
806 Ga0501070_0004523 3300049586 Bacteria 11933
807 Ga0501070_0014917 3300049586 Bacteria 6535
808 Ga0501070_0025886 3300049586 Bacteria 4922
809 Ga0501070_0092430 3300049586 Bacteria 2504
810 Ga0501070_0156848 3300049586 Bacteria 1877
811 Ga0501070_0347371 3300049586 Bacteria 1204
812 Ga0501070_0405570 3300049586 Bacteria 1102
813 Ga0501071_0012339 3300049587 Bacteria 5794
814 Ga0501071_0365096 3300049587 Bacteria 1100
815 Ga0501071_0440620 3300049587 Bacteria 997
816 Ga0501072_0007300 3300049588 Bacteria 8382
817 Ga0501072_0144642 3300049588 Bacteria 1896
818 Ga0501072_0181169 3300049588 Bacteria 1680
819 Ga0501073_0001438 3300049589 Bacteria 17600
820 Ga0501073_0026638 3300049589 Bacteria 4140
821 Ga0501074_0002081 3300049590 Bacteria 13828
822 Ga0501074_0015528 3300049590 Bacteria 5535
823 Ga0501074_0026756 3300049590 Bacteria 4182
824 Ga0501074_0065720 3300049590 Bacteria 2610
825 Ga0501076_0039234 3300049592 Bacteria 3718
826 Ga0501076_0262274 3300049592 Bacteria 1415
827 Ga0501076_0340354 3300049592 Bacteria 1231
828 Ga0501077_0007040 3300049593 Bacteria 6936
829 Ga0501077_0151572 3300049593 Bacteria 1471
830 Ga0501079_0112992 3300049741 Bacteria 2111
831 Ga0501079_0319524 3300049741 Bacteria 1215
832 Ga0501080_0009062 3300049742 Bacteria 9057
833 Ga0501080_0016540 3300049742 Bacteria 6815
834 Ga0501080_0056688 3300049742 Bacteria 3648
835 Ga0501080_0133283 3300049742 Bacteria 2300
836 Ga0501080_0167300 3300049742 Bacteria 2029
837 Ga0501081_0431911 3300049743 Bacteria 977
838 Ga0501083_0033984 3300049744 Bacteria 3488
839 Ga0501035_0007226 3300049822 Bacteria 10390
840 Ga0501035_0043976 3300049822 Bacteria 4024
841 Ga0501035_0047183 3300049822 Bacteria 3869
842 Ga0501044_0001740 3300049823 Bacteria 25430
843 Ga0501044_0027073 3300049823 Bacteria 6066
844 Ga0501044_0046494 3300049823 Bacteria 4492
845 Ga0501045_0007627 3300049824 Bacteria 7521
846 Ga0501045_0045049 3300049824 Bacteria 3212
847 Ga0501045_0305520 3300049824 Bacteria 1184
848 nmdc:mga03n38_101440_c1 3300050490 Bacteria 1388
849 nmdc:mga03n38_12549_c1 3300050490 Bacteria 3193
850 nmdc:mga03n38_16877_c1 3300050490 Bacteria 2849
851 nmdc:mga03n38_182_c1 3300050490 Bacteria 14160
852 nmdc:mga03n38_52576_c1 3300050490 Bacteria 1824
853 nmdc:mga03n38_83309_c1 3300050490 Bacteria 1508
854 nmdc:mga00v17_103515_c1 3300050491 Bacteria 1799
855 nmdc:mga00v17_15986_c1 3300050491 Bacteria 4224
856 nmdc:mga00v17_222875_c1 3300050491 Bacteria 1221
857 nmdc:mga00v17_4761_c1 3300050491 Bacteria 7102
858 nmdc:mga00v17_76350_c1 3300050491 Bacteria 2084
859 nmdc:mga00v17_84397_c1 3300050491 Bacteria 1988
860 nmdc:mga00v17_938_c1 3300050491 Bacteria 15668
861 nmdc:mga00v17_9434_c1 3300050491 Bacteria 5281
862 nmdc:mga0yw44_23554_c1 3300050492 Bacteria 3471
863 nmdc:mga0yw44_2602_c1 3300050492 Bacteria 7754
864 nmdc:mga0yw44_30881_c1 3300050492 Bacteria 3111
865 nmdc:mga0yw44_434524_c1 3300050492 Bacteria 889
866 nmdc:mga0yw44_4605_c1 3300050492 Bacteria 6360
867 nmdc:mga0yw44_73996_c1 3300050492 Bacteria 2121
868 nmdc:mga0yw44_8410_c1 3300050492 Bacteria 5141
869 nmdc:mga0yw44_97024_c1 3300050492 Bacteria 1872
870 nmdc:mga06z11_101722_c1 3300050494 Bacteria 1578
871 nmdc:mga06z11_59730_c1 3300050494 Bacteria 1983
872 nmdc:mga06z11_81385_c1 3300050494 Bacteria 1738
873 nmdc:mga04h51_7926_c1 3300050495 Bacteria 2825
874 nmdc:mga07m45_16037_c1 3300050496 Bacteria 4010
875 nmdc:mga07m45_20267_c1 3300050496 Bacteria 3612
876 nmdc:mga07m45_43084_c2 3300050496 Bacteria 995
877 nmdc:mga05p37_688_c1 3300050507 Bacteria 37481
878 nmdc:mga05p37_947_c1 3300050507 Bacteria 32746
879 nmdc:mga09592_38_c2 3300050508 Bacteria 42368
880 nmdc:mga09592_48606_c1 3300050508 Bacteria 3576
881 nmdc:mga0qj67_110810_c1 3300050509 Bacteria 2216
882 nmdc:mga0qj67_31_c2 3300050509 Bacteria 11004
883 nmdc:mga06r32_19_c1 3300050510 Bacteria 98901
884 nmdc:mga06r32_282_c1 3300050510 Bacteria 42388
885 Ga0495601_0009096 3300053077 Bacteria 5865
886 Ga0495601_0040369 3300053077 Bacteria 2923
887 Ga0495601_0070549 3300053077 Bacteria 2230
888 Ga0495601_0192570 3300053077 Bacteria 1332
889 Ga0495612_0025097 3300053078 Bacteria 2393
890 Ga0495595_0028265 3300053084 Bacteria 2504
891 Ga0495619_0007037 3300053085 Bacteria 7117
892 Ga0495619_0016103 3300053085 Bacteria 4732
893 Ga0495619_0457374 3300053085 Bacteria 880
894 Ga0500644_0000009 3300053088 Bacteria 127269
895 Ga0500651_0000647 3300053093 Bacteria 17374
896 Ga0500660_164739 3300053100 Bacteria 832
897 Ga0500554_030903 3300053102 Bacteria 1577
898 Ga0500554_065185 3300053102 Bacteria 1176
899 Ga0500556_0001531 3300053104 Bacteria 9469
900 Ga0500593_000177 3300053117 Bacteria 25732
901 Ga0500559_0045296 3300053136 Bacteria 1925
902 Ga0500568_0001114 3300053139 Bacteria 18032
903 Ga0500573_0049081 3300053140 Bacteria 2429
904 Ga0500573_0102212 3300053140 Bacteria 1612
905 Ga0500590_006392 3300053148 Bacteria 5740
906 Ga0500616_0000463 3300053153 Bacteria 52811
907 Ga0500616_0001506 3300053153 Bacteria 21995
908 Ga0501084_0013685 3300054114 Bacteria 6716
909 Ga0501082_0023488 3300060353 Bacteria 5320
910 Ga0501082_0252637 3300060353 Bacteria 1534
911 Ga0466962_0003718 3300061719 Bacteria 7279
912 Ga0466962_0121126 3300061719 Bacteria 1262
913 Ga0530510_0181576 3300061734 Bacteria 1561
914 Ga0530510_0424942 3300061734 Bacteria 1003

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10064450 Ga0065714_1006445038 209
2 3300013297 Ga0157378_10498882 Ga0157378_104988821 216
3 3300031728 Ga0316578_10206613 Ga0316578_102066132 218
4 3300035398 Ga0316574_0115910 Ga0316574_0115910_131_880 218
5 3300005563 Ga0068855_100777547 Ga0068855_1007775471 223
6 3300032004 Ga0307414_10028339 Ga0307414_100283393 223
7 3300013308 Ga0157375_10275722 Ga0157375_102757222 228
8 3300048905 Ga0496102_0015865 Ga0496102_0015865_5655_6401 228
9 3300048906 Ga0496103_0002876 Ga0496103_0002876_154_900 228
10 3300048907 Ga0496104_0080867 Ga0496104_0080867_1102_1848 228
11 3300048908 Ga0496105_0100662 Ga0496105_0100662_958_1704 228
12 3300048917 Ga0496114_0096703 Ga0496114_0096703_1598_2344 228
13 3300048918 Ga0496115_0090499 Ga0496115_0090499_418_1164 228
14 3300048922 Ga0496119_0032727 Ga0496119_0032727_2654_3400 228
15 3300044712 Ga0453684_0029935 Ga0453684_0029935_861_1589 231
16 3300045976 Ga0466967_0060849 Ga0466967_0060849_1023_1733 231
17 iso_pu_bacteria 2643221576 2643888969 231
18 iso_pu_bacteria 2643221590 2643958024 231
19 3300005356 Ga0070674_100121364 Ga0070674_1001213641 232
20 3300025937 Ga0207669_10367607 Ga0207669_103676072 232
21 3300041512 Ga0451853_0001627 Ga0451853_0001627_59_784 232
22 3300005985 Ga0081539_10092132 Ga0081539_100921322 233
23 3300037418 Ga0395900_0400287 Ga0395900_0400287_63_782 233
24 3300037466 Ga0395898_0141403 Ga0395898_0141403_995_1714 233
25 3300037471 Ga0395905_0007654 Ga0395905_0007654_9228_9947 233
26 3300003203 JGI25406J46586_10010786 JGI25406J46586_100107863 234
27 3300003203 JGI25406J46586_10016391 JGI25406J46586_100163913 234
28 3300005985 Ga0081539_10000728 Ga0081539_100007288 234
29 3300005985 Ga0081539_10001334 Ga0081539_1000133412 234
30 3300021384 Ga0213876_10100757 Ga0213876_101007572 234
31 3300031911 Ga0307412_10642861 Ga0307412_106428612 234
32 3300032126 Ga0307415_100112687 Ga0307415_1001126872 234
33 3300039437 Ga0436365_1820644 Ga0436365_1820644_347_1069 234
34 3300053153 Ga0500616_0001506 Ga0500616_0001506_859_1581 234
35 3300005290 Ga0065712_10008640 Ga0065712_100086401 235
36 3300005338 Ga0068868_100021449 Ga0068868_1000214493 235
37 3300005355 Ga0070671_100248582 Ga0070671_1002485822 235
38 3300005364 Ga0070673_100151454 Ga0070673_1001514543 235
39 3300005445 Ga0070708_100000330 Ga0070708_10000033022 235
40 3300005456 Ga0070678_100222966 Ga0070678_1002229662 235
41 3300005466 Ga0070685_10374641 Ga0070685_103746412 235
42 3300005467 Ga0070706_100017306 Ga0070706_1000173061 235
43 3300005468 Ga0070707_100042667 Ga0070707_1000426674 235
44 3300005471 Ga0070698_100171381 Ga0070698_1001713811 235
45 3300005518 Ga0070699_100000914 Ga0070699_10000091415 235
46 3300005536 Ga0070697_100043038 Ga0070697_1000430384 235
47 3300005548 Ga0070665_100070157 Ga0070665_1000701573 235
48 3300005564 Ga0070664_100168461 Ga0070664_1001684611 235
