F486933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 350 | 1928 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10070424|Ga0075433_100704242 |
| Length | 273 |
| Sequence | VLTVDFRRFPVGPGDRVLDLGCGGGRHAHEAYRRGADVVACDADLGELGTVADMAAAMHEAGEAPATAHARPVAGDGTVMPFGSEVFDRVIAAEVLEHIGDDQRALNEIARVLRPGGLLAVTVPAWLPERICWRLSDDYHNIPGGHVRIYTRPELEAKLRRAGLTVGGHHHAHGLHSPYWWLKCAVGVGDDDHPLARAYHRLLVWDIMKRPAATRVAERALNPLIGKSLVLYARKPVPPGGDGHGEGSADRGGAARRSADRDASRPERAHAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 91 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 173 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 202 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 209 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 210 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 213 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 219 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 288 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 340 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 341 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 342 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 343 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 344 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 345 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 346 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 347 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 348 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 349 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 350 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.44 |
| Metatranscriptomes | 0.41 |
| Isolates | 1.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 0.62 |
| Nodule | 0.1 |
| Rhizoplane | 7.16 |
| Rhizosphere | 90.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075433_10070424 | 3300006852 | Bacteria | 3073 |
| 2 | MBSR1b_contig_4503056 | 2162886012 | Bacteria | 1083 |
| 3 | LJQas_1002216 | 3300000549 | Bacteria | 2740 |
| 4 | LJQas_1005280 | 3300000549 | Bacteria | 1646 |
| 5 | JGI25404J52841_10007904 | 3300003659 | Bacteria | 2257 |
| 6 | Ga0070658_10062310 | 3300005327 | Bacteria | 3039 |
| 7 | Ga0070683_100292681 | 3300005329 | Bacteria | 1549 |
| 8 | Ga0070690_100221277 | 3300005330 | Bacteria | 1326 |
| 9 | Ga0070682_100044302 | 3300005337 | Bacteria | 2754 |
| 10 | Ga0068868_100200272 | 3300005338 | Bacteria | 1664 |
| 11 | Ga0068868_100248708 | 3300005338 | Bacteria | 1496 |
| 12 | Ga0070660_100324824 | 3300005339 | Bacteria | 1264 |
| 13 | Ga0070689_100205556 | 3300005340 | Bacteria | 1610 |
| 14 | Ga0070661_100034192 | 3300005344 | Bacteria | 3685 |
| 15 | Ga0070692_10054061 | 3300005345 | Bacteria | 2095 |
| 16 | Ga0070668_100145070 | 3300005347 | Bacteria | 1915 |
| 17 | Ga0070669_100085306 | 3300005353 | Bacteria | 2358 |
| 18 | Ga0070669_100164889 | 3300005353 | Bacteria | 1724 |
| 19 | Ga0070675_100110283 | 3300005354 | Bacteria | 2327 |
| 20 | Ga0070675_100294337 | 3300005354 | Bacteria | 1429 |
| 21 | Ga0070671_100225384 | 3300005355 | Bacteria | 1590 |
| 22 | Ga0070671_100449315 | 3300005355 | Bacteria | 1106 |
| 23 | Ga0070671_100498713 | 3300005355 | Bacteria | 1047 |
| 24 | Ga0070674_100351482 | 3300005356 | Bacteria | 1191 |
| 25 | Ga0070673_100188377 | 3300005364 | Bacteria | 1770 |
| 26 | Ga0070659_100080447 | 3300005366 | Bacteria | 2601 |
| 27 | Ga0070709_10000293 | 3300005434 | Bacteria | 31656 |
| 28 | Ga0070709_10080490 | 3300005434 | Bacteria | 2124 |
| 29 | Ga0070709_10179554 | 3300005434 | Bacteria | 1485 |
| 30 | Ga0070709_10266136 | 3300005434 | Bacteria | 1240 |
| 31 | Ga0070714_100013140 | 3300005435 | Bacteria | 6629 |
| 32 | Ga0070714_100017411 | 3300005435 | Bacteria | 5820 |
| 33 | Ga0070714_100055138 | 3300005435 | Bacteria | 3397 |
| 34 | Ga0070714_100660553 | 3300005435 | Bacteria | 1007 |
| 35 | Ga0070713_100021561 | 3300005436 | Bacteria | 4959 |
| 36 | Ga0070713_100031308 | 3300005436 | Bacteria | 4236 |
| 37 | Ga0070713_100050178 | 3300005436 | Bacteria | 3445 |
| 38 | Ga0070713_100412669 | 3300005436 | Bacteria | 1263 |
| 39 | Ga0070710_10003256 | 3300005437 | Bacteria | 7698 |
| 40 | Ga0070710_10063550 | 3300005437 | Bacteria | 2109 |
| 41 | Ga0070710_10086358 | 3300005437 | Bacteria | 1842 |
| 42 | Ga0070711_100006437 | 3300005439 | Bacteria | 7081 |
| 43 | Ga0070711_100015362 | 3300005439 | Bacteria | 4846 |
| 44 | Ga0070711_100183901 | 3300005439 | Bacteria | 1601 |
| 45 | Ga0070700_100067335 | 3300005441 | Bacteria | 2275 |
| 46 | Ga0070694_100276674 | 3300005444 | Bacteria | 1278 |
| 47 | Ga0070708_100002499 | 3300005445 | Bacteria | 14189 |
| 48 | Ga0070708_100007308 | 3300005445 | Bacteria | 8839 |
| 49 | Ga0070708_100008434 | 3300005445 | Bacteria | 8271 |
| 50 | Ga0070708_100036014 | 3300005445 | Bacteria | 4314 |
| 51 | Ga0070708_100064148 | 3300005445 | Bacteria | 3290 |
| 52 | Ga0070708_100222667 | 3300005445 | Bacteria | 1769 |
| 53 | Ga0070678_100068342 | 3300005456 | Bacteria | 2648 |
| 54 | Ga0070681_10109484 | 3300005458 | Bacteria | 2702 |
| 55 | Ga0070685_10054414 | 3300005466 | Bacteria | 2321 |
| 56 | Ga0070706_100000821 | 3300005467 | Bacteria | 34271 |
| 57 | Ga0070706_100012251 | 3300005467 | Bacteria | 7947 |
| 58 | Ga0070706_100026028 | 3300005467 | Bacteria | 5384 |
| 59 | Ga0070706_100072290 | 3300005467 | Bacteria | 3192 |
| 60 | Ga0070706_100105320 | 3300005467 | Bacteria | 2624 |
| 61 | Ga0070706_100131481 | 3300005467 | Bacteria | 2335 |
| 62 | Ga0070706_100200810 | 3300005467 | Bacteria | 1862 |
| 63 | Ga0070706_100240642 | 3300005467 | Bacteria | 1690 |
| 64 | Ga0070706_100487897 | 3300005467 | Bacteria | 1146 |
| 65 | Ga0070706_100652523 | 3300005467 | Bacteria | 977 |
| 66 | Ga0070707_100000127 | 3300005468 | Bacteria | 71273 |
| 67 | Ga0070707_100005476 | 3300005468 | Bacteria | 11869 |
| 68 | Ga0070707_100011395 | 3300005468 | Bacteria | 8291 |
| 69 | Ga0070707_100056141 | 3300005468 | Bacteria | 3776 |
| 70 | Ga0070707_100084429 | 3300005468 | Bacteria | 3068 |
| 71 | Ga0070707_100178396 | 3300005468 | Bacteria | 2071 |
| 72 | Ga0070707_100189646 | 3300005468 | Bacteria | 2004 |
| 73 | Ga0070707_100227558 | 3300005468 | Bacteria | 1816 |
| 74 | Ga0070707_100340617 | 3300005468 | Bacteria | 1457 |
| 75 | Ga0070698_100000991 | 3300005471 | Bacteria | 31258 |
| 76 | Ga0070698_100001111 | 3300005471 | Bacteria | 29683 |
| 77 | Ga0070698_100001614 | 3300005471 | Bacteria | 25100 |
| 78 | Ga0070698_100006941 | 3300005471 | Bacteria | 12264 |
| 79 | Ga0070698_100039365 | 3300005471 | Bacteria | 4866 |
| 80 | Ga0070698_100101309 | 3300005471 | Bacteria | 2851 |
| 81 | Ga0070698_100392966 | 3300005471 | Bacteria | 1320 |
| 82 | Ga0070699_100001261 | 3300005518 | Bacteria | 23319 |
| 83 | Ga0070699_100037119 | 3300005518 | Bacteria | 4216 |
| 84 | Ga0070699_100166608 | 3300005518 | Bacteria | 1952 |
| 85 | Ga0070699_100196601 | 3300005518 | Bacteria | 1793 |
| 86 | Ga0070679_100122886 | 3300005530 | Bacteria | 2580 |
| 87 | Ga0070679_100546748 | 3300005530 | Bacteria | 1102 |
| 88 | Ga0070679_101044614 | 3300005530 | Bacteria | 761 |
| 89 | Ga0070684_100108726 | 3300005535 | Bacteria | 2484 |
| 90 | Ga0070684_100169923 | 3300005535 | Bacteria | 1980 |
| 91 | Ga0070684_100307033 | 3300005535 | Bacteria | 1456 |
| 92 | Ga0070697_100018646 | 3300005536 | Bacteria | 5473 |
| 93 | Ga0070697_100232197 | 3300005536 | Bacteria | 1574 |
| 94 | Ga0068853_100148960 | 3300005539 | Bacteria | 2105 |
| 95 | Ga0068853_100589575 | 3300005539 | Bacteria | 1055 |
| 96 | Ga0070672_100226477 | 3300005543 | Bacteria | 1569 |
| 97 | Ga0070686_100045356 | 3300005544 | Bacteria | 2768 |
| 98 | Ga0070686_100140224 | 3300005544 | Bacteria | 1682 |
| 99 | Ga0070695_100032198 | 3300005545 | Bacteria | 3277 |
| 100 | Ga0070696_100254839 | 3300005546 | Bacteria | 1328 |
| 101 | Ga0070693_100058626 | 3300005547 | Bacteria | 2229 |
| 102 | Ga0070693_100217594 | 3300005547 | Bacteria | 1250 |
| 103 | Ga0070665_100223229 | 3300005548 | Bacteria | 1885 |
| 104 | Ga0070665_100498795 | 3300005548 | Bacteria | 1228 |
| 105 | Ga0070704_100057288 | 3300005549 | Bacteria | 2770 |
| 106 | Ga0070704_100076553 | 3300005549 | Bacteria | 2447 |
| 107 | Ga0068855_100091730 | 3300005563 | Bacteria | 3504 |
| 108 | Ga0070664_100130112 | 3300005564 | Bacteria | 2210 |
| 109 | Ga0070664_100403871 | 3300005564 | Bacteria | 1250 |
| 110 | Ga0068856_100135864 | 3300005614 | Bacteria | 2464 |
| 111 | Ga0068856_100347834 | 3300005614 | Bacteria | 1501 |
| 112 | Ga0068852_100061594 | 3300005616 | Bacteria | 3261 |
| 113 | Ga0068852_100381114 | 3300005616 | Bacteria | 1383 |
| 114 | Ga0068859_100478543 | 3300005617 | Bacteria | 1341 |
| 115 | Ga0068864_100124815 | 3300005618 | Bacteria | 2305 |
| 116 | Ga0068864_100139546 | 3300005618 | Bacteria | 2185 |
| 117 | Ga0068864_100339540 | 3300005618 | Bacteria | 1415 |
| 118 | Ga0068861_100170483 | 3300005719 | Bacteria | 1803 |
| 119 | Ga0068861_100596540 | 3300005719 | Bacteria | 1013 |
| 120 | Ga0068870_10037551 | 3300005840 | Bacteria | 2497 |
| 121 | Ga0068863_100138833 | 3300005841 | Bacteria | 2323 |
| 122 | Ga0068858_100120268 | 3300005842 | Bacteria | 2455 |
| 123 | Ga0068860_100831676 | 3300005843 | Bacteria | 937 |
| 124 | Ga0081540_1001333 | 3300005983 | Bacteria | 21517 |
| 125 | Ga0081540_1016514 | 3300005983 | Bacteria | 4614 |
| 126 | Ga0070717_10001020 | 3300006028 | Bacteria | 18788 |
| 127 | Ga0070717_10009294 | 3300006028 | Bacteria | 7386 |
| 128 | Ga0070717_10011549 | 3300006028 | Bacteria | 6710 |
| 129 | Ga0070717_10012759 | 3300006028 | Bacteria | 6414 |
| 130 | Ga0070717_10047815 | 3300006028 | Bacteria | 3506 |
| 131 | Ga0070717_10357577 | 3300006028 | Bacteria | 1306 |
| 132 | Ga0070717_10477366 | 3300006028 | Bacteria | 1126 |
| 133 | Ga0075363_100032602 | 3300006048 | Bacteria | 2707 |
| 134 | Ga0075363_100066133 | 3300006048 | Bacteria | 1956 |
| 135 | Ga0070715_10010346 | 3300006163 | Bacteria | 3322 |
| 136 | Ga0070715_10019130 | 3300006163 | Bacteria | 2621 |
| 137 | Ga0070715_10029471 | 3300006163 | Bacteria | 2211 |
| 138 | Ga0070715_10064352 | 3300006163 | Bacteria | 1619 |
| 139 | Ga0070716_100000033 | 3300006173 | Bacteria | 57092 |
| 140 | Ga0070716_100005591 | 3300006173 | Bacteria | 6102 |
| 141 | Ga0070716_100097761 | 3300006173 | Bacteria | 1792 |
| 142 | Ga0070716_100116560 | 3300006173 | Bacteria | 1664 |
| 143 | Ga0070716_100145979 | 3300006173 | Bacteria | 1515 |
| 144 | Ga0070716_100239739 | 3300006173 | Bacteria | 1229 |
| 145 | Ga0070712_100007693 | 3300006175 | Bacteria | 6739 |
| 146 | Ga0070712_100294010 | 3300006175 | Bacteria | 1312 |
| 147 | Ga0070712_100452809 | 3300006175 | Bacteria | 1069 |
| 148 | Ga0075367_10250915 | 3300006178 | Bacteria | 1110 |
| 149 | Ga0097621_100108230 | 3300006237 | Bacteria | 2346 |
| 150 | Ga0097621_100164273 | 3300006237 | Bacteria | 1910 |
| 151 | Ga0097621_100584969 | 3300006237 | Bacteria | 1019 |
| 152 | Ga0068871_100053084 | 3300006358 | Bacteria | 3284 |
