F486929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 452 | 1928 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_100224342|Ga0070668_1002243421 |
| Length | 236 |
| Sequence | MAHNSTHLERGVIDRCRRPFQARLSRVSLNGMPVRRKTRKSDTNGYLDGQFLVAMPAMTDKRFARSVIYMCAHSVQGAMGLIVNQRAPHITFPELLGQLSIPGGDNDGEGFEPDLIDLDVHVGGPVETGRGFVLHSSDYFAADSTLPIDDGVSLTATVDILKAIASGKGPDRAILALGYAGWRPGQLESEIQANGWLHCPPDVDLLFDRDLDQKYGRAMSKIGIDPSHLVSEAGHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 109 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 110 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 219 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 278 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 279 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 280 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 281 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 347 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 348 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 400 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 409 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 410 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 411 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 415 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 416 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 417 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 420 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 421 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 422 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 423 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 424 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 425 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 426 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 427 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 428 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 429 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 430 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 431 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 432 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 433 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 434 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 435 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 436 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 437 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 438 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 439 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 440 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 441 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 442 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 443 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 444 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 445 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 446 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 447 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 448 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 449 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 450 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 451 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 452 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.16 |
| Metatranscriptomes | 0.52 |
| Isolates | 3.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.15 |
| Nodule | 1.45 |
| Rhizoplane | 7.26 |
| Rhizosphere | 81.95 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 0.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070668_100224342 | 3300005347 | Bacteria | 1551 |
| 2 | JGI24741J21665_1030462 | 3300001915 | Bacteria | 809 |
| 3 | JGI24746J21847_1019977 | 3300001977 | Bacteria | 942 |
| 4 | JGI24740J21852_10002543 | 3300001979 | Bacteria | 8224 |
| 5 | JGI24739J22299_10014798 | 3300001989 | Bacteria | 2837 |
| 6 | JGI24737J22298_10024313 | 3300001990 | Bacteria | 1919 |
| 7 | JGI24743J22301_10048055 | 3300001991 | Bacteria | 866 |
| 8 | JGI24735J21928_10042004 | 3300002067 | Bacteria | 1332 |
| 9 | JGI24738J21930_10031365 | 3300002075 | Bacteria | 1084 |
| 10 | JGI24749J21850_1027232 | 3300002076 | Bacteria | 816 |
| 11 | JGI24744J21845_10016801 | 3300002077 | Bacteria | 1456 |
| 12 | JGI24034J26672_10037342 | 3300002239 | Bacteria | 808 |
| 13 | JGI24751J29686_10048208 | 3300002459 | Bacteria | 879 |
| 14 | JGI25406J46586_10038370 | 3300003203 | Bacteria | 1717 |
| 15 | JGI25153J46596_10019231 | 3300003215 | Bacteria | 2623 |
| 16 | rootH1_10040793 | 3300003323 | Bacteria | 5038 |
| 17 | Ga0055539_1022387 | 3300003752 | Bacteria | 746 |
| 18 | Ga0055530_10018980 | 3300003791 | Bacteria | 2098 |
| 19 | Ga0055531_10004299 | 3300003794 | Bacteria | 8731 |
| 20 | Ga0065165_1002916 | 3300005262 | Bacteria | 13077 |
| 21 | Ga0065712_10297111 | 3300005290 | Bacteria | 864 |
| 22 | Ga0070676_10106354 | 3300005328 | Bacteria | 1741 |
| 23 | Ga0070690_100000132 | 3300005330 | Bacteria | 38694 |
| 24 | Ga0070670_100019173 | 3300005331 | Bacteria | 5866 |
| 25 | Ga0070666_10005308 | 3300005335 | Bacteria | 7895 |
| 26 | Ga0070666_10606610 | 3300005335 | Bacteria | 799 |
| 27 | Ga0070680_100009699 | 3300005336 | Bacteria | 7408 |
| 28 | Ga0070682_100012548 | 3300005337 | Bacteria | 4860 |
| 29 | Ga0070682_100109989 | 3300005337 | Bacteria | 1835 |
| 30 | Ga0068868_100003681 | 3300005338 | Bacteria | 10710 |
| 31 | Ga0070660_100000566 | 3300005339 | Bacteria | 24792 |
| 32 | Ga0070689_100010934 | 3300005340 | Bacteria | 6486 |
| 33 | Ga0070689_100366989 | 3300005340 | Bacteria | 1211 |
| 34 | Ga0070691_10002290 | 3300005341 | Bacteria | 8480 |
| 35 | Ga0070691_10047138 | 3300005341 | Bacteria | 2049 |
| 36 | Ga0070687_100245736 | 3300005343 | Bacteria | 1109 |
| 37 | Ga0070661_100001081 | 3300005344 | Bacteria | 19286 |
| 38 | Ga0070692_10000077 | 3300005345 | Bacteria | 20285 |
| 39 | Ga0070668_100007631 | 3300005347 | Bacteria | 8028 |
| 40 | Ga0070668_100514555 | 3300005347 | Bacteria | 1038 |
| 41 | Ga0070669_100001786 | 3300005353 | Bacteria | 15475 |
| 42 | Ga0070675_100001964 | 3300005354 | Bacteria | 15219 |
| 43 | Ga0070671_100008228 | 3300005355 | Bacteria | 8346 |
| 44 | Ga0070671_100281621 | 3300005355 | Bacteria | 1414 |
| 45 | Ga0070674_100001960 | 3300005356 | Bacteria | 11248 |
| 46 | Ga0070674_100560326 | 3300005356 | Bacteria | 960 |
| 47 | Ga0070674_100988936 | 3300005356 | Bacteria | 738 |
| 48 | Ga0070673_100001024 | 3300005364 | Bacteria | 15818 |
| 49 | Ga0070673_100418324 | 3300005364 | Bacteria | 1201 |
| 50 | Ga0070688_100000125 | 3300005365 | Bacteria | 40976 |
| 51 | Ga0070688_100422402 | 3300005365 | Bacteria | 991 |
| 52 | Ga0070659_100003247 | 3300005366 | Bacteria | 11571 |
| 53 | Ga0070667_100001803 | 3300005367 | Bacteria | 19053 |
| 54 | Ga0070667_100415388 | 3300005367 | Bacteria | 1226 |
| 55 | Ga0070709_10000375 | 3300005434 | Bacteria | 27523 |
| 56 | Ga0070709_10001030 | 3300005434 | Bacteria | 15418 |
| 57 | Ga0070714_100011184 | 3300005435 | Bacteria | 7115 |
| 58 | Ga0070714_100321708 | 3300005435 | Bacteria | 1447 |
| 59 | Ga0070714_100644657 | 3300005435 | Bacteria | 1019 |
| 60 | Ga0070714_100751108 | 3300005435 | Bacteria | 943 |
| 61 | Ga0070713_100026017 | 3300005436 | Bacteria | 4587 |
| 62 | Ga0070713_100045651 | 3300005436 | Bacteria | 3592 |
| 63 | Ga0070710_10014142 | 3300005437 | Bacteria | 4011 |
| 64 | Ga0070710_10027576 | 3300005437 | Bacteria | 3031 |
| 65 | Ga0070701_10000761 | 3300005438 | Bacteria | 11491 |
| 66 | Ga0070711_100000898 | 3300005439 | Bacteria | 15668 |
| 67 | Ga0070711_100438539 | 3300005439 | Bacteria | 1067 |
| 68 | Ga0070711_100550372 | 3300005439 | Bacteria | 957 |
| 69 | Ga0070705_100001091 | 3300005440 | Bacteria | 15071 |
| 70 | Ga0070700_100026631 | 3300005441 | Bacteria | 3418 |
| 71 | Ga0070694_100002073 | 3300005444 | Bacteria | 11899 |
| 72 | Ga0070663_100093492 | 3300005455 | Bacteria | 2231 |
| 73 | Ga0070663_100104498 | 3300005455 | Bacteria | 2119 |
| 74 | Ga0070663_100644734 | 3300005455 | Unclassified | 895 |
| 75 | Ga0070678_100000369 | 3300005456 | Bacteria | 21044 |
| 76 | Ga0070662_100028337 | 3300005457 | Bacteria | 3896 |
| 77 | Ga0070662_100728955 | 3300005457 | Bacteria | 840 |
| 78 | Ga0070681_10055923 | 3300005458 | Bacteria | 3928 |
| 79 | Ga0068867_100212339 | 3300005459 | Bacteria | 1555 |
| 80 | Ga0070685_10639340 | 3300005466 | Bacteria | 770 |
| 81 | Ga0070706_100142204 | 3300005467 | Bacteria | 2239 |
| 82 | Ga0070707_100545279 | 3300005468 | Bacteria | 1122 |
| 83 | Ga0070699_100424239 | 3300005518 | Bacteria | 1204 |
| 84 | Ga0070679_100142265 | 3300005530 | Bacteria | 2377 |
| 85 | Ga0070684_100001508 | 3300005535 | Bacteria | 16819 |
| 86 | Ga0070684_100517204 | 3300005535 | Bacteria | 1106 |
| 87 | Ga0070684_100619092 | 3300005535 | Bacteria | 1007 |
| 88 | Ga0070697_100005000 | 3300005536 | Bacteria | 10181 |
| 89 | Ga0070697_100867908 | 3300005536 | Bacteria | 800 |
| 90 | Ga0068853_100000997 | 3300005539 | Bacteria | 19938 |
| 91 | Ga0068853_100003336 | 3300005539 | Bacteria | 12288 |
| 92 | Ga0068853_100239292 | 3300005539 | Bacteria | 1663 |
| 93 | Ga0068853_100353668 | 3300005539 | Bacteria | 1367 |
| 94 | Ga0070672_100020079 | 3300005543 | Bacteria | 4867 |
| 95 | Ga0070686_100001627 | 3300005544 | Bacteria | 12561 |
| 96 | Ga0070695_100000694 | 3300005545 | Bacteria | 17997 |
| 97 | Ga0070696_100006259 | 3300005546 | Bacteria | 7968 |
| 98 | Ga0070696_100204330 | 3300005546 | Bacteria | 1476 |
| 99 | Ga0070696_100209924 | 3300005546 | Bacteria | 1457 |
| 100 | Ga0070696_100478701 | 3300005546 | Bacteria | 987 |
| 101 | Ga0070693_100000962 | 3300005547 | Bacteria | 12774 |
| 102 | Ga0070693_100470622 | 3300005547 | Bacteria | 886 |
| 103 | Ga0070665_100023123 | 3300005548 | Bacteria | 6262 |
| 104 | Ga0070665_100134094 | 3300005548 | Bacteria | 2478 |
| 105 | Ga0070665_100453837 | 3300005548 | Bacteria | 1291 |
| 106 | Ga0070704_100000146 | 3300005549 | Bacteria | 26878 |
| 107 | Ga0070704_100157354 | 3300005549 | Bacteria | 1793 |
| 108 | Ga0070704_100203321 | 3300005549 | Bacteria | 1600 |
| 109 | Ga0070704_100678602 | 3300005549 | Bacteria | 912 |
| 110 | Ga0068855_100290295 | 3300005563 | Bacteria | 1813 |
| 111 | Ga0068855_100837575 | 3300005563 | Bacteria | 975 |
| 112 | Ga0070664_100000194 | 3300005564 | Bacteria | 43008 |
| 113 | Ga0068857_100000347 | 3300005577 | Bacteria | 31990 |
| 114 | Ga0068857_100014557 | 3300005577 | Bacteria | 6861 |
| 115 | Ga0068854_100002339 | 3300005578 | Bacteria | 11682 |
| 116 | Ga0068856_100003776 | 3300005614 | Bacteria | 15173 |
| 117 | Ga0068856_100005030 | 3300005614 | Bacteria | 13091 |
| 118 | Ga0068856_100860372 | 3300005614 | Bacteria | 926 |
| 119 | Ga0070702_100002264 | 3300005615 | Bacteria | 8229 |
| 120 | Ga0070702_100066164 | 3300005615 | Bacteria | 2119 |
| 121 | Ga0068852_100030567 | 3300005616 | Bacteria | 4436 |
| 122 | Ga0068852_100158800 | 3300005616 | Bacteria | 2109 |
| 123 | Ga0068859_100009233 | 3300005617 | Bacteria | 9963 |
| 124 | Ga0068859_100285657 | 3300005617 | Bacteria | 1743 |
| 125 | Ga0068859_100300339 | 3300005617 | Bacteria | 1699 |
| 126 | Ga0068859_100442615 | 3300005617 | Bacteria | 1396 |
| 127 | Ga0068864_100008194 | 3300005618 | Bacteria | 8617 |
| 128 | Ga0068864_100450929 | 3300005618 | Bacteria | 1230 |
| 129 | Ga0068866_10001158 | 3300005718 | Bacteria | 11595 |
| 130 | Ga0068866_10052173 | 3300005718 | Bacteria | 2086 |
| 131 | Ga0068866_10292869 | 3300005718 | Bacteria | 1013 |
| 132 | Ga0068861_100003098 | 3300005719 | Bacteria | 10989 |
| 133 | Ga0068861_100036198 | 3300005719 | Bacteria | 3662 |
| 134 | Ga0068861_100209304 | 3300005719 | Bacteria | 1642 |
| 135 | Ga0068861_100373801 | 3300005719 | Bacteria | 1257 |
| 136 | Ga0068851_10001831 | 3300005834 | Bacteria | 9313 |
| 137 | Ga0068851_10012565 | 3300005834 | Bacteria | 3994 |