49 3300005617 Ga0068859_100004174 Ga0068859_1000041744 235
50 3300005618 Ga0068864_100031732 Ga0068864_1000317326 235
51 3300005618 Ga0068864_100305102 Ga0068864_1003051022 235
52 3300005842 Ga0068858_100035292 Ga0068858_1000352925 235
53 3300005843 Ga0068860_100044109 Ga0068860_1000441094 235
54 3300006237 Ga0097621_100028408 Ga0097621_1000284083 235
55 3300006358 Ga0068871_100021352 Ga0068871_1000213524 235
56 3300006931 Ga0097620_100004174 Ga0097620_10000417415 235
57 3300009176 Ga0105242_10587153 Ga0105242_105871532 235
58 3300009177 Ga0105248_10013752 Ga0105248_100137526 235
59 3300013296 Ga0157374_10099734 Ga0157374_100997344 235
60 3300013297 Ga0157378_10304166 Ga0157378_103041662 235
61 3300013306 Ga0163162_10000646 Ga0163162_1000064615 235
62 3300013308 Ga0157375_10006748 Ga0157375_1000674810 235
63 3300013308 Ga0157375_10538778 Ga0157375_105387781 235
64 3300014325 Ga0163163_10023922 Ga0163163_100239224 235
65 3300014325 Ga0163163_10117210 Ga0163163_101172102 235
66 3300014969 Ga0157376_10045102 Ga0157376_100451022 235
67 3300014969 Ga0157376_10475073 Ga0157376_104750731 235
68 3300025910 Ga0207684_10168280 Ga0207684_101682802 235
69 3300025910 Ga0207684_10489089 Ga0207684_104890891 235
70 3300025931 Ga0207644_10225731 Ga0207644_102257313 235
71 3300025941 Ga0207711_10156093 Ga0207711_101560933 235
72 3300025942 Ga0207689_10026504 Ga0207689_100265045 235
73 3300025945 Ga0207679_10605007 Ga0207679_106050071 235
74 3300025960 Ga0207651_10113870 Ga0207651_101138702 235
75 3300025986 Ga0207658_10023727 Ga0207658_100237273 235
76 3300026095 Ga0207676_10028744 Ga0207676_100287443 235
77 3300028381 Ga0268264_10136939 Ga0268264_101369392 235
78 3300053085 Ga0495619_0457374 Ga0495619_0457374_19_744 235
79 iso_pu_bacteria 2675903060 2676487850 235
80 iso_pu_bacteria 2738541272 2738692305 235
81 iso_pu_bacteria 2738543027 2739323389 235
82 iso_pu_bacteria 2739367654 2739609165 235
83 iso_pu_bacteria 2758568522 2760303388 235
84 iso_pu_bacteria 2758568621 2760622716 235
85 iso_pu_bacteria 2808606394 2809027505 235
86 iso_pu_bacteria 2856741275 2856746553 235
87 iso_pu_bacteria 2856741275 2856747054 235
88 iso_pu_bacteria 2863067949 2863071322 235
89 iso_pu_bacteria 2866552031 2866552446 235
90 iso_pu_bacteria 2866612099 2866615166 235
91 iso_pu_bacteria 2873314349 2873320728 235
92 iso_pu_bacteria 2884693830 2884697623 235
93 iso_pu_bacteria 2891395885 2891403000 235
94 iso_pu_bacteria 2891554331 2891554677 235
95 iso_pu_bacteria 2891562705 2891569668 235
96 iso_pu_bacteria 2895427314 2895438187 235
97 iso_pu_bacteria 2895442618 2895447583 235
98 iso_pu_bacteria 8055066027 8055066854 235
99 iso_pu_bacteria 8055172936 8055178864 235
100 iso_pu_bacteria 8056207758 8056212386 235
101 iso_pu_bacteria 8056579771 8056584210 235
102 3300005445 Ga0070708_100880566 Ga0070708_1008805661 236
103 3300009551 Ga0105238_10491700 Ga0105238_104917002 236
104 3300026078 Ga0207702_10106187 Ga0207702_101061872 236
105 3300031727 Ga0316576_10073392 Ga0316576_100733922 236
106 3300044658 Ga0466972_0040707 Ga0466972_0040707_1244_1975 236
107 3300044683 Ga0466965_0059510 Ga0466965_0059510_31_762 236
108 3300044901 Ga0466960_0004086 Ga0466960_0004086_2750_3481 236
109 3300046471 Ga0495650_0000702 Ga0495650_0000702_20115_20852 236
110 iso_pu_bacteria 2643221572 2643877905 236
111 iso_pu_bacteria 2643221669 2644384960 236
112 iso_pu_bacteria 2852677369 2852680387 236
113 3300005530 Ga0070679_100267296 Ga0070679_1002672962 237
114 3300005548 Ga0070665_100054031 Ga0070665_1000540313 237
115 3300006048 Ga0075363_100084389 Ga0075363_1000843892 237
116 3300006051 Ga0075364_10209326 Ga0075364_102093261 237
117 3300006178 Ga0075367_10087304 Ga0075367_100873042 237
118 3300009177 Ga0105248_10194062 Ga0105248_101940622 237
119 3300014325 Ga0163163_10464547 Ga0163163_104645472 237
120 3300014326 Ga0157380_10322101 Ga0157380_103221012 237
121 3300020081 Ga0206354_10817771 Ga0206354_108177712 237
122 3300025900 Ga0207710_10119330 Ga0207710_101193302 237
123 3300025917 Ga0207660_10270256 Ga0207660_102702562 237
124 3300025921 Ga0207652_10527328 Ga0207652_105273282 237
125 3300025928 Ga0207700_10215306 Ga0207700_102153063 237
126 3300026088 Ga0207641_10120500 Ga0207641_101205003 237
127 3300028379 Ga0268266_10307389 Ga0268266_103073891 237
128 3300030732 Ga0316176_1191746 Ga0316176_11917462 237
129 3300030733 Ga0314311_1041561 Ga0314311_10415612 237
130 3300030734 Ga0316179_1043364 Ga0316179_10433642 237
131 3300030744 Ga0316181_1131546 Ga0316181_11315461 237
132 3300046459 Ga0495629_0095322 Ga0495629_0095322_935_1666 237
133 3300046642 Ga0495634_0333711 Ga0495634_0333711_59_787 237
134 3300048907 Ga0496104_0758063 Ga0496104_0758063_103_846 237
135 3300048915 Ga0496112_0006741 Ga0496112_0006741_2722_3465 237
136 3300048915 Ga0496112_0047690 Ga0496112_0047690_2326_3084 237
137 3300048916 Ga0496113_0238698 Ga0496113_0238698_137_880 237
138 3300049586 Ga0501070_0405570 Ga0501070_0405570_247_981 237
139 3300050490 nmdc:mga03n38_83309_c1 nmdc:mga03n38_83309_c1_596_1324 237
140 3300050491 nmdc:mga00v17_84397_c1 nmdc:mga00v17_84397_c1_468_1196 237
141 3300050492 nmdc:mga0yw44_30881_c1 nmdc:mga0yw44_30881_c1_999_1727 237
142 iso_pu_bacteria 2643221615 2644089564 237
143 iso_pu_bacteria 2643221617 2644098867 237
144 iso_pu_bacteria 2643221620 2644114748 237
145 iso_pu_bacteria 2643221657 2644319409 237
146 iso_pu_bacteria 2643221697 2644537298 237
147 iso_pu_bacteria 2738541305 2738868082 237
148 iso_pu_bacteria 2773857762 2774393363 237
149 iso_pu_bacteria 2808606439 2809195748 237
150 iso_pu_bacteria 2811994874 2812332403 237
151 iso_pu_bacteria 2811994878 2812350646 237
152 iso_pu_bacteria 2816332119 2816425411 237
153 iso_pu_bacteria 2891968417 2891971754 237
154 iso_pu_bacteria 2932431166 2932433626 237
155 3300005327 Ga0070658_10002446 Ga0070658_100024462 238
156 3300005327 Ga0070658_10074477 Ga0070658_100744774 238
157 3300005327 Ga0070658_10102337 Ga0070658_101023373 238
158 3300005329 Ga0070683_100003754 Ga0070683_10000375410 238
159 3300005336 Ga0070680_100098517 Ga0070680_1000985172 238
160 3300005337 Ga0070682_100062608 Ga0070682_1000626083 238
161 3300005337 Ga0070682_100087650 Ga0070682_1000876503 238
162 3300005337 Ga0070682_100095566 Ga0070682_1000955662 238
163 3300005338 Ga0068868_100007705 Ga0068868_1000077057 238
164 3300005339 Ga0070660_100005438 Ga0070660_1000054386 238
165 3300005339 Ga0070660_100020239 Ga0070660_1000202392 238
166 3300005339 Ga0070660_100369661 Ga0070660_1003696611 238
167 3300005339 Ga0070660_100614894 Ga0070660_1006148941 238
168 3300005343 Ga0070687_100256643 Ga0070687_1002566432 238
169 3300005345 Ga0070692_10027293 Ga0070692_100272934 238
170 3300005345 Ga0070692_10040097 Ga0070692_100400972 238
171 3300005347 Ga0070668_100367586 Ga0070668_1003675862 238
172 3300005355 Ga0070671_100513148 Ga0070671_1005131482 238
173 3300005366 Ga0070659_100000614 Ga0070659_10000061419 238
174 3300005367 Ga0070667_100160987 Ga0070667_1001609872 238
175 3300005367 Ga0070667_100666974 Ga0070667_1006669741 238
176 3300005438 Ga0070701_10013530 Ga0070701_100135302 238
177 3300005439 Ga0070711_100228695 Ga0070711_1002286952 238
178 3300005441 Ga0070700_100001727 Ga0070700_10000172710 238
179 3300005458 Ga0070681_10266804 Ga0070681_102668042 238
180 3300005459 Ga0068867_100008705 Ga0068867_1000087056 238
181 3300005466 Ga0070685_10031117 Ga0070685_100311172 238
182 3300005530 Ga0070679_100369016 Ga0070679_1003690162 238
183 3300005530 Ga0070679_100795516 Ga0070679_1007955161 238
184 3300005535 Ga0070684_100003940 Ga0070684_1000039409 238
185 3300005539 Ga0068853_100040444 Ga0068853_1000404446 238
186 3300005543 Ga0070672_100213289 Ga0070672_1002132893 238
187 3300005563 Ga0068855_100034141 Ga0068855_1000341414 238
188 3300005563 Ga0068855_100141077 Ga0068855_1001410774 238
189 3300005563 Ga0068855_100184251 Ga0068855_1001842514 238
190 3300005563 Ga0068855_100227865 Ga0068855_1002278652 238
191 3300005563 Ga0068855_100294638 Ga0068855_1002946382 238
192 3300005563 Ga0068855_100415398 Ga0068855_1004153982 238
193 3300005577 Ga0068857_100017894 Ga0068857_1000178944 238
194 3300005577 Ga0068857_100036107 Ga0068857_1000361074 238
195 3300005577 Ga0068857_100338560 Ga0068857_1003385602 238