| 153 | Ga0068871_100254483 | 3300006358 | Bacteria | 1530 |
| 154 | Ga0075428_100076214 | 3300006844 | Bacteria | 3662 |
| 155 | Ga0075428_100092168 | 3300006844 | Bacteria | 3304 |
| 156 | Ga0075428_100930327 | 3300006844 | Bacteria | 921 |
| 157 | Ga0075430_100002290 | 3300006846 | Bacteria | 15866 |
| 158 | Ga0075430_100151889 | 3300006846 | Bacteria | 1928 |
| 159 | Ga0075431_100029054 | 3300006847 | Bacteria | 5688 |
| 160 | Ga0075431_100071846 | 3300006847 | Bacteria | 3571 |
| 161 | Ga0075431_100083479 | 3300006847 | Bacteria | 3298 |
| 162 | Ga0075431_100567217 | 3300006847 | Bacteria | 1121 |
| 163 | Ga0075433_10071211 | 3300006852 | Bacteria | 3056 |
| 164 | Ga0075434_100026313 | 3300006871 | Bacteria | 5698 |
| 165 | Ga0075434_100291665 | 3300006871 | Bacteria | 1651 |
| 166 | Ga0075429_100001611 | 3300006880 | Bacteria | 18624 |
| 167 | Ga0075429_100005255 | 3300006880 | Bacteria | 11135 |
| 168 | Ga0075429_100663565 | 3300006880 | Bacteria | 914 |
| 169 | Ga0075436_100051322 | 3300006914 | Bacteria | 2846 |
| 170 | Ga0075436_100068691 | 3300006914 | Bacteria | 2448 |
| 171 | Ga0075436_100233217 | 3300006914 | Bacteria | 1308 |
| 172 | Ga0075436_100364468 | 3300006914 | Bacteria | 1043 |
| 173 | Ga0097620_100478559 | 3300006931 | Bacteria | 1341 |
| 174 | Ga0075435_100004822 | 3300007076 | Bacteria | 9330 |
| 175 | Ga0075435_100078033 | 3300007076 | Bacteria | 2715 |
| 176 | Ga0075435_100247692 | 3300007076 | Bacteria | 1516 |
| 177 | Ga0099794_10052186 | 3300007265 | Bacteria | 1971 |
| 178 | Ga0099795_10205588 | 3300007788 | Bacteria | 832 |
| 179 | Ga0105251_10036723 | 3300009011 | Bacteria | 2409 |
| 180 | Ga0105250_10037039 | 3300009092 | Bacteria | 1957 |
| 181 | Ga0105240_10303024 | 3300009093 | Bacteria | 1827 |
| 182 | Ga0111539_10022313 | 3300009094 | Bacteria | 7779 |
| 183 | Ga0111539_10271458 | 3300009094 | Bacteria | 1974 |
| 184 | Ga0111539_10658800 | 3300009094 | Bacteria | 1219 |
| 185 | Ga0111539_10684655 | 3300009094 | Bacteria | 1194 |
| 186 | Ga0111539_11514946 | 3300009094 | Bacteria | 778 |
| 187 | Ga0105245_10746402 | 3300009098 | Bacteria | 1014 |
| 188 | Ga0105247_10157558 | 3300009101 | Bacteria | 1501 |
| 189 | Ga0114129_10002251 | 3300009147 | Bacteria | 26657 |
| 190 | Ga0114129_10004683 | 3300009147 | Bacteria | 19326 |
| 191 | Ga0114129_10271758 | 3300009147 | Bacteria | 2267 |
| 192 | Ga0114129_10771310 | 3300009147 | Bacteria | 1229 |
| 193 | Ga0114129_11027368 | 3300009147 | Bacteria | 1036 |
| 194 | Ga0114129_11275324 | 3300009147 | Bacteria | 912 |
| 195 | Ga0105243_10400014 | 3300009148 | Bacteria | 1276 |
| 196 | Ga0105243_10553506 | 3300009148 | Bacteria | 1100 |
| 197 | Ga0105243_10623051 | 3300009148 | Bacteria | 1042 |
| 198 | Ga0105243_10807812 | 3300009148 | Bacteria | 925 |
| 199 | Ga0105243_11233985 | 3300009148 | Bacteria | 762 |
| 200 | Ga0105248_10870744 | 3300009177 | Bacteria | 1017 |
| 201 | Ga0105238_10416675 | 3300009551 | Bacteria | 1337 |
| 202 | Ga0105249_10220934 | 3300009553 | Bacteria | 1864 |
| 203 | Ga0105239_10029474 | 3300010375 | Bacteria | 6034 |
| 204 | Ga0105246_10087057 | 3300011119 | Bacteria | 2241 |
| 205 | Ga0105246_10101216 | 3300011119 | Bacteria | 2098 |
| 206 | Ga0157344_1001969 | 3300012476 | Bacteria | 1044 |
| 207 | Ga0157338_1001773 | 3300012515 | Bacteria | 1602 |
| 208 | Ga0157373_10146731 | 3300013100 | Bacteria | 1659 |
| 209 | Ga0157370_10053773 | 3300013104 | Bacteria | 3840 |
| 210 | Ga0157369_10148649 | 3300013105 | Bacteria | 2476 |
| 211 | Ga0157369_10249367 | 3300013105 | Bacteria | 1853 |
| 212 | Ga0157369_10555681 | 3300013105 | Bacteria | 1186 |
| 213 | Ga0157369_10675561 | 3300013105 | Bacteria | 1064 |
| 214 | Ga0157374_10052816 | 3300013296 | Bacteria | 3787 |
| 215 | Ga0157378_10130263 | 3300013297 | Bacteria | 2328 |
| 216 | Ga0157372_11605052 | 3300013307 | Bacteria | 749 |
| 217 | Ga0157375_10329798 | 3300013308 | Bacteria | 1691 |
| 218 | Ga0157375_10388596 | 3300013308 | Bacteria | 1562 |
| 219 | Ga0157375_11271779 | 3300013308 | Bacteria | 864 |
| 220 | Ga0163163_10128939 | 3300014325 | Bacteria | 2569 |
| 221 | Ga0163163_10163292 | 3300014325 | Bacteria | 2273 |
| 222 | Ga0157380_10193693 | 3300014326 | Bacteria | 1797 |
| 223 | Ga0157380_10266561 | 3300014326 | Bacteria | 1559 |
| 224 | Ga0182008_10084040 | 3300014497 | Bacteria | 1567 |
| 225 | Ga0157377_10056996 | 3300014745 | Bacteria | 2220 |
| 226 | Ga0157379_10139694 | 3300014968 | Bacteria | 2183 |
| 227 | Ga0157379_10510242 | 3300014968 | Bacteria | 1115 |
| 228 | Ga0157376_10260982 | 3300014969 | Bacteria | 1623 |
| 229 | Ga0157376_11009867 | 3300014969 | Bacteria | 855 |
| 230 | Ga0163161_10189921 | 3300017792 | Bacteria | 1579 |
| 231 | Ga0206356_10031144 | 3300020070 | Bacteria | 2419 |
| 232 | Ga0206354_11350309 | 3300020081 | Bacteria | 803 |
| 233 | Ga0213873_10028432 | 3300021358 | Bacteria | 1371 |
| 234 | Ga0207692_10022881 | 3300025898 | Bacteria | 2882 |
| 235 | Ga0207692_10074608 | 3300025898 | Bacteria | 1798 |
| 236 | Ga0207692_10244671 | 3300025898 | Bacteria | 1072 |
| 237 | Ga0207642_10171567 | 3300025899 | Bacteria | 1174 |
| 238 | Ga0207688_10033053 | 3300025901 | Bacteria | 2859 |
| 239 | Ga0207685_10004309 | 3300025905 | Bacteria | 3600 |
| 240 | Ga0207699_10000215 | 3300025906 | Bacteria | 34196 |
| 241 | Ga0207699_10003454 | 3300025906 | Bacteria | 7535 |
| 242 | Ga0207699_10024246 | 3300025906 | Bacteria | 3315 |
| 243 | Ga0207699_10215395 | 3300025906 | Bacteria | 1308 |
| 244 | Ga0207643_10053128 | 3300025908 | Bacteria | 2301 |
| 245 | Ga0207684_10001704 | 3300025910 | Bacteria | 23348 |
| 246 | Ga0207684_10004662 | 3300025910 | Bacteria | 12874 |
| 247 | Ga0207684_10010229 | 3300025910 | Bacteria | 8258 |
| 248 | Ga0207684_10029960 | 3300025910 | Bacteria | 4633 |
| 249 | Ga0207684_10061894 | 3300025910 | Bacteria | 3177 |
| 250 | Ga0207684_10066482 | 3300025910 | Bacteria | 3061 |
| 251 | Ga0207684_10066544 | 3300025910 | Bacteria | 3060 |
| 252 | Ga0207684_10079683 | 3300025910 | Bacteria | 2786 |
| 253 | Ga0207684_10104224 | 3300025910 | Bacteria | 2425 |
| 254 | Ga0207684_10126755 | 3300025910 | Bacteria | 2191 |
| 255 | Ga0207684_10176946 | 3300025910 | Bacteria | 1839 |
| 256 | Ga0207684_10232891 | 3300025910 | Bacteria | 1589 |
| 257 | Ga0207707_10192607 | 3300025912 | Bacteria | 1778 |
| 258 | Ga0207707_10211329 | 3300025912 | Bacteria | 1690 |
| 259 | Ga0207707_10227070 | 3300025912 | Bacteria | 1625 |
| 260 | Ga0207707_10453441 | 3300025912 | Bacteria | 1097 |
| 261 | Ga0207693_10018514 | 3300025915 | Bacteria | 5546 |
| 262 | Ga0207693_10024549 | 3300025915 | Bacteria | 4782 |
| 263 | Ga0207693_10030599 | 3300025915 | Bacteria | 4253 |
| 264 | Ga0207693_10185606 | 3300025915 | Bacteria | 1637 |
| 265 | Ga0207693_10260883 | 3300025915 | Bacteria | 1359 |
| 266 | Ga0207663_10031674 | 3300025916 | Bacteria | 3132 |
| 267 | Ga0207663_10057750 | 3300025916 | Bacteria | 2446 |
| 268 | Ga0207662_10042542 | 3300025918 | Bacteria | 2678 |
| 269 | Ga0207657_10103294 | 3300025919 | Bacteria | 2362 |
| 270 | Ga0207649_10064837 | 3300025920 | Bacteria | 2311 |
| 271 | Ga0207649_10195943 | 3300025920 | Bacteria | 1424 |
| 272 | Ga0207646_10000264 | 3300025922 | Bacteria | 71299 |
| 273 | Ga0207646_10007362 | 3300025922 | Bacteria | 11210 |
| 274 | Ga0207646_10010104 | 3300025922 | Bacteria | 9249 |
| 275 | Ga0207646_10013014 | 3300025922 | Bacteria | 7969 |
| 276 | Ga0207646_10065507 | 3300025922 | Bacteria | 3244 |
| 277 | Ga0207646_10100885 | 3300025922 | Bacteria | 2587 |
| 278 | Ga0207646_10143808 | 3300025922 | Bacteria | 2149 |
| 279 | Ga0207646_10154536 | 3300025922 | Bacteria | 2069 |
| 280 | Ga0207646_10236417 | 3300025922 | Bacteria | 1651 |
| 281 | Ga0207646_10413858 | 3300025922 | Bacteria | 1217 |
| 282 | Ga0207650_10202093 | 3300025925 | Bacteria | 1592 |
| 283 | Ga0207659_10149137 | 3300025926 | Bacteria | 1824 |
| 284 | Ga0207687_10061398 | 3300025927 | Bacteria | 2654 |
| 285 | Ga0207687_10140536 | 3300025927 | Bacteria | 1831 |
| 286 | Ga0207687_10167063 | 3300025927 | Bacteria | 1694 |
| 287 | Ga0207700_10000237 | 3300025928 | Bacteria | 32998 |
| 288 | Ga0207700_10001853 | 3300025928 | Bacteria | 11977 |
| 289 | Ga0207700_10016470 | 3300025928 | Bacteria | 4912 |
| 290 | Ga0207700_10037335 | 3300025928 | Bacteria | 3517 |
| 291 | Ga0207700_10105031 | 3300025928 | Bacteria | 2261 |
| 292 | Ga0207700_10105775 | 3300025928 | Bacteria | 2254 |
| 293 | Ga0207700_10273880 | 3300025928 | Bacteria | 1449 |
| 294 | Ga0207700_10493850 | 3300025928 | Bacteria | 1083 |
| 295 | Ga0207664_10000276 | 3300025929 | Bacteria | 38889 |
| 296 | Ga0207664_10001948 | 3300025929 | Bacteria | 13584 |
| 297 | Ga0207664_10002105 | 3300025929 | Bacteria | 13093 |
| 298 | Ga0207664_10046981 | 3300025929 | Bacteria | 3390 |
| 299 | Ga0207664_10060628 | 3300025929 | Bacteria | 3016 |
| 300 | Ga0207664_10104128 | 3300025929 | Bacteria | 2349 |
| 301 | Ga0207664_10549967 | 3300025929 | Bacteria | 1036 |
| 302 | Ga0207690_10463986 | 3300025932 | Bacteria | 1020 |
| 303 | Ga0207706_10273696 | 3300025933 | Bacteria | 1473 |
| 304 | Ga0207709_10067553 | 3300025935 | Bacteria | 2256 |
| 305 | Ga0207709_10258183 | 3300025935 | Bacteria | 1276 |
| 306 | Ga0207670_10358109 | 3300025936 | Bacteria | 1157 |
| 307 | Ga0207704_10015167 | 3300025938 | Bacteria | 3917 |
| 308 | Ga0207665_10000079 | 3300025939 | Bacteria | 62721 |
| 309 | Ga0207665_10005128 | 3300025939 | Bacteria | 8746 |
| 310 | Ga0207665_10068352 | 3300025939 | Bacteria | 2421 |
| 311 | Ga0207665_10082801 | 3300025939 | Bacteria | 2212 |
| 312 | Ga0207665_10098394 | 3300025939 | Bacteria | 2038 |
| 313 | Ga0207691_10102634 | 3300025940 | Bacteria | 2551 |
| 314 | Ga0207689_10087196 | 3300025942 | Bacteria | 2564 |
| 315 | Ga0207689_10201397 | 3300025942 | Bacteria | 1643 |
| 316 | Ga0207661_10462431 | 3300025944 | Bacteria | 1157 |
| 317 | Ga0207667_10137171 | 3300025949 | Bacteria | 2519 |
| 318 | Ga0207712_10023288 | 3300025961 | Bacteria | 4086 |
| 319 | Ga0207712_10153084 | 3300025961 | Bacteria | 1783 |
| 320 | Ga0207712_10488781 | 3300025961 | Bacteria | 1050 |
| 321 | Ga0207640_10103556 | 3300025981 | Bacteria | 2001 |
| 322 | Ga0207640_10590255 | 3300025981 | Bacteria | 939 |
| 323 | Ga0207658_10460975 | 3300025986 | Bacteria | 1127 |
| 324 | Ga0207677_10303872 | 3300026023 | Bacteria | 1319 |
| 325 | Ga0207703_10074917 | 3300026035 | Bacteria | 2803 |
| 326 | Ga0207678_10052664 | 3300026067 | Bacteria | 3510 |
| 327 | Ga0207708_10052111 | 3300026075 | Bacteria | 3117 |
| 328 | Ga0207702_10171277 | 3300026078 | Bacteria | 1991 |
| 329 | Ga0207702_10731314 | 3300026078 | Bacteria | 976 |
| 330 | Ga0207676_10470729 | 3300026095 | Bacteria | 1188 |
| 331 | Ga0207676_10821750 | 3300026095 | Bacteria | 908 |
| 332 | Ga0207674_10016544 | 3300026116 | Bacteria | 8068 |
| 333 | Ga0207674_10029717 | 3300026116 | Bacteria | 5751 |
| 334 | Ga0207675_100071147 | 3300026118 | Bacteria | 3251 |