| 138 | Ga0068863_100009936 | 3300005841 | Bacteria | 9265 |
| 139 | Ga0068863_100843405 | 3300005841 | Bacteria | 915 |
| 140 | Ga0068858_100005670 | 3300005842 | Bacteria | 12203 |
| 141 | Ga0068858_100031377 | 3300005842 | Bacteria | 4935 |
| 142 | Ga0068858_100090802 | 3300005842 | Bacteria | 2843 |
| 143 | Ga0068858_100380904 | 3300005842 | Bacteria | 1354 |
| 144 | Ga0068858_101184832 | 3300005842 | Bacteria | 751 |
| 145 | Ga0068860_100000411 | 3300005843 | Bacteria | 55810 |
| 146 | Ga0068860_100007100 | 3300005843 | Bacteria | 11206 |
| 147 | Ga0068860_100221871 | 3300005843 | Bacteria | 1836 |
| 148 | Ga0068860_100391229 | 3300005843 | Bacteria | 1374 |
| 149 | Ga0068862_100000967 | 3300005844 | Bacteria | 27645 |
| 150 | Ga0081455_10002674 | 3300005937 | Bacteria | 21063 |
| 151 | Ga0081455_10009824 | 3300005937 | Bacteria | 9800 |
| 152 | Ga0081540_1133943 | 3300005983 | Bacteria | 1006 |
| 153 | Ga0081539_10001094 | 3300005985 | Bacteria | 49286 |
| 154 | Ga0081539_10032156 | 3300005985 | Bacteria | 3218 |
| 155 | Ga0070717_10026943 | 3300006028 | Bacteria | 4590 |
| 156 | Ga0075368_10104777 | 3300006042 | Bacteria | 1163 |
| 157 | Ga0075432_10041098 | 3300006058 | Bacteria | 1614 |
| 158 | Ga0070715_10000091 | 3300006163 | Bacteria | 22194 |
| 159 | Ga0070715_10165602 | 3300006163 | Bacteria | 1096 |
| 160 | Ga0070716_100011336 | 3300006173 | Bacteria | 4488 |
| 161 | Ga0070716_100175226 | 3300006173 | Bacteria | 1403 |
| 162 | Ga0070712_100001007 | 3300006175 | Bacteria | 16978 |
| 163 | Ga0070712_100011722 | 3300006175 | Bacteria | 5569 |
| 164 | Ga0070712_100142395 | 3300006175 | Bacteria | 1831 |
| 165 | Ga0075367_10008319 | 3300006178 | Bacteria | 5372 |
| 166 | Ga0068871_100129675 | 3300006358 | Bacteria | 2137 |
| 167 | Ga0075428_100003217 | 3300006844 | Bacteria | 17869 |
| 168 | Ga0075428_100049289 | 3300006844 | Bacteria | 4620 |
| 169 | Ga0075428_100272294 | 3300006844 | Bacteria | 1822 |
| 170 | Ga0075428_100360956 | 3300006844 | Bacteria | 1558 |
| 171 | Ga0075430_100046367 | 3300006846 | Bacteria | 3671 |
| 172 | Ga0075430_100376934 | 3300006846 | Bacteria | 1171 |
| 173 | Ga0075430_100389731 | 3300006846 | Bacteria | 1150 |
| 174 | Ga0075431_100003293 | 3300006847 | Bacteria | 15635 |
| 175 | Ga0075431_100016100 | 3300006847 | Bacteria | 7586 |
| 176 | Ga0075431_100111480 | 3300006847 | Bacteria | 2823 |
| 177 | Ga0075431_100152635 | 3300006847 | Unclassified | 2378 |
| 178 | Ga0075431_100248756 | 3300006847 | Bacteria | 1807 |
| 179 | Ga0075431_100466138 | 3300006847 | Bacteria | 1257 |
| 180 | Ga0075433_10110340 | 3300006852 | Bacteria | 2440 |
| 181 | Ga0075433_10112477 | 3300006852 | Bacteria | 2415 |
| 182 | Ga0075433_10344997 | 3300006852 | Bacteria | 1316 |
| 183 | Ga0075433_10618869 | 3300006852 | Bacteria | 950 |
| 184 | Ga0075434_100000437 | 3300006871 | Bacteria | 30944 |
| 185 | Ga0075434_100018921 | 3300006871 | Bacteria | 6657 |
| 186 | Ga0075434_100187972 | 3300006871 | Bacteria | 2086 |
| 187 | Ga0075434_100590849 | 3300006871 | Bacteria | 1129 |
| 188 | Ga0075434_100696917 | 3300006871 | Bacteria | 1033 |
| 189 | Ga0075429_100031335 | 3300006880 | Bacteria | 4621 |
| 190 | Ga0068865_100031517 | 3300006881 | Bacteria | 3535 |
| 191 | Ga0068865_100157725 | 3300006881 | Bacteria | 1728 |
| 192 | Ga0068865_100226447 | 3300006881 | Bacteria | 1464 |
| 193 | Ga0075436_100002170 | 3300006914 | Bacteria | 13524 |
| 194 | Ga0097620_100009234 | 3300006931 | Bacteria | 9963 |
| 195 | Ga0097620_100285675 | 3300006931 | Bacteria | 1743 |
| 196 | Ga0097620_100300341 | 3300006931 | Bacteria | 1699 |
| 197 | Ga0097620_100442602 | 3300006931 | Bacteria | 1396 |
| 198 | Ga0099825_1019570 | 3300006941 | Bacteria | 5017 |
| 199 | Ga0099823_1026161 | 3300006944 | Bacteria | 5175 |
| 200 | Ga0079104_1000010 | 3300006946 | Bacteria | 366021 |
| 201 | Ga0075435_100009318 | 3300007076 | Bacteria | 7100 |
| 202 | Ga0075435_100015409 | 3300007076 | Bacteria | 5747 |
| 203 | Ga0075435_100044849 | 3300007076 | Bacteria | 3543 |
| 204 | Ga0075435_100133732 | 3300007076 | Bacteria | 2076 |
| 205 | Ga0105250_10006562 | 3300009092 | Bacteria | 5070 |
| 206 | Ga0105240_10006744 | 3300009093 | Bacteria | 16809 |
| 207 | Ga0105240_10024137 | 3300009093 | Bacteria | 8025 |
| 208 | Ga0105240_10145276 | 3300009093 | Bacteria | 2831 |
| 209 | Ga0105240_10760180 | 3300009093 | Bacteria | 1053 |
| 210 | Ga0105240_10983235 | 3300009093 | Bacteria | 903 |
| 211 | Ga0111539_10007284 | 3300009094 | Bacteria | 14165 |
| 212 | Ga0111539_10010676 | 3300009094 | Bacteria | 11565 |
| 213 | Ga0111539_10096054 | 3300009094 | Bacteria | 3481 |
| 214 | Ga0111539_10797157 | 3300009094 | Bacteria | 1099 |
| 215 | Ga0111539_10972591 | 3300009094 | Bacteria | 987 |
| 216 | Ga0105245_10002335 | 3300009098 | Bacteria | 17159 |
| 217 | Ga0105245_10183784 | 3300009098 | Bacteria | 1999 |
| 218 | Ga0105247_10001750 | 3300009101 | Bacteria | 15298 |
| 219 | Ga0105247_10017506 | 3300009101 | Bacteria | 4298 |
| 220 | Ga0105247_10060649 | 3300009101 | Bacteria | 2344 |
| 221 | Ga0105247_10545903 | 3300009101 | Bacteria | 851 |
| 222 | Ga0114129_10086909 | 3300009147 | Bacteria | 4336 |
| 223 | Ga0114129_10127955 | 3300009147 | Bacteria | 3491 |
| 224 | Ga0114129_10161059 | 3300009147 | Bacteria | 3065 |
| 225 | Ga0114129_10392048 | 3300009147 | Bacteria | 1831 |
| 226 | Ga0114129_11320514 | 3300009147 | Bacteria | 893 |
| 227 | Ga0105243_10005199 | 3300009148 | Bacteria | 10186 |
| 228 | Ga0105243_10048819 | 3300009148 | Bacteria | 3338 |
| 229 | Ga0105243_10762445 | 3300009148 | Unclassified | 950 |
| 230 | Ga0105241_10001223 | 3300009174 | Bacteria | 19645 |
| 231 | Ga0105241_10002644 | 3300009174 | Bacteria | 13413 |
| 232 | Ga0105241_10307619 | 3300009174 | Bacteria | 1362 |
| 233 | Ga0105242_10001958 | 3300009176 | Bacteria | 16205 |
| 234 | Ga0105242_10158609 | 3300009176 | Bacteria | 1978 |
| 235 | Ga0105242_10435239 | 3300009176 | Bacteria | 1232 |
| 236 | Ga0105248_10004605 | 3300009177 | Bacteria | 15262 |
| 237 | Ga0105248_10102427 | 3300009177 | Bacteria | 3227 |
| 238 | Ga0105237_10000852 | 3300009545 | Bacteria | 41478 |
| 239 | Ga0105237_10112552 | 3300009545 | Bacteria | 2714 |
| 240 | Ga0105237_10124000 | 3300009545 | Bacteria | 2578 |
| 241 | Ga0105237_10357565 | 3300009545 | Bacteria | 1464 |
| 242 | Ga0105237_10368819 | 3300009545 | Bacteria | 1440 |
| 243 | Ga0105238_10000517 | 3300009551 | Bacteria | 40562 |
| 244 | Ga0105238_10086951 | 3300009551 | Bacteria | 3113 |
| 245 | Ga0105238_10444815 | 3300009551 | Bacteria | 1292 |
| 246 | Ga0105249_10001834 | 3300009553 | Bacteria | 18468 |
| 247 | Ga0105249_10012163 | 3300009553 | Bacteria | 7578 |
| 248 | Ga0105249_10315285 | 3300009553 | Bacteria | 1573 |
| 249 | Ga0105249_11188251 | 3300009553 | Bacteria | 834 |
| 250 | Ga0105239_10002648 | 3300010375 | Bacteria | 22602 |
| 251 | Ga0105239_10004780 | 3300010375 | Bacteria | 16073 |
| 252 | Ga0105239_10136885 | 3300010375 | Bacteria | 2727 |
| 253 | Ga0105239_11635832 | 3300010375 | Bacteria | 745 |
| 254 | Ga0105246_10000433 | 3300011119 | Bacteria | 22347 |
| 255 | Ga0105246_10761418 | 3300011119 | Bacteria | 855 |
| 256 | Ga0157342_1002313 | 3300012507 | Bacteria | 1535 |
| 257 | Ga0157373_10011762 | 3300013100 | Bacteria | 6429 |
| 258 | Ga0157371_10006258 | 3300013102 | Bacteria | 9860 |
| 259 | Ga0157370_10101893 | 3300013104 | Bacteria | 2689 |
| 260 | Ga0157370_10212000 | 3300013104 | Bacteria | 1795 |
| 261 | Ga0157369_10001745 | 3300013105 | Bacteria | 26370 |
| 262 | Ga0157369_10034677 | 3300013105 | Bacteria | 5535 |
| 263 | Ga0157369_10096092 | 3300013105 | Bacteria | 3161 |
| 264 | Ga0157374_10059981 | 3300013296 | Bacteria | 3559 |
| 265 | Ga0157378_10001283 | 3300013297 | Bacteria | 22595 |
| 266 | Ga0157378_10015568 | 3300013297 | Bacteria | 6660 |
| 267 | Ga0157378_10038277 | 3300013297 | Bacteria | 4250 |
| 268 | Ga0157378_10368422 | 3300013297 | Bacteria | 1408 |
| 269 | Ga0163162_10002987 | 3300013306 | Bacteria | 16152 |
| 270 | Ga0163162_10027188 | 3300013306 | Bacteria | 5657 |
| 271 | Ga0157372_10001332 | 3300013307 | Bacteria | 26676 |
| 272 | Ga0157372_10145389 | 3300013307 | Bacteria | 2734 |
| 273 | Ga0157375_10003129 | 3300013308 | Bacteria | 14370 |
| 274 | Ga0157375_10021721 | 3300013308 | Bacteria | 5892 |
| 275 | Ga0157375_10114079 | 3300013308 | Bacteria | 2804 |
| 276 | Ga0157375_10187567 | 3300013308 | Bacteria | 2222 |
| 277 | Ga0157375_10564642 | 3300013308 | Bacteria | 1299 |
| 278 | Ga0163163_10004852 | 3300014325 | Bacteria | 11559 |
| 279 | Ga0163163_10145567 | 3300014325 | Bacteria | 2413 |
| 280 | Ga0163163_10176903 | 3300014325 | Bacteria | 2180 |
| 281 | Ga0157380_10004603 | 3300014326 | Bacteria | 9580 |
| 282 | Ga0157380_10094327 | 3300014326 | Bacteria | 2477 |
| 283 | Ga0157380_10804673 | 3300014326 | Bacteria | 957 |
| 284 | Ga0157377_10010256 | 3300014745 | Bacteria | 4627 |
| 285 | Ga0157379_10002584 | 3300014968 | Bacteria | 15210 |
| 286 | Ga0157379_10043870 | 3300014968 | Bacteria | 3992 |
| 287 | Ga0157379_10056547 | 3300014968 | Bacteria | 3505 |
| 288 | Ga0157379_10157016 | 3300014968 | Bacteria | 2052 |
| 289 | Ga0157379_10414404 | 3300014968 | Bacteria | 1240 |
| 290 | Ga0157376_10000538 | 3300014969 | Bacteria | 24411 |
| 291 | Ga0157376_10024288 | 3300014969 | Bacteria | 4756 |
| 292 | Ga0157376_10036787 | 3300014969 | Bacteria | 3968 |
| 293 | Ga0163161_10000490 | 3300017792 | Bacteria | 32523 |
| 294 | Ga0206350_11192583 | 3300020080 | Bacteria | 923 |
| 295 | Ga0206354_10816019 | 3300020081 | Bacteria | 911 |
| 296 | Ga0206354_11350350 | 3300020081 | Bacteria | 1698 |
| 297 | Ga0213876_10225003 | 3300021384 | Bacteria | 997 |
| 298 | Ga0224712_10035877 | 3300022467 | Bacteria | 1834 |
| 299 | Ga0224712_10150869 | 3300022467 | Bacteria | 1030 |
| 300 | Ga0209677_101450 | 3300025253 | Bacteria | 10255 |
| 301 | Ga0209233_1005932 | 3300025261 | Bacteria | 3999 |
| 302 | Ga0209455_1001576 | 3300025272 | Bacteria | 10047 |
| 303 | Ga0209455_1003672 | 3300025272 | Bacteria | 5321 |
| 304 | Ga0209676_1009741 | 3300025292 | Bacteria | 4104 |
| 305 | Ga0209758_1004272 | 3300025297 | Bacteria | 12068 |
| 306 | Ga0209758_1038102 | 3300025297 | Bacteria | 1849 |
| 307 | Ga0209051_1003930 | 3300025303 | Bacteria | 9469 |
| 308 | Ga0209257_1006738 | 3300025304 | Bacteria | 7251 |
| 309 | Ga0207656_10003508 | 3300025321 | Bacteria | 5395 |
| 310 | Ga0207653_10006535 | 3300025885 | Bacteria | 3641 |
| 311 | Ga0207692_10005648 | 3300025898 | Bacteria | 5022 |
| 312 | Ga0207692_10007364 | 3300025898 | Bacteria | 4512 |
| 313 | Ga0207642_10061365 | 3300025899 | Bacteria | 1748 |
| 314 | Ga0207642_10187493 | 3300025899 | Bacteria | 1132 |
| 315 | Ga0207710_10006549 | 3300025900 | Bacteria | 4963 |
| 316 | Ga0207710_10064626 | 3300025900 | Bacteria | 1667 |
| 317 | Ga0207710_10084680 | 3300025900 | Bacteria | 1476 |
| 318 | Ga0207688_10001250 | 3300025901 | Bacteria | 13206 |
| 319 | Ga0207680_10028076 | 3300025903 | Bacteria | 3144 |
| 320 | Ga0207680_10255972 | 3300025903 | Bacteria | 1210 |
| 321 | Ga0207647_10003291 | 3300025904 | Bacteria | 12131 |
| 322 | Ga0207685_10002881 | 3300025905 | Bacteria | 4055 |
| 323 | Ga0207699_10008987 | 3300025906 | Bacteria | 4952 |
| 324 | Ga0207645_10075195 | 3300025907 | Bacteria | 2162 |
| 325 | Ga0207645_10117787 | 3300025907 | Bacteria | 1723 |
| 326 | Ga0207684_10138260 | 3300025910 | Bacteria | 2093 |
| 327 | Ga0207654_10000248 | 3300025911 | Bacteria | 32761 |
| 328 | Ga0207654_10029250 | 3300025911 | Bacteria | 3014 |
| 329 | Ga0207707_10027159 | 3300025912 | Bacteria | 5005 |
| 330 | Ga0207695_10000343 | 3300025913 | Bacteria | 107739 |
| 331 | Ga0207695_10049026 | 3300025913 | Bacteria | 4455 |
| 332 | Ga0207695_10213787 | 3300025913 | Bacteria | 1838 |
| 333 | Ga0207671_10011331 | 3300025914 | Bacteria | 7263 |
| 334 | Ga0207671_10234084 | 3300025914 | Bacteria | 1442 |
| 335 | Ga0207671_10239771 | 3300025914 | Bacteria | 1424 |