196 3300005614 Ga0068856_100020314 Ga0068856_1000203148 238
197 3300005614 Ga0068856_100189851 Ga0068856_1001898513 238
198 3300005614 Ga0068856_100456403 Ga0068856_1004564032 238
199 3300005614 Ga0068856_100528361 Ga0068856_1005283612 238
200 3300005615 Ga0070702_100071901 Ga0070702_1000719012 238
201 3300005616 Ga0068852_100010538 Ga0068852_1000105387 238
202 3300005616 Ga0068852_100053856 Ga0068852_1000538563 238
203 3300005617 Ga0068859_100190879 Ga0068859_1001908793 238
204 3300005617 Ga0068859_100394459 Ga0068859_1003944591 238
205 3300005834 Ga0068851_10000124 Ga0068851_1000012421 238
206 3300005841 Ga0068863_100124165 Ga0068863_1001241653 238
207 3300005841 Ga0068863_100600925 Ga0068863_1006009252 238
208 3300005842 Ga0068858_100000175 Ga0068858_10000017545 238
209 3300006038 Ga0075365_10000640 Ga0075365_100006409 238
210 3300006881 Ga0068865_100114224 Ga0068865_1001142242 238
211 3300006931 Ga0097620_100190874 Ga0097620_1001908742 238
212 3300006931 Ga0097620_100394417 Ga0097620_1003944171 238
213 3300009093 Ga0105240_10131613 Ga0105240_101316133 238
214 3300009093 Ga0105240_10751637 Ga0105240_107516372 238
215 3300009093 Ga0105240_11192571 Ga0105240_111925711 238
216 3300009094 Ga0111539_10015597 Ga0111539_1001559711 238
217 3300009098 Ga0105245_10033293 Ga0105245_100332935 238
218 3300009098 Ga0105245_10101974 Ga0105245_101019744 238
219 3300009101 Ga0105247_10094621 Ga0105247_100946212 238
220 3300009174 Ga0105241_10000211 Ga0105241_1000021120 238
221 3300009174 Ga0105241_10232294 Ga0105241_102322942 238
222 3300009176 Ga0105242_10057516 Ga0105242_100575162 238
223 3300009177 Ga0105248_10082344 Ga0105248_100823446 238
224 3300009177 Ga0105248_10093672 Ga0105248_100936722 238
225 3300009177 Ga0105248_10172428 Ga0105248_101724282 238
226 3300009545 Ga0105237_10005342 Ga0105237_100053424 238
227 3300009545 Ga0105237_10007321 Ga0105237_1000732111 238
228 3300009545 Ga0105237_10094775 Ga0105237_100947754 238
229 3300009545 Ga0105237_10868826 Ga0105237_108688262 238
230 3300009551 Ga0105238_10001857 Ga0105238_1000185715 238
231 3300009551 Ga0105238_10036361 Ga0105238_100363614 238
232 3300009551 Ga0105238_10333455 Ga0105238_103334553 238
233 3300009551 Ga0105238_10432732 Ga0105238_104327322 238
234 3300009553 Ga0105249_10058232 Ga0105249_100582324 238
235 3300009553 Ga0105249_11172280 Ga0105249_111722801 238
236 3300010375 Ga0105239_10027190 Ga0105239_100271902 238
237 3300010375 Ga0105239_10149110 Ga0105239_101491104 238
238 3300011119 Ga0105246_10005341 Ga0105246_100053413 238
239 3300013105 Ga0157369_10050387 Ga0157369_100503874 238
240 3300013105 Ga0157369_10762532 Ga0157369_107625322 238
241 3300013307 Ga0157372_10712912 Ga0157372_107129121 238
242 3300013308 Ga0157375_10041252 Ga0157375_100412522 238
243 3300014325 Ga0163163_10173331 Ga0163163_101733312 238
244 3300014325 Ga0163163_10256340 Ga0163163_102563402 238
245 3300014325 Ga0163163_10862411 Ga0163163_108624112 238
246 3300014326 Ga0157380_10009167 Ga0157380_100091673 238
247 3300014497 Ga0182008_10180367 Ga0182008_101803672 238
248 3300014745 Ga0157377_10204939 Ga0157377_102049392 238
249 3300014968 Ga0157379_10004102 Ga0157379_100041028 238
250 3300014968 Ga0157379_10381489 Ga0157379_103814891 238
251 3300020081 Ga0206354_10434341 Ga0206354_104343411 238
252 3300020082 Ga0206353_10244667 Ga0206353_102446673 238
253 3300025254 Ga0209148_1000830 Ga0209148_100083012 238
254 3300025321 Ga0207656_10000001 Ga0207656_1000000129 238
255 3300025321 Ga0207656_10000003 Ga0207656_10000003135 238
256 3300025900 Ga0207710_10050534 Ga0207710_100505342 238
257 3300025901 Ga0207688_10016189 Ga0207688_100161894 238
258 3300025901 Ga0207688_10092825 Ga0207688_100928252 238
259 3300025904 Ga0207647_10066052 Ga0207647_100660522 238
260 3300025909 Ga0207705_10004785 Ga0207705_100047855 238
261 3300025909 Ga0207705_10043184 Ga0207705_100431844 238
262 3300025909 Ga0207705_10058716 Ga0207705_100587163 238
263 3300025909 Ga0207705_10142139 Ga0207705_101421391 238
264 3300025909 Ga0207705_10237966 Ga0207705_102379662 238
265 3300025911 Ga0207654_10000003 Ga0207654_10000003333 238
266 3300025912 Ga0207707_10244818 Ga0207707_102448182 238
267 3300025913 Ga0207695_10019828 Ga0207695_100198283 238
268 3300025913 Ga0207695_10035922 Ga0207695_100359223 238
269 3300025914 Ga0207671_10000001 Ga0207671_1000000127 238
270 3300025917 Ga0207660_10075333 Ga0207660_100753333 238
271 3300025918 Ga0207662_10275076 Ga0207662_102750762 238
272 3300025919 Ga0207657_10014789 Ga0207657_100147897 238
273 3300025919 Ga0207657_10032104 Ga0207657_100321044 238
274 3300025919 Ga0207657_10098639 Ga0207657_100986394 238
275 3300025919 Ga0207657_10338962 Ga0207657_103389622 238
276 3300025924 Ga0207694_10000039 Ga0207694_1000003915 238
277 3300025924 Ga0207694_10047828 Ga0207694_100478284 238
278 3300025924 Ga0207694_10263129 Ga0207694_102631292 238
279 3300025927 Ga0207687_10045021 Ga0207687_100450214 238
280 3300025927 Ga0207687_10063863 Ga0207687_100638634 238
281 3300025932 Ga0207690_10002300 Ga0207690_1000230010 238
282 3300025932 Ga0207690_10103316 Ga0207690_101033163 238
283 3300025935 Ga0207709_10009370 Ga0207709_100093706 238
284 3300025940 Ga0207691_10001309 Ga0207691_1000130919 238
285 3300025941 Ga0207711_10002075 Ga0207711_1000207517 238
286 3300025941 Ga0207711_10607072 Ga0207711_106070721 238
287 3300025944 Ga0207661_10012912 Ga0207661_100129125 238
288 3300025944 Ga0207661_10155490 Ga0207661_101554901 238
289 3300025944 Ga0207661_10716558 Ga0207661_107165581 238
290 3300025949 Ga0207667_10001963 Ga0207667_100019637 238
291 3300025949 Ga0207667_10071396 Ga0207667_100713963 238
292 3300025949 Ga0207667_10143189 Ga0207667_101431892 238
293 3300025949 Ga0207667_10209304 Ga0207667_102093043 238
294 3300025961 Ga0207712_10137742 Ga0207712_101377424 238
295 3300025981 Ga0207640_10175773 Ga0207640_101757732 238
296 3300025986 Ga0207658_10163271 Ga0207658_101632712 238
297 3300026035 Ga0207703_10000131 Ga0207703_1000013126 238
298 3300026041 Ga0207639_10385870 Ga0207639_103858702 238
299 3300026075 Ga0207708_10006405 Ga0207708_100064053 238
300 3300026078 Ga0207702_10044597 Ga0207702_100445974 238
301 3300026078 Ga0207702_10731019 Ga0207702_107310192 238
302 3300026089 Ga0207648_10001262 Ga0207648_1000126216 238
303 3300026095 Ga0207676_10503859 Ga0207676_105038592 238
304 3300026116 Ga0207674_10011490 Ga0207674_1001149010 238
305 3300026116 Ga0207674_10030152 Ga0207674_100301527 238
306 3300026116 Ga0207674_10031793 Ga0207674_100317937 238
307 3300026116 Ga0207674_10051815 Ga0207674_100518157 238
308 3300026116 Ga0207674_10474475 Ga0207674_104744752 238
309 3300026118 Ga0207675_100002583 Ga0207675_10000258313 238
310 3300026142 Ga0207698_10005106 Ga0207698_100051063 238
311 3300026142 Ga0207698_10009635 Ga0207698_100096358 238
312 3300026142 Ga0207698_10257452 Ga0207698_102574522 238
313 3300026142 Ga0207698_10269546 Ga0207698_102695462 238
314 3300027907 Ga0207428_10217109 Ga0207428_102171092 238
315 3300031649 Ga0307514_10139981 Ga0307514_101399811 238
316 3300031903 Ga0307407_10048260 Ga0307407_100482602 238
317 3300035089 Ga0373944_0001493 Ga0373944_0001493_2651_3376 238
318 3300035116 Ga0373945_0000297 Ga0373945_0000297_4285_5010 238
319 3300035118 Ga0373954_0034272 Ga0373954_0034272_202_927 238
320 3300035119 Ga0373956_0102199 Ga0373956_0102199_538_1263 238
321 3300035170 Ga0373943_0000586 Ga0373943_0000586_9379_10104 238
322 3300035170 Ga0373943_0036836 Ga0373943_0036836_528_1250 238
323 3300035171 Ga0373946_0000057 Ga0373946_0000057_20984_21709 238
324 3300035410 Ga0373924_0008137 Ga0373924_0008137_2460_3185 238
325 3300035692 Ga0373935_0001547 Ga0373935_0001547_8591_9316 238
326 3300035695 Ga0373927_0000281 Ga0373927_0000281_12624_13349 238
327 3300037068 Ga0373925_0004092 Ga0373925_0004092_6601_7326 238
328 3300041452 Ga0451793_0945671 Ga0451793_0945671_2411_3196 238
329 3300045976 Ga0466967_0107759 Ga0466967_0107759_1248_1982 238
330 3300045976 Ga0466967_0180153 Ga0466967_0180153_819_1544 238
331 3300046461 Ga0495641_0015388 Ga0495641_0015388_696_1421 238
332 3300046461 Ga0495641_0039930 Ga0495641_0039930_453_1229 238
333 3300046477 Ga0495664_0001381 Ga0495664_0001381_6833_7558 238