| 335 | Ga0207675_100242890 | 3300026118 | Bacteria | 1740 |
| 336 | Ga0207683_10001961 | 3300026121 | Bacteria | 18223 |
| 337 | Ga0207683_10239461 | 3300026121 | Bacteria | 1655 |
| 338 | Ga0207698_10556498 | 3300026142 | Bacteria | 1125 |
| 339 | Ga0207428_10267784 | 3300027907 | Bacteria | 1271 |
| 340 | Ga0268266_10509921 | 3300028379 | Bacteria | 1149 |
| 341 | Ga0265338_10000931 | 3300028800 | Bacteria | 49350 |
| 342 | Ga0265338_10002733 | 3300028800 | Bacteria | 25888 |
| 343 | Ga0265338_10007759 | 3300028800 | Bacteria | 13203 |
| 344 | Ga0265760_10099131 | 3300031090 | Bacteria | 919 |
| 345 | Ga0265325_10000666 | 3300031241 | Bacteria | 25053 |
| 346 | Ga0265331_10034269 | 3300031250 | Bacteria | 2505 |
| 347 | Ga0265327_10009735 | 3300031251 | Bacteria | 6877 |
| 348 | Ga0265327_10029452 | 3300031251 | Bacteria | 3123 |
| 349 | Ga0265327_10066785 | 3300031251 | Bacteria | 1813 |
| 350 | Ga0265327_10081088 | 3300031251 | Bacteria | 1603 |
| 351 | Ga0265316_10022142 | 3300031344 | Bacteria | 5368 |
| 352 | Ga0265313_10000421 | 3300031595 | Bacteria | 45317 |
| 353 | Ga0265314_10099761 | 3300031711 | Bacteria | 1869 |
| 354 | Ga0316576_10326660 | 3300031727 | Bacteria | 1144 |
| 355 | Ga0307413_10008822 | 3300031824 | Bacteria | 4787 |
| 356 | Ga0307407_10182180 | 3300031903 | Bacteria | 1393 |
| 357 | Ga0307412_10067286 | 3300031911 | Bacteria | 2432 |
| 358 | Ga0307409_100066270 | 3300031995 | Bacteria | 2847 |
| 359 | Ga0307409_100326338 | 3300031995 | Bacteria | 1438 |
| 360 | Ga0307409_100346976 | 3300031995 | Bacteria | 1399 |
| 361 | Ga0307416_100011074 | 3300032002 | Bacteria | 5995 |
| 362 | Ga0307416_100780410 | 3300032002 | Bacteria | 1050 |
| 363 | Ga0307411_10161550 | 3300032005 | Bacteria | 1679 |
| 364 | Ga0307415_100003889 | 3300032126 | Bacteria | 7673 |
| 365 | Ga0307415_100023156 | 3300032126 | Bacteria | 3850 |
| 366 | Ga0373930_0017303 | 3300034816 | Bacteria | 1373 |
| 367 | Ga0373950_0022418 | 3300034818 | Bacteria | 1123 |
| 368 | Ga0373958_0038218 | 3300034819 | Bacteria | 971 |
| 369 | Ga0373926_0007799 | 3300035083 | Bacteria | 3565 |
| 370 | Ga0373926_0038875 | 3300035083 | Bacteria | 1695 |
| 371 | Ga0373928_0032986 | 3300035084 | Bacteria | 1157 |
| 372 | Ga0373929_0008257 | 3300035085 | Bacteria | 1918 |
| 373 | Ga0373929_0012072 | 3300035085 | Bacteria | 1637 |
| 374 | Ga0373934_0000147 | 3300035086 | Bacteria | 25688 |
| 375 | Ga0373934_0002032 | 3300035086 | Bacteria | 7431 |
| 376 | Ga0373934_0008979 | 3300035086 | Bacteria | 3736 |
| 377 | Ga0373934_0043062 | 3300035086 | Bacteria | 1784 |
| 378 | Ga0373934_0043712 | 3300035086 | Bacteria | 1770 |
| 379 | Ga0373944_0001945 | 3300035089 | Bacteria | 5233 |
| 380 | Ga0373944_0049699 | 3300035089 | Bacteria | 1318 |
| 381 | Ga0373949_0023503 | 3300035090 | Bacteria | 1427 |
| 382 | Ga0373923_0006138 | 3300035111 | Bacteria | 4130 |
| 383 | Ga0373923_0023993 | 3300035111 | Bacteria | 2405 |
| 384 | Ga0373923_0026639 | 3300035111 | Bacteria | 2301 |
| 385 | Ga0373923_0113291 | 3300035111 | Bacteria | 1206 |
| 386 | Ga0373932_0016797 | 3300035112 | Bacteria | 1872 |
| 387 | Ga0373936_0001334 | 3300035113 | Bacteria | 8956 |
| 388 | Ga0373936_0001833 | 3300035113 | Bacteria | 7824 |
| 389 | Ga0373936_0049328 | 3300035113 | Bacteria | 1700 |
| 390 | Ga0373939_0025030 | 3300035114 | Bacteria | 1669 |
| 391 | Ga0373941_0146569 | 3300035115 | Bacteria | 863 |
| 392 | Ga0373945_0001276 | 3300035116 | Bacteria | 7645 |
| 393 | Ga0373945_0001451 | 3300035116 | Bacteria | 7231 |
| 394 | Ga0373953_0000058 | 3300035117 | Bacteria | 28394 |
| 395 | Ga0373953_0011227 | 3300035117 | Bacteria | 3139 |
| 396 | Ga0373953_0011364 | 3300035117 | Bacteria | 3123 |
| 397 | Ga0373953_0021950 | 3300035117 | Bacteria | 2401 |
| 398 | Ga0373953_0082699 | 3300035117 | Bacteria | 1336 |
| 399 | Ga0373953_0111418 | 3300035117 | Bacteria | 1157 |
| 400 | Ga0373954_0036587 | 3300035118 | Bacteria | 2279 |
| 401 | Ga0373954_0133439 | 3300035118 | Bacteria | 1209 |
| 402 | Ga0373956_0000532 | 3300035119 | Bacteria | 15593 |
| 403 | Ga0373956_0022918 | 3300035119 | Bacteria | 2676 |
| 404 | Ga0373956_0054261 | 3300035119 | Bacteria | 1805 |
| 405 | Ga0373956_0060718 | 3300035119 | Bacteria | 1712 |
| 406 | Ga0373956_0145723 | 3300035119 | Bacteria | 1113 |
| 407 | Ga0373957_0005875 | 3300035120 | Bacteria | 3832 |
| 408 | Ga0373957_0013383 | 3300035120 | Bacteria | 2783 |
| 409 | Ga0373957_0120707 | 3300035120 | Bacteria | 1061 |
| 410 | Ga0373960_0022395 | 3300035121 | Bacteria | 1691 |
| 411 | Ga0373943_0001034 | 3300035170 | Bacteria | 12360 |
| 412 | Ga0373943_0001717 | 3300035170 | Bacteria | 9929 |
| 413 | Ga0373943_0332646 | 3300035170 | Bacteria | 868 |
| 414 | Ga0373946_0001997 | 3300035171 | Bacteria | 7141 |
| 415 | Ga0373946_0007314 | 3300035171 | Bacteria | 4030 |
| 416 | Ga0373946_0020811 | 3300035171 | Bacteria | 2538 |
| 417 | Ga0373946_0033724 | 3300035171 | Bacteria | 2063 |
| 418 | Ga0373946_0044196 | 3300035171 | Bacteria | 1839 |
| 419 | Ga0373955_0001363 | 3300035172 | Bacteria | 10382 |
| 420 | Ga0373955_0003228 | 3300035172 | Bacteria | 7143 |
| 421 | Ga0373955_0007678 | 3300035172 | Bacteria | 4967 |
| 422 | Ga0373955_0018334 | 3300035172 | Bacteria | 3479 |
| 423 | Ga0373955_0071122 | 3300035172 | Bacteria | 1945 |
| 424 | Ga0373961_0014919 | 3300035241 | Bacteria | 1979 |
| 425 | Ga0316574_0095529 | 3300035398 | Bacteria | 1899 |
| 426 | Ga0316574_0166129 | 3300035398 | Bacteria | 1421 |
| 427 | Ga0373924_0000537 | 3300035410 | Bacteria | 11689 |
| 428 | Ga0373924_0001574 | 3300035410 | Bacteria | 7455 |
| 429 | Ga0373924_0004757 | 3300035410 | Bacteria | 4764 |
| 430 | Ga0373924_0032163 | 3300035410 | Bacteria | 2113 |
| 431 | Ga0373924_0042310 | 3300035410 | Bacteria | 1868 |
| 432 | Ga0373924_0107855 | 3300035410 | Bacteria | 1201 |
| 433 | Ga0373931_0059827 | 3300035691 | Bacteria | 2049 |
| 434 | Ga0373935_0000168 | 3300035692 | Bacteria | 30620 |
| 435 | Ga0373935_0005165 | 3300035692 | Bacteria | 7684 |
| 436 | Ga0373935_0005683 | 3300035692 | Bacteria | 7360 |
| 437 | Ga0373935_0079030 | 3300035692 | Bacteria | 2135 |
| 438 | Ga0373927_0027084 | 3300035695 | Bacteria | 3745 |
| 439 | Ga0373927_0030375 | 3300035695 | Bacteria | 3525 |
| 440 | Ga0373927_0163752 | 3300035695 | Bacteria | 1457 |
| 441 | Ga0373927_0483336 | 3300035695 | Bacteria | 818 |
| 442 | Ga0373933_0000002 | 3300035724 | Bacteria | 151785 |
| 443 | Ga0373933_0012052 | 3300035724 | Bacteria | 4774 |
| 444 | Ga0373933_0046479 | 3300035724 | Bacteria | 2578 |
| 445 | Ga0373933_0073712 | 3300035724 | Bacteria | 2080 |
| 446 | Ga0373933_0100991 | 3300035724 | Bacteria | 1790 |
| 447 | Ga0373933_0153466 | 3300035724 | Bacteria | 1459 |
| 448 | Ga0373947_0000007 | 3300035725 | Bacteria | 192259 |
| 449 | Ga0373947_0000631 | 3300035725 | Bacteria | 20809 |
| 450 | Ga0373947_0021996 | 3300035725 | Bacteria | 3695 |
| 451 | Ga0373947_0137456 | 3300035725 | Bacteria | 1565 |
| 452 | Ga0373947_0333284 | 3300035725 | Bacteria | 1016 |
| 453 | Ga0373937_0000014 | 3300036401 | Bacteria | 151785 |
| 454 | Ga0373937_0003979 | 3300036401 | Bacteria | 12502 |
| 455 | Ga0373937_0023082 | 3300036401 | Bacteria | 5598 |
| 456 | Ga0373937_0082916 | 3300036401 | Bacteria | 2966 |
| 457 | Ga0373937_0100751 | 3300036401 | Bacteria | 2680 |
| 458 | Ga0373937_0116213 | 3300036401 | Bacteria | 2491 |
| 459 | Ga0373937_0139157 | 3300036401 | Bacteria | 2270 |
| 460 | Ga0373937_0147637 | 3300036401 | Bacteria | 2202 |
| 461 | Ga0373937_0457909 | 3300036401 | Bacteria | 1211 |
| 462 | Ga0373937_0668570 | 3300036401 | Bacteria | 984 |
| 463 | Ga0373937_0818233 | 3300036401 | Bacteria | 879 |
| 464 | Ga0316582_0543542 | 3300036647 | Bacteria | 800 |
| 465 | Ga0316584_0277669 | 3300036712 | Bacteria | 1218 |
| 466 | Ga0373925_0002113 | 3300037068 | Bacteria | 16308 |
| 467 | Ga0373925_0004222 | 3300037068 | Bacteria | 10907 |
| 468 | Ga0373925_0015186 | 3300037068 | Bacteria | 5567 |
| 469 | Ga0373925_0021959 | 3300037068 | Bacteria | 4652 |
| 470 | Ga0436364_0735026 | 3300037853 | Bacteria | 6279 |
| 471 | Ga0436364_0914140 | 3300037853 | Bacteria | 18948 |
| 472 | Ga0436360_1165953 | 3300039438 | Bacteria | 2381 |
| 473 | Ga0436361_0058011 | 3300039447 | Bacteria | 718 |
| 474 | Ga0436363_0094543 | 3300039450 | Bacteria | 1053 |
| 475 | Ga0436363_0198794 | 3300039450 | Bacteria | 1531 |
| 476 | Ga0436363_1712497 | 3300039450 | Bacteria | 1526 |
| 477 | Ga0436362_0562836 | 3300039453 | Bacteria | 1507 |
| 478 | Ga0436362_0951630 | 3300039453 | Bacteria | 5013 |
| 479 | Ga0436362_1061215 | 3300039453 | Bacteria | 4679 |
| 480 | Ga0439438_036712 | 3300041405 | Bacteria | 1284 |
| 481 | Ga0439447_060972 | 3300041407 | Bacteria | 887 |
| 482 | Ga0451853_0314525 | 3300041512 | Bacteria | 4190 |
| 483 | Ga0439431_0013818 | 3300041997 | Bacteria | 1865 |
| 484 | Ga0439446_0027658 | 3300042156 | Bacteria | 1628 |
| 485 | Ga0466965_0016093 | 3300044683 | Bacteria | 3554 |
| 486 | Ga0466965_0097229 | 3300044683 | Bacteria | 1503 |
| 487 | Ga0466966_0078499 | 3300044684 | Bacteria | 2058 |
| 488 | Ga0466961_0024031 | 3300044693 | Bacteria | 3921 |
| 489 | Ga0466961_0072354 | 3300044693 | Bacteria | 2187 |
| 490 | Ga0466961_0101793 | 3300044693 | Bacteria | 1809 |
| 491 | Ga0466963_0026729 | 3300044694 | Bacteria | 3693 |
| 492 | Ga0466964_0012828 | 3300044706 | Bacteria | 3174 |
| 493 | Ga0466971_0028679 | 3300044719 | Bacteria | 2489 |
| 494 | Ga0466971_0082617 | 3300044719 | Bacteria | 1466 |
| 495 | Ga0466970_0024199 | 3300044765 | Bacteria | 3175 |
| 496 | Ga0466970_0029227 | 3300044765 | Bacteria | 2901 |
| 497 | Ga0466970_0116116 | 3300044765 | Bacteria | 1464 |
| 498 | Ga0466957_0016152 | 3300044842 | Bacteria | 4364 |
| 499 | Ga0466960_0033457 | 3300044901 | Bacteria | 2389 |
| 500 | Ga0466960_0100214 | 3300044901 | Bacteria | 1491 |
| 501 | Ga0466960_0105888 | 3300044901 | Bacteria | 1454 |
| 502 | Ga0466959_0108272 | 3300045049 | Bacteria | 1985 |
| 503 | Ga0466959_0147955 | 3300045049 | Bacteria | 1657 |
| 504 | Ga0466958_0010458 | 3300045836 | Bacteria | 5198 |
| 505 | Ga0466958_0380035 | 3300045836 | Bacteria | 911 |
| 506 | Ga0466967_0005049 | 3300045976 | Bacteria | 9047 |
| 507 | Ga0466967_0586912 | 3300045976 | Bacteria | 1099 |
| 508 | Ga0466967_0708812 | 3300045976 | Bacteria | 997 |
| 509 | Ga0495592_0000133 | 3300046454 | Bacteria | 66075 |
| 510 | Ga0495592_0011180 | 3300046454 | Bacteria | 6780 |
| 511 | Ga0495592_0018646 | 3300046454 | Bacteria | 5281 |
| 512 | Ga0495592_0091562 | 3300046454 | Bacteria | 2180 |
| 513 | Ga0495592_0095463 | 3300046454 | Bacteria | 2127 |
| 514 | Ga0495592_0100167 | 3300046454 | Bacteria | 2066 |
| 515 | Ga0495603_0007688 | 3300046455 | Bacteria | 6493 |
| 516 | Ga0495603_0088065 | 3300046455 | Bacteria | 1817 |
| 517 | Ga0495603_0181329 | 3300046455 | Bacteria | 1218 |
| 518 | Ga0495629_0002868 | 3300046459 | Bacteria | 13174 |