| 336 | Ga0207671_10387416 | 3300025914 | Bacteria | 1111 |
| 337 | Ga0207693_10000412 | 3300025915 | Bacteria | 38871 |
| 338 | Ga0207693_10047106 | 3300025915 | Bacteria | 3388 |
| 339 | Ga0207693_10078258 | 3300025915 | Bacteria | 2588 |
| 340 | Ga0207693_10780288 | 3300025915 | Bacteria | 737 |
| 341 | Ga0207663_10000871 | 3300025916 | Bacteria | 13709 |
| 342 | Ga0207663_10068191 | 3300025916 | Bacteria | 2284 |
| 343 | Ga0207660_10006910 | 3300025917 | Bacteria | 7346 |
| 344 | Ga0207662_10011701 | 3300025918 | Bacteria | 4874 |
| 345 | Ga0207657_10000047 | 3300025919 | Bacteria | 111686 |
| 346 | Ga0207657_10421461 | 3300025919 | Bacteria | 1049 |
| 347 | Ga0207649_10004715 | 3300025920 | Bacteria | 7380 |
| 348 | Ga0207652_10439393 | 3300025921 | Bacteria | 1176 |
| 349 | Ga0207681_10017352 | 3300025923 | Bacteria | 4519 |
| 350 | Ga0207694_10000136 | 3300025924 | Bacteria | 74908 |
| 351 | Ga0207650_10038148 | 3300025925 | Bacteria | 3506 |
| 352 | Ga0207659_10043668 | 3300025926 | Bacteria | 3150 |
| 353 | Ga0207687_10015831 | 3300025927 | Bacteria | 4949 |
| 354 | Ga0207687_10250573 | 3300025927 | Bacteria | 1408 |
| 355 | Ga0207700_10089733 | 3300025928 | Bacteria | 2424 |
| 356 | Ga0207700_10288808 | 3300025928 | Bacteria | 1413 |
| 357 | Ga0207700_10313751 | 3300025928 | Bacteria | 1357 |
| 358 | Ga0207700_10341238 | 3300025928 | Bacteria | 1302 |
| 359 | Ga0207664_10047350 | 3300025929 | Bacteria | 3377 |
| 360 | Ga0207664_10456874 | 3300025929 | Bacteria | 1140 |
| 361 | Ga0207644_10005779 | 3300025931 | Bacteria | 8050 |
| 362 | Ga0207690_10001352 | 3300025932 | Bacteria | 15387 |
| 363 | Ga0207706_10000079 | 3300025933 | Bacteria | 100592 |
| 364 | Ga0207686_10016453 | 3300025934 | Bacteria | 4153 |
| 365 | Ga0207686_10421171 | 3300025934 | Bacteria | 1021 |
| 366 | Ga0207709_10702857 | 3300025935 | Bacteria | 809 |
| 367 | Ga0207670_10120631 | 3300025936 | Bacteria | 1905 |
| 368 | Ga0207670_10232883 | 3300025936 | Bacteria | 1415 |
| 369 | Ga0207669_10004194 | 3300025937 | Bacteria | 6319 |
| 370 | Ga0207704_10001638 | 3300025938 | Bacteria | 10043 |
| 371 | Ga0207704_10378610 | 3300025938 | Bacteria | 1110 |
| 372 | Ga0207665_10000268 | 3300025939 | Bacteria | 35929 |
| 373 | Ga0207665_10059641 | 3300025939 | Bacteria | 2583 |
| 374 | Ga0207691_10024140 | 3300025940 | Bacteria | 5718 |
| 375 | Ga0207691_10494572 | 3300025940 | Bacteria | 1039 |
| 376 | Ga0207711_10150173 | 3300025941 | Bacteria | 2102 |
| 377 | Ga0207711_10180935 | 3300025941 | Bacteria | 1917 |
| 378 | Ga0207689_10119881 | 3300025942 | Bacteria | 2164 |
| 379 | Ga0207689_10553071 | 3300025942 | Bacteria | 967 |
| 380 | Ga0207689_10752738 | 3300025942 | Bacteria | 822 |
| 381 | Ga0207661_10000613 | 3300025944 | Bacteria | 22875 |
| 382 | Ga0207661_10438663 | 3300025944 | Bacteria | 1188 |
| 383 | Ga0207679_10015477 | 3300025945 | Bacteria | 5042 |
| 384 | Ga0207667_10016518 | 3300025949 | Bacteria | 8337 |
| 385 | Ga0207667_10144695 | 3300025949 | Bacteria | 2447 |
| 386 | Ga0207667_10324472 | 3300025949 | Bacteria | 1572 |
| 387 | Ga0207667_11050626 | 3300025949 | Bacteria | 800 |
| 388 | Ga0207651_10204300 | 3300025960 | Bacteria | 1585 |
| 389 | Ga0207651_10369507 | 3300025960 | Bacteria | 1213 |
| 390 | Ga0207712_10003528 | 3300025961 | Bacteria | 9865 |
| 391 | Ga0207712_10044532 | 3300025961 | Bacteria | 3067 |
| 392 | Ga0207668_10005573 | 3300025972 | Bacteria | 7422 |
| 393 | Ga0207668_10385290 | 3300025972 | Bacteria | 1181 |
| 394 | Ga0207668_10783147 | 3300025972 | Bacteria | 843 |
| 395 | Ga0207640_10080850 | 3300025981 | Bacteria | 2220 |
| 396 | Ga0207658_10050845 | 3300025986 | Bacteria | 3051 |
| 397 | Ga0207658_10372810 | 3300025986 | Bacteria | 1248 |
| 398 | Ga0207677_10446490 | 3300026023 | Bacteria | 1107 |
| 399 | Ga0207703_10010804 | 3300026035 | Bacteria | 7123 |
| 400 | Ga0207703_10030237 | 3300026035 | Bacteria | 4279 |
| 401 | Ga0207703_10316506 | 3300026035 | Bacteria | 1428 |
| 402 | Ga0207703_10466547 | 3300026035 | Bacteria | 1181 |
| 403 | Ga0207639_10100681 | 3300026041 | Bacteria | 2335 |
| 404 | Ga0207639_10216336 | 3300026041 | Bacteria | 1652 |
| 405 | Ga0207639_10547664 | 3300026041 | Bacteria | 1062 |
| 406 | Ga0207639_10769344 | 3300026041 | Bacteria | 896 |
| 407 | Ga0207678_10000392 | 3300026067 | Bacteria | 39947 |
| 408 | Ga0207678_10355197 | 3300026067 | Bacteria | 1264 |
| 409 | Ga0207708_10002311 | 3300026075 | Bacteria | 14019 |
| 410 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 411 | Ga0207702_10025691 | 3300026078 | Bacteria | 4889 |
| 412 | Ga0207702_10169114 | 3300026078 | Bacteria | 2003 |
| 413 | Ga0207702_10228686 | 3300026078 | Bacteria | 1737 |
| 414 | Ga0207641_10004680 | 3300026088 | Bacteria | 11806 |
| 415 | Ga0207641_10187007 | 3300026088 | Bacteria | 1901 |
| 416 | Ga0207641_10692234 | 3300026088 | Bacteria | 1003 |
| 417 | Ga0207648_10130384 | 3300026089 | Bacteria | 2213 |
| 418 | Ga0207648_10285393 | 3300026089 | Bacteria | 1477 |
| 419 | Ga0207676_10036926 | 3300026095 | Bacteria | 3719 |
| 420 | Ga0207676_10394568 | 3300026095 | Bacteria | 1292 |
| 421 | Ga0207674_10000403 | 3300026116 | Bacteria | 56087 |
| 422 | Ga0207674_10003449 | 3300026116 | Bacteria | 19336 |
| 423 | Ga0207675_100000204 | 3300026118 | Bacteria | 54999 |
| 424 | Ga0207675_100018399 | 3300026118 | Bacteria | 6515 |
| 425 | Ga0207675_100059117 | 3300026118 | Bacteria | 3577 |
| 426 | Ga0207675_100085253 | 3300026118 | Bacteria | 2964 |
| 427 | Ga0207683_10000026 | 3300026121 | Bacteria | 111890 |
| 428 | Ga0207698_10007715 | 3300026142 | Bacteria | 6752 |
| 429 | Ga0207698_10022080 | 3300026142 | Bacteria | 4414 |
| 430 | Ga0209281_1000078 | 3300027111 | Bacteria | 261622 |
| 431 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 432 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 433 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 434 | Ga0209983_1047621 | 3300027665 | Bacteria | 934 |
| 435 | Ga0209813_10004386 | 3300027866 | Bacteria | 3369 |
| 436 | Ga0209813_10094422 | 3300027866 | Bacteria | 1009 |
| 437 | Ga0207428_10009013 | 3300027907 | Bacteria | 8985 |
| 438 | Ga0207428_10058824 | 3300027907 | Bacteria | 3049 |
| 439 | Ga0207428_10385060 | 3300027907 | Bacteria | 1028 |
| 440 | Ga0268266_10091186 | 3300028379 | Bacteria | 2672 |
| 441 | Ga0268266_10198746 | 3300028379 | Bacteria | 1834 |
| 442 | Ga0268265_10662317 | 3300028380 | Bacteria | 1004 |
| 443 | Ga0268264_10000194 | 3300028381 | Bacteria | 125395 |
| 444 | Ga0268264_10014684 | 3300028381 | Bacteria | 6436 |
| 445 | Ga0268264_10019377 | 3300028381 | Bacteria | 5561 |
| 446 | Ga0268264_10799317 | 3300028381 | Bacteria | 942 |
| 447 | Ga0268264_11033036 | 3300028381 | Unclassified | 829 |
| 448 | Ga0265337_1006579 | 3300028556 | Bacteria | 4459 |
| 449 | Ga0265326_10011532 | 3300028558 | Bacteria | 2602 |
| 450 | Ga0265319_1009499 | 3300028563 | Bacteria | 4138 |
| 451 | Ga0265334_10001587 | 3300028573 | Bacteria | 10922 |
| 452 | Ga0265323_10001598 | 3300028653 | Bacteria | 10926 |
| 453 | Ga0265336_10000238 | 3300028666 | Bacteria | 39366 |
| 454 | Ga0307515_10441348 | 3300028794 | Bacteria | 918 |
| 455 | Ga0265338_10000278 | 3300028800 | Bacteria | 93010 |
| 456 | Ga0265324_10001755 | 3300029957 | Bacteria | 11922 |
| 457 | Ga0265330_10211006 | 3300031235 | Bacteria | 820 |
| 458 | Ga0265328_10032026 | 3300031239 | Bacteria | 1953 |
| 459 | Ga0265325_10021108 | 3300031241 | Bacteria | 3582 |
| 460 | Ga0265325_10068951 | 3300031241 | Bacteria | 1779 |
| 461 | Ga0265325_10086138 | 3300031241 | Bacteria | 1555 |
| 462 | Ga0265325_10157284 | 3300031241 | Bacteria | 1071 |
| 463 | Ga0265325_10184735 | 3300031241 | Bacteria | 969 |
| 464 | Ga0265340_10000397 | 3300031247 | Bacteria | 23270 |
| 465 | Ga0265340_10013221 | 3300031247 | Bacteria | 4343 |
| 466 | Ga0265340_10014208 | 3300031247 | Bacteria | 4166 |
| 467 | Ga0265340_10073276 | 3300031247 | Bacteria | 1621 |
| 468 | Ga0265339_10000016 | 3300031249 | Bacteria | 185313 |
| 469 | Ga0265339_10013893 | 3300031249 | Bacteria | 4871 |
| 470 | Ga0265339_10020578 | 3300031249 | Bacteria | 3852 |
| 471 | Ga0265339_10032991 | 3300031249 | Bacteria | 2919 |
| 472 | Ga0265316_10037176 | 3300031344 | Bacteria | 3932 |
| 473 | Ga0265316_10166769 | 3300031344 | Bacteria | 1645 |
| 474 | Ga0307513_10006480 | 3300031456 | Bacteria | 15285 |
| 475 | Ga0265313_10000060 | 3300031595 | Bacteria | 107224 |
| 476 | Ga0265313_10001332 | 3300031595 | Bacteria | 23248 |
| 477 | Ga0265313_10039946 | 3300031595 | Bacteria | 2324 |
| 478 | Ga0265313_10091458 | 3300031595 | Bacteria | 1365 |
| 479 | Ga0265314_10082713 | 3300031711 | Bacteria | 2112 |
| 480 | Ga0265342_10006501 | 3300031712 | Bacteria | 8699 |
| 481 | Ga0265342_10118122 | 3300031712 | Bacteria | 1495 |
| 482 | Ga0307516_10018505 | 3300031730 | Bacteria | 7237 |
| 483 | Ga0307416_100995733 | 3300032002 | Bacteria | 941 |
| 484 | Ga0373938_0006926 | 3300034957 | Bacteria | 1978 |
| 485 | Ga0373928_0033382 | 3300035084 | Bacteria | 1151 |
| 486 | Ga0373929_0048702 | 3300035085 | Bacteria | 963 |
| 487 | Ga0373949_0014064 | 3300035090 | Bacteria | 1780 |
| 488 | Ga0373951_0054044 | 3300035091 | Bacteria | 993 |
| 489 | Ga0373952_0012012 | 3300035092 | Bacteria | 1697 |
| 490 | Ga0373952_0013064 | 3300035092 | Bacteria | 1642 |
| 491 | Ga0373952_0086003 | 3300035092 | Bacteria | 810 |
| 492 | Ga0373932_0005443 | 3300035112 | Bacteria | 2995 |
| 493 | Ga0373932_0008895 | 3300035112 | Bacteria | 2405 |
| 494 | Ga0373936_0046310 | 3300035113 | Bacteria | 1753 |
| 495 | Ga0373939_0002625 | 3300035114 | Bacteria | 4222 |
| 496 | Ga0373939_0004663 | 3300035114 | Bacteria | 3249 |
| 497 | Ga0373960_0055393 | 3300035121 | Unclassified | 1188 |
| 498 | Ga0373960_0128930 | 3300035121 | Bacteria | 846 |
| 499 | Ga0373943_0249927 | 3300035170 | Bacteria | 995 |
| 500 | Ga0373942_0003455 | 3300035207 | Bacteria | 3710 |
| 501 | Ga0373942_0028908 | 3300035207 | Bacteria | 1451 |
| 502 | Ga0373961_0008667 | 3300035241 | Bacteria | 2477 |
| 503 | Ga0373961_0060423 | 3300035241 | Bacteria | 1148 |
| 504 | Ga0373962_0011595 | 3300035242 | Bacteria | 2211 |
| 505 | Ga0373962_0045265 | 3300035242 | Bacteria | 1253 |
| 506 | Ga0373962_0099235 | 3300035242 | Bacteria | 906 |
| 507 | Ga0373931_0000272 | 3300035691 | Bacteria | 21907 |
| 508 | Ga0373931_0005753 | 3300035691 | Bacteria | 5759 |
| 509 | Ga0373931_0031452 | 3300035691 | Bacteria | 2740 |
| 510 | Ga0373935_0533301 | 3300035692 | Bacteria | 854 |
| 511 | Ga0373927_0006712 | 3300035695 | Bacteria | 7830 |
| 512 | Ga0373947_0000790 | 3300035725 | Bacteria | 19015 |
| 513 | Ga0373947_0127839 | 3300035725 | Bacteria | 1620 |
| 514 | Ga0373937_0130019 | 3300036401 | Bacteria | 2351 |
| 515 | Ga0373925_0001714 | 3300037068 | Bacteria | 18478 |
| 516 | Ga0373925_0068711 | 3300037068 | Bacteria | 2675 |
| 517 | Ga0395900_0004457 | 3300037418 | Bacteria | 14827 |
| 518 | Ga0395900_0026747 | 3300037418 | Bacteria | 5906 |
| 519 | Ga0395900_0240515 | 3300037418 | Bacteria | 1816 |
| 520 | Ga0395898_0014586 | 3300037466 | Bacteria | 8069 |
| 521 | Ga0395898_0237216 | 3300037466 | Bacteria | 1739 |
| 522 | Ga0395898_0755816 | 3300037466 | Bacteria | 913 |
| 523 | Ga0395905_0000463 | 3300037471 | Bacteria | 56433 |
| 524 | Ga0395905_0001025 | 3300037471 | Bacteria | 35622 |
| 525 | Ga0395905_0001846 | 3300037471 | Bacteria | 24436 |
| 526 | Ga0395905_0707115 | 3300037471 | Bacteria | 910 |
| 527 | Ga0395905_1419738 | 3300037471 | Bacteria | 598 |
| 528 | Ga0436364_1035385 | 3300037853 | Bacteria | 947 |
| 529 | Ga0436364_1124912 | 3300037853 | Bacteria | 3542 |
| 530 | Ga0395901_0019998 | 3300038443 | Bacteria | 6849 |
| 531 | Ga0395901_0048529 | 3300038443 | Bacteria | 4409 |
| 532 | Ga0395901_0176955 | 3300038443 | Bacteria | 2238 |
| 533 | Ga0400487_27525 | 3300039110 | Unclassified | 1164 |
| 534 | Ga0436365_0096215 | 3300039437 | Bacteria | 1062 |