334 3300046477 Ga0495664_0305809 Ga0495664_0305809_32_763 238
335 3300046514 Ga0495618_0020849 Ga0495618_0020849_1053_1778 238
336 3300046517 Ga0495630_0045401 Ga0495630_0045401_1687_2412 238
337 3300046531 Ga0495665_0024404 Ga0495665_0024404_704_1429 238
338 3300046533 Ga0495640_0280571 Ga0495640_0280571_80_805 238
339 3300046642 Ga0495634_0064680 Ga0495634_0064680_364_1089 238
340 3300046663 Ga0495635_0001647 Ga0495635_0001647_2645_3370 238
341 3300046678 Ga0495599_0132695 Ga0495599_0132695_412_1137 238
342 3300046681 Ga0495647_0099096 Ga0495647_0099096_40_771 238
343 3300046690 Ga0495624_0019973 Ga0495624_0019973_811_1536 238
344 3300047315 Ga0495581_0202462 Ga0495581_0202462_143_868 238
345 3300047319 Ga0495674_0001430 Ga0495674_0001430_13655_14380 238
346 3300047321 Ga0495676_0001791 Ga0495676_0001791_15590_16315 238
347 3300047322 Ga0495680_0060752 Ga0495680_0060752_901_1626 238
348 3300048903 Ga0496100_0155326 Ga0496100_0155326_770_1501 238
349 3300048905 Ga0496102_0011688 Ga0496102_0011688_4732_5463 238
350 3300048906 Ga0496103_0058264 Ga0496103_0058264_1121_1852 238
351 3300048909 Ga0496106_0218851 Ga0496106_0218851_99_830 238
352 3300048911 Ga0496108_0034423 Ga0496108_0034423_1066_1797 238
353 3300048912 Ga0496109_0106752 Ga0496109_0106752_711_1457 238
354 3300048912 Ga0496109_0176383 Ga0496109_0176383_1129_1860 238
355 3300048912 Ga0496109_0289847 Ga0496109_0289847_630_1394 238
356 3300048913 Ga0496110_0051777 Ga0496110_0051777_1788_2519 238
357 3300048913 Ga0496110_0106428 Ga0496110_0106428_1105_1851 238
358 3300048914 Ga0496111_0009560 Ga0496111_0009560_4667_5398 238
359 3300048917 Ga0496114_0018839 Ga0496114_0018839_267_1094 238
360 3300048917 Ga0496114_0137086 Ga0496114_0137086_472_1218 238
361 3300048917 Ga0496114_0306276 Ga0496114_0306276_158_889 238
362 3300048920 Ga0496117_0029237 Ga0496117_0029237_1498_2241 238
363 3300048921 Ga0496118_0035053 Ga0496118_0035053_2421_3164 238
364 3300048922 Ga0496119_0001675 Ga0496119_0001675_823_1566 238
365 3300048922 Ga0496119_0102138 Ga0496119_0102138_583_1326 238
366 3300048923 Ga0496120_0024499 Ga0496120_0024499_863_1606 238
367 3300048923 Ga0496120_0093505 Ga0496120_0093505_123_860 238
368 3300048929 Ga0496126_0239668 Ga0496126_0239668_333_1076 238
369 3300048929 Ga0496126_0298325 Ga0496126_0298325_494_1237 238
370 3300049568 Ga0501031_0015189 Ga0501031_0015189_1017_1760 238
371 3300049569 Ga0501032_0140581 Ga0501032_0140581_159_887 238
372 3300049570 Ga0501033_0003981 Ga0501033_0003981_993_1727 238
373 3300049571 Ga0501034_0005065 Ga0501034_0005065_1766_2497 238
374 3300049571 Ga0501034_0019848 Ga0501034_0019848_4030_4773 238
375 3300049571 Ga0501034_0646506 Ga0501034_0646506_17_751 238
376 3300049572 Ga0501036_0008211 Ga0501036_0008211_1629_2363 238
377 3300049572 Ga0501036_0028967 Ga0501036_0028967_3447_4190 238
378 3300049573 Ga0501037_0025612 Ga0501037_0025612_3452_4195 238
379 3300049573 Ga0501037_0080981 Ga0501037_0080981_452_1186 238
380 3300049573 Ga0501037_0214994 Ga0501037_0214994_589_1317 238
381 3300049574 Ga0501038_0017389 Ga0501038_0017389_415_1149 238
382 3300049574 Ga0501038_0042352 Ga0501038_0042352_2712_3455 238
383 3300049575 Ga0501039_0037135 Ga0501039_0037135_616_1344 238
384 3300049575 Ga0501039_0087312 Ga0501039_0087312_525_1268 238
385 3300049578 Ga0501042_0136702 Ga0501042_0136702_218_961 238
386 3300049579 Ga0501043_0110306 Ga0501043_0110306_213_947 238
387 3300049579 Ga0501043_0134887 Ga0501043_0134887_258_986 238
388 3300049580 Ga0501046_0000566 Ga0501046_0000566_2034_2777 238
389 3300049580 Ga0501046_0002036 Ga0501046_0002036_12965_13699 238
390 3300049580 Ga0501046_0004086 Ga0501046_0004086_11640_12374 238
391 3300049581 Ga0501047_0081025 Ga0501047_0081025_1615_2349 238
392 3300049581 Ga0501047_0122557 Ga0501047_0122557_168_896 238
393 3300049581 Ga0501047_0523338 Ga0501047_0523338_37_780 238
394 3300049582 Ga0501048_0010210 Ga0501048_0010210_2805_3548 238
395 3300049582 Ga0501048_0027539 Ga0501048_0027539_1302_2036 238
396 3300049583 Ga0501067_0001083 Ga0501067_0001083_4395_5126 238
397 3300049584 Ga0501068_0032931 Ga0501068_0032931_135_878 238
398 3300049585 Ga0501069_0117466 Ga0501069_0117466_399_1145 238
399 3300049586 Ga0501070_0004523 Ga0501070_0004523_9168_9899 238
400 3300049586 Ga0501070_0025886 Ga0501070_0025886_977_1711 238
401 3300049586 Ga0501070_0092430 Ga0501070_0092430_528_1271 238
402 3300049587 Ga0501071_0012339 Ga0501071_0012339_2966_3697 238
403 3300049588 Ga0501072_0007300 Ga0501072_0007300_1649_2380 238
404 3300049589 Ga0501073_0001438 Ga0501073_0001438_9554_10285 238
405 3300049590 Ga0501074_0002081 Ga0501074_0002081_10014_10745 238
406 3300049590 Ga0501074_0065720 Ga0501074_0065720_859_1587 238
407 3300049742 Ga0501080_0016540 Ga0501080_0016540_5450_6184 238
408 3300049822 Ga0501035_0043976 Ga0501035_0043976_2995_3723 238
409 3300049822 Ga0501035_0047183 Ga0501035_0047183_203_946 238
410 3300049823 Ga0501044_0046494 Ga0501044_0046494_3585_4328 238
411 3300049824 Ga0501045_0007627 Ga0501045_0007627_2884_3627 238
412 3300050492 nmdc:mga0yw44_8410_c1 nmdc:mga0yw44_8410_c1_1744_2475 238
413 3300053077 Ga0495601_0009096 Ga0495601_0009096_428_1159 238
414 3300053093 Ga0500651_0000647 Ga0500651_0000647_9372_10115 238
415 3300053102 Ga0500554_065185 Ga0500554_065185_400_1143 238
416 3300053136 Ga0500559_0045296 Ga0500559_0045296_966_1700 238
417 3300053140 Ga0500573_0049081 Ga0500573_0049081_1665_2396 238
418 3300053148 Ga0500590_006392 Ga0500590_006392_3827_4570 238
419 3300053153 Ga0500616_0000463 Ga0500616_0000463_24633_25412 238
420 3300054114 Ga0501084_0013685 Ga0501084_0013685_351_1082 238
421 iso_pu_bacteria 2643221604 2644034509 238
422 iso_pu_bacteria 2893684298 2893684870 238
423 3300002067 JGI24735J21928_10027302 JGI24735J21928_100273022 239
424 3300005327 Ga0070658_10000487 Ga0070658_1000048718 239
425 3300005329 Ga0070683_100000788 Ga0070683_1000007881 239
426 3300005335 Ga0070666_10162507 Ga0070666_101625072 239
427 3300005336 Ga0070680_100001431 Ga0070680_10000143118 239
428 3300005337 Ga0070682_100127614 Ga0070682_1001276142 239
429 3300005340 Ga0070689_100379597 Ga0070689_1003795972 239
430 3300005344 Ga0070661_100678940 Ga0070661_1006789401 239
431 3300005347 Ga0070668_100095611 Ga0070668_1000956112 239
432 3300005355 Ga0070671_100030886 Ga0070671_1000308863 239
433 3300005364 Ga0070673_100357746 Ga0070673_1003577462 239
434 3300005367 Ga0070667_100010113 Ga0070667_1000101139 239
435 3300005367 Ga0070667_100036420 Ga0070667_1000364205 239
436 3300005367 Ga0070667_100436861 Ga0070667_1004368612 239
437 3300005434 Ga0070709_10107128 Ga0070709_101071283 239
438 3300005435 Ga0070714_100325100 Ga0070714_1003251002 239
439 3300005437 Ga0070710_10103776 Ga0070710_101037762 239
440 3300005437 Ga0070710_10444518 Ga0070710_104445181 239
441 3300005439 Ga0070711_100007809 Ga0070711_1000078094 239
442 3300005439 Ga0070711_100181917 Ga0070711_1001819171 239
443 3300005458 Ga0070681_10003941 Ga0070681_1000394115 239
444 3300005458 Ga0070681_10506206 Ga0070681_105062062 239
445 3300005467 Ga0070706_100058871 Ga0070706_1000588713 239
446 3300005468 Ga0070707_100072910 Ga0070707_1000729104 239
447 3300005471 Ga0070698_100011699 Ga0070698_1000116996 239
448 3300005471 Ga0070698_100060163 Ga0070698_1000601635 239
449 3300005518 Ga0070699_100001377 Ga0070699_10000137713 239
450 3300005530 Ga0070679_100002183 Ga0070679_10000218313 239
451 3300005535 Ga0070684_100008019 Ga0070684_1000080196 239
452 3300005535 Ga0070684_100054260 Ga0070684_1000542603 239
453 3300005544 Ga0070686_100384818 Ga0070686_1003848181 239
454 3300005548 Ga0070665_100001500 Ga0070665_10000150015 239
455 3300005548 Ga0070665_100020284 Ga0070665_1000202842 239
456 3300005564 Ga0070664_100324567 Ga0070664_1003245672 239
457 3300005577 Ga0068857_100032082 Ga0068857_1000320826 239
458 3300005577 Ga0068857_100218519 Ga0068857_1002185193 239
459 3300005615 Ga0070702_100104931 Ga0070702_1001049312 239
460 3300005719 Ga0068861_100346217 Ga0068861_1003462172 239
461 3300005841 Ga0068863_100001958 Ga0068863_10000195815 239
462 3300005842 Ga0068858_100034213 Ga0068858_1000342134 239
463 3300005843 Ga0068860_100000043 Ga0068860_100000043104 239