| 519 | Ga0495629_0028696 | 3300046459 | Bacteria | 3949 |
| 520 | Ga0495629_0034052 | 3300046459 | Bacteria | 3601 |
| 521 | Ga0495629_0047594 | 3300046459 | Bacteria | 3008 |
| 522 | Ga0495629_0253780 | 3300046459 | Bacteria | 1210 |
| 523 | Ga0495629_0315659 | 3300046459 | Bacteria | 1069 |
| 524 | Ga0495641_0012372 | 3300046461 | Bacteria | 4778 |
| 525 | Ga0495641_0016724 | 3300046461 | Bacteria | 3853 |
| 526 | Ga0495641_0073790 | 3300046461 | Bacteria | 1530 |
| 527 | Ga0495641_0309201 | 3300046461 | Unclassified | 713 |
| 528 | Ga0495651_0000470 | 3300046462 | Bacteria | 30998 |
| 529 | Ga0495651_0001347 | 3300046462 | Bacteria | 19012 |
| 530 | Ga0495651_0012416 | 3300046462 | Bacteria | 6568 |
| 531 | Ga0495651_0018081 | 3300046462 | Bacteria | 5457 |
| 532 | Ga0495651_0020335 | 3300046462 | Bacteria | 5152 |
| 533 | Ga0495651_0045457 | 3300046462 | Bacteria | 3401 |
| 534 | Ga0495651_0073204 | 3300046462 | Bacteria | 2601 |
| 535 | Ga0495653_0021798 | 3300046463 | Bacteria | 5186 |
| 536 | Ga0495653_0022407 | 3300046463 | Bacteria | 5112 |
| 537 | Ga0495653_0028427 | 3300046463 | Bacteria | 4469 |
| 538 | Ga0495653_0031442 | 3300046463 | Bacteria | 4219 |
| 539 | Ga0495653_0046286 | 3300046463 | Bacteria | 3369 |
| 540 | Ga0495653_0068420 | 3300046463 | Bacteria | 2663 |
| 541 | Ga0495653_0120145 | 3300046463 | Bacteria | 1874 |
| 542 | Ga0495653_0162076 | 3300046463 | Bacteria | 1551 |
| 543 | Ga0495580_0011155 | 3300046472 | Bacteria | 6961 |
| 544 | Ga0495580_0072122 | 3300046472 | Bacteria | 2412 |
| 545 | Ga0495580_0284629 | 3300046472 | Bacteria | 1127 |
| 546 | Ga0495582_0000564 | 3300046473 | Bacteria | 20477 |
| 547 | Ga0495582_0014717 | 3300046473 | Bacteria | 4299 |
| 548 | Ga0495582_0080952 | 3300046473 | Bacteria | 1803 |
| 549 | Ga0495639_0000320 | 3300046475 | Bacteria | 23322 |
| 550 | Ga0495639_0012003 | 3300046475 | Bacteria | 3736 |
| 551 | Ga0495639_0060948 | 3300046475 | Bacteria | 1729 |
| 552 | Ga0495662_0002566 | 3300046476 | Bacteria | 9168 |
| 553 | Ga0495662_0004176 | 3300046476 | Bacteria | 7275 |
| 554 | Ga0495662_0006002 | 3300046476 | Bacteria | 6075 |
| 555 | Ga0495662_0035173 | 3300046476 | Bacteria | 2417 |
| 556 | Ga0495664_0000448 | 3300046477 | Bacteria | 20228 |
| 557 | Ga0495664_0008540 | 3300046477 | Bacteria | 5710 |
| 558 | Ga0495664_0032453 | 3300046477 | Bacteria | 3064 |
| 559 | Ga0495664_0084001 | 3300046477 | Bacteria | 1910 |
| 560 | Ga0495664_0102439 | 3300046477 | Bacteria | 1725 |
| 561 | Ga0495664_0269277 | 3300046477 | Bacteria | 1029 |
| 562 | Ga0495664_0273126 | 3300046477 | Bacteria | 1021 |
| 563 | Ga0495608_0000028 | 3300046511 | Bacteria | 151829 |
| 564 | Ga0495608_0005511 | 3300046511 | Bacteria | 9037 |
| 565 | Ga0495608_0018095 | 3300046511 | Bacteria | 4867 |
| 566 | Ga0495608_0024564 | 3300046511 | Bacteria | 4119 |
| 567 | Ga0495608_0029548 | 3300046511 | Bacteria | 3716 |
| 568 | Ga0495608_0056210 | 3300046511 | Bacteria | 2599 |
| 569 | Ga0495608_0083484 | 3300046511 | Bacteria | 2074 |
| 570 | Ga0495608_0083910 | 3300046511 | Bacteria | 2068 |
| 571 | Ga0495608_0207861 | 3300046511 | Bacteria | 1231 |
| 572 | Ga0495618_0018754 | 3300046514 | Bacteria | 4250 |
| 573 | Ga0495618_0061533 | 3300046514 | Bacteria | 2382 |
| 574 | Ga0495618_0104710 | 3300046514 | Bacteria | 1812 |
| 575 | Ga0495618_0270399 | 3300046514 | Bacteria | 1062 |
| 576 | Ga0495618_0306229 | 3300046514 | Bacteria | 986 |
| 577 | Ga0495628_0000371 | 3300046516 | Bacteria | 41228 |
| 578 | Ga0495628_0009484 | 3300046516 | Bacteria | 8308 |
| 579 | Ga0495628_0071155 | 3300046516 | Bacteria | 2711 |
| 580 | Ga0495628_0083266 | 3300046516 | Bacteria | 2484 |
| 581 | Ga0495628_0100045 | 3300046516 | Bacteria | 2238 |
| 582 | Ga0495628_0104685 | 3300046516 | Bacteria | 2180 |
| 583 | Ga0495628_0128986 | 3300046516 | Bacteria | 1935 |
| 584 | Ga0495628_0159230 | 3300046516 | Bacteria | 1716 |
| 585 | Ga0495628_0170652 | 3300046516 | Bacteria | 1649 |
| 586 | Ga0495628_0171807 | 3300046516 | Bacteria | 1643 |
| 587 | Ga0495628_0198464 | 3300046516 | Bacteria | 1512 |
| 588 | Ga0495628_0216447 | 3300046516 | Bacteria | 1440 |
| 589 | Ga0495628_0264617 | 3300046516 | Bacteria | 1280 |
| 590 | Ga0495630_0039791 | 3300046517 | Bacteria | 3514 |
| 591 | Ga0495630_0081973 | 3300046517 | Bacteria | 2434 |
| 592 | Ga0495630_0092051 | 3300046517 | Bacteria | 2291 |
| 593 | Ga0495630_0116237 | 3300046517 | Bacteria | 2027 |
| 594 | Ga0495630_0123366 | 3300046517 | Bacteria | 1966 |
| 595 | Ga0495630_0155421 | 3300046517 | Bacteria | 1741 |
| 596 | Ga0495630_0284589 | 3300046517 | Bacteria | 1263 |
| 597 | Ga0495630_0567314 | 3300046517 | Bacteria | 870 |
| 598 | Ga0495666_0001809 | 3300046526 | Bacteria | 10565 |
| 599 | Ga0495666_0021044 | 3300046526 | Bacteria | 3229 |
| 600 | Ga0495666_0039596 | 3300046526 | Bacteria | 2288 |
| 601 | Ga0495666_0055293 | 3300046526 | Bacteria | 1902 |
| 602 | Ga0495652_0000031 | 3300046529 | Bacteria | 151765 |
| 603 | Ga0495652_0006866 | 3300046529 | Bacteria | 10536 |
| 604 | Ga0495652_0063281 | 3300046529 | Bacteria | 3115 |
| 605 | Ga0495652_0077351 | 3300046529 | Bacteria | 2758 |
| 606 | Ga0495652_0081177 | 3300046529 | Bacteria | 2675 |
| 607 | Ga0495652_0118260 | 3300046529 | Bacteria | 2118 |
| 608 | Ga0495652_0121714 | 3300046529 | Bacteria | 2079 |
| 609 | Ga0495652_0132782 | 3300046529 | Bacteria | 1968 |
| 610 | Ga0495665_0000756 | 3300046531 | Bacteria | 16765 |
| 611 | Ga0495665_0016699 | 3300046531 | Bacteria | 3954 |
| 612 | Ga0495665_0025410 | 3300046531 | Bacteria | 3181 |
| 613 | Ga0495665_0062049 | 3300046531 | Bacteria | 1973 |
| 614 | Ga0495640_0007267 | 3300046533 | Bacteria | 8726 |
| 615 | Ga0495640_0032524 | 3300046533 | Bacteria | 3714 |
| 616 | Ga0495640_0033050 | 3300046533 | Bacteria | 3679 |
| 617 | Ga0495640_0033878 | 3300046533 | Bacteria | 3627 |
| 618 | Ga0495640_0061722 | 3300046533 | Bacteria | 2545 |
| 619 | Ga0495640_0076132 | 3300046533 | Bacteria | 2239 |
| 620 | Ga0495640_0143060 | 3300046533 | Bacteria | 1541 |
| 621 | Ga0495640_0358298 | 3300046533 | Bacteria | 899 |
| 622 | Ga0495586_0002211 | 3300046535 | Bacteria | 10567 |
| 623 | Ga0495586_0265090 | 3300046535 | Bacteria | 981 |
| 624 | Ga0495587_0000023 | 3300046536 | Bacteria | 151763 |
| 625 | Ga0495587_0005276 | 3300046536 | Bacteria | 8446 |
| 626 | Ga0495587_0018386 | 3300046536 | Bacteria | 4336 |
| 627 | Ga0495587_0025920 | 3300046536 | Bacteria | 3578 |
| 628 | Ga0495587_0144175 | 3300046536 | Bacteria | 1358 |
| 629 | Ga0495645_0028213 | 3300046543 | Bacteria | 4078 |
| 630 | Ga0495645_0206569 | 3300046543 | Bacteria | 1328 |
| 631 | Ga0495667_0000054 | 3300046559 | Bacteria | 105009 |
| 632 | Ga0495667_0004964 | 3300046559 | Bacteria | 8999 |
| 633 | Ga0495667_0015283 | 3300046559 | Bacteria | 5184 |
| 634 | Ga0495667_0021989 | 3300046559 | Bacteria | 4300 |
| 635 | Ga0495667_0022231 | 3300046559 | Bacteria | 4274 |
| 636 | Ga0495667_0042258 | 3300046559 | Bacteria | 3022 |
| 637 | Ga0495667_0054602 | 3300046559 | Bacteria | 2628 |
| 638 | Ga0495667_0194090 | 3300046559 | Bacteria | 1300 |
| 639 | Ga0495667_0271471 | 3300046559 | Bacteria | 1077 |
| 640 | Ga0495656_0084799 | 3300046615 | Bacteria | 1438 |
| 641 | Ga0495634_0026344 | 3300046642 | Bacteria | 4058 |
| 642 | Ga0495634_0073890 | 3300046642 | Bacteria | 2241 |
| 643 | Ga0495634_0195835 | 3300046642 | Bacteria | 1257 |
| 644 | Ga0495634_0295734 | 3300046642 | Bacteria | 980 |
| 645 | Ga0495634_0311030 | 3300046642 | Bacteria | 950 |
| 646 | Ga0495635_0001747 | 3300046663 | Bacteria | 14637 |
| 647 | Ga0495635_0007937 | 3300046663 | Bacteria | 7415 |
| 648 | Ga0495635_0027968 | 3300046663 | Bacteria | 3920 |
| 649 | Ga0495635_0034608 | 3300046663 | Bacteria | 3504 |
| 650 | Ga0495635_0112018 | 3300046663 | Bacteria | 1864 |
| 651 | Ga0495635_0275647 | 3300046663 | Bacteria | 1130 |
| 652 | Ga0495657_0000022 | 3300046675 | Bacteria | 151837 |
| 653 | Ga0495657_0002646 | 3300046675 | Bacteria | 14974 |
| 654 | Ga0495657_0017242 | 3300046675 | Bacteria | 5246 |
| 655 | Ga0495657_0019711 | 3300046675 | Bacteria | 4862 |
| 656 | Ga0495657_0032342 | 3300046675 | Bacteria | 3650 |
| 657 | Ga0495657_0037823 | 3300046675 | Bacteria | 3324 |
| 658 | Ga0495599_0000236 | 3300046678 | Bacteria | 34674 |
| 659 | Ga0495599_0021152 | 3300046678 | Bacteria | 4057 |
| 660 | Ga0495599_0033930 | 3300046678 | Bacteria | 3207 |
| 661 | Ga0495599_0058238 | 3300046678 | Bacteria | 2417 |
| 662 | Ga0495599_0086958 | 3300046678 | Bacteria | 1951 |
| 663 | Ga0495599_0093224 | 3300046678 | Bacteria | 1879 |
| 664 | Ga0495599_0135255 | 3300046678 | Bacteria | 1530 |
| 665 | Ga0495623_0001803 | 3300046679 | Bacteria | 14395 |
| 666 | Ga0495623_0024139 | 3300046679 | Bacteria | 3922 |
| 667 | Ga0495623_0027986 | 3300046679 | Bacteria | 3629 |
| 668 | Ga0495623_0041308 | 3300046679 | Bacteria | 2942 |
| 669 | Ga0495623_0207738 | 3300046679 | Bacteria | 1122 |
| 670 | Ga0495646_0005340 | 3300046680 | Bacteria | 8111 |
| 671 | Ga0495646_0010149 | 3300046680 | Bacteria | 5988 |
| 672 | Ga0495646_0014616 | 3300046680 | Bacteria | 4989 |
| 673 | Ga0495646_0118768 | 3300046680 | Bacteria | 1498 |
| 674 | Ga0495647_0004740 | 3300046681 | Bacteria | 4436 |
| 675 | Ga0495647_0021880 | 3300046681 | Bacteria | 2307 |
| 676 | Ga0495658_0009682 | 3300046683 | Bacteria | 4806 |
| 677 | Ga0495658_0022731 | 3300046683 | Bacteria | 3320 |
| 678 | Ga0495658_0040437 | 3300046683 | Bacteria | 2592 |
| 679 | Ga0495613_0011190 | 3300046689 | Bacteria | 6664 |
| 680 | Ga0495613_0026219 | 3300046689 | Bacteria | 4342 |
| 681 | Ga0495613_0066560 | 3300046689 | Bacteria | 2631 |
| 682 | Ga0495613_0237503 | 3300046689 | Bacteria | 1275 |
| 683 | Ga0495613_0438784 | 3300046689 | Bacteria | 886 |
| 684 | Ga0495624_0001756 | 3300046690 | Bacteria | 16592 |
| 685 | Ga0495624_0001919 | 3300046690 | Bacteria | 15831 |
| 686 | Ga0495624_0013711 | 3300046690 | Bacteria | 5519 |
| 687 | Ga0495624_0090949 | 3300046690 | Bacteria | 1883 |
| 688 | Ga0495600_0004257 | 3300046809 | Bacteria | 8546 |
| 689 | Ga0495600_0008322 | 3300046809 | Bacteria | 6368 |
| 690 | Ga0495600_0010830 | 3300046809 | Bacteria | 5670 |
| 691 | Ga0495600_0022765 | 3300046809 | Bacteria | 4026 |
| 692 | Ga0495600_0031230 | 3300046809 | Bacteria | 3450 |
| 693 | Ga0495600_0049556 | 3300046809 | Bacteria | 2740 |
| 694 | Ga0495600_0074472 | 3300046809 | Bacteria | 2217 |
| 695 | Ga0495600_0108367 | 3300046809 | Bacteria | 1809 |
| 696 | Ga0495600_0241530 | 3300046809 | Bacteria | 1151 |
| 697 | Ga0495581_0001057 | 3300047315 | Bacteria | 14925 |
| 698 | Ga0495581_0012081 | 3300047315 | Bacteria | 4996 |
| 699 | Ga0495581_0049758 | 3300047315 | Bacteria | 2420 |
| 700 | Ga0495604_0000022 | 3300047317 | Bacteria | 151744 |
| 701 | Ga0495604_0001853 | 3300047317 | Bacteria | 17235 |
| 702 | Ga0495604_0017016 | 3300047317 | Bacteria | 5815 |
| 703 | Ga0495604_0018581 | 3300047317 | Bacteria | 5568 |