| 535 | Ga0436365_0502292 | 3300039437 | Bacteria | 2576 |
| 536 | Ga0436365_1937907 | 3300039437 | Bacteria | 2252 |
| 537 | Ga0436360_0019834 | 3300039438 | Bacteria | 1149 |
| 538 | Ga0436361_1111580 | 3300039447 | Bacteria | 766 |
| 539 | Ga0451833_1324743 | 3300041491 | Bacteria | 541 |
| 540 | Ga0439433_0111100 | 3300041999 | Bacteria | 686 |
| 541 | Ga0439446_0242404 | 3300042156 | Bacteria | 620 |
| 542 | Ga0439435_0009720 | 3300042436 | Bacteria | 2263 |
| 543 | Ga0439460_0197788 | 3300042461 | Unclassified | 684 |
| 544 | Ga0466971_0058904 | 3300044719 | Bacteria | 1734 |
| 545 | Ga0466970_0075322 | 3300044765 | Bacteria | 1818 |
| 546 | Ga0466970_0217095 | 3300044765 | Bacteria | 1067 |
| 547 | Ga0466957_0199958 | 3300044842 | Bacteria | 1312 |
| 548 | Ga0466957_0386895 | 3300044842 | Bacteria | 955 |
| 549 | Ga0466959_0136527 | 3300045049 | Bacteria | 1736 |
| 550 | Ga0466959_0271653 | 3300045049 | Bacteria | 1165 |
| 551 | Ga0495603_0000441 | 3300046455 | Bacteria | 22761 |
| 552 | Ga0495603_0183854 | 3300046455 | Bacteria | 1209 |
| 553 | Ga0495603_0598482 | 3300046455 | Bacteria | 631 |
| 554 | Ga0495590_0047837 | 3300046457 | Bacteria | 1492 |
| 555 | Ga0495590_0080154 | 3300046457 | Bacteria | 1150 |
| 556 | Ga0495629_0000840 | 3300046459 | Bacteria | 24948 |
| 557 | Ga0495638_0206581 | 3300046460 | Bacteria | 1105 |
| 558 | Ga0495641_0026421 | 3300046461 | Bacteria | 2832 |
| 559 | Ga0495580_0001605 | 3300046472 | Bacteria | 19867 |
| 560 | Ga0495582_0000619 | 3300046473 | Bacteria | 19530 |
| 561 | Ga0495639_0002230 | 3300046475 | Bacteria | 8518 |
| 562 | Ga0495662_0116855 | 3300046476 | Bacteria | 1308 |
| 563 | Ga0495664_0222203 | 3300046477 | Bacteria | 1143 |
| 564 | Ga0495584_0057774 | 3300046491 | Bacteria | 1952 |
| 565 | Ga0495584_0317218 | 3300046491 | Bacteria | 791 |
| 566 | Ga0495594_0000067 | 3300046499 | Bacteria | 45132 |
| 567 | Ga0495607_0115355 | 3300046501 | Bacteria | 1418 |
| 568 | Ga0495643_0022103 | 3300046522 | Bacteria | 3635 |
| 569 | Ga0495643_0284857 | 3300046522 | Unclassified | 759 |
| 570 | Ga0495644_0041488 | 3300046523 | Bacteria | 1733 |
| 571 | Ga0495663_0123939 | 3300046525 | Bacteria | 867 |
| 572 | Ga0495666_0077405 | 3300046526 | Bacteria | 1576 |
| 573 | Ga0495654_0000043 | 3300046530 | Bacteria | 161913 |
| 574 | Ga0495654_0086487 | 3300046530 | Bacteria | 1461 |
| 575 | Ga0495665_0001878 | 3300046531 | Bacteria | 11359 |
| 576 | Ga0495665_0205416 | 3300046531 | Bacteria | 1020 |
| 577 | Ga0495665_0510239 | 3300046531 | Bacteria | 605 |
| 578 | Ga0495645_0001839 | 3300046543 | Bacteria | 14422 |
| 579 | Ga0495622_0004063 | 3300046557 | Bacteria | 6832 |
| 580 | Ga0495633_0150039 | 3300046558 | Bacteria | 1077 |
| 581 | Ga0495667_0694892 | 3300046559 | Bacteria | 630 |
| 582 | Ga0495656_0053711 | 3300046615 | Bacteria | 1732 |
| 583 | Ga0495668_0053826 | 3300046616 | Bacteria | 2225 |
| 584 | Ga0495634_0004589 | 3300046642 | Bacteria | 10790 |
| 585 | Ga0495635_0451326 | 3300046663 | Bacteria | 850 |
| 586 | Ga0495635_0630261 | 3300046663 | Bacteria | 698 |
| 587 | Ga0495588_0006117 | 3300046674 | Bacteria | 5403 |
| 588 | Ga0495599_0029202 | 3300046678 | Bacteria | 3456 |
| 589 | Ga0495647_0004660 | 3300046681 | Bacteria | 4470 |
| 590 | Ga0495658_0000623 | 3300046683 | Bacteria | 19287 |
| 591 | Ga0495658_0402655 | 3300046683 | Bacteria | 872 |
| 592 | Ga0495669_0083069 | 3300046684 | Bacteria | 1472 |
| 593 | Ga0495613_0000306 | 3300046689 | Bacteria | 44259 |
| 594 | Ga0495613_0254956 | 3300046689 | Bacteria | 1223 |
| 595 | Ga0495671_0312627 | 3300046692 | Bacteria | 755 |
| 596 | Ga0495589_0116586 | 3300046794 | Bacteria | 1287 |
| 597 | Ga0495581_0000520 | 3300047315 | Bacteria | 19707 |
| 598 | Ga0495674_0120135 | 3300047319 | Bacteria | 2221 |
| 599 | Ga0495674_0795907 | 3300047319 | Bacteria | 736 |
| 600 | Ga0495676_0035027 | 3300047321 | Bacteria | 4204 |
| 601 | Ga0495676_0068038 | 3300047321 | Bacteria | 2753 |
| 602 | Ga0495676_0264924 | 3300047321 | Bacteria | 1168 |
| 603 | Ga0495680_0039696 | 3300047322 | Bacteria | 3753 |
| 604 | Ga0495677_0145604 | 3300047445 | Bacteria | 911 |
| 605 | Ga0495593_0000741 | 3300047673 | Bacteria | 18972 |
| 606 | Ga0495614_0002751 | 3300048089 | Bacteria | 7817 |
| 607 | Ga0496100_0012548 | 3300048903 | Bacteria | 4860 |
| 608 | Ga0496100_0039173 | 3300048903 | Bacteria | 3008 |
| 609 | Ga0496100_0095627 | 3300048903 | Bacteria | 2037 |
| 610 | Ga0496101_0002433 | 3300048904 | Bacteria | 11442 |
| 611 | Ga0496101_0010447 | 3300048904 | Bacteria | 6132 |
| 612 | Ga0496101_0275290 | 3300048904 | Bacteria | 1314 |
| 613 | Ga0496102_0011741 | 3300048905 | Bacteria | 7559 |
| 614 | Ga0496102_0015978 | 3300048905 | Bacteria | 6551 |
| 615 | Ga0496102_0129946 | 3300048905 | Bacteria | 2356 |
| 616 | Ga0496102_0365165 | 3300048905 | Bacteria | 1359 |
| 617 | Ga0496103_0009787 | 3300048906 | Bacteria | 5676 |
| 618 | Ga0496103_0092179 | 3300048906 | Bacteria | 1912 |
| 619 | Ga0496103_0187751 | 3300048906 | Bacteria | 1329 |
| 620 | Ga0496104_0001121 | 3300048907 | Bacteria | 22928 |
| 621 | Ga0496104_0005122 | 3300048907 | Bacteria | 11440 |
| 622 | Ga0496104_0042435 | 3300048907 | Bacteria | 4268 |
| 623 | Ga0496104_0116132 | 3300048907 | Bacteria | 2568 |
| 624 | Ga0496104_0217548 | 3300048907 | Bacteria | 1822 |
| 625 | Ga0496105_0003149 | 3300048908 | Bacteria | 12142 |
| 626 | Ga0496105_0030430 | 3300048908 | Bacteria | 4423 |
| 627 | Ga0496105_0048741 | 3300048908 | Bacteria | 3496 |
| 628 | Ga0496105_0203661 | 3300048908 | Bacteria | 1615 |
| 629 | Ga0496105_0337087 | 3300048908 | Bacteria | 1206 |
| 630 | Ga0496106_0003556 | 3300048909 | Bacteria | 11604 |
| 631 | Ga0496106_0032831 | 3300048909 | Bacteria | 3871 |
| 632 | Ga0496106_0077262 | 3300048909 | Bacteria | 2553 |
| 633 | Ga0496106_0197754 | 3300048909 | Bacteria | 1599 |
| 634 | Ga0496106_0537201 | 3300048909 | Bacteria | 938 |
| 635 | Ga0496106_0664808 | 3300048909 | Bacteria | 832 |
| 636 | Ga0496107_0039274 | 3300048910 | Bacteria | 3394 |
| 637 | Ga0496107_0057973 | 3300048910 | Bacteria | 2799 |
| 638 | Ga0496107_0095358 | 3300048910 | Bacteria | 2177 |
| 639 | Ga0496107_0235549 | 3300048910 | Unclassified | 1362 |
| 640 | Ga0496108_0013407 | 3300048911 | Bacteria | 6684 |
| 641 | Ga0496108_0191370 | 3300048911 | Bacteria | 1773 |
| 642 | Ga0496108_0196962 | 3300048911 | Bacteria | 1747 |
| 643 | Ga0496108_0467005 | 3300048911 | Bacteria | 1103 |
| 644 | Ga0496108_0587744 | 3300048911 | Bacteria | 970 |
| 645 | Ga0496109_0016963 | 3300048912 | Bacteria | 6374 |
| 646 | Ga0496109_0021712 | 3300048912 | Bacteria | 5681 |
| 647 | Ga0496109_0031736 | 3300048912 | Bacteria | 4743 |
| 648 | Ga0496109_0040221 | 3300048912 | Bacteria | 4234 |
| 649 | Ga0496109_0272109 | 3300048912 | Bacteria | 1596 |
| 650 | Ga0496109_0422059 | 3300048912 | Bacteria | 1260 |
| 651 | Ga0496109_1025531 | 3300048912 | Bacteria | 762 |
| 652 | Ga0496110_0050169 | 3300048913 | Bacteria | 3663 |
| 653 | Ga0496110_0055452 | 3300048913 | Bacteria | 3487 |
| 654 | Ga0496110_0114339 | 3300048913 | Bacteria | 2428 |
| 655 | Ga0496110_0601499 | 3300048913 | Bacteria | 997 |
| 656 | Ga0496111_0006155 | 3300048914 | Bacteria | 7767 |
| 657 | Ga0496111_0008506 | 3300048914 | Bacteria | 6797 |
| 658 | Ga0496111_0011375 | 3300048914 | Bacteria | 5992 |
| 659 | Ga0496111_0030040 | 3300048914 | Bacteria | 3863 |
| 660 | Ga0496111_0182962 | 3300048914 | Bacteria | 1558 |
| 661 | Ga0496112_0003566 | 3300048915 | Bacteria | 12935 |
| 662 | Ga0496112_0004157 | 3300048915 | Bacteria | 12189 |
| 663 | Ga0496112_0005950 | 3300048915 | Bacteria | 10642 |
| 664 | Ga0496112_0048867 | 3300048915 | Bacteria | 4145 |
| 665 | Ga0496112_0069837 | 3300048915 | Bacteria | 3470 |
| 666 | Ga0496113_0034904 | 3300048916 | Bacteria | 3673 |
| 667 | Ga0496113_0235411 | 3300048916 | Bacteria | 1461 |
| 668 | Ga0496114_0005084 | 3300048917 | Bacteria | 10252 |
| 669 | Ga0496114_0016968 | 3300048917 | Bacteria | 5872 |
| 670 | Ga0496114_0018129 | 3300048917 | Bacteria | 5687 |
| 671 | Ga0496114_0963582 | 3300048917 | Bacteria | 736 |
| 672 | Ga0496115_0058298 | 3300048918 | Bacteria | 3107 |
| 673 | Ga0496115_0150053 | 3300048918 | Bacteria | 1924 |
| 674 | Ga0496115_0208438 | 3300048918 | Bacteria | 1614 |
| 675 | Ga0496117_0047746 | 3300048920 | Bacteria | 3066 |
| 676 | Ga0496117_0262694 | 3300048920 | Bacteria | 935 |
| 677 | Ga0496118_0063903 | 3300048921 | Bacteria | 2705 |
| 678 | Ga0496118_0069619 | 3300048921 | Bacteria | 2547 |
| 679 | Ga0496121_0008329 | 3300048924 | Bacteria | 12248 |
| 680 | Ga0496121_0089977 | 3300048924 | Bacteria | 2401 |
| 681 | Ga0496121_0097751 | 3300048924 | Bacteria | 2274 |
| 682 | Ga0496121_0170675 | 3300048924 | Bacteria | 1580 |
| 683 | Ga0496122_0023503 | 3300048925 | Bacteria | 5431 |
| 684 | Ga0496122_0025339 | 3300048925 | Bacteria | 5154 |
| 685 | Ga0496123_0029566 | 3300048926 | Bacteria | 4029 |
| 686 | Ga0496124_0018333 | 3300048927 | Bacteria | 6556 |
| 687 | Ga0496124_0075943 | 3300048927 | Bacteria | 2775 |
| 688 | Ga0496124_0079267 | 3300048927 | Bacteria | 2705 |
| 689 | Ga0496124_0221903 | 3300048927 | Bacteria | 1421 |
| 690 | Ga0496125_0065863 | 3300048928 | Bacteria | 2866 |
| 691 | Ga0496125_0165870 | 3300048928 | Bacteria | 1492 |
| 692 | Ga0496126_0033948 | 3300048929 | Bacteria | 4798 |
| 693 | Ga0496126_0728268 | 3300048929 | Bacteria | 768 |
| 694 | Ga0501031_0018247 | 3300049568 | Bacteria | 4566 |
| 695 | Ga0501031_0019059 | 3300049568 | Bacteria | 4467 |
| 696 | Ga0501031_0064762 | 3300049568 | Bacteria | 2381 |
| 697 | Ga0501031_0154659 | 3300049568 | Bacteria | 1499 |
| 698 | Ga0501032_0102264 | 3300049569 | Bacteria | 1899 |
| 699 | Ga0501032_0154271 | 3300049569 | Bacteria | 1509 |
| 700 | Ga0501033_0000165 | 3300049570 | Bacteria | 63213 |
| 701 | Ga0501033_0061294 | 3300049570 | Bacteria | 2773 |
| 702 | Ga0501033_0206627 | 3300049570 | Bacteria | 1401 |
| 703 | Ga0501033_0334362 | 3300049570 | Bacteria | 1063 |
| 704 | Ga0501034_0362793 | 3300049571 | Bacteria | 1376 |
| 705 | Ga0501034_0388152 | 3300049571 | Bacteria | 1320 |
| 706 | Ga0501036_0010396 | 3300049572 | Bacteria | 7683 |
| 707 | Ga0501036_0050046 | 3300049572 | Bacteria | 3539 |
| 708 | Ga0501036_0062494 | 3300049572 | Bacteria | 3154 |
| 709 | Ga0501036_0203101 | 3300049572 | Bacteria | 1667 |
| 710 | Ga0501036_1401005 | 3300049572 | Bacteria | 567 |
| 711 | Ga0501037_0046690 | 3300049573 | Bacteria | 3176 |
| 712 | Ga0501037_0094802 | 3300049573 | Bacteria | 2158 |
| 713 | Ga0501037_0110673 | 3300049573 | Bacteria | 1979 |
| 714 | Ga0501037_0436858 | 3300049573 | Bacteria | 894 |
| 715 | Ga0501038_0027908 | 3300049574 | Bacteria | 5016 |
| 716 | Ga0501038_0164994 | 3300049574 | Bacteria | 1797 |
| 717 | Ga0501038_0235436 | 3300049574 | Bacteria | 1455 |
| 718 | Ga0501038_0492907 | 3300049574 | Bacteria | 938 |
| 719 | Ga0501039_0012810 | 3300049575 | Bacteria | 6410 |
| 720 | Ga0501039_0024150 | 3300049575 | Bacteria | 4669 |
| 721 | Ga0501039_0055460 | 3300049575 | Bacteria | 3069 |
| 722 | Ga0501039_0092905 | 3300049575 | Bacteria | 2351 |
| 723 | Ga0501039_0112275 | 3300049575 | Bacteria | 2131 |
| 724 | Ga0501039_0272602 | 3300049575 | Bacteria | 1330 |
| 725 | Ga0501039_0393157 | 3300049575 | Bacteria | 1089 |
| 726 | Ga0501040_0011102 | 3300049576 | Bacteria | 5888 |
| 727 | Ga0501040_0034372 | 3300049576 | Bacteria | 3434 |
| 728 | Ga0501040_0110567 | 3300049576 | Bacteria | 1921 |
| 729 | Ga0501040_0160241 | 3300049576 | Bacteria | 1590 |
| 730 | Ga0501040_0214608 | 3300049576 | Bacteria | 1368 |
| 731 | Ga0501040_0274269 | 3300049576 | Bacteria | 1204 |
| 732 | Ga0501041_0005900 | 3300049577 | Bacteria | 7158 |
| 733 | Ga0501041_0012868 | 3300049577 | Bacteria | 4957 |
| 734 | Ga0501041_0104099 | 3300049577 | Bacteria | 1758 |
| 735 | Ga0501041_0111852 | 3300049577 | Bacteria | 1694 |
| 736 | Ga0501041_0115119 | 3300049577 | Bacteria | 1669 |