464 3300005937 Ga0081455_10000128 Ga0081455_1000012872 239
465 3300005937 Ga0081455_10001337 Ga0081455_100013374 239
466 3300005937 Ga0081455_10009693 Ga0081455_100096935 239
467 3300005981 Ga0081538_10000005 Ga0081538_10000005140 239
468 3300005985 Ga0081539_10022628 Ga0081539_100226283 239
469 3300005985 Ga0081539_10048547 Ga0081539_100485474 239
470 3300006028 Ga0070717_10041626 Ga0070717_100416265 239
471 3300006038 Ga0075365_10007324 Ga0075365_100073243 239
472 3300006038 Ga0075365_10009470 Ga0075365_100094704 239
473 3300006038 Ga0075365_10020733 Ga0075365_100207335 239
474 3300006038 Ga0075365_10025374 Ga0075365_100253744 239
475 3300006038 Ga0075365_10028215 Ga0075365_100282152 239
476 3300006038 Ga0075365_10173901 Ga0075365_101739012 239
477 3300006042 Ga0075368_10004612 Ga0075368_100046125 239
478 3300006048 Ga0075363_100000612 Ga0075363_1000006123 239
479 3300006048 Ga0075363_100005598 Ga0075363_1000055983 239
480 3300006048 Ga0075363_100009078 Ga0075363_1000090785 239
481 3300006048 Ga0075363_100043254 Ga0075363_1000432544 239
482 3300006048 Ga0075363_100079551 Ga0075363_1000795513 239
483 3300006048 Ga0075363_100150586 Ga0075363_1001505863 239
484 3300006051 Ga0075364_10002963 Ga0075364_1000296311 239
485 3300006051 Ga0075364_10009875 Ga0075364_100098754 239
486 3300006051 Ga0075364_10011486 Ga0075364_100114863 239
487 3300006051 Ga0075364_10033013 Ga0075364_100330133 239
488 3300006051 Ga0075364_10087474 Ga0075364_100874742 239
489 3300006051 Ga0075364_10115186 Ga0075364_101151863 239
490 3300006051 Ga0075364_10134197 Ga0075364_101341972 239
491 3300006051 Ga0075364_10143427 Ga0075364_101434272 239
492 3300006051 Ga0075364_10157376 Ga0075364_101573763 239
493 3300006173 Ga0070716_100139129 Ga0070716_1001391292 239
494 3300006175 Ga0070712_100038812 Ga0070712_1000388122 239
495 3300006175 Ga0070712_100187171 Ga0070712_1001871712 239
496 3300006178 Ga0075367_10057284 Ga0075367_100572843 239
497 3300006178 Ga0075367_10076675 Ga0075367_100766753 239
498 3300006178 Ga0075367_10078641 Ga0075367_100786412 239
499 3300006178 Ga0075367_10082849 Ga0075367_100828492 239
500 3300006353 Ga0075370_10006358 Ga0075370_100063582 239
501 3300006353 Ga0075370_10039921 Ga0075370_100399214 239
502 3300006353 Ga0075370_10084347 Ga0075370_100843472 239
503 3300006844 Ga0075428_100007901 Ga0075428_10000790112 239
504 3300006846 Ga0075430_100008527 Ga0075430_10000852710 239
505 3300006846 Ga0075430_100035267 Ga0075430_1000352676 239
506 3300006847 Ga0075431_100000088 Ga0075431_10000008817 239
507 3300006847 Ga0075431_100007324 Ga0075431_1000073243 239
508 3300006880 Ga0075429_100002486 Ga0075429_10000248610 239
509 3300006880 Ga0075429_100009056 Ga0075429_10000905610 239
510 3300006880 Ga0075429_100050142 Ga0075429_1000501426 239
511 3300007076 Ga0075435_100277005 Ga0075435_1002770052 239
512 3300009093 Ga0105240_10003864 Ga0105240_100038647 239
513 3300009093 Ga0105240_10335224 Ga0105240_103352242 239
514 3300009094 Ga0111539_10565023 Ga0111539_105650232 239
515 3300009094 Ga0111539_10881613 Ga0111539_108816132 239
516 3300009098 Ga0105245_10150434 Ga0105245_101504343 239
517 3300009098 Ga0105245_10238939 Ga0105245_102389392 239
518 3300009098 Ga0105245_10542452 Ga0105245_105424522 239
519 3300009147 Ga0114129_10000059 Ga0114129_1000005930 239
520 3300009147 Ga0114129_10040088 Ga0114129_100400889 239
521 3300009147 Ga0114129_10051139 Ga0114129_100511392 239
522 3300009148 Ga0105243_10273621 Ga0105243_102736212 239
523 3300009148 Ga0105243_10652321 Ga0105243_106523211 239
524 3300009176 Ga0105242_10834030 Ga0105242_108340302 239
525 3300009545 Ga0105237_10138602 Ga0105237_101386022 239
526 3300009551 Ga0105238_10367295 Ga0105238_103672952 239
527 3300009551 Ga0105238_10892819 Ga0105238_108928192 239
528 3300010375 Ga0105239_10128443 Ga0105239_101284433 239
529 3300010375 Ga0105239_10372671 Ga0105239_103726713 239
530 3300011119 Ga0105246_10465775 Ga0105246_104657752 239
531 3300013102 Ga0157371_10565524 Ga0157371_105655242 239
532 3300013104 Ga0157370_10643926 Ga0157370_106439262 239
533 3300013105 Ga0157369_10056590 Ga0157369_100565903 239
534 3300013105 Ga0157369_10101724 Ga0157369_101017243 239
535 3300013307 Ga0157372_10226888 Ga0157372_102268884 239
536 3300013307 Ga0157372_10603543 Ga0157372_106035432 239
537 3300013307 Ga0157372_10788781 Ga0157372_107887812 239
538 3300013308 Ga0157375_10028362 Ga0157375_100283623 239
539 3300013308 Ga0157375_10199098 Ga0157375_101990982 239
540 3300013308 Ga0157375_10603463 Ga0157375_106034632 239
541 3300014325 Ga0163163_10320655 Ga0163163_103206553 239
542 3300014325 Ga0163163_10422695 Ga0163163_104226952 239
543 3300014325 Ga0163163_10606015 Ga0163163_106060152 239
544 3300014745 Ga0157377_10114815 Ga0157377_101148152 239
545 3300014968 Ga0157379_10110172 Ga0157379_101101724 239
546 3300014969 Ga0157376_10540297 Ga0157376_105402971 239
547 3300020081 Ga0206354_10103529 Ga0206354_101035293 239
548 3300020082 Ga0206353_10033622 Ga0206353_100336222 239
549 3300020082 Ga0206353_10580619 Ga0206353_105806196 239
550 3300020082 Ga0206353_11297471 Ga0206353_112974712 239
551 3300020082 Ga0206353_11747993 Ga0206353_117479933 239
552 3300021384 Ga0213876_10073807 Ga0213876_100738072 239
553 3300021388 Ga0213875_10026616 Ga0213875_100266164 239
554 3300021388 Ga0213875_10044625 Ga0213875_100446252 239
555 3300025898 Ga0207692_10019279 Ga0207692_100192794 239
556 3300025898 Ga0207692_10031456 Ga0207692_100314563 239
557 3300025903 Ga0207680_10154452 Ga0207680_101544522 239
558 3300025906 Ga0207699_10003210 Ga0207699_100032108 239
559 3300025906 Ga0207699_10054845 Ga0207699_100548453 239
560 3300025907 Ga0207645_10219615 Ga0207645_102196152 239
561 3300025908 Ga0207643_10307348 Ga0207643_103073482 239
562 3300025909 Ga0207705_10004857 Ga0207705_100048576 239
563 3300025912 Ga0207707_10001838 Ga0207707_100018384 239
564 3300025912 Ga0207707_10414230 Ga0207707_104142302 239
565 3300025915 Ga0207693_10034783 Ga0207693_100347835 239
566 3300025916 Ga0207663_10022800 Ga0207663_100228003 239
567 3300025917 Ga0207660_10000619 Ga0207660_100006198 239
568 3300025918 Ga0207662_10153317 Ga0207662_101533173 239
569 3300025919 Ga0207657_10098006 Ga0207657_100980063 239
570 3300025919 Ga0207657_10409826 Ga0207657_104098262 239
571 3300025920 Ga0207649_10166664 Ga0207649_101666643 239
572 3300025921 Ga0207652_10003015 Ga0207652_1000301512 239
573 3300025922 Ga0207646_10282552 Ga0207646_102825521 239
574 3300025927 Ga0207687_10153808 Ga0207687_101538082 239
575 3300025927 Ga0207687_10458862 Ga0207687_104588622 239
576 3300025927 Ga0207687_10627015 Ga0207687_106270152 239
577 3300025929 Ga0207664_10024940 Ga0207664_100249403 239
578 3300025929 Ga0207664_10139174 Ga0207664_101391743 239
579 3300025929 Ga0207664_10281671 Ga0207664_102816712 239
580 3300025929 Ga0207664_10295976 Ga0207664_102959762 239
581 3300025929 Ga0207664_10315233 Ga0207664_103152332 239
582 3300025931 Ga0207644_10196350 Ga0207644_101963503 239
583 3300025932 Ga0207690_10264837 Ga0207690_102648372 239
584 3300025936 Ga0207670_10122393 Ga0207670_101223932 239
585 3300025938 Ga0207704_10441113 Ga0207704_104411132 239
586 3300025939 Ga0207665_10016104 Ga0207665_100161046 239
587 3300025944 Ga0207661_10006300 Ga0207661_100063003 239
588 3300025944 Ga0207661_10074007 Ga0207661_100740072 239
589 3300025944 Ga0207661_10389118 Ga0207661_103891182 239
590 3300025945 Ga0207679_10009597 Ga0207679_100095972 239
591 3300025945 Ga0207679_10111860 Ga0207679_101118601 239
592 3300025972 Ga0207668_10009134 Ga0207668_100091343 239
593 3300025972 Ga0207668_10181597 Ga0207668_101815972 239
594 3300025986 Ga0207658_10002264 Ga0207658_100022649 239
595 3300025986 Ga0207658_10014394 Ga0207658_100143943 239
596 3300025986 Ga0207658_10306908 Ga0207658_103069083 239
597 3300026023 Ga0207677_10187853 Ga0207677_101878532 239
598 3300026035 Ga0207703_10036156 Ga0207703_100361564 239
599 3300026075 Ga0207708_10019070 Ga0207708_100190704 239
600 3300026088 Ga0207641_10010850 Ga0207641_100108506 239
601 3300026088 Ga0207641_10964067 Ga0207641_109640671 239
602 3300026095 Ga0207676_10489901 Ga0207676_104899012 239
603 3300026116 Ga0207674_10031495 Ga0207674_100314952 239
604 3300026118 Ga0207675_100022886 Ga0207675_1000228862 239