| 704 | Ga0495604_0074648 | 3300047317 | Bacteria | 2555 |
| 705 | Ga0495604_0153676 | 3300047317 | Bacteria | 1632 |
| 706 | Ga0495604_0178897 | 3300047317 | Bacteria | 1485 |
| 707 | Ga0495604_0188536 | 3300047317 | Bacteria | 1438 |
| 708 | Ga0495604_0250625 | 3300047317 | Bacteria | 1207 |
| 709 | Ga0495674_0003145 | 3300047319 | Bacteria | 16037 |
| 710 | Ga0495674_0007792 | 3300047319 | Bacteria | 10224 |
| 711 | Ga0495674_0042408 | 3300047319 | Bacteria | 4058 |
| 712 | Ga0495674_0051880 | 3300047319 | Bacteria | 3613 |
| 713 | Ga0495674_0053849 | 3300047319 | Bacteria | 3535 |
| 714 | Ga0495674_0072201 | 3300047319 | Bacteria | 2977 |
| 715 | Ga0495676_0003179 | 3300047321 | Bacteria | 14842 |
| 716 | Ga0495676_0127487 | 3300047321 | Bacteria | 1842 |
| 717 | Ga0495680_0000271 | 3300047322 | Bacteria | 57595 |
| 718 | Ga0495680_0006193 | 3300047322 | Bacteria | 11151 |
| 719 | Ga0495680_0007684 | 3300047322 | Bacteria | 9841 |
| 720 | Ga0495680_0044719 | 3300047322 | Bacteria | 3500 |
| 721 | Ga0495680_0050667 | 3300047322 | Bacteria | 3245 |
| 722 | Ga0495680_0052558 | 3300047322 | Bacteria | 3175 |
| 723 | Ga0495680_0093708 | 3300047322 | Bacteria | 2247 |
| 724 | Ga0495680_0109534 | 3300047322 | Bacteria | 2048 |
| 725 | Ga0495680_0195976 | 3300047322 | Bacteria | 1451 |
| 726 | Ga0495680_0215007 | 3300047322 | Bacteria | 1374 |
| 727 | Ga0495675_0002876 | 3300047444 | Bacteria | 10327 |
| 728 | Ga0495675_0017842 | 3300047444 | Bacteria | 4500 |
| 729 | Ga0495675_0026629 | 3300047444 | Bacteria | 3688 |
| 730 | Ga0495675_0036613 | 3300047444 | Bacteria | 3128 |
| 731 | Ga0495675_0053260 | 3300047444 | Bacteria | 2569 |
| 732 | Ga0495675_0059915 | 3300047444 | Bacteria | 2413 |
| 733 | Ga0495675_0063539 | 3300047444 | Bacteria | 2335 |
| 734 | Ga0495675_0235896 | 3300047444 | Bacteria | 1102 |
| 735 | Ga0495675_0253348 | 3300047444 | Bacteria | 1056 |
| 736 | Ga0495684_0002493 | 3300047471 | Bacteria | 14670 |
| 737 | Ga0495684_0015783 | 3300047471 | Bacteria | 5812 |
| 738 | Ga0495684_0023986 | 3300047471 | Bacteria | 4692 |
| 739 | Ga0495684_0147408 | 3300047471 | Bacteria | 1761 |
| 740 | Ga0495684_0154016 | 3300047471 | Bacteria | 1717 |
| 741 | Ga0495684_0173246 | 3300047471 | Bacteria | 1603 |
| 742 | Ga0495684_0293427 | 3300047471 | Bacteria | 1170 |
| 743 | Ga0495593_0001295 | 3300047673 | Bacteria | 14668 |
| 744 | Ga0495593_0026522 | 3300047673 | Bacteria | 3198 |
| 745 | Ga0495593_0033280 | 3300047673 | Bacteria | 2807 |
| 746 | Ga0495593_0061503 | 3300047673 | Bacteria | 1964 |
| 747 | Ga0495602_0000390 | 3300048088 | Bacteria | 41015 |
| 748 | Ga0495602_0005560 | 3300048088 | Bacteria | 13223 |
| 749 | Ga0495602_0040901 | 3300048088 | Bacteria | 4240 |
| 750 | Ga0495602_0045188 | 3300048088 | Bacteria | 3987 |
| 751 | Ga0495602_0045765 | 3300048088 | Bacteria | 3957 |
| 752 | Ga0495602_0132266 | 3300048088 | Bacteria | 1987 |
| 753 | Ga0495602_0297071 | 3300048088 | Bacteria | 1183 |
| 754 | Ga0495602_0350753 | 3300048088 | Bacteria | 1065 |
| 755 | Ga0495614_0158368 | 3300048089 | Bacteria | 1012 |
| 756 | Ga0496100_0058723 | 3300048903 | Bacteria | 2526 |
| 757 | Ga0496100_0161424 | 3300048903 | Bacteria | 1607 |
| 758 | Ga0496101_0291735 | 3300048904 | Bacteria | 1276 |
| 759 | Ga0496101_0316119 | 3300048904 | Bacteria | 1225 |
| 760 | Ga0496102_0071268 | 3300048905 | Bacteria | 3191 |
| 761 | Ga0496102_0115326 | 3300048905 | Bacteria | 2506 |
| 762 | Ga0496102_0165043 | 3300048905 | Bacteria | 2084 |
| 763 | Ga0496102_0288707 | 3300048905 | Bacteria | 1546 |
| 764 | Ga0496102_0610907 | 3300048905 | Bacteria | 1013 |
| 765 | Ga0496103_0052153 | 3300048906 | Bacteria | 2533 |
| 766 | Ga0496103_0073907 | 3300048906 | Bacteria | 2136 |
| 767 | Ga0496104_0005347 | 3300048907 | Bacteria | 11236 |
| 768 | Ga0496104_0063047 | 3300048907 | Bacteria | 3515 |
| 769 | Ga0496104_0074849 | 3300048907 | Bacteria | 3223 |
| 770 | Ga0496104_0109580 | 3300048907 | Bacteria | 2646 |
| 771 | Ga0496104_0113883 | 3300048907 | Bacteria | 2593 |
| 772 | Ga0496104_0508933 | 3300048907 | Bacteria | 1115 |
| 773 | Ga0496105_0000120 | 3300048908 | Bacteria | 53984 |
| 774 | Ga0496105_0001446 | 3300048908 | Bacteria | 16716 |
| 775 | Ga0496105_0032956 | 3300048908 | Bacteria | 4253 |
| 776 | Ga0496105_0050079 | 3300048908 | Bacteria | 3450 |
| 777 | Ga0496105_0081889 | 3300048908 | Bacteria | 2666 |
| 778 | Ga0496105_0112057 | 3300048908 | Bacteria | 2251 |
| 779 | Ga0496105_0238822 | 3300048908 | Bacteria | 1475 |
| 780 | Ga0496106_0014173 | 3300048909 | Bacteria | 5888 |
| 781 | Ga0496106_0050724 | 3300048909 | Bacteria | 3127 |
| 782 | Ga0496107_0012223 | 3300048910 | Bacteria | 5990 |
| 783 | Ga0496107_0059096 | 3300048910 | Bacteria | 2774 |
| 784 | Ga0496107_0061382 | 3300048910 | Bacteria | 2721 |
| 785 | Ga0496107_0149131 | 3300048910 | Bacteria | 1730 |
| 786 | Ga0496108_0003930 | 3300048911 | Bacteria | 11933 |
| 787 | Ga0496108_0013769 | 3300048911 | Bacteria | 6598 |
| 788 | Ga0496108_0099415 | 3300048911 | Bacteria | 2480 |
| 789 | Ga0496108_0201341 | 3300048911 | Bacteria | 1728 |
| 790 | Ga0496108_0201397 | 3300048911 | Bacteria | 1728 |
| 791 | Ga0496108_0354668 | 3300048911 | Bacteria | 1280 |
| 792 | Ga0496109_0050712 | 3300048912 | Bacteria | 3779 |
| 793 | Ga0496109_0066117 | 3300048912 | Bacteria | 3310 |
| 794 | Ga0496109_0078784 | 3300048912 | Bacteria | 3034 |
| 795 | Ga0496109_0105266 | 3300048912 | Bacteria | 2620 |
| 796 | Ga0496109_0110142 | 3300048912 | Bacteria | 2560 |
| 797 | Ga0496109_0116456 | 3300048912 | Bacteria | 2487 |
| 798 | Ga0496109_0214334 | 3300048912 | Bacteria | 1811 |
| 799 | Ga0496109_0306374 | 3300048912 | Bacteria | 1498 |
| 800 | Ga0496110_0052690 | 3300048913 | Bacteria | 3576 |
| 801 | Ga0496110_0248671 | 3300048913 | Bacteria | 1618 |
| 802 | Ga0496110_0401932 | 3300048913 | Bacteria | 1249 |
| 803 | Ga0496110_0448696 | 3300048913 | Bacteria | 1175 |
| 804 | Ga0496110_0666359 | 3300048913 | Bacteria | 941 |
| 805 | Ga0496111_0057011 | 3300048914 | Bacteria | 2828 |
| 806 | Ga0496111_0059336 | 3300048914 | Bacteria | 2772 |
| 807 | Ga0496111_0318746 | 3300048914 | Bacteria | 1151 |
| 808 | Ga0496112_0019980 | 3300048915 | Bacteria | 6339 |
| 809 | Ga0496112_0100925 | 3300048915 | Bacteria | 2855 |
| 810 | Ga0496112_0110877 | 3300048915 | Bacteria | 2714 |
| 811 | Ga0496112_0734130 | 3300048915 | Bacteria | 914 |
| 812 | Ga0496112_1109155 | 3300048915 | Bacteria | 709 |
| 813 | Ga0496113_0018578 | 3300048916 | Bacteria | 4844 |
| 814 | Ga0496113_0060279 | 3300048916 | Bacteria | 2860 |
| 815 | Ga0496113_0133702 | 3300048916 | Bacteria | 1948 |
| 816 | Ga0496114_0029335 | 3300048917 | Bacteria | 4520 |
| 817 | Ga0496114_0140488 | 3300048917 | Bacteria | 2090 |
| 818 | Ga0496114_0232865 | 3300048917 | Bacteria | 1619 |
| 819 | Ga0496114_0561245 | 3300048917 | Bacteria | 1008 |
| 820 | Ga0496115_0024636 | 3300048918 | Bacteria | 4680 |
| 821 | Ga0496115_0057015 | 3300048918 | Bacteria | 3141 |
| 822 | Ga0496115_0251032 | 3300048918 | Bacteria | 1456 |
| 823 | Ga0496115_0253264 | 3300048918 | Bacteria | 1449 |
| 824 | Ga0496115_0293654 | 3300048918 | Bacteria | 1333 |
| 825 | Ga0496126_0015540 | 3300048929 | Bacteria | 7649 |
| 826 | Ga0501318_006305 | 3300049534 | Bacteria | 1208 |
| 827 | Ga0501032_0004992 | 3300049569 | Bacteria | 9922 |
| 828 | Ga0501033_0011495 | 3300049570 | Bacteria | 6776 |
| 829 | Ga0501033_0064498 | 3300049570 | Bacteria | 2696 |
| 830 | Ga0501034_0026588 | 3300049571 | Bacteria | 5892 |
| 831 | Ga0501034_0046611 | 3300049571 | Bacteria | 4379 |
| 832 | Ga0501034_0101105 | 3300049571 | Bacteria | 2877 |
| 833 | Ga0501034_0488103 | 3300049571 | Bacteria | 1146 |
| 834 | Ga0501036_0001691 | 3300049572 | Bacteria | 17131 |
| 835 | Ga0501036_0234518 | 3300049572 | Bacteria | 1539 |
| 836 | Ga0501037_0004582 | 3300049573 | Bacteria | 10045 |
| 837 | Ga0501037_0060222 | 3300049573 | Bacteria | 2769 |
| 838 | Ga0501037_0170740 | 3300049573 | Bacteria | 1546 |
| 839 | Ga0501038_0006532 | 3300049574 | Bacteria | 10786 |
| 840 | Ga0501038_0063465 | 3300049574 | Bacteria | 3152 |
| 841 | Ga0501038_0227512 | 3300049574 | Bacteria | 1486 |
| 842 | Ga0501039_0007936 | 3300049575 | Bacteria | 8085 |
| 843 | Ga0501040_0043993 | 3300049576 | Bacteria | 3044 |
| 844 | Ga0501041_0044080 | 3300049577 | Bacteria | 2712 |
| 845 | Ga0501042_0021677 | 3300049578 | Bacteria | 4481 |
| 846 | Ga0501042_0053726 | 3300049578 | Bacteria | 2874 |
| 847 | Ga0501042_0058647 | 3300049578 | Bacteria | 2748 |
| 848 | Ga0501042_0175898 | 3300049578 | Bacteria | 1544 |
| 849 | Ga0501043_0011613 | 3300049579 | Bacteria | 6894 |
| 850 | Ga0501043_0120385 | 3300049579 | Bacteria | 2058 |
| 851 | Ga0501043_0128504 | 3300049579 | Bacteria | 1986 |
| 852 | Ga0501046_0007199 | 3300049580 | Bacteria | 9781 |
| 853 | Ga0501046_0008028 | 3300049580 | Bacteria | 9225 |
| 854 | Ga0501047_0012050 | 3300049581 | Bacteria | 8182 |
| 855 | Ga0501047_0211162 | 3300049581 | Bacteria | 1799 |
| 856 | Ga0501048_0007791 | 3300049582 | Bacteria | 8120 |
| 857 | Ga0501048_0041177 | 3300049582 | Bacteria | 3310 |
| 858 | Ga0501067_0002053 | 3300049583 | Bacteria | 11111 |
| 859 | Ga0501068_0062779 | 3300049584 | Bacteria | 2259 |
| 860 | Ga0501068_0081858 | 3300049584 | Bacteria | 1982 |
| 861 | Ga0501069_0050892 | 3300049585 | Bacteria | 2304 |
| 862 | Ga0501069_0101767 | 3300049585 | Bacteria | 1631 |
| 863 | Ga0501070_0003699 | 3300049586 | Bacteria | 13215 |
| 864 | Ga0501070_0006215 | 3300049586 | Bacteria | 10167 |
| 865 | Ga0501070_0359151 | 3300049586 | Bacteria | 1182 |
| 866 | Ga0501071_0010142 | 3300049587 | Bacteria | 6304 |
| 867 | Ga0501073_0012664 | 3300049589 | Bacteria | 6151 |
| 868 | Ga0501073_0041947 | 3300049589 | Bacteria | 3231 |
| 869 | Ga0501074_0000839 | 3300049590 | Bacteria | 19548 |
| 870 | Ga0501076_0068482 | 3300049592 | Bacteria | 2835 |
| 871 | Ga0501076_0089718 | 3300049592 | Bacteria | 2472 |
| 872 | Ga0501077_0002353 | 3300049593 | Bacteria | 11388 |
| 873 | Ga0501209_037301 | 3300049656 | Bacteria | 1268 |
| 874 | Ga0501079_0056339 | 3300049741 | Bacteria | 3033 |
| 875 | Ga0501079_0065564 | 3300049741 | Bacteria | 2802 |
| 876 | Ga0501080_0006490 | 3300049742 | Bacteria | 10503 |
| 877 | Ga0501081_0191365 | 3300049743 | Bacteria | 1482 |
| 878 | Ga0501083_0027628 | 3300049744 | Bacteria | 3914 |
| 879 | Ga0501035_0028393 | 3300049822 | Bacteria | 5107 |
| 880 | Ga0501035_0446334 | 3300049822 | Bacteria | 1071 |
| 881 | Ga0501044_0021785 | 3300049823 | Bacteria | 6834 |
| 882 | Ga0501044_0038130 | 3300049823 | Bacteria | 5019 |
| 883 | Ga0501044_0057823 | 3300049823 | Bacteria | 3978 |
| 884 | Ga0501044_0323078 | 3300049823 | Bacteria | 1467 |
| 885 | Ga0501044_0574624 | 3300049823 | Bacteria | 1022 |
| 886 | Ga0501045_0351914 | 3300049824 | Bacteria | 1096 |
| 887 | nmdc:mga03n38_10458_c1 | 3300050490 | Bacteria | 3414 |
| 888 | nmdc:mga0yw44_33714_c1 | 3300050492 | Bacteria | 2994 |