| 737 | Ga0501041_0127842 | 3300049577 | Bacteria | 1582 |
| 738 | Ga0501041_0385164 | 3300049577 | Bacteria | 887 |
| 739 | Ga0501041_0433083 | 3300049577 | Bacteria | 834 |
| 740 | Ga0501042_0004334 | 3300049578 | Bacteria | 9047 |
| 741 | Ga0501042_0041700 | 3300049578 | Bacteria | 3265 |
| 742 | Ga0501042_0072925 | 3300049578 | Bacteria | 2456 |
| 743 | Ga0501042_0087311 | 3300049578 | Bacteria | 2237 |
| 744 | Ga0501043_0039464 | 3300049579 | Bacteria | 3710 |
| 745 | Ga0501043_0052089 | 3300049579 | Bacteria | 3216 |
| 746 | Ga0501043_0338439 | 3300049579 | Bacteria | 1145 |
| 747 | Ga0501046_0037603 | 3300049580 | Bacteria | 3889 |
| 748 | Ga0501046_0049030 | 3300049580 | Bacteria | 3342 |
| 749 | Ga0501046_0494222 | 3300049580 | Bacteria | 877 |
| 750 | Ga0501047_0180925 | 3300049581 | Bacteria | 1975 |
| 751 | Ga0501048_0009618 | 3300049582 | Bacteria | 7254 |
| 752 | Ga0501048_0110136 | 3300049582 | Bacteria | 1944 |
| 753 | Ga0501048_0118483 | 3300049582 | Bacteria | 1870 |
| 754 | Ga0501048_0210620 | 3300049582 | Bacteria | 1378 |
| 755 | Ga0501048_0305458 | 3300049582 | Bacteria | 1132 |
| 756 | Ga0501048_0443650 | 3300049582 | Bacteria | 929 |
| 757 | Ga0501067_0001414 | 3300049583 | Bacteria | 13016 |
| 758 | Ga0501067_0118441 | 3300049583 | Bacteria | 1473 |
| 759 | Ga0501067_0151364 | 3300049583 | Bacteria | 1293 |
| 760 | Ga0501068_0073805 | 3300049584 | Bacteria | 2084 |
| 761 | Ga0501068_0108673 | 3300049584 | Bacteria | 1723 |
| 762 | Ga0501069_0236220 | 3300049585 | Bacteria | 1065 |
| 763 | Ga0501069_0430967 | 3300049585 | Bacteria | 782 |
| 764 | Ga0501069_0512408 | 3300049585 | Bacteria | 716 |
| 765 | Ga0501070_0043242 | 3300049586 | Bacteria | 3750 |
| 766 | Ga0501070_0132022 | 3300049586 | Bacteria | 2063 |
| 767 | Ga0501070_0266119 | 3300049586 | Bacteria | 1401 |
| 768 | Ga0501070_0323089 | 3300049586 | Bacteria | 1255 |
| 769 | Ga0501071_0019681 | 3300049587 | Bacteria | 4686 |
| 770 | Ga0501071_0021438 | 3300049587 | Bacteria | 4500 |
| 771 | Ga0501071_0055362 | 3300049587 | Bacteria | 2863 |
| 772 | Ga0501071_0072077 | 3300049587 | Bacteria | 2519 |
| 773 | Ga0501071_0087454 | 3300049587 | Bacteria | 2286 |
| 774 | Ga0501071_0107854 | 3300049587 | Bacteria | 2057 |
| 775 | Ga0501072_0012631 | 3300049588 | Bacteria | 6456 |
| 776 | Ga0501072_0033814 | 3300049588 | Bacteria | 4006 |
| 777 | Ga0501072_0130696 | 3300049588 | Bacteria | 2001 |
| 778 | Ga0501072_0178836 | 3300049588 | Bacteria | 1692 |
| 779 | Ga0501073_0129775 | 3300049589 | Bacteria | 1747 |
| 780 | Ga0501073_0543303 | 3300049589 | Bacteria | 803 |
| 781 | Ga0501074_0028541 | 3300049590 | Bacteria | 4044 |
| 782 | Ga0501074_0071912 | 3300049590 | Bacteria | 2486 |
| 783 | Ga0501074_0185281 | 3300049590 | Bacteria | 1484 |
| 784 | Ga0501074_0610854 | 3300049590 | Bacteria | 771 |
| 785 | Ga0501074_0620765 | 3300049590 | Bacteria | 764 |
| 786 | Ga0501075_0002322 | 3300049591 | Bacteria | 12625 |
| 787 | Ga0501075_0006118 | 3300049591 | Bacteria | 8269 |
| 788 | Ga0501075_0012671 | 3300049591 | Bacteria | 5997 |
| 789 | Ga0501075_0015132 | 3300049591 | Bacteria | 5534 |
| 790 | Ga0501075_0070921 | 3300049591 | Bacteria | 2633 |
| 791 | Ga0501075_0098624 | 3300049591 | Bacteria | 2218 |
| 792 | Ga0501075_0155348 | 3300049591 | Bacteria | 1744 |
| 793 | Ga0501075_0281474 | 3300049591 | Bacteria | 1267 |
| 794 | Ga0501076_0009092 | 3300049592 | Bacteria | 7315 |
| 795 | Ga0501076_0011036 | 3300049592 | Bacteria | 6717 |
| 796 | Ga0501076_0049110 | 3300049592 | Bacteria | 3336 |
| 797 | Ga0501076_0084603 | 3300049592 | Bacteria | 2548 |
| 798 | Ga0501076_0331027 | 3300049592 | Bacteria | 1249 |
| 799 | Ga0501076_0465161 | 3300049592 | Bacteria | 1041 |
| 800 | Ga0501076_0524191 | 3300049592 | Bacteria | 977 |
| 801 | Ga0501076_0656056 | 3300049592 | Bacteria | 866 |
| 802 | Ga0501077_0007577 | 3300049593 | Bacteria | 6698 |
| 803 | Ga0501077_0009692 | 3300049593 | Bacteria | 5987 |
| 804 | Ga0501077_0032091 | 3300049593 | Bacteria | 3342 |
| 805 | Ga0501077_0059327 | 3300049593 | Bacteria | 2429 |
| 806 | Ga0501077_0092901 | 3300049593 | Bacteria | 1912 |
| 807 | Ga0501077_0131485 | 3300049593 | Bacteria | 1586 |
| 808 | Ga0501077_0160611 | 3300049593 | Bacteria | 1427 |
| 809 | Ga0501077_0430334 | 3300049593 | Bacteria | 844 |
| 810 | Ga0501079_0006052 | 3300049741 | Bacteria | 9069 |
| 811 | Ga0501079_0017035 | 3300049741 | Bacteria | 5549 |
| 812 | Ga0501079_0082619 | 3300049741 | Bacteria | 2484 |
| 813 | Ga0501079_0204266 | 3300049741 | Bacteria | 1543 |
| 814 | Ga0501079_0254203 | 3300049741 | Bacteria | 1373 |
| 815 | Ga0501079_0562156 | 3300049741 | Bacteria | 897 |
| 816 | Ga0501080_0018226 | 3300049742 | Bacteria | 6498 |
| 817 | Ga0501080_0160984 | 3300049742 | Bacteria | 2073 |
| 818 | Ga0501080_0236155 | 3300049742 | Bacteria | 1670 |
| 819 | Ga0501080_0243634 | 3300049742 | Bacteria | 1640 |
| 820 | Ga0501080_0269689 | 3300049742 | Bacteria | 1549 |
| 821 | Ga0501080_0351603 | 3300049742 | Bacteria | 1331 |
| 822 | Ga0501081_0008837 | 3300049743 | Bacteria | 6549 |
| 823 | Ga0501081_0009707 | 3300049743 | Bacteria | 6276 |
| 824 | Ga0501081_0048832 | 3300049743 | Bacteria | 2913 |
| 825 | Ga0501081_0057804 | 3300049743 | Bacteria | 2682 |
| 826 | Ga0501081_0587723 | 3300049743 | Bacteria | 833 |
| 827 | Ga0501083_0001062 | 3300049744 | Bacteria | 18344 |
| 828 | Ga0501083_0027140 | 3300049744 | Bacteria | 3952 |
| 829 | Ga0501083_0047990 | 3300049744 | Bacteria | 2883 |
| 830 | Ga0501083_0054706 | 3300049744 | Bacteria | 2678 |
| 831 | Ga0501083_0059019 | 3300049744 | Bacteria | 2566 |
| 832 | Ga0501083_0124668 | 3300049744 | Bacteria | 1689 |
| 833 | Ga0501083_0233358 | 3300049744 | Bacteria | 1198 |
| 834 | Ga0501035_0001055 | 3300049822 | Bacteria | 28892 |
| 835 | Ga0501035_0055153 | 3300049822 | Bacteria | 3549 |
| 836 | Ga0501035_0132542 | 3300049822 | Bacteria | 2172 |
| 837 | Ga0501035_0395611 | 3300049822 | Bacteria | 1150 |
| 838 | Ga0501044_0936403 | 3300049823 | Bacteria | 740 |
| 839 | Ga0501045_0013203 | 3300049824 | Bacteria | 5826 |
| 840 | Ga0501045_0135424 | 3300049824 | Bacteria | 1831 |
| 841 | Ga0501045_0143113 | 3300049824 | Bacteria | 1778 |
| 842 | Ga0501045_0145614 | 3300049824 | Bacteria | 1762 |
| 843 | Ga0501045_0187221 | 3300049824 | Bacteria | 1542 |
| 844 | Ga0501045_0295393 | 3300049824 | Bacteria | 1206 |
| 845 | Ga0501045_0656700 | 3300049824 | Bacteria | 775 |
| 846 | nmdc:mga0yw44_276743_c1 | 3300050492 | Bacteria | 1121 |
| 847 | nmdc:mga0k408_324982_c1 | 3300050493 | Bacteria | 918 |
| 848 | nmdc:mga06z11_27251_c1 | 3300050494 | Bacteria | 2731 |
| 849 | nmdc:mga06z11_4683_c1 | 3300050494 | Bacteria | 5402 |
| 850 | nmdc:mga05p37_197320_c1 | 3300050507 | Bacteria | 2440 |
| 851 | nmdc:mga05p37_277802_c1 | 3300050507 | Bacteria | 1999 |
| 852 | nmdc:mga05p37_304832_c1 | 3300050507 | Bacteria | 1891 |
| 853 | nmdc:mga09592_171162_c1 | 3300050508 | Bacteria | 1878 |
| 854 | nmdc:mga09592_1766_c1 | 3300050508 | Bacteria | 17366 |
| 855 | nmdc:mga09592_285705_c1 | 3300050508 | Bacteria | 1430 |
| 856 | nmdc:mga0qj67_116450_c1 | 3300050509 | Bacteria | 2159 |
| 857 | nmdc:mga0qj67_5071_c1 | 3300050509 | Bacteria | 9583 |
| 858 | nmdc:mga0qj67_739369_c1 | 3300050509 | Bacteria | 781 |
| 859 | nmdc:mga06r32_131161_c1 | 3300050510 | Bacteria | 2478 |
| 860 | nmdc:mga06r32_2699_c1 | 3300050510 | Bacteria | 15873 |
| 861 | nmdc:mga06r32_407392_c1 | 3300050510 | Bacteria | 1342 |
| 862 | nmdc:mga06r32_577844_c1 | 3300050510 | Bacteria | 1096 |
| 863 | nmdc:mga06r32_61975_c1 | 3300050510 | Bacteria | 3602 |
| 864 | nmdc:mga08y16_10691_c1 | 3300050511 | Bacteria | 9631 |
| 865 | nmdc:mga08y16_197590_c1 | 3300050511 | Bacteria | 2085 |
| 866 | nmdc:mga08y16_29502_c1 | 3300050511 | Bacteria | 5780 |
| 867 | nmdc:mga08y16_37547_c1 | 3300050511 | Bacteria | 5086 |
| 868 | nmdc:mga0n895_1273_c1 | 3300050512 | Bacteria | 18618 |
| 869 | nmdc:mga0n895_16404_c1 | 3300050512 | Bacteria | 6795 |
| 870 | nmdc:mga0n895_184516_c1 | 3300050512 | Bacteria | 2117 |
| 871 | nmdc:mga0n895_197375_c1 | 3300050512 | Bacteria | 2044 |
| 872 | nmdc:mga0n895_668722_c1 | 3300050512 | Bacteria | 1036 |
| 873 | nmdc:mga0rr50_12331_c1 | 3300050513 | Bacteria | 5520 |
| 874 | nmdc:mga0rr50_70440_c1 | 3300050513 | Bacteria | 2664 |
| 875 | nmdc:mga0rr50_818250_c1 | 3300050513 | Bacteria | 795 |
| 876 | nmdc:mga08x19_31143_c1 | 3300050514 | Bacteria | 3354 |
| 877 | nmdc:mga0a205_298671_c1 | 3300050515 | Bacteria | 1484 |
| 878 | nmdc:mga0a205_54545_c1 | 3300050515 | Bacteria | 3860 |
| 879 | nmdc:mga0a205_57553_c1 | 3300050515 | Bacteria | 3753 |
| 880 | nmdc:mga0sz30_287710_c1 | 3300050516 | Bacteria | 732 |
| 881 | Ga0495601_0025917 | 3300053077 | Bacteria | 3617 |
| 882 | Ga0495601_0051547 | 3300053077 | Bacteria | 2597 |
| 883 | Ga0500635_0156183 | 3300053080 | Bacteria | 873 |
| 884 | Ga0495655_0000614 | 3300053083 | Bacteria | 5816 |
| 885 | Ga0495595_0026853 | 3300053084 | Bacteria | 2561 |
| 886 | Ga0495619_0014629 | 3300053085 | Bacteria | 4956 |
| 887 | Ga0495619_0019133 | 3300053085 | Bacteria | 4351 |
| 888 | Ga0500643_064813 | 3300053087 | Bacteria | 1021 |
| 889 | Ga0500644_0003039 | 3300053088 | Bacteria | 4161 |
| 890 | Ga0500572_001422 | 3300053111 | Bacteria | 6578 |
| 891 | Ga0500618_000007 | 3300053125 | Bacteria | 226268 |
| 892 | Ga0500618_001066 | 3300053125 | Bacteria | 13544 |
| 893 | Ga0500559_0000750 | 3300053136 | Bacteria | 21301 |
| 894 | Ga0500577_0000750 | 3300053142 | Bacteria | 8336 |
| 895 | Ga0500590_022856 | 3300053148 | Bacteria | 3248 |
| 896 | Ga0500603_023087 | 3300053150 | Bacteria | 1546 |
| 897 | Ga0500616_0000758 | 3300053153 | Bacteria | 37186 |
| 898 | Ga0500622_0002839 | 3300053156 | Bacteria | 12151 |
| 899 | Ga0500636_0000562 | 3300053177 | Bacteria | 20257 |
| 900 | Ga0500636_0016824 | 3300053177 | Bacteria | 4312 |
| 901 | Ga0500637_0009578 | 3300053178 | Bacteria | 4937 |
| 902 | Ga0500576_097625 | 3300053725 | Bacteria | 1206 |
| 903 | Ga0500601_003129 | 3300053737 | Bacteria | 1787 |
| 904 | Ga0501084_0001874 | 3300054114 | Bacteria | 16763 |
| 905 | Ga0501084_0010094 | 3300054114 | Bacteria | 7802 |
| 906 | Ga0501084_0015357 | 3300054114 | Bacteria | 6348 |
| 907 | Ga0501084_0031135 | 3300054114 | Bacteria | 4463 |
| 908 | Ga0501084_0035892 | 3300054114 | Bacteria | 4144 |
| 909 | Ga0501084_0081161 | 3300054114 | Bacteria | 2720 |
| 910 | Ga0501084_0087331 | 3300054114 | Bacteria | 2618 |
| 911 | Ga0501084_0117137 | 3300054114 | Bacteria | 2240 |
| 912 | Ga0501084_0126400 | 3300054114 | Bacteria | 2151 |
| 913 | Ga0501084_0243763 | 3300054114 | Bacteria | 1517 |
| 914 | Ga0501084_0290570 | 3300054114 | Bacteria | 1381 |
| 915 | Ga0501084_0590777 | 3300054114 | Bacteria | 938 |
| 916 | Ga0501084_0752287 | 3300054114 | Bacteria | 821 |
| 917 | Ga0501082_0008485 | 3300060353 | Bacteria | 8860 |
| 918 | Ga0501082_0027615 | 3300060353 | Bacteria | 4885 |
| 919 | Ga0501082_0039628 | 3300060353 | Bacteria | 4063 |
| 920 | Ga0501082_0108400 | 3300060353 | Bacteria | 2403 |
| 921 | Ga0501082_0111536 | 3300060353 | Bacteria | 2368 |
| 922 | Ga0501082_0241771 | 3300060353 | Bacteria | 1571 |
| 923 | Ga0501082_0288996 | 3300060353 | Bacteria | 1427 |
| 924 | Ga0501082_0684825 | 3300060353 | Bacteria | 897 |
| 925 | Ga0501082_0834195 | 3300060353 | Bacteria | 806 |
| 926 | Ga0466962_0142212 | 3300061719 | Bacteria | 1162 |
| 927 | Ga0530510_0019403 | 3300061734 | Bacteria | 4826 |
| 928 | Ga0530510_0020859 | 3300061734 | Bacteria | 4660 |
| 929 | Ga0530510_0091899 | 3300061734 | Bacteria | 2214 |
| 930 | Ga0530510_0106649 | 3300061734 | Bacteria | 2050 |
| 931 | Ga0530510_0119654 | 3300061734 | Bacteria | 1932 |
| 932 | Ga0530510_0412678 | 3300061734 | Bacteria | 1019 |
| 933 | 2511173867 | 2510917026 | Bacteria | 7046020 |
| 934 | 2561467230 | 2558860983 | Bacteria | 4133860 |
| 935 | 2585994721 | 2585427633 | Bacteria | 6413184 |