605 3300026142 Ga0207698_10591408 Ga0207698_105914082 239
606 3300026142 Ga0207698_10663147 Ga0207698_106631472 239
607 3300027866 Ga0209813_10005935 Ga0209813_100059354 239
608 3300028379 Ga0268266_10001099 Ga0268266_1000109911 239
609 3300028379 Ga0268266_10003454 Ga0268266_100034549 239
610 3300028380 Ga0268265_10315832 Ga0268265_103158322 239
611 3300028381 Ga0268264_10000027 Ga0268264_10000027315 239
612 3300028381 Ga0268264_10000775 Ga0268264_1000077522 239
613 3300031242 Ga0265329_10057247 Ga0265329_100572472 239
614 3300031456 Ga0307513_10172564 Ga0307513_101725643 239
615 3300031616 Ga0307508_10043766 Ga0307508_100437662 239
616 3300031730 Ga0307516_10204116 Ga0307516_102041161 239
617 3300031731 Ga0307405_10080843 Ga0307405_100808435 239
618 3300031731 Ga0307405_10193875 Ga0307405_101938751 239
619 3300031852 Ga0307410_10320180 Ga0307410_103201802 239
620 3300031852 Ga0307410_10343321 Ga0307410_103433212 239
621 3300031901 Ga0307406_10215758 Ga0307406_102157582 239
622 3300031911 Ga0307412_10021847 Ga0307412_100218475 239
623 3300031911 Ga0307412_10065908 Ga0307412_100659082 239
624 3300031995 Ga0307409_100083762 Ga0307409_1000837623 239
625 3300031995 Ga0307409_100246486 Ga0307409_1002464862 239
626 3300031995 Ga0307409_100306105 Ga0307409_1003061053 239
627 3300031995 Ga0307409_100421865 Ga0307409_1004218652 239
628 3300032002 Ga0307416_100877097 Ga0307416_1008770971 239
629 3300032002 Ga0307416_101030314 Ga0307416_1010303141 239
630 3300032004 Ga0307414_10446127 Ga0307414_104461272 239
631 3300032004 Ga0307414_10512980 Ga0307414_105129801 239
632 3300032004 Ga0307414_10876483 Ga0307414_108764831 239
633 3300032005 Ga0307411_10968546 Ga0307411_109685461 239
634 3300032126 Ga0307415_100094377 Ga0307415_1000943772 239
635 3300032126 Ga0307415_100307980 Ga0307415_1003079802 239
636 3300032126 Ga0307415_100611466 Ga0307415_1006114662 239
637 3300035083 Ga0373926_0003223 Ga0373926_0003223_2359_3087 239
638 3300035086 Ga0373934_0003231 Ga0373934_0003231_607_1335 239
639 3300035089 Ga0373944_0002001 Ga0373944_0002001_2509_3237 239
640 3300035111 Ga0373923_0009413 Ga0373923_0009413_2092_2820 239
641 3300035113 Ga0373936_0010006 Ga0373936_0010006_2146_2874 239
642 3300035116 Ga0373945_0011275 Ga0373945_0011275_286_1014 239
643 3300035118 Ga0373954_0003219 Ga0373954_0003219_5581_6309 239
644 3300035120 Ga0373957_0009188 Ga0373957_0009188_2148_2876 239
645 3300035170 Ga0373943_0007254 Ga0373943_0007254_4211_4939 239
646 3300035171 Ga0373946_0001085 Ga0373946_0001085_6630_7358 239
647 3300035172 Ga0373955_0054523 Ga0373955_0054523_1239_1967 239
648 3300035410 Ga0373924_0002621 Ga0373924_0002621_596_1324 239
649 3300035692 Ga0373935_0007043 Ga0373935_0007043_2079_2807 239
650 3300035695 Ga0373927_0003517 Ga0373927_0003517_8402_9130 239
651 3300035695 Ga0373927_0306994 Ga0373927_0306994_32_757 239
652 3300035724 Ga0373933_0049458 Ga0373933_0049458_1036_1764 239
653 3300035725 Ga0373947_0259726 Ga0373947_0259726_387_1115 239
654 3300036401 Ga0373937_0090054 Ga0373937_0090054_708_1436 239
655 3300036401 Ga0373937_0111267 Ga0373937_0111267_1782_2510 239
656 3300037068 Ga0373925_0018182 Ga0373925_0018182_3343_4071 239
657 3300037312 Ga0395899_0167194 Ga0395899_0167194_442_1179 239
658 3300037418 Ga0395900_0475010 Ga0395900_0475010_199_936 239
659 3300037466 Ga0395898_0152562 Ga0395898_0152562_1279_2037 239
660 3300037466 Ga0395898_0234068 Ga0395898_0234068_614_1348 239
661 3300037466 Ga0395898_0320330 Ga0395898_0320330_538_1275 239
662 3300037853 Ga0436364_1551954 Ga0436364_1551954_5272_5997 239
663 3300038443 Ga0395901_0038724 Ga0395901_0038724_996_1718 239
664 3300038443 Ga0395901_0140828 Ga0395901_0140828_152_889 239
665 3300039437 Ga0436365_0906829 Ga0436365_0906829_1125_1853 239
666 3300041460 Ga0451802_0761233 Ga0451802_0761233_120_839 239
667 3300041491 Ga0451833_0532435 Ga0451833_0532435_6086_6817 239
668 3300041496 Ga0451839_0500015 Ga0451839_0500015_2842_3573 239
669 3300041997 Ga0439431_0005909 Ga0439431_0005909_885_1619 239
670 3300042146 Ga0450907_015927 Ga0450907_015927_207_941 239
671 3300042156 Ga0439446_0007150 Ga0439446_0007150_110_844 239
672 3300042435 Ga0439434_0047335 Ga0439434_0047335_579_1313 239
673 3300042439 Ga0439464_0026721 Ga0439464_0026721_520_1260 239
674 3300044656 Ga0466969_0038176 Ga0466969_0038176_170_889 239
675 3300044656 Ga0466969_0098588 Ga0466969_0098588_341_1072 239
676 3300044658 Ga0466972_0134952 Ga0466972_0134952_126_869 239
677 3300044658 Ga0466972_0147407 Ga0466972_0147407_168_902 239
678 3300044683 Ga0466965_0018748 Ga0466965_0018748_837_1580 239
679 3300044683 Ga0466965_0047295 Ga0466965_0047295_1088_1825 239
680 3300044683 Ga0466965_0056454 Ga0466965_0056454_257_1021 239
681 3300044684 Ga0466966_0028816 Ga0466966_0028816_2041_2760 239
682 3300044684 Ga0466966_0066102 Ga0466966_0066102_848_1585 239
683 3300044684 Ga0466966_0074133 Ga0466966_0074133_1316_2047 239
684 3300044693 Ga0466961_0010808 Ga0466961_0010808_1046_1777 239
685 3300044693 Ga0466961_0024561 Ga0466961_0024561_1480_2244 239
686 3300044693 Ga0466961_0032099 Ga0466961_0032099_239_988 239
687 3300044693 Ga0466961_0235003 Ga0466961_0235003_214_951 239
688 3300044693 Ga0466961_0282228 Ga0466961_0282228_171_923 239
689 3300044694 Ga0466963_0091226 Ga0466963_0091226_513_1262 239
690 3300044694 Ga0466963_0101303 Ga0466963_0101303_699_1439 239
691 3300044694 Ga0466963_0104822 Ga0466963_0104822_571_1323 239
692 3300044694 Ga0466963_0167581 Ga0466963_0167581_173_910 239
693 3300044706 Ga0466964_0002463 Ga0466964_0002463_5779_6516 239
694 3300044706 Ga0466964_0067283 Ga0466964_0067283_647_1411 239
695 3300044719 Ga0466971_0005451 Ga0466971_0005451_4505_5269 239
696 3300044719 Ga0466971_0019229 Ga0466971_0019229_1516_2253 239
697 3300044735 Ga0466968_0057896 Ga0466968_0057896_103_867 239
698 3300044765 Ga0466970_0003597 Ga0466970_0003597_606_1340 239
699 3300044765 Ga0466970_0006898 Ga0466970_0006898_255_1004 239
700 3300044765 Ga0466970_0010213 Ga0466970_0010213_1489_2253 239
701 3300044765 Ga0466970_0038490 Ga0466970_0038490_1700_2455 239
702 3300044765 Ga0466970_0047490 Ga0466970_0047490_906_1655 239
703 3300044765 Ga0466970_0048238 Ga0466970_0048238_693_1445 239
704 3300044765 Ga0466970_0079816 Ga0466970_0079816_466_1203 239
705 3300044765 Ga0466970_0130462 Ga0466970_0130462_257_994 239
706 3300044765 Ga0466970_0213390 Ga0466970_0213390_251_985 239
707 3300044765 Ga0466970_0226034 Ga0466970_0226034_40_789 239
708 3300044842 Ga0466957_0060381 Ga0466957_0060381_1171_1920 239
709 3300044842 Ga0466957_0104957 Ga0466957_0104957_82_846 239
710 3300044842 Ga0466957_0537814 Ga0466957_0537814_34_783 239
711 3300044901 Ga0466960_0000528 Ga0466960_0000528_7185_7919 239
712 3300044901 Ga0466960_0018199 Ga0466960_0018199_1703_2440 239
713 3300044901 Ga0466960_0020794 Ga0466960_0020794_2056_2805 239
714 3300044901 Ga0466960_0179474 Ga0466960_0179474_258_1016 239
715 3300045049 Ga0466959_0002006 Ga0466959_0002006_1210_1929 239
716 3300045049 Ga0466959_0071713 Ga0466959_0071713_653_1384 239
717 3300045049 Ga0466959_0092898 Ga0466959_0092898_192_956 239
718 3300045049 Ga0466959_0322624 Ga0466959_0322624_122_859 239
719 3300045836 Ga0466958_0087273 Ga0466958_0087273_950_1714 239
720 3300045836 Ga0466958_0188949 Ga0466958_0188949_98_826 239
721 3300045976 Ga0466967_0087613 Ga0466967_0087613_1930_2679 239
722 3300045976 Ga0466967_0210904 Ga0466967_0210904_705_1463 239
723 3300045976 Ga0466967_0241880 Ga0466967_0241880_97_849 239
724 3300045976 Ga0466967_0491483 Ga0466967_0491483_271_1002 239
725 3300045976 Ga0466967_0522640 Ga0466967_0522640_148_882 239
726 3300046454 Ga0495592_0014634 Ga0495592_0014634_3446_4174 239
727 3300046454 Ga0495592_0120924 Ga0495592_0120924_497_1222 239
728 3300046455 Ga0495603_0001542 Ga0495603_0001542_10771_11499 239
729 3300046459 Ga0495629_0009091 Ga0495629_0009091_36_764 239
730 3300046461 Ga0495641_0009648 Ga0495641_0009648_3437_4165 239
731 3300046461 Ga0495641_0093999 Ga0495641_0093999_468_1190 239
732 3300046462 Ga0495651_0059452 Ga0495651_0059452_674_1399 239
733 3300046462 Ga0495651_0080028 Ga0495651_0080028_705_1433 239
734 3300046463 Ga0495653_0029872 Ga0495653_0029872_1943_2671 239