| 889 | nmdc:mga05p37_260330_c1 | 3300050507 | Bacteria | 2076 |
| 890 | nmdc:mga05p37_268844_c1 | 3300050507 | Bacteria | 2038 |
| 891 | nmdc:mga05p37_31168_c1 | 3300050507 | Bacteria | 6513 |
| 892 | nmdc:mga05p37_35256_c1 | 3300050507 | Bacteria | 6133 |
| 893 | nmdc:mga05p37_747895_c1 | 3300050507 | Bacteria | 1078 |
| 894 | nmdc:mga05p37_935669_c1 | 3300050507 | Bacteria | 930 |
| 895 | nmdc:mga09592_117507_c1 | 3300050508 | Bacteria | 2282 |
| 896 | nmdc:mga09592_12387_c1 | 3300050508 | Bacteria | 6946 |
| 897 | nmdc:mga09592_6580_c1 | 3300050508 | Bacteria | 9463 |
| 898 | nmdc:mga0qj67_314243_c1 | 3300050509 | Bacteria | 1269 |
| 899 | nmdc:mga0qj67_59393_c1 | 3300050509 | Bacteria | 3032 |
| 900 | nmdc:mga0qj67_87402_c1 | 3300050509 | Bacteria | 2502 |
| 901 | nmdc:mga06r32_15774_c1 | 3300050510 | Bacteria | 6868 |
| 902 | nmdc:mga06r32_29633_c1 | 3300050510 | Bacteria | 5132 |
| 903 | nmdc:mga06r32_863151_c1 | 3300050510 | Bacteria | 863 |
| 904 | nmdc:mga08y16_206354_c1 | 3300050511 | Bacteria | 2036 |
| 905 | nmdc:mga08y16_473481_c1 | 3300050511 | Bacteria | 778 |
| 906 | nmdc:mga0n895_101040_c1 | 3300050512 | Bacteria | 2894 |
| 907 | nmdc:mga0n895_116954_c1 | 3300050512 | Bacteria | 2685 |
| 908 | nmdc:mga0n895_171467_c1 | 3300050512 | Bacteria | 2202 |
| 909 | nmdc:mga0n895_28600_c1 | 3300050512 | Bacteria | 5304 |
| 910 | nmdc:mga0n895_75766_c1 | 3300050512 | Bacteria | 3344 |
| 911 | nmdc:mga0rr50_11746_c1 | 3300050513 | Bacteria | 5621 |
| 912 | nmdc:mga0rr50_238794_c1 | 3300050513 | Bacteria | 1506 |
| 913 | nmdc:mga0rr50_28281_c1 | 3300050513 | Bacteria | 3939 |
| 914 | nmdc:mga0rr50_375337_c1 | 3300050513 | Bacteria | 1198 |
| 915 | nmdc:mga0rr50_72921_c1 | 3300050513 | Bacteria | 2623 |
| 916 | nmdc:mga08x19_220840_c1 | 3300050514 | Bacteria | 1302 |
| 917 | nmdc:mga08x19_263015_c1 | 3300050514 | Bacteria | 1193 |
| 918 | nmdc:mga08x19_37258_c1 | 3300050514 | Bacteria | 3086 |
| 919 | nmdc:mga08x19_57784_c1 | 3300050514 | Bacteria | 2508 |
| 920 | nmdc:mga0a205_193307_c1 | 3300050515 | Bacteria | 1926 |
| 921 | nmdc:mga0a205_40338_c1 | 3300050515 | Bacteria | 4494 |
| 922 | nmdc:mga0a205_5351_c1 | 3300050515 | Bacteria | 10049 |
| 923 | Ga0495601_0035492 | 3300053077 | Bacteria | 3113 |
| 924 | Ga0495601_0072009 | 3300053077 | Bacteria | 2207 |
| 925 | Ga0495601_0183868 | 3300053077 | Bacteria | 1366 |
| 926 | Ga0495601_0224367 | 3300053077 | Bacteria | 1227 |
| 927 | Ga0495601_0251480 | 3300053077 | Bacteria | 1154 |
| 928 | Ga0495601_0410142 | 3300053077 | Bacteria | 878 |
| 929 | Ga0495612_0009026 | 3300053078 | Bacteria | 4044 |
| 930 | Ga0495595_0011120 | 3300053084 | Bacteria | 3757 |
| 931 | Ga0495595_0029393 | 3300053084 | Bacteria | 2459 |
| 932 | Ga0495595_0056235 | 3300053084 | Bacteria | 1833 |
| 933 | Ga0495595_0141802 | 3300053084 | Bacteria | 1179 |
| 934 | Ga0495595_0143512 | 3300053084 | Bacteria | 1172 |
| 935 | Ga0495619_0004343 | 3300053085 | Bacteria | 9041 |
| 936 | Ga0495619_0004905 | 3300053085 | Bacteria | 8494 |
| 937 | Ga0495619_0006518 | 3300053085 | Bacteria | 7388 |
| 938 | Ga0495619_0012772 | 3300053085 | Bacteria | 5287 |
| 939 | Ga0495619_0017109 | 3300053085 | Bacteria | 4594 |
| 940 | Ga0495619_0198079 | 3300053085 | Bacteria | 1390 |
| 941 | Ga0495619_0333996 | 3300053085 | Bacteria | 1049 |
| 942 | Ga0495619_0342402 | 3300053085 | Bacteria | 1035 |
| 943 | Ga0500616_0001211 | 3300053153 | Bacteria | 26057 |
| 944 | Ga0501084_0000044 | 3300054114 | Bacteria | 97657 |
| 945 | Ga0501084_0011106 | 3300054114 | Bacteria | 7459 |
| 946 | Ga0501084_0104758 | 3300054114 | Bacteria | 2375 |
| 947 | Ga0501084_0419470 | 3300054114 | Bacteria | 1131 |
| 948 | Ga0501082_0007063 | 3300060353 | Bacteria | 9688 |
| 949 | Ga0501082_0943635 | 3300060353 | Unclassified | 754 |
| 950 | Ga0466962_0006441 | 3300061719 | Bacteria | 5634 |
| 951 | Ga0466962_0089850 | 3300061719 | Bacteria | 1471 |
| 952 | Ga0530510_0009732 | 3300061734 | Bacteria | 6745 |
| 953 | Ga0530510_0538320 | 3300061734 | Bacteria | 886 |
| 954 | 2644229354 | 2643221641 | Bacteria | 4490190 |
| 955 | 2645721831 | 2643221961 | Bacteria | 3919167 |
| 956 | 2676489071 | 2675903060 | Bacteria | 10051191 |
| 957 | 2689996318 | 2687453743 | Bacteria | 8361025 |
| 958 | 2884702679 | 2884693830 | Bacteria | 11273186 |
| 959 | 2895436407 | 2895427314 | Bacteria | 13147766 |
| 960 | 2895452179 | 2895442618 | Bacteria | 11027144 |
| 961 | 2984580261 | 2984576629 | Bacteria | 4248407 |
| 962 | 2990259111 | 2990256926 | Bacteria | 4252839 |
| 963 | 8055069263 | 8055066027 | Bacteria | 9479577 |
| 964 | 8055172973 | 8055172936 | Bacteria | 9305943 |
| 965 | Ga0075433_10070424 | |||
| 966 | MBSR1b_contig_4503056 | |||
| 967 | LJQas_1002216 | |||
| 968 | LJQas_1005280 | |||
| 969 | JGI25404J52841_10007904 | |||
| 970 | Ga0070658_10062310 | |||
| 971 | Ga0070683_100292681 | |||
| 972 | Ga0070690_100221277 | |||
| 973 | Ga0070682_100044302 | |||
| 974 | Ga0068868_100200272 | |||
| 975 | Ga0068868_100248708 | |||
| 976 | Ga0070660_100324824 | |||
| 977 | Ga0070689_100205556 | |||
| 978 | Ga0070661_100034192 | |||
| 979 | Ga0070692_10054061 | |||
| 980 | Ga0070668_100145070 | |||
| 981 | Ga0070669_100085306 | |||
| 982 | Ga0070669_100164889 | |||
| 983 | Ga0070675_100110283 | |||
| 984 | Ga0070675_100294337 | |||
| 985 | Ga0070671_100225384 | |||
| 986 | Ga0070671_100449315 | |||
| 987 | Ga0070671_100498713 | |||
| 988 | Ga0070674_100351482 | |||
| 989 | Ga0070673_100188377 | |||
| 990 | Ga0070659_100080447 | |||
| 991 | Ga0070709_10000293 | |||
| 992 | Ga0070709_10080490 | |||
| 993 | Ga0070709_10179554 | |||
| 994 | Ga0070709_10266136 | |||
| 995 | Ga0070714_100013140 | |||
| 996 | Ga0070714_100017411 | |||
| 997 | Ga0070714_100055138 | |||
| 998 | Ga0070714_100660553 | |||
| 999 | Ga0070713_100021561 | |||
| 1000 | Ga0070713_100031308 | |||
| 1001 | Ga0070713_100050178 | |||
| 1002 | Ga0070713_100412669 | |||
| 1003 | Ga0070710_10003256 | |||
| 1004 | Ga0070710_10063550 | |||
| 1005 | Ga0070710_10086358 | |||
| 1006 | Ga0070711_100006437 | |||
| 1007 | Ga0070711_100015362 | |||
| 1008 | Ga0070711_100183901 | |||
| 1009 | Ga0070700_100067335 | |||
| 1010 | Ga0070694_100276674 | |||
| 1011 | Ga0070708_100002499 | |||
| 1012 | Ga0070708_100007308 | |||
| 1013 | Ga0070708_100008434 | |||
| 1014 | Ga0070708_100036014 | |||
| 1015 | Ga0070708_100064148 | |||
| 1016 | Ga0070708_100222667 | |||
| 1017 | Ga0070678_100068342 | |||
| 1018 | Ga0070681_10109484 | |||
| 1019 | Ga0070685_10054414 | |||
| 1020 | Ga0070706_100000821 | |||
| 1021 | Ga0070706_100012251 | |||
| 1022 | Ga0070706_100026028 | |||
| 1023 | Ga0070706_100072290 | |||
| 1024 | Ga0070706_100105320 | |||
| 1025 | Ga0070706_100131481 | |||
| 1026 | Ga0070706_100200810 | |||
| 1027 | Ga0070706_100240642 | |||
| 1028 | Ga0070706_100487897 | |||
| 1029 | Ga0070706_100652523 | |||
| 1030 | Ga0070707_100000127 | |||
| 1031 | Ga0070707_100005476 | |||
| 1032 | Ga0070707_100011395 | |||
| 1033 | Ga0070707_100056141 | |||
| 1034 | Ga0070707_100084429 | |||
| 1035 | Ga0070707_100178396 | |||
| 1036 | Ga0070707_100189646 | |||
| 1037 | Ga0070707_100227558 | |||
| 1038 | Ga0070707_100340617 | |||
| 1039 | Ga0070698_100000991 | |||
| 1040 | Ga0070698_100001111 | |||
| 1041 | Ga0070698_100001614 | |||
| 1042 | Ga0070698_100006941 | |||
| 1043 | Ga0070698_100039365 | |||
| 1044 | Ga0070698_100101309 | |||
| 1045 | Ga0070698_100392966 | |||
| 1046 | Ga0070699_100001261 | |||
| 1047 | Ga0070699_100037119 | |||
| 1048 | Ga0070699_100166608 | |||
| 1049 | Ga0070699_100196601 | |||
| 1050 | Ga0070679_100122886 | |||
| 1051 | Ga0070679_100546748 | |||
| 1052 | Ga0070679_101044614 | |||
| 1053 | Ga0070684_100108726 | |||
| 1054 | Ga0070684_100169923 | |||
| 1055 | Ga0070684_100307033 | |||
| 1056 | Ga0070697_100018646 | |||
| 1057 | Ga0070697_100232197 | |||
| 1058 | Ga0068853_100148960 | |||
| 1059 | Ga0068853_100589575 | |||
| 1060 | Ga0070672_100226477 | |||
| 1061 | Ga0070686_100045356 | |||
| 1062 | Ga0070686_100140224 | |||
| 1063 | Ga0070695_100032198 | |||
| 1064 | Ga0070696_100254839 | |||
| 1065 | Ga0070693_100058626 | |||
| 1066 | Ga0070693_100217594 | |||
| 1067 | Ga0070665_100223229 | |||
| 1068 | Ga0070665_100498795 | |||
| 1069 | Ga0070704_100057288 | |||
| 1070 | Ga0070704_100076553 | |||
| 1071 | Ga0068855_100091730 | |||
| 1072 | Ga0070664_100130112 | |||
| 1073 | Ga0070664_100403871 | |||
| 1074 | Ga0068856_100135864 | |||
| 1075 | Ga0068856_100347834 | |||
| 1076 | Ga0068852_100061594 | |||
| 1077 | Ga0068852_100381114 | |||
| 1078 | Ga0068859_100478543 | |||
| 1079 | Ga0068864_100124815 | |||
| 1080 | Ga0068864_100139546 | |||
| 1081 | Ga0068864_100339540 | |||
| 1082 | Ga0068861_100170483 | |||
| 1083 | Ga0068861_100596540 | |||
| 1084 | Ga0068870_10037551 | |||
| 1085 | Ga0068863_100138833 | |||
| 1086 | Ga0068858_100120268 | |||
| 1087 | Ga0068860_100831676 | |||
| 1088 | Ga0081540_1001333 | |||
| 1089 | Ga0081540_1016514 | |||
| 1090 | Ga0070717_10001020 | |||
| 1091 | Ga0070717_10009294 | |||
| 1092 | Ga0070717_10011549 | |||
| 1093 | Ga0070717_10012759 | |||
| 1094 | Ga0070717_10047815 | |||
| 1095 | Ga0070717_10357577 | |||
| 1096 | Ga0070717_10477366 | |||
| 1097 | Ga0075363_100032602 | |||
| 1098 | Ga0075363_100066133 | |||
| 1099 | Ga0070715_10010346 | |||
| 1100 | Ga0070715_10019130 | |||
| 1101 | Ga0070715_10029471 | |||
| 1102 | Ga0070715_10064352 | |||
| 1103 | Ga0070716_100000033 | |||
| 1104 | Ga0070716_100005591 | |||
| 1105 | Ga0070716_100097761 | |||
| 1106 | Ga0070716_100116560 | |||
| 1107 | Ga0070716_100145979 | |||
| 1108 | Ga0070716_100239739 | |||
| 1109 | Ga0070712_100007693 | |||
| 1110 | Ga0070712_100294010 | |||
| 1111 | Ga0070712_100452809 | |||
| 1112 | Ga0075367_10250915 | |||
| 1113 | Ga0097621_100108230 | |||
| 1114 | Ga0097621_100164273 | |||
| 1115 | Ga0097621_100584969 | |||
| 1116 | Ga0068871_100053084 | |||
| 1117 | Ga0068871_100254483 | |||
| 1118 | Ga0075428_100076214 | |||
| 1119 | Ga0075428_100092168 | |||
| 1120 | Ga0075428_100930327 | |||
| 1121 | Ga0075430_100002290 | |||
| 1122 | Ga0075430_100151889 | |||
| 1123 | Ga0075431_100029054 | |||
| 1124 | Ga0075431_100071846 | |||
| 1125 | Ga0075431_100083479 | |||
| 1126 | Ga0075431_100567217 | |||
| 1127 | Ga0075433_10071211 | |||
| 1128 | Ga0075434_100026313 | |||
| 1129 | Ga0075434_100291665 | |||
| 1130 | Ga0075429_100001611 | |||
| 1131 | Ga0075429_100005255 | |||
| 1132 | Ga0075429_100663565 | |||
| 1133 | Ga0075436_100051322 | |||
| 1134 | Ga0075436_100068691 | |||
| 1135 | Ga0075436_100233217 | |||
| 1136 | Ga0075436_100364468 | |||
| 1137 | Ga0097620_100478559 | |||
| 1138 | Ga0075435_100004822 | |||
| 1139 | Ga0075435_100078033 | |||
| 1140 | Ga0075435_100247692 | |||
| 1141 | Ga0099794_10052186 | |||
| 1142 | Ga0099795_10205588 | |||
| 1143 | Ga0105251_10036723 | |||
| 1144 | Ga0105250_10037039 | |||
| 1145 | Ga0105240_10303024 | |||
| 1146 | Ga0111539_10022313 | |||
| 1147 | Ga0111539_10271458 | |||