| 936 | 2585999204 | 2585427634 | Bacteria | 6455027 |
| 937 | 2599719343 | 2599185236 | Bacteria | 6875203 |
| 938 | 2715501660 | 2713897090 | Bacteria | 3353799 |
| 939 | 2821123854 | 2821123053 | Bacteria | 7836056 |
| 940 | 2824603715 | 2824600985 | Bacteria | 8488197 |
| 941 | 2824610679 | 2824609381 | Bacteria | 8672835 |
| 942 | 2824657901 | 2824653114 | Bacteria | 8493680 |
| 943 | 2838739117 | 2838736955 | Bacteria | 5760694 |
| 944 | 2841843015 | 2841840854 | Bacteria | 5761912 |
| 945 | 2842142797 | 2842140634 | Bacteria | 5759631 |
| 946 | 2844316345 | 2844315083 | Bacteria | 8138177 |
| 947 | 2847939351 | 2847930680 | Bacteria | 9342022 |
| 948 | 2854898495 | 2854896431 | Bacteria | 5869725 |
| 949 | 2854917729 | 2854916844 | Bacteria | 5725939 |
| 950 | 2855021462 | 2855020534 | Bacteria | 3204685 |
| 951 | 2857513425 | 2857509624 | Bacteria | 7472071 |
| 952 | 2857531416 | 2857531043 | Bacteria | 6754041 |
| 953 | 2879087024 | 2879083081 | Bacteria | 8587928 |
| 954 | 2888421265 | 2888419890 | Bacteria | 7857137 |
| 955 | 2891050732 | 2891048133 | Bacteria | 4447501 |
| 956 | 2903728321 | 2903727486 | Bacteria | 8281579 |
| 957 | 2906606461 | 2906602504 | Bacteria | 8295279 |
| 958 | 2906631350 | 2906626472 | Bacteria | 8826946 |
| 959 | 2919171832 | 2919171160 | Bacteria | 6499771 |
| 960 | 2995395135 | 2995392953 | Bacteria | 4539380 |
| 961 | 8016585318 | 8016583857 | Bacteria | 10421953 |
| 962 | 8018151871 | 8018150411 | Bacteria | 5549903 |
| 963 | 8054461485 | 8054460903 | Bacteria | 4872905 |
| 964 | 8056879320 | 8056875544 | Bacteria | 4355797 |
| 965 | Ga0070668_100224342 | |||
| 966 | JGI24741J21665_1030462 | |||
| 967 | JGI24746J21847_1019977 | |||
| 968 | JGI24740J21852_10002543 | |||
| 969 | JGI24739J22299_10014798 | |||
| 970 | JGI24737J22298_10024313 | |||
| 971 | JGI24743J22301_10048055 | |||
| 972 | JGI24735J21928_10042004 | |||
| 973 | JGI24738J21930_10031365 | |||
| 974 | JGI24749J21850_1027232 | |||
| 975 | JGI24744J21845_10016801 | |||
| 976 | JGI24034J26672_10037342 | |||
| 977 | JGI24751J29686_10048208 | |||
| 978 | JGI25406J46586_10038370 | |||
| 979 | JGI25153J46596_10019231 | |||
| 980 | rootH1_10040793 | |||
| 981 | Ga0055539_1022387 | |||
| 982 | Ga0055530_10018980 | |||
| 983 | Ga0055531_10004299 | |||
| 984 | Ga0065165_1002916 | |||
| 985 | Ga0065712_10297111 | |||
| 986 | Ga0070676_10106354 | |||
| 987 | Ga0070690_100000132 | |||
| 988 | Ga0070670_100019173 | |||
| 989 | Ga0070666_10005308 | |||
| 990 | Ga0070666_10606610 | |||
| 991 | Ga0070680_100009699 | |||
| 992 | Ga0070682_100012548 | |||
| 993 | Ga0070682_100109989 | |||
| 994 | Ga0068868_100003681 | |||
| 995 | Ga0070660_100000566 | |||
| 996 | Ga0070689_100010934 | |||
| 997 | Ga0070689_100366989 | |||
| 998 | Ga0070691_10002290 | |||
| 999 | Ga0070691_10047138 | |||
| 1000 | Ga0070687_100245736 | |||
| 1001 | Ga0070661_100001081 | |||
| 1002 | Ga0070692_10000077 | |||
| 1003 | Ga0070668_100007631 | |||
| 1004 | Ga0070668_100514555 | |||
| 1005 | Ga0070669_100001786 | |||
| 1006 | Ga0070675_100001964 | |||
| 1007 | Ga0070671_100008228 | |||
| 1008 | Ga0070671_100281621 | |||
| 1009 | Ga0070674_100001960 | |||
| 1010 | Ga0070674_100560326 | |||
| 1011 | Ga0070674_100988936 | |||
| 1012 | Ga0070673_100001024 | |||
| 1013 | Ga0070673_100418324 | |||
| 1014 | Ga0070688_100000125 | |||
| 1015 | Ga0070688_100422402 | |||
| 1016 | Ga0070659_100003247 | |||
| 1017 | Ga0070667_100001803 | |||
| 1018 | Ga0070667_100415388 | |||
| 1019 | Ga0070709_10000375 | |||
| 1020 | Ga0070709_10001030 | |||
| 1021 | Ga0070714_100011184 | |||
| 1022 | Ga0070714_100321708 | |||
| 1023 | Ga0070714_100644657 | |||
| 1024 | Ga0070714_100751108 | |||
| 1025 | Ga0070713_100026017 | |||
| 1026 | Ga0070713_100045651 | |||
| 1027 | Ga0070710_10014142 | |||
| 1028 | Ga0070710_10027576 | |||
| 1029 | Ga0070701_10000761 | |||
| 1030 | Ga0070711_100000898 | |||
| 1031 | Ga0070711_100438539 | |||
| 1032 | Ga0070711_100550372 | |||
| 1033 | Ga0070705_100001091 | |||
| 1034 | Ga0070700_100026631 | |||
| 1035 | Ga0070694_100002073 | |||
| 1036 | Ga0070663_100093492 | |||
| 1037 | Ga0070663_100104498 | |||
| 1038 | Ga0070663_100644734 | |||
| 1039 | Ga0070678_100000369 | |||
| 1040 | Ga0070662_100028337 | |||
| 1041 | Ga0070662_100728955 | |||
| 1042 | Ga0070681_10055923 | |||
| 1043 | Ga0068867_100212339 | |||
| 1044 | Ga0070685_10639340 | |||
| 1045 | Ga0070706_100142204 | |||
| 1046 | Ga0070707_100545279 | |||
| 1047 | Ga0070699_100424239 | |||
| 1048 | Ga0070679_100142265 | |||
| 1049 | Ga0070684_100001508 | |||
| 1050 | Ga0070684_100517204 | |||
| 1051 | Ga0070684_100619092 | |||
| 1052 | Ga0070697_100005000 | |||
| 1053 | Ga0070697_100867908 | |||
| 1054 | Ga0068853_100000997 | |||
| 1055 | Ga0068853_100003336 | |||
| 1056 | Ga0068853_100239292 | |||
| 1057 | Ga0068853_100353668 | |||
| 1058 | Ga0070672_100020079 | |||
| 1059 | Ga0070686_100001627 | |||
| 1060 | Ga0070695_100000694 | |||
| 1061 | Ga0070696_100006259 | |||
| 1062 | Ga0070696_100204330 | |||
| 1063 | Ga0070696_100209924 | |||
| 1064 | Ga0070696_100478701 | |||
| 1065 | Ga0070693_100000962 | |||
| 1066 | Ga0070693_100470622 | |||
| 1067 | Ga0070665_100023123 | |||
| 1068 | Ga0070665_100134094 | |||
| 1069 | Ga0070665_100453837 | |||
| 1070 | Ga0070704_100000146 | |||
| 1071 | Ga0070704_100157354 | |||
| 1072 | Ga0070704_100203321 | |||
| 1073 | Ga0070704_100678602 | |||
| 1074 | Ga0068855_100290295 | |||
| 1075 | Ga0068855_100837575 | |||
| 1076 | Ga0070664_100000194 | |||
| 1077 | Ga0068857_100000347 | |||
| 1078 | Ga0068857_100014557 | |||
| 1079 | Ga0068854_100002339 | |||
| 1080 | Ga0068856_100003776 | |||
| 1081 | Ga0068856_100005030 | |||
| 1082 | Ga0068856_100860372 | |||
| 1083 | Ga0070702_100002264 | |||
| 1084 | Ga0070702_100066164 | |||
| 1085 | Ga0068852_100030567 | |||
| 1086 | Ga0068852_100158800 | |||
| 1087 | Ga0068859_100009233 | |||
| 1088 | Ga0068859_100285657 | |||
| 1089 | Ga0068859_100300339 | |||
| 1090 | Ga0068859_100442615 | |||
| 1091 | Ga0068864_100008194 | |||
| 1092 | Ga0068864_100450929 | |||
| 1093 | Ga0068866_10001158 | |||
| 1094 | Ga0068866_10052173 | |||
| 1095 | Ga0068866_10292869 | |||
| 1096 | Ga0068861_100003098 | |||
| 1097 | Ga0068861_100036198 | |||
| 1098 | Ga0068861_100209304 | |||
| 1099 | Ga0068861_100373801 | |||
| 1100 | Ga0068851_10001831 | |||
| 1101 | Ga0068851_10012565 | |||
| 1102 | Ga0068863_100009936 | |||
| 1103 | Ga0068863_100843405 | |||
| 1104 | Ga0068858_100005670 | |||
| 1105 | Ga0068858_100031377 | |||
| 1106 | Ga0068858_100090802 | |||
| 1107 | Ga0068858_100380904 | |||
| 1108 | Ga0068858_101184832 | |||
| 1109 | Ga0068860_100000411 | |||
| 1110 | Ga0068860_100007100 | |||
| 1111 | Ga0068860_100221871 | |||
| 1112 | Ga0068860_100391229 | |||
| 1113 | Ga0068862_100000967 | |||
| 1114 | Ga0081455_10002674 | |||
| 1115 | Ga0081455_10009824 | |||
| 1116 | Ga0081540_1133943 | |||
| 1117 | Ga0081539_10001094 | |||
| 1118 | Ga0081539_10032156 | |||
| 1119 | Ga0070717_10026943 | |||
| 1120 | Ga0075368_10104777 | |||
| 1121 | Ga0075432_10041098 | |||
| 1122 | Ga0070715_10000091 | |||
| 1123 | Ga0070715_10165602 | |||
| 1124 | Ga0070716_100011336 | |||
| 1125 | Ga0070716_100175226 | |||
| 1126 | Ga0070712_100001007 | |||
| 1127 | Ga0070712_100011722 | |||
| 1128 | Ga0070712_100142395 | |||
| 1129 | Ga0075367_10008319 | |||
| 1130 | Ga0068871_100129675 | |||
| 1131 | Ga0075428_100003217 | |||
| 1132 | Ga0075428_100049289 | |||
| 1133 | Ga0075428_100272294 | |||
| 1134 | Ga0075428_100360956 | |||
| 1135 | Ga0075430_100046367 | |||
| 1136 | Ga0075430_100376934 | |||
| 1137 | Ga0075430_100389731 | |||
| 1138 | Ga0075431_100003293 | |||
| 1139 | Ga0075431_100016100 | |||
| 1140 | Ga0075431_100111480 | |||
| 1141 | Ga0075431_100152635 | |||
| 1142 | Ga0075431_100248756 | |||
| 1143 | Ga0075431_100466138 | |||
| 1144 | Ga0075433_10110340 | |||
| 1145 | Ga0075433_10112477 | |||
| 1146 | Ga0075433_10344997 | |||
| 1147 | Ga0075433_10618869 | |||
| 1148 | Ga0075434_100000437 | |||
| 1149 | Ga0075434_100018921 | |||
| 1150 | Ga0075434_100187972 | |||
| 1151 | Ga0075434_100590849 | |||
| 1152 | Ga0075434_100696917 | |||
| 1153 | Ga0075429_100031335 | |||
| 1154 | Ga0068865_100031517 | |||
| 1155 | Ga0068865_100157725 | |||
| 1156 | Ga0068865_100226447 | |||
| 1157 | Ga0075436_100002170 | |||
| 1158 | Ga0097620_100009234 | |||
| 1159 | Ga0097620_100285675 | |||
| 1160 | Ga0097620_100300341 | |||
| 1161 | Ga0097620_100442602 | |||
| 1162 | Ga0099825_1019570 | |||
| 1163 | Ga0099823_1026161 | |||
| 1164 | Ga0079104_1000010 | |||
| 1165 | Ga0075435_100009318 | |||
| 1166 | Ga0075435_100015409 | |||
| 1167 | Ga0075435_100044849 | |||
| 1168 | Ga0075435_100133732 | |||
| 1169 | Ga0105250_10006562 | |||
| 1170 | Ga0105240_10006744 | |||
| 1171 | Ga0105240_10024137 | |||
| 1172 | Ga0105240_10145276 | |||
| 1173 | Ga0105240_10760180 | |||
| 1174 | Ga0105240_10983235 | |||
| 1175 | Ga0111539_10007284 | |||
| 1176 | Ga0111539_10010676 | |||
| 1177 | Ga0111539_10096054 | |||
| 1178 | Ga0111539_10797157 | |||
| 1179 | Ga0111539_10972591 | |||
| 1180 | Ga0105245_10002335 | |||
| 1181 | Ga0105245_10183784 | |||
| 1182 | Ga0105247_10001750 | |||
| 1183 | Ga0105247_10017506 | |||
| 1184 | Ga0105247_10060649 | |||
| 1185 | Ga0105247_10545903 | |||
| 1186 | Ga0114129_10086909 | |||
| 1187 | Ga0114129_10127955 | |||
| 1188 | Ga0114129_10161059 | |||
| 1189 | Ga0114129_10392048 | |||
| 1190 | Ga0114129_11320514 | |||
| 1191 | Ga0105243_10005199 | |||
| 1192 | Ga0105243_10048819 | |||
| 1193 | Ga0105243_10762445 | |||
| 1194 | Ga0105241_10001223 | |||
| 1195 | Ga0105241_10002644 | |||
| 1196 | Ga0105241_10307619 | |||
| 1197 | Ga0105242_10001958 | |||
| 1198 | Ga0105242_10158609 | |||
| 1199 | Ga0105242_10435239 | |||
| 1200 | Ga0105248_10004605 | |||
| 1201 | Ga0105248_10102427 | |||
| 1202 | Ga0105237_10000852 | |||
| 1203 | Ga0105237_10112552 | |||
| 1204 | Ga0105237_10124000 | |||
| 1205 | Ga0105237_10357565 | |||
| 1206 | Ga0105237_10368819 | |||
| 1207 | Ga0105238_10000517 | |||
| 1208 | Ga0105238_10086951 | |||
| 1209 | Ga0105238_10444815 | |||
| 1210 | Ga0105249_10001834 | |||
| 1211 | Ga0105249_10012163 | |||
| 1212 | Ga0105249_10315285 | |||
| 1213 | Ga0105249_11188251 | |||
| 1214 | Ga0105239_10002648 | |||
| 1215 | Ga0105239_10004780 | |||
| 1216 | Ga0105239_10136885 | |||
| 1217 | Ga0105239_11635832 | |||
| 1218 | Ga0105246_10000433 | |||
| 1219 | Ga0105246_10761418 | |||
| 1220 | Ga0157342_1002313 | |||
| 1221 | Ga0157373_10011762 | |||
| 1222 | Ga0157371_10006258 | |||
| 1223 | Ga0157370_10101893 | |||
| 1224 | Ga0157370_10212000 | |||
| 1225 | Ga0157369_10001745 | |||
| 1226 | Ga0157369_10034677 | |||
| 1227 | Ga0157369_10096092 | |||
| 1228 | Ga0157374_10059981 | |||
| 1229 | Ga0157378_10001283 | |||
| 1230 | Ga0157378_10015568 | |||
| 1231 | Ga0157378_10038277 | |||
| 1232 | Ga0157378_10368422 | |||
| 1233 | Ga0163162_10002987 | |||
| 1234 | Ga0163162_10027188 | |||
| 1235 | Ga0157372_10001332 | |||
| 1236 | Ga0157372_10145389 | |||
| 1237 | Ga0157375_10003129 | |||
| 1238 | Ga0157375_10021721 | |||
| 1239 | Ga0157375_10114079 | |||
| 1240 | Ga0157375_10187567 | |||
| 1241 | Ga0157375_10564642 | |||
| 1242 | Ga0163163_10004852 | |||
| 1243 | Ga0163163_10145567 | |||
| 1244 | Ga0163163_10176903 | |||
| 1245 | Ga0157380_10004603 | |||
| 1246 | Ga0157380_10094327 | |||
| 1247 | Ga0157380_10804673 | |||
| 1248 | Ga0157377_10010256 | |||
| 1249 | Ga0157379_10002584 | |||
| 1250 | Ga0157379_10043870 | |||
| 1251 | Ga0157379_10056547 | |||
| 1252 | Ga0157379_10157016 | |||
| 1253 | Ga0157379_10414404 | |||
| 1254 | Ga0157376_10000538 | |||
| 1255 | Ga0157376_10024288 | |||
| 1256 | Ga0157376_10036787 | |||
| 1257 | Ga0163161_10000490 | |||
| 1258 | Ga0206350_11192583 | |||
| 1259 | Ga0206354_10816019 | |||
| 1260 | Ga0206354_11350350 | |||
| 1261 | Ga0213876_10225003 | |||
| 1262 | Ga0224712_10035877 | |||