735 3300046472 Ga0495580_0092637 Ga0495580_0092637_780_1508 239
736 3300046473 Ga0495582_0033962 Ga0495582_0033962_1942_2670 239
737 3300046475 Ga0495639_0001019 Ga0495639_0001019_9558_10286 239
738 3300046476 Ga0495662_0001001 Ga0495662_0001001_11015_11743 239
739 3300046477 Ga0495664_0066644 Ga0495664_0066644_908_1636 239
740 3300046499 Ga0495594_0015381 Ga0495594_0015381_652_1380 239
741 3300046511 Ga0495608_0016336 Ga0495608_0016336_1802_2530 239
742 3300046514 Ga0495618_0032056 Ga0495618_0032056_512_1240 239
743 3300046514 Ga0495618_0079458 Ga0495618_0079458_570_1298 239
744 3300046514 Ga0495618_0166591 Ga0495618_0166591_330_1055 239
745 3300046516 Ga0495628_0078730 Ga0495628_0078730_1342_2067 239
746 3300046516 Ga0495628_0153270 Ga0495628_0153270_908_1636 239
747 3300046516 Ga0495628_0401921 Ga0495628_0401921_168_893 239
748 3300046517 Ga0495630_0001525 Ga0495630_0001525_11590_12318 239
749 3300046526 Ga0495666_0005147 Ga0495666_0005147_1670_2398 239
750 3300046529 Ga0495652_0102575 Ga0495652_0102575_1094_1819 239
751 3300046529 Ga0495652_0137957 Ga0495652_0137957_286_1014 239
752 3300046531 Ga0495665_0003599 Ga0495665_0003599_2229_2957 239
753 3300046533 Ga0495640_0070817 Ga0495640_0070817_706_1434 239
754 3300046535 Ga0495586_0024803 Ga0495586_0024803_1688_2416 239
755 3300046536 Ga0495587_0050043 Ga0495587_0050043_1500_2225 239
756 3300046536 Ga0495587_0083884 Ga0495587_0083884_270_998 239
757 3300046543 Ga0495645_0004607 Ga0495645_0004607_7310_8038 239
758 3300046543 Ga0495645_0043472 Ga0495645_0043472_914_1642 239
759 3300046559 Ga0495667_0033861 Ga0495667_0033861_2368_3093 239
760 3300046559 Ga0495667_0099489 Ga0495667_0099489_247_975 239
761 3300046642 Ga0495634_0014957 Ga0495634_0014957_1802_2530 239
762 3300046663 Ga0495635_0071456 Ga0495635_0071456_743_1471 239
763 3300046663 Ga0495635_0078034 Ga0495635_0078034_456_1220 239
764 3300046674 Ga0495588_0067071 Ga0495588_0067071_127_855 239
765 3300046675 Ga0495657_0033202 Ga0495657_0033202_1959_2687 239
766 3300046675 Ga0495657_0034902 Ga0495657_0034902_2533_3258 239
767 3300046678 Ga0495599_0092889 Ga0495599_0092889_119_847 239
768 3300046679 Ga0495623_0006098 Ga0495623_0006098_6994_7722 239
769 3300046680 Ga0495646_0091542 Ga0495646_0091542_908_1636 239
770 3300046681 Ga0495647_0003977 Ga0495647_0003977_3740_4468 239
771 3300046683 Ga0495658_0001135 Ga0495658_0001135_11845_12573 239
772 3300046689 Ga0495613_0039267 Ga0495613_0039267_1578_2306 239
773 3300046690 Ga0495624_0010905 Ga0495624_0010905_2457_3185 239
774 3300046690 Ga0495624_0357850 Ga0495624_0357850_100_864 239
775 3300046691 Ga0495670_0145463 Ga0495670_0145463_283_1020 239
776 3300046809 Ga0495600_0004762 Ga0495600_0004762_1959_2687 239
777 3300047315 Ga0495581_0000621 Ga0495581_0000621_6247_6975 239
778 3300047317 Ga0495604_0078764 Ga0495604_0078764_1326_2054 239
779 3300047317 Ga0495604_0080068 Ga0495604_0080068_321_1046 239
780 3300047319 Ga0495674_0044503 Ga0495674_0044503_1545_2273 239
781 3300047319 Ga0495674_0170653 Ga0495674_0170653_830_1558 239
782 3300047321 Ga0495676_0047778 Ga0495676_0047778_1981_2709 239
783 3300047322 Ga0495680_0043195 Ga0495680_0043195_754_1482 239
784 3300047322 Ga0495680_0045877 Ga0495680_0045877_2527_3255 239
785 3300047322 Ga0495680_0047836 Ga0495680_0047836_718_1443 239
786 3300047444 Ga0495675_0034315 Ga0495675_0034315_531_1259 239
787 3300047444 Ga0495675_0108117 Ga0495675_0108117_183_908 239
788 3300047471 Ga0495684_0019054 Ga0495684_0019054_2181_2909 239
789 3300047471 Ga0495684_0031990 Ga0495684_0031990_1910_2638 239
790 3300047471 Ga0495684_0049805 Ga0495684_0049805_171_896 239
791 3300047673 Ga0495593_0004888 Ga0495593_0004888_5012_5740 239
792 3300048088 Ga0495602_0022328 Ga0495602_0022328_4009_4734 239
793 3300048088 Ga0495602_0086282 Ga0495602_0086282_1589_2317 239
794 3300048088 Ga0495602_0212140 Ga0495602_0212140_159_884 239
795 3300048089 Ga0495614_0014075 Ga0495614_0014075_1744_2472 239
796 3300048903 Ga0496100_0233110 Ga0496100_0233110_282_1016 239
797 3300048903 Ga0496100_0257311 Ga0496100_0257311_504_1241 239
798 3300048903 Ga0496100_0428566 Ga0496100_0428566_249_974 239
799 3300048904 Ga0496101_0038871 Ga0496101_0038871_217_954 239
800 3300048904 Ga0496101_0053929 Ga0496101_0053929_56_790 239
801 3300048904 Ga0496101_0443424 Ga0496101_0443424_151_888 239
802 3300048905 Ga0496102_0043775 Ga0496102_0043775_1279_2016 239
803 3300048905 Ga0496102_0636600 Ga0496102_0636600_223_957 239
804 3300048906 Ga0496103_0293758 Ga0496103_0293758_122_859 239
805 3300048907 Ga0496104_0041192 Ga0496104_0041192_3083_3820 239
806 3300048907 Ga0496104_0762041 Ga0496104_0762041_132_851 239
807 3300048908 Ga0496105_0085711 Ga0496105_0085711_1758_2480 239
808 3300048908 Ga0496105_0228083 Ga0496105_0228083_108_845 239
809 3300048910 Ga0496107_0184584 Ga0496107_0184584_492_1229 239
810 3300048910 Ga0496107_0253879 Ga0496107_0253879_522_1256 239
811 3300048911 Ga0496108_0032801 Ga0496108_0032801_2638_3375 239
812 3300048911 Ga0496108_0183013 Ga0496108_0183013_635_1360 239
813 3300048912 Ga0496109_0012037 Ga0496109_0012037_5916_6653 239
814 3300048912 Ga0496109_0148022 Ga0496109_0148022_1192_1926 239
815 3300048912 Ga0496109_0370241 Ga0496109_0370241_374_1108 239
816 3300048913 Ga0496110_0024974 Ga0496110_0024974_313_1047 239
817 3300048913 Ga0496110_0462075 Ga0496110_0462075_77_814 239
818 3300048914 Ga0496111_0092189 Ga0496111_0092189_339_1073 239
819 3300048914 Ga0496111_0177208 Ga0496111_0177208_413_1153 239
820 3300048914 Ga0496111_0289223 Ga0496111_0289223_227_961 239
821 3300048915 Ga0496112_0238116 Ga0496112_0238116_661_1395 239
822 3300048916 Ga0496113_0427798 Ga0496113_0427798_63_797 239
823 3300048917 Ga0496114_0005838 Ga0496114_0005838_8571_9290 239
824 3300048917 Ga0496114_0006548 Ga0496114_0006548_6050_6787 239
825 3300048917 Ga0496114_0057665 Ga0496114_0057665_294_1028 239
826 3300048917 Ga0496114_0143372 Ga0496114_0143372_53_790 239
827 3300048917 Ga0496114_0179282 Ga0496114_0179282_928_1665 239
828 3300048917 Ga0496114_0329178 Ga0496114_0329178_450_1184 239
829 3300048917 Ga0496114_0356295 Ga0496114_0356295_34_768 239
830 3300048917 Ga0496114_0385358 Ga0496114_0385358_220_969 239
831 3300048917 Ga0496114_0440598 Ga0496114_0440598_207_941 239
832 3300048917 Ga0496114_0462954 Ga0496114_0462954_264_1001 239
833 3300048917 Ga0496114_0466478 Ga0496114_0466478_378_1103 239
834 3300048918 Ga0496115_0043254 Ga0496115_0043254_2618_3352 239
835 3300048918 Ga0496115_0186105 Ga0496115_0186105_108_845 239
836 3300048927 Ga0496124_0253126 Ga0496124_0253126_387_1136 239
837 3300048929 Ga0496126_0426082 Ga0496126_0426082_223_948 239
838 3300049568 Ga0501031_0212989 Ga0501031_0212989_335_1075 239
839 3300049568 Ga0501031_0232436 Ga0501031_0232436_149_880 239
840 3300049569 Ga0501032_0271348 Ga0501032_0271348_313_1050 239
841 3300049570 Ga0501033_0200435 Ga0501033_0200435_78_815 239
842 3300049571 Ga0501034_0008156 Ga0501034_0008156_5137_5859 239
843 3300049572 Ga0501036_0008607 Ga0501036_0008607_2877_3617 239
844 3300049572 Ga0501036_0013280 Ga0501036_0013280_4378_5100 239
845 3300049572 Ga0501036_0027720 Ga0501036_0027720_3865_4602 239
846 3300049572 Ga0501036_0175033 Ga0501036_0175033_315_1058 239
847 3300049572 Ga0501036_0223756 Ga0501036_0223756_388_1164 239
848 3300049572 Ga0501036_0505710 Ga0501036_0505710_177_917 239
849 3300049573 Ga0501037_0123987 Ga0501037_0123987_363_1103 239
850 3300049574 Ga0501038_0035695 Ga0501038_0035695_489_1211 239
851 3300049574 Ga0501038_0040013 Ga0501038_0040013_491_1228 239
852 3300049574 Ga0501038_0619217 Ga0501038_0619217_52_792 239
853 3300049575 Ga0501039_0043657 Ga0501039_0043657_2355_3095 239
854 3300049575 Ga0501039_0355941 Ga0501039_0355941_163_897 239
855 3300049575 Ga0501039_0430367 Ga0501039_0430367_232_1008 239
856 3300049576 Ga0501040_0234028 Ga0501040_0234028_46_786 239
857 3300049576 Ga0501040_0267544 Ga0501040_0267544_192_932 239
858 3300049576 Ga0501040_0356969 Ga0501040_0356969_274_1017 239
859 3300049577 Ga0501041_0245354 Ga0501041_0245354_367_1107 239
860 3300049578 Ga0501042_0009659 Ga0501042_0009659_4321_5058 239
861 3300049578 Ga0501042_0116547 Ga0501042_0116547_783_1511 239
862 3300049578 Ga0501042_0139076 Ga0501042_0139076_449_1189 239