| 1148 | Ga0111539_10658800 | |||
| 1149 | Ga0111539_10684655 | |||
| 1150 | Ga0111539_11514946 | |||
| 1151 | Ga0105245_10746402 | |||
| 1152 | Ga0105247_10157558 | |||
| 1153 | Ga0114129_10002251 | |||
| 1154 | Ga0114129_10004683 | |||
| 1155 | Ga0114129_10271758 | |||
| 1156 | Ga0114129_10771310 | |||
| 1157 | Ga0114129_11027368 | |||
| 1158 | Ga0114129_11275324 | |||
| 1159 | Ga0105243_10400014 | |||
| 1160 | Ga0105243_10553506 | |||
| 1161 | Ga0105243_10623051 | |||
| 1162 | Ga0105243_10807812 | |||
| 1163 | Ga0105243_11233985 | |||
| 1164 | Ga0105248_10870744 | |||
| 1165 | Ga0105238_10416675 | |||
| 1166 | Ga0105249_10220934 | |||
| 1167 | Ga0105239_10029474 | |||
| 1168 | Ga0105246_10087057 | |||
| 1169 | Ga0105246_10101216 | |||
| 1170 | Ga0157344_1001969 | |||
| 1171 | Ga0157338_1001773 | |||
| 1172 | Ga0157373_10146731 | |||
| 1173 | Ga0157370_10053773 | |||
| 1174 | Ga0157369_10148649 | |||
| 1175 | Ga0157369_10249367 | |||
| 1176 | Ga0157369_10555681 | |||
| 1177 | Ga0157369_10675561 | |||
| 1178 | Ga0157374_10052816 | |||
| 1179 | Ga0157378_10130263 | |||
| 1180 | Ga0157372_11605052 | |||
| 1181 | Ga0157375_10329798 | |||
| 1182 | Ga0157375_10388596 | |||
| 1183 | Ga0157375_11271779 | |||
| 1184 | Ga0163163_10128939 | |||
| 1185 | Ga0163163_10163292 | |||
| 1186 | Ga0157380_10193693 | |||
| 1187 | Ga0157380_10266561 | |||
| 1188 | Ga0182008_10084040 | |||
| 1189 | Ga0157377_10056996 | |||
| 1190 | Ga0157379_10139694 | |||
| 1191 | Ga0157379_10510242 | |||
| 1192 | Ga0157376_10260982 | |||
| 1193 | Ga0157376_11009867 | |||
| 1194 | Ga0163161_10189921 | |||
| 1195 | Ga0206356_10031144 | |||
| 1196 | Ga0206354_11350309 | |||
| 1197 | Ga0213873_10028432 | |||
| 1198 | Ga0207692_10022881 | |||
| 1199 | Ga0207692_10074608 | |||
| 1200 | Ga0207692_10244671 | |||
| 1201 | Ga0207642_10171567 | |||
| 1202 | Ga0207688_10033053 | |||
| 1203 | Ga0207685_10004309 | |||
| 1204 | Ga0207699_10000215 | |||
| 1205 | Ga0207699_10003454 | |||
| 1206 | Ga0207699_10024246 | |||
| 1207 | Ga0207699_10215395 | |||
| 1208 | Ga0207643_10053128 | |||
| 1209 | Ga0207684_10001704 | |||
| 1210 | Ga0207684_10004662 | |||
| 1211 | Ga0207684_10010229 | |||
| 1212 | Ga0207684_10029960 | |||
| 1213 | Ga0207684_10061894 | |||
| 1214 | Ga0207684_10066482 | |||
| 1215 | Ga0207684_10066544 | |||
| 1216 | Ga0207684_10079683 | |||
| 1217 | Ga0207684_10104224 | |||
| 1218 | Ga0207684_10126755 | |||
| 1219 | Ga0207684_10176946 | |||
| 1220 | Ga0207684_10232891 | |||
| 1221 | Ga0207707_10192607 | |||
| 1222 | Ga0207707_10211329 | |||
| 1223 | Ga0207707_10227070 | |||
| 1224 | Ga0207707_10453441 | |||
| 1225 | Ga0207693_10018514 | |||
| 1226 | Ga0207693_10024549 | |||
| 1227 | Ga0207693_10030599 | |||
| 1228 | Ga0207693_10185606 | |||
| 1229 | Ga0207693_10260883 | |||
| 1230 | Ga0207663_10031674 | |||
| 1231 | Ga0207663_10057750 | |||
| 1232 | Ga0207662_10042542 | |||
| 1233 | Ga0207657_10103294 | |||
| 1234 | Ga0207649_10064837 | |||
| 1235 | Ga0207649_10195943 | |||
| 1236 | Ga0207646_10000264 | |||
| 1237 | Ga0207646_10007362 | |||
| 1238 | Ga0207646_10010104 | |||
| 1239 | Ga0207646_10013014 | |||
| 1240 | Ga0207646_10065507 | |||
| 1241 | Ga0207646_10100885 | |||
| 1242 | Ga0207646_10143808 | |||
| 1243 | Ga0207646_10154536 | |||
| 1244 | Ga0207646_10236417 | |||
| 1245 | Ga0207646_10413858 | |||
| 1246 | Ga0207650_10202093 | |||
| 1247 | Ga0207659_10149137 | |||
| 1248 | Ga0207687_10061398 | |||
| 1249 | Ga0207687_10140536 | |||
| 1250 | Ga0207687_10167063 | |||
| 1251 | Ga0207700_10000237 | |||
| 1252 | Ga0207700_10001853 | |||
| 1253 | Ga0207700_10016470 | |||
| 1254 | Ga0207700_10037335 | |||
| 1255 | Ga0207700_10105031 | |||
| 1256 | Ga0207700_10105775 | |||
| 1257 | Ga0207700_10273880 | |||
| 1258 | Ga0207700_10493850 | |||
| 1259 | Ga0207664_10000276 | |||
| 1260 | Ga0207664_10001948 | |||
| 1261 | Ga0207664_10002105 | |||
| 1262 | Ga0207664_10046981 | |||
| 1263 | Ga0207664_10060628 | |||
| 1264 | Ga0207664_10104128 | |||
| 1265 | Ga0207664_10549967 | |||
| 1266 | Ga0207690_10463986 | |||
| 1267 | Ga0207706_10273696 | |||
| 1268 | Ga0207709_10067553 | |||
| 1269 | Ga0207709_10258183 | |||
| 1270 | Ga0207670_10358109 | |||
| 1271 | Ga0207704_10015167 | |||
| 1272 | Ga0207665_10000079 | |||
| 1273 | Ga0207665_10005128 | |||
| 1274 | Ga0207665_10068352 | |||
| 1275 | Ga0207665_10082801 | |||
| 1276 | Ga0207665_10098394 | |||
| 1277 | Ga0207691_10102634 | |||
| 1278 | Ga0207689_10087196 | |||
| 1279 | Ga0207689_10201397 | |||
| 1280 | Ga0207661_10462431 | |||
| 1281 | Ga0207667_10137171 | |||
| 1282 | Ga0207712_10023288 | |||
| 1283 | Ga0207712_10153084 | |||
| 1284 | Ga0207712_10488781 | |||
| 1285 | Ga0207640_10103556 | |||
| 1286 | Ga0207640_10590255 | |||
| 1287 | Ga0207658_10460975 | |||
| 1288 | Ga0207677_10303872 | |||
| 1289 | Ga0207703_10074917 | |||
| 1290 | Ga0207678_10052664 | |||
| 1291 | Ga0207708_10052111 | |||
| 1292 | Ga0207702_10171277 | |||
| 1293 | Ga0207702_10731314 | |||
| 1294 | Ga0207676_10470729 | |||
| 1295 | Ga0207676_10821750 | |||
| 1296 | Ga0207674_10016544 | |||
| 1297 | Ga0207674_10029717 | |||
| 1298 | Ga0207675_100071147 | |||
| 1299 | Ga0207675_100242890 | |||
| 1300 | Ga0207683_10001961 | |||
| 1301 | Ga0207683_10239461 | |||
| 1302 | Ga0207698_10556498 | |||
| 1303 | Ga0207428_10267784 | |||
| 1304 | Ga0268266_10509921 | |||
| 1305 | Ga0265338_10000931 | |||
| 1306 | Ga0265338_10002733 | |||
| 1307 | Ga0265338_10007759 | |||
| 1308 | Ga0265760_10099131 | |||
| 1309 | Ga0265325_10000666 | |||
| 1310 | Ga0265331_10034269 | |||
| 1311 | Ga0265327_10009735 | |||
| 1312 | Ga0265327_10029452 | |||
| 1313 | Ga0265327_10066785 | |||
| 1314 | Ga0265327_10081088 | |||
| 1315 | Ga0265316_10022142 | |||
| 1316 | Ga0265313_10000421 | |||
| 1317 | Ga0265314_10099761 | |||
| 1318 | Ga0316576_10326660 | |||
| 1319 | Ga0307413_10008822 | |||
| 1320 | Ga0307407_10182180 | |||
| 1321 | Ga0307412_10067286 | |||
| 1322 | Ga0307409_100066270 | |||
| 1323 | Ga0307409_100326338 | |||
| 1324 | Ga0307409_100346976 | |||
| 1325 | Ga0307416_100011074 | |||
| 1326 | Ga0307416_100780410 | |||
| 1327 | Ga0307411_10161550 | |||
| 1328 | Ga0307415_100003889 | |||
| 1329 | Ga0307415_100023156 | |||
| 1330 | Ga0373930_0017303 | |||
| 1331 | Ga0373950_0022418 | |||
| 1332 | Ga0373958_0038218 | |||
| 1333 | Ga0373926_0007799 | |||
| 1334 | Ga0373926_0038875 | |||
| 1335 | Ga0373928_0032986 | |||
| 1336 | Ga0373929_0008257 | |||
| 1337 | Ga0373929_0012072 | |||
| 1338 | Ga0373934_0000147 | |||
| 1339 | Ga0373934_0002032 | |||
| 1340 | Ga0373934_0008979 | |||
| 1341 | Ga0373934_0043062 | |||
| 1342 | Ga0373934_0043712 | |||
| 1343 | Ga0373944_0001945 | |||
| 1344 | Ga0373944_0049699 | |||
| 1345 | Ga0373949_0023503 | |||
| 1346 | Ga0373923_0006138 | |||
| 1347 | Ga0373923_0023993 | |||
| 1348 | Ga0373923_0026639 | |||
| 1349 | Ga0373923_0113291 | |||
| 1350 | Ga0373932_0016797 | |||
| 1351 | Ga0373936_0001334 | |||
| 1352 | Ga0373936_0001833 | |||
| 1353 | Ga0373936_0049328 | |||
| 1354 | Ga0373939_0025030 | |||
| 1355 | Ga0373941_0146569 | |||
| 1356 | Ga0373945_0001276 | |||
| 1357 | Ga0373945_0001451 | |||
| 1358 | Ga0373953_0000058 | |||
| 1359 | Ga0373953_0011227 | |||
| 1360 | Ga0373953_0011364 | |||
| 1361 | Ga0373953_0021950 | |||
| 1362 | Ga0373953_0082699 | |||
| 1363 | Ga0373953_0111418 | |||
| 1364 | Ga0373954_0036587 | |||
| 1365 | Ga0373954_0133439 | |||
| 1366 | Ga0373956_0000532 | |||
| 1367 | Ga0373956_0022918 | |||
| 1368 | Ga0373956_0054261 | |||
| 1369 | Ga0373956_0060718 | |||
| 1370 | Ga0373956_0145723 | |||
| 1371 | Ga0373957_0005875 | |||
| 1372 | Ga0373957_0013383 | |||
| 1373 | Ga0373957_0120707 | |||
| 1374 | Ga0373960_0022395 | |||
| 1375 | Ga0373943_0001034 | |||
| 1376 | Ga0373943_0001717 | |||
| 1377 | Ga0373943_0332646 | |||
| 1378 | Ga0373946_0001997 | |||
| 1379 | Ga0373946_0007314 | |||
| 1380 | Ga0373946_0020811 | |||
| 1381 | Ga0373946_0033724 | |||
| 1382 | Ga0373946_0044196 | |||
| 1383 | Ga0373955_0001363 | |||
| 1384 | Ga0373955_0003228 | |||
| 1385 | Ga0373955_0007678 | |||
| 1386 | Ga0373955_0018334 | |||
| 1387 | Ga0373955_0071122 | |||
| 1388 | Ga0373961_0014919 | |||
| 1389 | Ga0316574_0095529 | |||
| 1390 | Ga0316574_0166129 | |||
| 1391 | Ga0373924_0000537 | |||
| 1392 | Ga0373924_0001574 | |||
| 1393 | Ga0373924_0004757 | |||
| 1394 | Ga0373924_0032163 | |||
| 1395 | Ga0373924_0042310 | |||
| 1396 | Ga0373924_0107855 | |||
| 1397 | Ga0373931_0059827 | |||
| 1398 | Ga0373935_0000168 | |||
| 1399 | Ga0373935_0005165 | |||
| 1400 | Ga0373935_0005683 | |||
| 1401 | Ga0373935_0079030 | |||
| 1402 | Ga0373927_0027084 | |||
| 1403 | Ga0373927_0030375 | |||
| 1404 | Ga0373927_0163752 | |||
| 1405 | Ga0373927_0483336 | |||
| 1406 | Ga0373933_0000002 | |||
| 1407 | Ga0373933_0012052 | |||
| 1408 | Ga0373933_0046479 | |||
| 1409 | Ga0373933_0073712 | |||
| 1410 | Ga0373933_0100991 | |||
| 1411 | Ga0373933_0153466 | |||
| 1412 | Ga0373947_0000007 | |||
| 1413 | Ga0373947_0000631 | |||
| 1414 | Ga0373947_0021996 | |||
| 1415 | Ga0373947_0137456 | |||
| 1416 | Ga0373947_0333284 | |||
| 1417 | Ga0373937_0000014 | |||
| 1418 | Ga0373937_0003979 | |||
| 1419 | Ga0373937_0023082 | |||
| 1420 | Ga0373937_0082916 | |||
| 1421 | Ga0373937_0100751 | |||
| 1422 | Ga0373937_0116213 | |||
| 1423 | Ga0373937_0139157 | |||
| 1424 | Ga0373937_0147637 | |||
| 1425 | Ga0373937_0457909 | |||
| 1426 | Ga0373937_0668570 | |||
| 1427 | Ga0373937_0818233 | |||
| 1428 | Ga0316582_0543542 | |||
| 1429 | Ga0316584_0277669 | |||
| 1430 | Ga0373925_0002113 | |||
| 1431 | Ga0373925_0004222 | |||
| 1432 | Ga0373925_0015186 | |||
| 1433 | Ga0373925_0021959 | |||
| 1434 | Ga0436364_0735026 | |||
| 1435 | Ga0436364_0914140 | |||
| 1436 | Ga0436360_1165953 | |||
| 1437 | Ga0436361_0058011 | |||
| 1438 | Ga0436363_0094543 | |||
| 1439 | Ga0436363_0198794 | |||
| 1440 | Ga0436363_1712497 | |||
| 1441 | Ga0436362_0562836 | |||
| 1442 | Ga0436362_0951630 | |||
| 1443 | Ga0436362_1061215 | |||
| 1444 | Ga0439438_036712 | |||
| 1445 | Ga0439447_060972 | |||
| 1446 | Ga0451853_0314525 | |||
| 1447 | Ga0439431_0013818 | |||
| 1448 | Ga0439446_0027658 | |||
| 1449 | Ga0466965_0016093 | |||
| 1450 | Ga0466965_0097229 | |||
| 1451 | Ga0466966_0078499 | |||
| 1452 | Ga0466961_0024031 | |||
| 1453 | Ga0466961_0072354 | |||
| 1454 | Ga0466961_0101793 | |||
| 1455 | Ga0466963_0026729 | |||
| 1456 | Ga0466964_0012828 | |||
| 1457 | Ga0466971_0028679 | |||
| 1458 | Ga0466971_0082617 | |||
| 1459 | Ga0466970_0024199 | |||
| 1460 | Ga0466970_0029227 | |||
| 1461 | Ga0466970_0116116 | |||
| 1462 | Ga0466957_0016152 | |||
| 1463 | Ga0466960_0033457 | |||
| 1464 | Ga0466960_0100214 | |||
| 1465 | Ga0466960_0105888 | |||
| 1466 | Ga0466959_0108272 | |||
| 1467 | Ga0466959_0147955 | |||
| 1468 | Ga0466958_0010458 | |||
| 1469 | Ga0466958_0380035 | |||
| 1470 | Ga0466967_0005049 | |||
| 1471 | Ga0466967_0586912 | |||
| 1472 | Ga0466967_0708812 | |||
| 1473 | Ga0495592_0000133 | |||