| 1263 | Ga0224712_10150869 | |||
| 1264 | Ga0209677_101450 | |||
| 1265 | Ga0209233_1005932 | |||
| 1266 | Ga0209455_1001576 | |||
| 1267 | Ga0209455_1003672 | |||
| 1268 | Ga0209676_1009741 | |||
| 1269 | Ga0209758_1004272 | |||
| 1270 | Ga0209758_1038102 | |||
| 1271 | Ga0209051_1003930 | |||
| 1272 | Ga0209257_1006738 | |||
| 1273 | Ga0207656_10003508 | |||
| 1274 | Ga0207653_10006535 | |||
| 1275 | Ga0207692_10005648 | |||
| 1276 | Ga0207692_10007364 | |||
| 1277 | Ga0207642_10061365 | |||
| 1278 | Ga0207642_10187493 | |||
| 1279 | Ga0207710_10006549 | |||
| 1280 | Ga0207710_10064626 | |||
| 1281 | Ga0207710_10084680 | |||
| 1282 | Ga0207688_10001250 | |||
| 1283 | Ga0207680_10028076 | |||
| 1284 | Ga0207680_10255972 | |||
| 1285 | Ga0207647_10003291 | |||
| 1286 | Ga0207685_10002881 | |||
| 1287 | Ga0207699_10008987 | |||
| 1288 | Ga0207645_10075195 | |||
| 1289 | Ga0207645_10117787 | |||
| 1290 | Ga0207684_10138260 | |||
| 1291 | Ga0207654_10000248 | |||
| 1292 | Ga0207654_10029250 | |||
| 1293 | Ga0207707_10027159 | |||
| 1294 | Ga0207695_10000343 | |||
| 1295 | Ga0207695_10049026 | |||
| 1296 | Ga0207695_10213787 | |||
| 1297 | Ga0207671_10011331 | |||
| 1298 | Ga0207671_10234084 | |||
| 1299 | Ga0207671_10239771 | |||
| 1300 | Ga0207671_10387416 | |||
| 1301 | Ga0207693_10000412 | |||
| 1302 | Ga0207693_10047106 | |||
| 1303 | Ga0207693_10078258 | |||
| 1304 | Ga0207693_10780288 | |||
| 1305 | Ga0207663_10000871 | |||
| 1306 | Ga0207663_10068191 | |||
| 1307 | Ga0207660_10006910 | |||
| 1308 | Ga0207662_10011701 | |||
| 1309 | Ga0207657_10000047 | |||
| 1310 | Ga0207657_10421461 | |||
| 1311 | Ga0207649_10004715 | |||
| 1312 | Ga0207652_10439393 | |||
| 1313 | Ga0207681_10017352 | |||
| 1314 | Ga0207694_10000136 | |||
| 1315 | Ga0207650_10038148 | |||
| 1316 | Ga0207659_10043668 | |||
| 1317 | Ga0207687_10015831 | |||
| 1318 | Ga0207687_10250573 | |||
| 1319 | Ga0207700_10089733 | |||
| 1320 | Ga0207700_10288808 | |||
| 1321 | Ga0207700_10313751 | |||
| 1322 | Ga0207700_10341238 | |||
| 1323 | Ga0207664_10047350 | |||
| 1324 | Ga0207664_10456874 | |||
| 1325 | Ga0207644_10005779 | |||
| 1326 | Ga0207690_10001352 | |||
| 1327 | Ga0207706_10000079 | |||
| 1328 | Ga0207686_10016453 | |||
| 1329 | Ga0207686_10421171 | |||
| 1330 | Ga0207709_10702857 | |||
| 1331 | Ga0207670_10120631 | |||
| 1332 | Ga0207670_10232883 | |||
| 1333 | Ga0207669_10004194 | |||
| 1334 | Ga0207704_10001638 | |||
| 1335 | Ga0207704_10378610 | |||
| 1336 | Ga0207665_10000268 | |||
| 1337 | Ga0207665_10059641 | |||
| 1338 | Ga0207691_10024140 | |||
| 1339 | Ga0207691_10494572 | |||
| 1340 | Ga0207711_10150173 | |||
| 1341 | Ga0207711_10180935 | |||
| 1342 | Ga0207689_10119881 | |||
| 1343 | Ga0207689_10553071 | |||
| 1344 | Ga0207689_10752738 | |||
| 1345 | Ga0207661_10000613 | |||
| 1346 | Ga0207661_10438663 | |||
| 1347 | Ga0207679_10015477 | |||
| 1348 | Ga0207667_10016518 | |||
| 1349 | Ga0207667_10144695 | |||
| 1350 | Ga0207667_10324472 | |||
| 1351 | Ga0207667_11050626 | |||
| 1352 | Ga0207651_10204300 | |||
| 1353 | Ga0207651_10369507 | |||
| 1354 | Ga0207712_10003528 | |||
| 1355 | Ga0207712_10044532 | |||
| 1356 | Ga0207668_10005573 | |||
| 1357 | Ga0207668_10385290 | |||
| 1358 | Ga0207668_10783147 | |||
| 1359 | Ga0207640_10080850 | |||
| 1360 | Ga0207658_10050845 | |||
| 1361 | Ga0207658_10372810 | |||
| 1362 | Ga0207677_10446490 | |||
| 1363 | Ga0207703_10010804 | |||
| 1364 | Ga0207703_10030237 | |||
| 1365 | Ga0207703_10316506 | |||
| 1366 | Ga0207703_10466547 | |||
| 1367 | Ga0207639_10100681 | |||
| 1368 | Ga0207639_10216336 | |||
| 1369 | Ga0207639_10547664 | |||
| 1370 | Ga0207639_10769344 | |||
| 1371 | Ga0207678_10000392 | |||
| 1372 | Ga0207678_10355197 | |||
| 1373 | Ga0207708_10002311 | |||
| 1374 | Ga0207702_10000006 | |||
| 1375 | Ga0207702_10025691 | |||
| 1376 | Ga0207702_10169114 | |||
| 1377 | Ga0207702_10228686 | |||
| 1378 | Ga0207641_10004680 | |||
| 1379 | Ga0207641_10187007 | |||
| 1380 | Ga0207641_10692234 | |||
| 1381 | Ga0207648_10130384 | |||
| 1382 | Ga0207648_10285393 | |||
| 1383 | Ga0207676_10036926 | |||
| 1384 | Ga0207676_10394568 | |||
| 1385 | Ga0207674_10000403 | |||
| 1386 | Ga0207674_10003449 | |||
| 1387 | Ga0207675_100000204 | |||
| 1388 | Ga0207675_100018399 | |||
| 1389 | Ga0207675_100059117 | |||
| 1390 | Ga0207675_100085253 | |||
| 1391 | Ga0207683_10000026 | |||
| 1392 | Ga0207698_10007715 | |||
| 1393 | Ga0207698_10022080 | |||
| 1394 | Ga0209281_1000078 | |||
| 1395 | Ga0209389_1000039 | |||
| 1396 | Ga0209489_100087 | |||
| 1397 | Ga0209700_100090 | |||
| 1398 | Ga0209983_1047621 | |||
| 1399 | Ga0209813_10004386 | |||
| 1400 | Ga0209813_10094422 | |||
| 1401 | Ga0207428_10009013 | |||
| 1402 | Ga0207428_10058824 | |||
| 1403 | Ga0207428_10385060 | |||
| 1404 | Ga0268266_10091186 | |||
| 1405 | Ga0268266_10198746 | |||
| 1406 | Ga0268265_10662317 | |||
| 1407 | Ga0268264_10000194 | |||
| 1408 | Ga0268264_10014684 | |||
| 1409 | Ga0268264_10019377 | |||
| 1410 | Ga0268264_10799317 | |||
| 1411 | Ga0268264_11033036 | |||
| 1412 | Ga0265337_1006579 | |||
| 1413 | Ga0265326_10011532 | |||
| 1414 | Ga0265319_1009499 | |||
| 1415 | Ga0265334_10001587 | |||
| 1416 | Ga0265323_10001598 | |||
| 1417 | Ga0265336_10000238 | |||
| 1418 | Ga0307515_10441348 | |||
| 1419 | Ga0265338_10000278 | |||
| 1420 | Ga0265324_10001755 | |||
| 1421 | Ga0265330_10211006 | |||
| 1422 | Ga0265328_10032026 | |||
| 1423 | Ga0265325_10021108 | |||
| 1424 | Ga0265325_10068951 | |||
| 1425 | Ga0265325_10086138 | |||
| 1426 | Ga0265325_10157284 | |||
| 1427 | Ga0265325_10184735 | |||
| 1428 | Ga0265340_10000397 | |||
| 1429 | Ga0265340_10013221 | |||
| 1430 | Ga0265340_10014208 | |||
| 1431 | Ga0265340_10073276 | |||
| 1432 | Ga0265339_10000016 | |||
| 1433 | Ga0265339_10013893 | |||
| 1434 | Ga0265339_10020578 | |||
| 1435 | Ga0265339_10032991 | |||
| 1436 | Ga0265316_10037176 | |||
| 1437 | Ga0265316_10166769 | |||
| 1438 | Ga0307513_10006480 | |||
| 1439 | Ga0265313_10000060 | |||
| 1440 | Ga0265313_10001332 | |||
| 1441 | Ga0265313_10039946 | |||
| 1442 | Ga0265313_10091458 | |||
| 1443 | Ga0265314_10082713 | |||
| 1444 | Ga0265342_10006501 | |||
| 1445 | Ga0265342_10118122 | |||
| 1446 | Ga0307516_10018505 | |||
| 1447 | Ga0307416_100995733 | |||
| 1448 | Ga0373938_0006926 | |||
| 1449 | Ga0373928_0033382 | |||
| 1450 | Ga0373929_0048702 | |||
| 1451 | Ga0373949_0014064 | |||
| 1452 | Ga0373951_0054044 | |||
| 1453 | Ga0373952_0012012 | |||
| 1454 | Ga0373952_0013064 | |||
| 1455 | Ga0373952_0086003 | |||
| 1456 | Ga0373932_0005443 | |||
| 1457 | Ga0373932_0008895 | |||
| 1458 | Ga0373936_0046310 | |||
| 1459 | Ga0373939_0002625 | |||
| 1460 | Ga0373939_0004663 | |||
| 1461 | Ga0373960_0055393 | |||
| 1462 | Ga0373960_0128930 | |||
| 1463 | Ga0373943_0249927 | |||
| 1464 | Ga0373942_0003455 | |||
| 1465 | Ga0373942_0028908 | |||
| 1466 | Ga0373961_0008667 | |||
| 1467 | Ga0373961_0060423 | |||
| 1468 | Ga0373962_0011595 | |||
| 1469 | Ga0373962_0045265 | |||
| 1470 | Ga0373962_0099235 | |||
| 1471 | Ga0373931_0000272 | |||
| 1472 | Ga0373931_0005753 | |||
| 1473 | Ga0373931_0031452 | |||
| 1474 | Ga0373935_0533301 | |||
| 1475 | Ga0373927_0006712 | |||
| 1476 | Ga0373947_0000790 | |||
| 1477 | Ga0373947_0127839 | |||
| 1478 | Ga0373937_0130019 | |||
| 1479 | Ga0373925_0001714 | |||
| 1480 | Ga0373925_0068711 | |||
| 1481 | Ga0395900_0004457 | |||
| 1482 | Ga0395900_0026747 | |||
| 1483 | Ga0395900_0240515 | |||
| 1484 | Ga0395898_0014586 | |||
| 1485 | Ga0395898_0237216 | |||
| 1486 | Ga0395898_0755816 | |||
| 1487 | Ga0395905_0000463 | |||
| 1488 | Ga0395905_0001025 | |||
| 1489 | Ga0395905_0001846 | |||
| 1490 | Ga0395905_0707115 | |||
| 1491 | Ga0395905_1419738 | |||
| 1492 | Ga0436364_1035385 | |||
| 1493 | Ga0436364_1124912 | |||
| 1494 | Ga0395901_0019998 | |||
| 1495 | Ga0395901_0048529 | |||
| 1496 | Ga0395901_0176955 | |||
| 1497 | Ga0400487_27525 | |||
| 1498 | Ga0436365_0096215 | |||
| 1499 | Ga0436365_0502292 | |||
| 1500 | Ga0436365_1937907 | |||
| 1501 | Ga0436360_0019834 | |||
| 1502 | Ga0436361_1111580 | |||
| 1503 | Ga0451833_1324743 | |||
| 1504 | Ga0439433_0111100 | |||
| 1505 | Ga0439446_0242404 | |||
| 1506 | Ga0439435_0009720 | |||
| 1507 | Ga0439460_0197788 | |||
| 1508 | Ga0466971_0058904 | |||
| 1509 | Ga0466970_0075322 | |||
| 1510 | Ga0466970_0217095 | |||
| 1511 | Ga0466957_0199958 | |||
| 1512 | Ga0466957_0386895 | |||
| 1513 | Ga0466959_0136527 | |||
| 1514 | Ga0466959_0271653 | |||
| 1515 | Ga0495603_0000441 | |||
| 1516 | Ga0495603_0183854 | |||
| 1517 | Ga0495603_0598482 | |||
| 1518 | Ga0495590_0047837 | |||
| 1519 | Ga0495590_0080154 | |||
| 1520 | Ga0495629_0000840 | |||
| 1521 | Ga0495638_0206581 | |||
| 1522 | Ga0495641_0026421 | |||
| 1523 | Ga0495580_0001605 | |||
| 1524 | Ga0495582_0000619 | |||
| 1525 | Ga0495639_0002230 | |||
| 1526 | Ga0495662_0116855 | |||
| 1527 | Ga0495664_0222203 | |||
| 1528 | Ga0495584_0057774 | |||
| 1529 | Ga0495584_0317218 | |||
| 1530 | Ga0495594_0000067 | |||
| 1531 | Ga0495607_0115355 | |||
| 1532 | Ga0495643_0022103 | |||
| 1533 | Ga0495643_0284857 | |||
| 1534 | Ga0495644_0041488 | |||
| 1535 | Ga0495663_0123939 | |||
| 1536 | Ga0495666_0077405 | |||
| 1537 | Ga0495654_0000043 | |||
| 1538 | Ga0495654_0086487 | |||
| 1539 | Ga0495665_0001878 | |||
| 1540 | Ga0495665_0205416 | |||
| 1541 | Ga0495665_0510239 | |||
| 1542 | Ga0495645_0001839 | |||
| 1543 | Ga0495622_0004063 | |||
| 1544 | Ga0495633_0150039 | |||
| 1545 | Ga0495667_0694892 | |||
| 1546 | Ga0495656_0053711 | |||
| 1547 | Ga0495668_0053826 | |||
| 1548 | Ga0495634_0004589 | |||
| 1549 | Ga0495635_0451326 | |||
| 1550 | Ga0495635_0630261 | |||
| 1551 | Ga0495588_0006117 | |||
| 1552 | Ga0495599_0029202 | |||
| 1553 | Ga0495647_0004660 | |||
| 1554 | Ga0495658_0000623 | |||
| 1555 | Ga0495658_0402655 | |||
| 1556 | Ga0495669_0083069 | |||
| 1557 | Ga0495613_0000306 | |||
| 1558 | Ga0495613_0254956 | |||
| 1559 | Ga0495671_0312627 | |||
| 1560 | Ga0495589_0116586 | |||
| 1561 | Ga0495581_0000520 | |||
| 1562 | Ga0495674_0120135 | |||
| 1563 | Ga0495674_0795907 | |||
| 1564 | Ga0495676_0035027 | |||
| 1565 | Ga0495676_0068038 | |||
| 1566 | Ga0495676_0264924 | |||
| 1567 | Ga0495680_0039696 | |||
| 1568 | Ga0495677_0145604 | |||
| 1569 | Ga0495593_0000741 | |||
| 1570 | Ga0495614_0002751 | |||
| 1571 | Ga0496100_0012548 | |||
| 1572 | Ga0496100_0039173 | |||
| 1573 | Ga0496100_0095627 | |||
| 1574 | Ga0496101_0002433 | |||
| 1575 | Ga0496101_0010447 | |||
| 1576 | Ga0496101_0275290 | |||
| 1577 | Ga0496102_0011741 | |||
| 1578 | Ga0496102_0015978 | |||
| 1579 | Ga0496102_0129946 | |||
| 1580 | Ga0496102_0365165 | |||
| 1581 | Ga0496103_0009787 | |||
| 1582 | Ga0496103_0092179 | |||
| 1583 | Ga0496103_0187751 | |||
| 1584 | Ga0496104_0001121 | |||
| 1585 | Ga0496104_0005122 | |||
| 1586 | Ga0496104_0042435 | |||
| 1587 | Ga0496104_0116132 | |||
| 1588 | Ga0496104_0217548 | |||
| 1589 | Ga0496105_0003149 | |||
| 1590 | Ga0496105_0030430 | |||
| 1591 | Ga0496105_0048741 | |||
| 1592 | Ga0496105_0203661 | |||
| 1593 | Ga0496105_0337087 | |||
| 1594 | Ga0496106_0003556 | |||
| 1595 | Ga0496106_0032831 | |||
| 1596 | Ga0496106_0077262 | |||
| 1597 | Ga0496106_0197754 | |||
| 1598 | Ga0496106_0537201 | |||
| 1599 | Ga0496106_0664808 | |||
| 1600 | Ga0496107_0039274 | |||
| 1601 | Ga0496107_0057973 | |||
| 1602 | Ga0496107_0095358 | |||
| 1603 | Ga0496107_0235549 | |||
| 1604 | Ga0496108_0013407 | |||
| 1605 | Ga0496108_0191370 | |||
| 1606 | Ga0496108_0196962 | |||
| 1607 | Ga0496108_0467005 | |||
| 1608 | Ga0496108_0587744 | |||
| 1609 | Ga0496109_0016963 | |||
| 1610 | Ga0496109_0021712 | |||
| 1611 | Ga0496109_0031736 | |||
| 1612 | Ga0496109_0040221 | |||
| 1613 | Ga0496109_0272109 | |||
| 1614 | Ga0496109_0422059 | |||
| 1615 | Ga0496109_1025531 | |||
| 1616 | Ga0496110_0050169 | |||
| 1617 | Ga0496110_0055452 | |||
| 1618 | Ga0496110_0114339 | |||