863 3300049579 Ga0501043_0010516 Ga0501043_0010516_5691_6413 239
864 3300049579 Ga0501043_0106695 Ga0501043_0106695_158_895 239
865 3300049580 Ga0501046_0108367 Ga0501046_0108367_1343_2080 239
866 3300049581 Ga0501047_0017471 Ga0501047_0017471_964_1686 239
867 3300049582 Ga0501048_0032249 Ga0501048_0032249_896_1636 239
868 3300049582 Ga0501048_0054767 Ga0501048_0054767_963_1685 239
869 3300049582 Ga0501048_0111534 Ga0501048_0111534_759_1487 239
870 3300049583 Ga0501067_0000937 Ga0501067_0000937_9845_10585 239
871 3300049583 Ga0501067_0043910 Ga0501067_0043910_1073_1813 239
872 3300049583 Ga0501067_0072027 Ga0501067_0072027_269_1000 239
873 3300049583 Ga0501067_0211074 Ga0501067_0211074_180_917 239
874 3300049584 Ga0501068_0116994 Ga0501068_0116994_414_1154 239
875 3300049584 Ga0501068_0189429 Ga0501068_0189429_375_1115 239
876 3300049585 Ga0501069_0061108 Ga0501069_0061108_972_1712 239
877 3300049586 Ga0501070_0014917 Ga0501070_0014917_4226_4981 239
878 3300049586 Ga0501070_0156848 Ga0501070_0156848_363_1085 239
879 3300049586 Ga0501070_0347371 Ga0501070_0347371_325_1071 239
880 3300049587 Ga0501071_0365096 Ga0501071_0365096_147_887 239
881 3300049587 Ga0501071_0440620 Ga0501071_0440620_27_761 239
882 3300049588 Ga0501072_0144642 Ga0501072_0144642_202_942 239
883 3300049588 Ga0501072_0181169 Ga0501072_0181169_905_1645 239
884 3300049589 Ga0501073_0026638 Ga0501073_0026638_2692_3414 239
885 3300049590 Ga0501074_0015528 Ga0501074_0015528_2384_3124 239
886 3300049590 Ga0501074_0026756 Ga0501074_0026756_3258_3998 239
887 3300049592 Ga0501076_0039234 Ga0501076_0039234_85_825 239
888 3300049592 Ga0501076_0262274 Ga0501076_0262274_52_792 239
889 3300049592 Ga0501076_0340354 Ga0501076_0340354_264_992 239
890 3300049593 Ga0501077_0007040 Ga0501077_0007040_5001_5741 239
891 3300049593 Ga0501077_0151572 Ga0501077_0151572_203_943 239
892 3300049741 Ga0501079_0112992 Ga0501079_0112992_832_1572 239
893 3300049741 Ga0501079_0319524 Ga0501079_0319524_255_983 239
894 3300049742 Ga0501080_0009062 Ga0501080_0009062_7881_8621 239
895 3300049742 Ga0501080_0056688 Ga0501080_0056688_72_812 239
896 3300049742 Ga0501080_0133283 Ga0501080_0133283_573_1328 239
897 3300049742 Ga0501080_0167300 Ga0501080_0167300_1138_1869 239
898 3300049743 Ga0501081_0431911 Ga0501081_0431911_217_957 239
899 3300049744 Ga0501083_0033984 Ga0501083_0033984_1582_2322 239
900 3300049822 Ga0501035_0007226 Ga0501035_0007226_9150_9887 239
901 3300049823 Ga0501044_0001740 Ga0501044_0001740_11056_11793 239
902 3300049823 Ga0501044_0027073 Ga0501044_0027073_5167_5889 239
903 3300049824 Ga0501045_0045049 Ga0501045_0045049_2409_3137 239
904 3300049824 Ga0501045_0305520 Ga0501045_0305520_345_1097 239
905 3300050490 nmdc:mga03n38_101440_c1 nmdc:mga03n38_101440_c1_349_1089 239
906 3300050490 nmdc:mga03n38_12549_c1 nmdc:mga03n38_12549_c1_2213_2968 239
907 3300050490 nmdc:mga03n38_16877_c1 nmdc:mga03n38_16877_c1_1469_2215 239
908 3300050490 nmdc:mga03n38_182_c1 nmdc:mga03n38_182_c1_1385_2116 239
909 3300050490 nmdc:mga03n38_52576_c1 nmdc:mga03n38_52576_c1_871_1617 239
910 3300050491 nmdc:mga00v17_103515_c1 nmdc:mga00v17_103515_c1_532_1263 239
911 3300050491 nmdc:mga00v17_15986_c1 nmdc:mga00v17_15986_c1_2767_3522 239
912 3300050491 nmdc:mga00v17_222875_c1 nmdc:mga00v17_222875_c1_28_777 239
913 3300050491 nmdc:mga00v17_4761_c1 nmdc:mga00v17_4761_c1_5470_6201 239
914 3300050491 nmdc:mga00v17_76350_c1 nmdc:mga00v17_76350_c1_354_1094 239
915 3300050491 nmdc:mga00v17_938_c1 nmdc:mga00v17_938_c1_13604_14335 239
916 3300050491 nmdc:mga00v17_9434_c1 nmdc:mga00v17_9434_c1_2522_3268 239
917 3300050492 nmdc:mga0yw44_23554_c1 nmdc:mga0yw44_23554_c1_2485_3225 239
918 3300050492 nmdc:mga0yw44_2602_c1 nmdc:mga0yw44_2602_c1_113_847 239
919 3300050492 nmdc:mga0yw44_434524_c1 nmdc:mga0yw44_434524_c1_110_829 239
920 3300050492 nmdc:mga0yw44_4605_c1 nmdc:mga0yw44_4605_c1_5399_6148 239
921 3300050492 nmdc:mga0yw44_73996_c1 nmdc:mga0yw44_73996_c1_645_1376 239
922 3300050492 nmdc:mga0yw44_97024_c1 nmdc:mga0yw44_97024_c1_292_1047 239
923 3300050494 nmdc:mga06z11_101722_c1 nmdc:mga06z11_101722_c1_703_1458 239
924 3300050494 nmdc:mga06z11_59730_c1 nmdc:mga06z11_59730_c1_524_1270 239
925 3300050494 nmdc:mga06z11_81385_c1 nmdc:mga06z11_81385_c1_962_1693 239
926 3300050495 nmdc:mga04h51_7926_c1 nmdc:mga04h51_7926_c1_674_1420 239
927 3300050496 nmdc:mga07m45_16037_c1 nmdc:mga07m45_16037_c1_68_814 239
928 3300050496 nmdc:mga07m45_20267_c1 nmdc:mga07m45_20267_c1_1339_2070 239
929 3300050496 nmdc:mga07m45_43084_c2 nmdc:mga07m45_43084_c2_227_961 239
930 3300050507 nmdc:mga05p37_688_c1 nmdc:mga05p37_688_c1_30830_31576 239
931 3300050507 nmdc:mga05p37_947_c1 nmdc:mga05p37_947_c1_970_1689 239
932 3300050508 nmdc:mga09592_38_c2 nmdc:mga09592_38_c2_32334_33053 239
933 3300050508 nmdc:mga09592_48606_c1 nmdc:mga09592_48606_c1_347_1066 239
934 3300050509 nmdc:mga0qj67_110810_c1 nmdc:mga0qj67_110810_c1_430_1176 239
935 3300050509 nmdc:mga0qj67_31_c2 nmdc:mga0qj67_31_c2_9316_10035 239
936 3300050510 nmdc:mga06r32_19_c1 nmdc:mga06r32_19_c1_67116_67835 239
937 3300050510 nmdc:mga06r32_282_c1 nmdc:mga06r32_282_c1_10160_10906 239
938 3300053077 Ga0495601_0040369 Ga0495601_0040369_2023_2754 239
939 3300053077 Ga0495601_0070549 Ga0495601_0070549_86_814 239
940 3300053077 Ga0495601_0192570 Ga0495601_0192570_478_1203 239
941 3300053078 Ga0495612_0025097 Ga0495612_0025097_758_1486 239
942 3300053084 Ga0495595_0028265 Ga0495595_0028265_862_1590 239
943 3300053085 Ga0495619_0007037 Ga0495619_0007037_1205_1933 239
944 3300053085 Ga0495619_0016103 Ga0495619_0016103_595_1329 239
945 3300053088 Ga0500644_0000009 Ga0500644_0000009_20790_21533 239
946 3300053100 Ga0500660_164739 Ga0500660_164739_83_805 239
947 3300053102 Ga0500554_030903 Ga0500554_030903_625_1359 239
948 3300053104 Ga0500556_0001531 Ga0500556_0001531_5652_6407 239
949 3300053117 Ga0500593_000177 Ga0500593_000177_22945_23691 239
950 3300053139 Ga0500568_0001114 Ga0500568_0001114_13471_14229 239
951 3300053140 Ga0500573_0102212 Ga0500573_0102212_331_1065 239
952 3300060353 Ga0501082_0023488 Ga0501082_0023488_3864_4604 239
953 3300060353 Ga0501082_0252637 Ga0501082_0252637_217_957 239
954 3300061719 Ga0466962_0003718 Ga0466962_0003718_3632_4396 239
955 3300061719 Ga0466962_0121126 Ga0466962_0121126_48_785 239
956 3300061734 Ga0530510_0181576 Ga0530510_0181576_171_905 239
957 3300061734 Ga0530510_0424942 Ga0530510_0424942_92_844 239
958 iso_pu_bacteria 2537561592 2537898576 239
959 iso_pu_bacteria 2643221641 2644228905 239
960 iso_pu_bacteria 2739367898 2740167025 239
961 iso_pu_bacteria 2808606700 2810363493 239
962 iso_pu_bacteria 2857481737 2857482642 239
963 iso_pu_bacteria 8054609563 8054612764 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

42

268

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9924 1 239
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9887 1 239
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9846 2 239
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9841 1 239
4x2r-assembly1.cif.gz_A crystal structure of pria from actinomyces urogenitalis 0.9837 1 238
ID Description Score Start End Superfamily
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9837 1 238 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9554 1 238 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9397 4 237 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9346 3 238 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9233 3 238 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6I2XYG1-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 1.001 114 239 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A6L6R4J1-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 1 129 239 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A6J7TZ86-F1-model_v4 Unannotated protein 0.9971 127 239 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A132MPP7-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9965 21 239 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A7K0R1I8-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9949 2 238 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.43 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map