| 1619 | Ga0496110_0601499 | |||
| 1620 | Ga0496111_0006155 | |||
| 1621 | Ga0496111_0008506 | |||
| 1622 | Ga0496111_0011375 | |||
| 1623 | Ga0496111_0030040 | |||
| 1624 | Ga0496111_0182962 | |||
| 1625 | Ga0496112_0003566 | |||
| 1626 | Ga0496112_0004157 | |||
| 1627 | Ga0496112_0005950 | |||
| 1628 | Ga0496112_0048867 | |||
| 1629 | Ga0496112_0069837 | |||
| 1630 | Ga0496113_0034904 | |||
| 1631 | Ga0496113_0235411 | |||
| 1632 | Ga0496114_0005084 | |||
| 1633 | Ga0496114_0016968 | |||
| 1634 | Ga0496114_0018129 | |||
| 1635 | Ga0496114_0963582 | |||
| 1636 | Ga0496115_0058298 | |||
| 1637 | Ga0496115_0150053 | |||
| 1638 | Ga0496115_0208438 | |||
| 1639 | Ga0496117_0047746 | |||
| 1640 | Ga0496117_0262694 | |||
| 1641 | Ga0496118_0063903 | |||
| 1642 | Ga0496118_0069619 | |||
| 1643 | Ga0496121_0008329 | |||
| 1644 | Ga0496121_0089977 | |||
| 1645 | Ga0496121_0097751 | |||
| 1646 | Ga0496121_0170675 | |||
| 1647 | Ga0496122_0023503 | |||
| 1648 | Ga0496122_0025339 | |||
| 1649 | Ga0496123_0029566 | |||
| 1650 | Ga0496124_0018333 | |||
| 1651 | Ga0496124_0075943 | |||
| 1652 | Ga0496124_0079267 | |||
| 1653 | Ga0496124_0221903 | |||
| 1654 | Ga0496125_0065863 | |||
| 1655 | Ga0496125_0165870 | |||
| 1656 | Ga0496126_0033948 | |||
| 1657 | Ga0496126_0728268 | |||
| 1658 | Ga0501031_0018247 | |||
| 1659 | Ga0501031_0019059 | |||
| 1660 | Ga0501031_0064762 | |||
| 1661 | Ga0501031_0154659 | |||
| 1662 | Ga0501032_0102264 | |||
| 1663 | Ga0501032_0154271 | |||
| 1664 | Ga0501033_0000165 | |||
| 1665 | Ga0501033_0061294 | |||
| 1666 | Ga0501033_0206627 | |||
| 1667 | Ga0501033_0334362 | |||
| 1668 | Ga0501034_0362793 | |||
| 1669 | Ga0501034_0388152 | |||
| 1670 | Ga0501036_0010396 | |||
| 1671 | Ga0501036_0050046 | |||
| 1672 | Ga0501036_0062494 | |||
| 1673 | Ga0501036_0203101 | |||
| 1674 | Ga0501036_1401005 | |||
| 1675 | Ga0501037_0046690 | |||
| 1676 | Ga0501037_0094802 | |||
| 1677 | Ga0501037_0110673 | |||
| 1678 | Ga0501037_0436858 | |||
| 1679 | Ga0501038_0027908 | |||
| 1680 | Ga0501038_0164994 | |||
| 1681 | Ga0501038_0235436 | |||
| 1682 | Ga0501038_0492907 | |||
| 1683 | Ga0501039_0012810 | |||
| 1684 | Ga0501039_0024150 | |||
| 1685 | Ga0501039_0055460 | |||
| 1686 | Ga0501039_0092905 | |||
| 1687 | Ga0501039_0112275 | |||
| 1688 | Ga0501039_0272602 | |||
| 1689 | Ga0501039_0393157 | |||
| 1690 | Ga0501040_0011102 | |||
| 1691 | Ga0501040_0034372 | |||
| 1692 | Ga0501040_0110567 | |||
| 1693 | Ga0501040_0160241 | |||
| 1694 | Ga0501040_0214608 | |||
| 1695 | Ga0501040_0274269 | |||
| 1696 | Ga0501041_0005900 | |||
| 1697 | Ga0501041_0012868 | |||
| 1698 | Ga0501041_0104099 | |||
| 1699 | Ga0501041_0111852 | |||
| 1700 | Ga0501041_0115119 | |||
| 1701 | Ga0501041_0127842 | |||
| 1702 | Ga0501041_0385164 | |||
| 1703 | Ga0501041_0433083 | |||
| 1704 | Ga0501042_0004334 | |||
| 1705 | Ga0501042_0041700 | |||
| 1706 | Ga0501042_0072925 | |||
| 1707 | Ga0501042_0087311 | |||
| 1708 | Ga0501043_0039464 | |||
| 1709 | Ga0501043_0052089 | |||
| 1710 | Ga0501043_0338439 | |||
| 1711 | Ga0501046_0037603 | |||
| 1712 | Ga0501046_0049030 | |||
| 1713 | Ga0501046_0494222 | |||
| 1714 | Ga0501047_0180925 | |||
| 1715 | Ga0501048_0009618 | |||
| 1716 | Ga0501048_0110136 | |||
| 1717 | Ga0501048_0118483 | |||
| 1718 | Ga0501048_0210620 | |||
| 1719 | Ga0501048_0305458 | |||
| 1720 | Ga0501048_0443650 | |||
| 1721 | Ga0501067_0001414 | |||
| 1722 | Ga0501067_0118441 | |||
| 1723 | Ga0501067_0151364 | |||
| 1724 | Ga0501068_0073805 | |||
| 1725 | Ga0501068_0108673 | |||
| 1726 | Ga0501069_0236220 | |||
| 1727 | Ga0501069_0430967 | |||
| 1728 | Ga0501069_0512408 | |||
| 1729 | Ga0501070_0043242 | |||
| 1730 | Ga0501070_0132022 | |||
| 1731 | Ga0501070_0266119 | |||
| 1732 | Ga0501070_0323089 | |||
| 1733 | Ga0501071_0019681 | |||
| 1734 | Ga0501071_0021438 | |||
| 1735 | Ga0501071_0055362 | |||
| 1736 | Ga0501071_0072077 | |||
| 1737 | Ga0501071_0087454 | |||
| 1738 | Ga0501071_0107854 | |||
| 1739 | Ga0501072_0012631 | |||
| 1740 | Ga0501072_0033814 | |||
| 1741 | Ga0501072_0130696 | |||
| 1742 | Ga0501072_0178836 | |||
| 1743 | Ga0501073_0129775 | |||
| 1744 | Ga0501073_0543303 | |||
| 1745 | Ga0501074_0028541 | |||
| 1746 | Ga0501074_0071912 | |||
| 1747 | Ga0501074_0185281 | |||
| 1748 | Ga0501074_0610854 | |||
| 1749 | Ga0501074_0620765 | |||
| 1750 | Ga0501075_0002322 | |||
| 1751 | Ga0501075_0006118 | |||
| 1752 | Ga0501075_0012671 | |||
| 1753 | Ga0501075_0015132 | |||
| 1754 | Ga0501075_0070921 | |||
| 1755 | Ga0501075_0098624 | |||
| 1756 | Ga0501075_0155348 | |||
| 1757 | Ga0501075_0281474 | |||
| 1758 | Ga0501076_0009092 | |||
| 1759 | Ga0501076_0011036 | |||
| 1760 | Ga0501076_0049110 | |||
| 1761 | Ga0501076_0084603 | |||
| 1762 | Ga0501076_0331027 | |||
| 1763 | Ga0501076_0465161 | |||
| 1764 | Ga0501076_0524191 | |||
| 1765 | Ga0501076_0656056 | |||
| 1766 | Ga0501077_0007577 | |||
| 1767 | Ga0501077_0009692 | |||
| 1768 | Ga0501077_0032091 | |||
| 1769 | Ga0501077_0059327 | |||
| 1770 | Ga0501077_0092901 | |||
| 1771 | Ga0501077_0131485 | |||
| 1772 | Ga0501077_0160611 | |||
| 1773 | Ga0501077_0430334 | |||
| 1774 | Ga0501079_0006052 | |||
| 1775 | Ga0501079_0017035 | |||
| 1776 | Ga0501079_0082619 | |||
| 1777 | Ga0501079_0204266 | |||
| 1778 | Ga0501079_0254203 | |||
| 1779 | Ga0501079_0562156 | |||
| 1780 | Ga0501080_0018226 | |||
| 1781 | Ga0501080_0160984 | |||
| 1782 | Ga0501080_0236155 | |||
| 1783 | Ga0501080_0243634 | |||
| 1784 | Ga0501080_0269689 | |||
| 1785 | Ga0501080_0351603 | |||
| 1786 | Ga0501081_0008837 | |||
| 1787 | Ga0501081_0009707 | |||
| 1788 | Ga0501081_0048832 | |||
| 1789 | Ga0501081_0057804 | |||
| 1790 | Ga0501081_0587723 | |||
| 1791 | Ga0501083_0001062 | |||
| 1792 | Ga0501083_0027140 | |||
| 1793 | Ga0501083_0047990 | |||
| 1794 | Ga0501083_0054706 | |||
| 1795 | Ga0501083_0059019 | |||
| 1796 | Ga0501083_0124668 | |||
| 1797 | Ga0501083_0233358 | |||
| 1798 | Ga0501035_0001055 | |||
| 1799 | Ga0501035_0055153 | |||
| 1800 | Ga0501035_0132542 | |||
| 1801 | Ga0501035_0395611 | |||
| 1802 | Ga0501044_0936403 | |||
| 1803 | Ga0501045_0013203 | |||
| 1804 | Ga0501045_0135424 | |||
| 1805 | Ga0501045_0143113 | |||
| 1806 | Ga0501045_0145614 | |||
| 1807 | Ga0501045_0187221 | |||
| 1808 | Ga0501045_0295393 | |||
| 1809 | Ga0501045_0656700 | |||
| 1810 | nmdc:mga0yw44_276743_c1 | |||
| 1811 | nmdc:mga0k408_324982_c1 | |||
| 1812 | nmdc:mga06z11_27251_c1 | |||
| 1813 | nmdc:mga06z11_4683_c1 | |||
| 1814 | nmdc:mga05p37_197320_c1 | |||
| 1815 | nmdc:mga05p37_277802_c1 | |||
| 1816 | nmdc:mga05p37_304832_c1 | |||
| 1817 | nmdc:mga09592_171162_c1 | |||
| 1818 | nmdc:mga09592_1766_c1 | |||
| 1819 | nmdc:mga09592_285705_c1 | |||
| 1820 | nmdc:mga0qj67_116450_c1 | |||
| 1821 | nmdc:mga0qj67_5071_c1 | |||
| 1822 | nmdc:mga0qj67_739369_c1 | |||
| 1823 | nmdc:mga06r32_131161_c1 | |||
| 1824 | nmdc:mga06r32_2699_c1 | |||
| 1825 | nmdc:mga06r32_407392_c1 | |||
| 1826 | nmdc:mga06r32_577844_c1 | |||
| 1827 | nmdc:mga06r32_61975_c1 | |||
| 1828 | nmdc:mga08y16_10691_c1 | |||
| 1829 | nmdc:mga08y16_197590_c1 | |||
| 1830 | nmdc:mga08y16_29502_c1 | |||
| 1831 | nmdc:mga08y16_37547_c1 | |||
| 1832 | nmdc:mga0n895_1273_c1 | |||
| 1833 | nmdc:mga0n895_16404_c1 | |||
| 1834 | nmdc:mga0n895_184516_c1 | |||
| 1835 | nmdc:mga0n895_197375_c1 | |||
| 1836 | nmdc:mga0n895_668722_c1 | |||
| 1837 | nmdc:mga0rr50_12331_c1 | |||
| 1838 | nmdc:mga0rr50_70440_c1 | |||
| 1839 | nmdc:mga0rr50_818250_c1 | |||
| 1840 | nmdc:mga08x19_31143_c1 | |||
| 1841 | nmdc:mga0a205_298671_c1 | |||
| 1842 | nmdc:mga0a205_54545_c1 | |||
| 1843 | nmdc:mga0a205_57553_c1 | |||
| 1844 | nmdc:mga0sz30_287710_c1 | |||
| 1845 | Ga0495601_0025917 | |||
| 1846 | Ga0495601_0051547 | |||
| 1847 | Ga0500635_0156183 | |||
| 1848 | Ga0495655_0000614 | |||
| 1849 | Ga0495595_0026853 | |||
| 1850 | Ga0495619_0014629 | |||
| 1851 | Ga0495619_0019133 | |||
| 1852 | Ga0500643_064813 | |||
| 1853 | Ga0500644_0003039 | |||
| 1854 | Ga0500572_001422 | |||
| 1855 | Ga0500618_000007 | |||
| 1856 | Ga0500618_001066 | |||
| 1857 | Ga0500559_0000750 | |||
| 1858 | Ga0500577_0000750 | |||
| 1859 | Ga0500590_022856 | |||
| 1860 | Ga0500603_023087 | |||
| 1861 | Ga0500616_0000758 | |||
| 1862 | Ga0500622_0002839 | |||
| 1863 | Ga0500636_0000562 | |||
| 1864 | Ga0500636_0016824 | |||
| 1865 | Ga0500637_0009578 | |||
| 1866 | Ga0500576_097625 | |||
| 1867 | Ga0500601_003129 | |||
| 1868 | Ga0501084_0001874 | |||
| 1869 | Ga0501084_0010094 | |||
| 1870 | Ga0501084_0015357 | |||
| 1871 | Ga0501084_0031135 | |||
| 1872 | Ga0501084_0035892 | |||
| 1873 | Ga0501084_0081161 | |||
| 1874 | Ga0501084_0087331 | |||
| 1875 | Ga0501084_0117137 | |||
| 1876 | Ga0501084_0126400 | |||
| 1877 | Ga0501084_0243763 | |||
| 1878 | Ga0501084_0290570 | |||
| 1879 | Ga0501084_0590777 | |||
| 1880 | Ga0501084_0752287 | |||
| 1881 | Ga0501082_0008485 | |||
| 1882 | Ga0501082_0027615 | |||
| 1883 | Ga0501082_0039628 | |||
| 1884 | Ga0501082_0108400 | |||
| 1885 | Ga0501082_0111536 | |||
| 1886 | Ga0501082_0241771 | |||
| 1887 | Ga0501082_0288996 | |||
| 1888 | Ga0501082_0684825 | |||
| 1889 | Ga0501082_0834195 | |||
| 1890 | Ga0466962_0142212 | |||
| 1891 | Ga0530510_0019403 | |||
| 1892 | Ga0530510_0020859 | |||
| 1893 | Ga0530510_0091899 | |||
| 1894 | Ga0530510_0106649 | |||
| 1895 | Ga0530510_0119654 | |||
| 1896 | Ga0530510_0412678 | |||
| 1897 | 2511173867 | |||
| 1898 | 2561467230 | |||
| 1899 | 2585994721 | |||
| 1900 | 2585999204 | |||
| 1901 | 2599719343 | |||
| 1902 | 2715501660 | |||
| 1903 | 2821123854 | |||
| 1904 | 2824603715 | |||
| 1905 | 2824610679 | |||
| 1906 | 2824657901 | |||
| 1907 | 2838739117 | |||
| 1908 | 2841843015 | |||
| 1909 | 2842142797 | |||
| 1910 | 2844316345 | |||
| 1911 | 2847939351 | |||
| 1912 | 2854898495 | |||
| 1913 | 2854917729 | |||
| 1914 | 2855021462 | |||
| 1915 | 2857513425 | |||
| 1916 | 2857531416 | |||
| 1917 | 2879087024 | |||
| 1918 | 2888421265 | |||
| 1919 | 2891050732 | |||
| 1920 | 2903728321 | |||
| 1921 | 2906606461 | |||
| 1922 | 2906631350 | |||
| 1923 | 2919171832 | |||
| 1924 | 2995395135 | |||
| 1925 | 8016585318 | |||
| 1926 | 8018151871 | |||
| 1927 | 8054461485 | |||
| 1928 | 8056879320 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2haf-assembly1.cif.gz_A | crystal structure of a putative translation repressor from vibrio cholerae | 0.9221 | 16 | 194 |
| 2ew0-assembly1.cif.gz_A | x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. | 0.915 | 15 | 200 |
| 2ew0-assembly1.cif.gz_A | x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. | 0.9099 | 15 | 200 |
| 2haf-assembly1.cif.gz_A | crystal structure of a putative translation repressor from vibrio cholerae | 0.8693 | 16 | 194 |
| 2hrx-assembly1.cif.gz_A | x-ray crystal structure of protein dip2367 from corynebacterium diphtheriae. northeast structural genomics consortium target cdr13. | 0.8108 | 16 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8W5_4_171_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9217 | 18 | 186 | 3.40.50.1000 |
| 2ew0A00 | Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like | 0.9121 | 15 | 200 | 3.40.1740.10 |
| 2aj2A01 | Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like | 0.9096 | 15 | 194 | 3.40.1740.10 |
| 2ew0A00 | Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like | 0.907 | 15 | 200 | 3.40.1740.10 |
| af_P0A8W5_4_171_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9006 | 18 | 186 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M9Z348-F1-model_v4 | Transcriptional regulator | 0.9868 | 92 | 194 |
GO:0005829
|
| AF-M4W589-F1-model_v4 | Transcriptional regulator | 0.9843 | 59 | 188 |
GO:0005829
|
| AF-V9PH53-F1-model_v4 | YqgE/AlgH family protein | 0.9787 | 37 | 160 |
GO:0005829
|
| AF-M9Z348-F1-model_v4 | Transcriptional regulator | 0.9775 | 92 | 194 |
GO:0005829
|
| AF-V9PHC8-F1-model_v4 | YqgE/AlgH family protein | 0.9769 | 37 | 160 |
GO:0005829
|