| 1474 | Ga0495592_0011180 | |||
| 1475 | Ga0495592_0018646 | |||
| 1476 | Ga0495592_0091562 | |||
| 1477 | Ga0495592_0095463 | |||
| 1478 | Ga0495592_0100167 | |||
| 1479 | Ga0495603_0007688 | |||
| 1480 | Ga0495603_0088065 | |||
| 1481 | Ga0495603_0181329 | |||
| 1482 | Ga0495629_0002868 | |||
| 1483 | Ga0495629_0028696 | |||
| 1484 | Ga0495629_0034052 | |||
| 1485 | Ga0495629_0047594 | |||
| 1486 | Ga0495629_0253780 | |||
| 1487 | Ga0495629_0315659 | |||
| 1488 | Ga0495641_0012372 | |||
| 1489 | Ga0495641_0016724 | |||
| 1490 | Ga0495641_0073790 | |||
| 1491 | Ga0495641_0309201 | |||
| 1492 | Ga0495651_0000470 | |||
| 1493 | Ga0495651_0001347 | |||
| 1494 | Ga0495651_0012416 | |||
| 1495 | Ga0495651_0018081 | |||
| 1496 | Ga0495651_0020335 | |||
| 1497 | Ga0495651_0045457 | |||
| 1498 | Ga0495651_0073204 | |||
| 1499 | Ga0495653_0021798 | |||
| 1500 | Ga0495653_0022407 | |||
| 1501 | Ga0495653_0028427 | |||
| 1502 | Ga0495653_0031442 | |||
| 1503 | Ga0495653_0046286 | |||
| 1504 | Ga0495653_0068420 | |||
| 1505 | Ga0495653_0120145 | |||
| 1506 | Ga0495653_0162076 | |||
| 1507 | Ga0495580_0011155 | |||
| 1508 | Ga0495580_0072122 | |||
| 1509 | Ga0495580_0284629 | |||
| 1510 | Ga0495582_0000564 | |||
| 1511 | Ga0495582_0014717 | |||
| 1512 | Ga0495582_0080952 | |||
| 1513 | Ga0495639_0000320 | |||
| 1514 | Ga0495639_0012003 | |||
| 1515 | Ga0495639_0060948 | |||
| 1516 | Ga0495662_0002566 | |||
| 1517 | Ga0495662_0004176 | |||
| 1518 | Ga0495662_0006002 | |||
| 1519 | Ga0495662_0035173 | |||
| 1520 | Ga0495664_0000448 | |||
| 1521 | Ga0495664_0008540 | |||
| 1522 | Ga0495664_0032453 | |||
| 1523 | Ga0495664_0084001 | |||
| 1524 | Ga0495664_0102439 | |||
| 1525 | Ga0495664_0269277 | |||
| 1526 | Ga0495664_0273126 | |||
| 1527 | Ga0495608_0000028 | |||
| 1528 | Ga0495608_0005511 | |||
| 1529 | Ga0495608_0018095 | |||
| 1530 | Ga0495608_0024564 | |||
| 1531 | Ga0495608_0029548 | |||
| 1532 | Ga0495608_0056210 | |||
| 1533 | Ga0495608_0083484 | |||
| 1534 | Ga0495608_0083910 | |||
| 1535 | Ga0495608_0207861 | |||
| 1536 | Ga0495618_0018754 | |||
| 1537 | Ga0495618_0061533 | |||
| 1538 | Ga0495618_0104710 | |||
| 1539 | Ga0495618_0270399 | |||
| 1540 | Ga0495618_0306229 | |||
| 1541 | Ga0495628_0000371 | |||
| 1542 | Ga0495628_0009484 | |||
| 1543 | Ga0495628_0071155 | |||
| 1544 | Ga0495628_0083266 | |||
| 1545 | Ga0495628_0100045 | |||
| 1546 | Ga0495628_0104685 | |||
| 1547 | Ga0495628_0128986 | |||
| 1548 | Ga0495628_0159230 | |||
| 1549 | Ga0495628_0170652 | |||
| 1550 | Ga0495628_0171807 | |||
| 1551 | Ga0495628_0198464 | |||
| 1552 | Ga0495628_0216447 | |||
| 1553 | Ga0495628_0264617 | |||
| 1554 | Ga0495630_0039791 | |||
| 1555 | Ga0495630_0081973 | |||
| 1556 | Ga0495630_0092051 | |||
| 1557 | Ga0495630_0116237 | |||
| 1558 | Ga0495630_0123366 | |||
| 1559 | Ga0495630_0155421 | |||
| 1560 | Ga0495630_0284589 | |||
| 1561 | Ga0495630_0567314 | |||
| 1562 | Ga0495666_0001809 | |||
| 1563 | Ga0495666_0021044 | |||
| 1564 | Ga0495666_0039596 | |||
| 1565 | Ga0495666_0055293 | |||
| 1566 | Ga0495652_0000031 | |||
| 1567 | Ga0495652_0006866 | |||
| 1568 | Ga0495652_0063281 | |||
| 1569 | Ga0495652_0077351 | |||
| 1570 | Ga0495652_0081177 | |||
| 1571 | Ga0495652_0118260 | |||
| 1572 | Ga0495652_0121714 | |||
| 1573 | Ga0495652_0132782 | |||
| 1574 | Ga0495665_0000756 | |||
| 1575 | Ga0495665_0016699 | |||
| 1576 | Ga0495665_0025410 | |||
| 1577 | Ga0495665_0062049 | |||
| 1578 | Ga0495640_0007267 | |||
| 1579 | Ga0495640_0032524 | |||
| 1580 | Ga0495640_0033050 | |||
| 1581 | Ga0495640_0033878 | |||
| 1582 | Ga0495640_0061722 | |||
| 1583 | Ga0495640_0076132 | |||
| 1584 | Ga0495640_0143060 | |||
| 1585 | Ga0495640_0358298 | |||
| 1586 | Ga0495586_0002211 | |||
| 1587 | Ga0495586_0265090 | |||
| 1588 | Ga0495587_0000023 | |||
| 1589 | Ga0495587_0005276 | |||
| 1590 | Ga0495587_0018386 | |||
| 1591 | Ga0495587_0025920 | |||
| 1592 | Ga0495587_0144175 | |||
| 1593 | Ga0495645_0028213 | |||
| 1594 | Ga0495645_0206569 | |||
| 1595 | Ga0495667_0000054 | |||
| 1596 | Ga0495667_0004964 | |||
| 1597 | Ga0495667_0015283 | |||
| 1598 | Ga0495667_0021989 | |||
| 1599 | Ga0495667_0022231 | |||
| 1600 | Ga0495667_0042258 | |||
| 1601 | Ga0495667_0054602 | |||
| 1602 | Ga0495667_0194090 | |||
| 1603 | Ga0495667_0271471 | |||
| 1604 | Ga0495656_0084799 | |||
| 1605 | Ga0495634_0026344 | |||
| 1606 | Ga0495634_0073890 | |||
| 1607 | Ga0495634_0195835 | |||
| 1608 | Ga0495634_0295734 | |||
| 1609 | Ga0495634_0311030 | |||
| 1610 | Ga0495635_0001747 | |||
| 1611 | Ga0495635_0007937 | |||
| 1612 | Ga0495635_0027968 | |||
| 1613 | Ga0495635_0034608 | |||
| 1614 | Ga0495635_0112018 | |||
| 1615 | Ga0495635_0275647 | |||
| 1616 | Ga0495657_0000022 | |||
| 1617 | Ga0495657_0002646 | |||
| 1618 | Ga0495657_0017242 | |||
| 1619 | Ga0495657_0019711 | |||
| 1620 | Ga0495657_0032342 | |||
| 1621 | Ga0495657_0037823 | |||
| 1622 | Ga0495599_0000236 | |||
| 1623 | Ga0495599_0021152 | |||
| 1624 | Ga0495599_0033930 | |||
| 1625 | Ga0495599_0058238 | |||
| 1626 | Ga0495599_0086958 | |||
| 1627 | Ga0495599_0093224 | |||
| 1628 | Ga0495599_0135255 | |||
| 1629 | Ga0495623_0001803 | |||
| 1630 | Ga0495623_0024139 | |||
| 1631 | Ga0495623_0027986 | |||
| 1632 | Ga0495623_0041308 | |||
| 1633 | Ga0495623_0207738 | |||
| 1634 | Ga0495646_0005340 | |||
| 1635 | Ga0495646_0010149 | |||
| 1636 | Ga0495646_0014616 | |||
| 1637 | Ga0495646_0118768 | |||
| 1638 | Ga0495647_0004740 | |||
| 1639 | Ga0495647_0021880 | |||
| 1640 | Ga0495658_0009682 | |||
| 1641 | Ga0495658_0022731 | |||
| 1642 | Ga0495658_0040437 | |||
| 1643 | Ga0495613_0011190 | |||
| 1644 | Ga0495613_0026219 | |||
| 1645 | Ga0495613_0066560 | |||
| 1646 | Ga0495613_0237503 | |||
| 1647 | Ga0495613_0438784 | |||
| 1648 | Ga0495624_0001756 | |||
| 1649 | Ga0495624_0001919 | |||
| 1650 | Ga0495624_0013711 | |||
| 1651 | Ga0495624_0090949 | |||
| 1652 | Ga0495600_0004257 | |||
| 1653 | Ga0495600_0008322 | |||
| 1654 | Ga0495600_0010830 | |||
| 1655 | Ga0495600_0022765 | |||
| 1656 | Ga0495600_0031230 | |||
| 1657 | Ga0495600_0049556 | |||
| 1658 | Ga0495600_0074472 | |||
| 1659 | Ga0495600_0108367 | |||
| 1660 | Ga0495600_0241530 | |||
| 1661 | Ga0495581_0001057 | |||
| 1662 | Ga0495581_0012081 | |||
| 1663 | Ga0495581_0049758 | |||
| 1664 | Ga0495604_0000022 | |||
| 1665 | Ga0495604_0001853 | |||
| 1666 | Ga0495604_0017016 | |||
| 1667 | Ga0495604_0018581 | |||
| 1668 | Ga0495604_0074648 | |||
| 1669 | Ga0495604_0153676 | |||
| 1670 | Ga0495604_0178897 | |||
| 1671 | Ga0495604_0188536 | |||
| 1672 | Ga0495604_0250625 | |||
| 1673 | Ga0495674_0003145 | |||
| 1674 | Ga0495674_0007792 | |||
| 1675 | Ga0495674_0042408 | |||
| 1676 | Ga0495674_0051880 | |||
| 1677 | Ga0495674_0053849 | |||
| 1678 | Ga0495674_0072201 | |||
| 1679 | Ga0495676_0003179 | |||
| 1680 | Ga0495676_0127487 | |||
| 1681 | Ga0495680_0000271 | |||
| 1682 | Ga0495680_0006193 | |||
| 1683 | Ga0495680_0007684 | |||
| 1684 | Ga0495680_0044719 | |||
| 1685 | Ga0495680_0050667 | |||
| 1686 | Ga0495680_0052558 | |||
| 1687 | Ga0495680_0093708 | |||
| 1688 | Ga0495680_0109534 | |||
| 1689 | Ga0495680_0195976 | |||
| 1690 | Ga0495680_0215007 | |||
| 1691 | Ga0495675_0002876 | |||
| 1692 | Ga0495675_0017842 | |||
| 1693 | Ga0495675_0026629 | |||
| 1694 | Ga0495675_0036613 | |||
| 1695 | Ga0495675_0053260 | |||
| 1696 | Ga0495675_0059915 | |||
| 1697 | Ga0495675_0063539 | |||
| 1698 | Ga0495675_0235896 | |||
| 1699 | Ga0495675_0253348 | |||
| 1700 | Ga0495684_0002493 | |||
| 1701 | Ga0495684_0015783 | |||
| 1702 | Ga0495684_0023986 | |||
| 1703 | Ga0495684_0147408 | |||
| 1704 | Ga0495684_0154016 | |||
| 1705 | Ga0495684_0173246 | |||
| 1706 | Ga0495684_0293427 | |||
| 1707 | Ga0495593_0001295 | |||
| 1708 | Ga0495593_0026522 | |||
| 1709 | Ga0495593_0033280 | |||
| 1710 | Ga0495593_0061503 | |||
| 1711 | Ga0495602_0000390 | |||
| 1712 | Ga0495602_0005560 | |||
| 1713 | Ga0495602_0040901 | |||
| 1714 | Ga0495602_0045188 | |||
| 1715 | Ga0495602_0045765 | |||
| 1716 | Ga0495602_0132266 | |||
| 1717 | Ga0495602_0297071 | |||
| 1718 | Ga0495602_0350753 | |||
| 1719 | Ga0495614_0158368 | |||
| 1720 | Ga0496100_0058723 | |||
| 1721 | Ga0496100_0161424 | |||
| 1722 | Ga0496101_0291735 | |||
| 1723 | Ga0496101_0316119 | |||
| 1724 | Ga0496102_0071268 | |||
| 1725 | Ga0496102_0115326 | |||
| 1726 | Ga0496102_0165043 | |||
| 1727 | Ga0496102_0288707 | |||
| 1728 | Ga0496102_0610907 | |||
| 1729 | Ga0496103_0052153 | |||
| 1730 | Ga0496103_0073907 | |||
| 1731 | Ga0496104_0005347 | |||
| 1732 | Ga0496104_0063047 | |||
| 1733 | Ga0496104_0074849 | |||
| 1734 | Ga0496104_0109580 | |||
| 1735 | Ga0496104_0113883 | |||
| 1736 | Ga0496104_0508933 | |||
| 1737 | Ga0496105_0000120 | |||
| 1738 | Ga0496105_0001446 | |||
| 1739 | Ga0496105_0032956 | |||
| 1740 | Ga0496105_0050079 | |||
| 1741 | Ga0496105_0081889 | |||
| 1742 | Ga0496105_0112057 | |||
| 1743 | Ga0496105_0238822 | |||
| 1744 | Ga0496106_0014173 | |||
| 1745 | Ga0496106_0050724 | |||
| 1746 | Ga0496107_0012223 | |||
| 1747 | Ga0496107_0059096 | |||
| 1748 | Ga0496107_0061382 | |||
| 1749 | Ga0496107_0149131 | |||
| 1750 | Ga0496108_0003930 | |||
| 1751 | Ga0496108_0013769 | |||
| 1752 | Ga0496108_0099415 | |||
| 1753 | Ga0496108_0201341 | |||
| 1754 | Ga0496108_0201397 | |||
| 1755 | Ga0496108_0354668 | |||
| 1756 | Ga0496109_0050712 | |||
| 1757 | Ga0496109_0066117 | |||
| 1758 | Ga0496109_0078784 | |||
| 1759 | Ga0496109_0105266 | |||
| 1760 | Ga0496109_0110142 | |||
| 1761 | Ga0496109_0116456 | |||
| 1762 | Ga0496109_0214334 | |||
| 1763 | Ga0496109_0306374 | |||
| 1764 | Ga0496110_0052690 | |||
| 1765 | Ga0496110_0248671 | |||
| 1766 | Ga0496110_0401932 | |||
| 1767 | Ga0496110_0448696 | |||
| 1768 | Ga0496110_0666359 | |||
| 1769 | Ga0496111_0057011 | |||
| 1770 | Ga0496111_0059336 | |||
| 1771 | Ga0496111_0318746 | |||
| 1772 | Ga0496112_0019980 | |||
| 1773 | Ga0496112_0100925 | |||
| 1774 | Ga0496112_0110877 | |||
| 1775 | Ga0496112_0734130 | |||
| 1776 | Ga0496112_1109155 | |||
| 1777 | Ga0496113_0018578 | |||
| 1778 | Ga0496113_0060279 | |||
| 1779 | Ga0496113_0133702 | |||
| 1780 | Ga0496114_0029335 | |||
| 1781 | Ga0496114_0140488 | |||
| 1782 | Ga0496114_0232865 | |||
| 1783 | Ga0496114_0561245 | |||
| 1784 | Ga0496115_0024636 | |||
| 1785 | Ga0496115_0057015 | |||
| 1786 | Ga0496115_0251032 | |||
| 1787 | Ga0496115_0253264 | |||
| 1788 | Ga0496115_0293654 | |||
| 1789 | Ga0496126_0015540 | |||
| 1790 | Ga0501318_006305 | |||
| 1791 | Ga0501032_0004992 | |||
| 1792 | Ga0501033_0011495 | |||
| 1793 | Ga0501033_0064498 | |||
| 1794 | Ga0501034_0026588 | |||
| 1795 | Ga0501034_0046611 | |||
| 1796 | Ga0501034_0101105 | |||
| 1797 | Ga0501034_0488103 | |||
| 1798 | Ga0501036_0001691 | |||
| 1799 | Ga0501036_0234518 | |||
| 1800 | Ga0501037_0004582 | |||
| 1801 | Ga0501037_0060222 | |||
| 1802 | Ga0501037_0170740 | |||
| 1803 | Ga0501038_0006532 | |||
| 1804 | Ga0501038_0063465 | |||
| 1805 | Ga0501038_0227512 | |||
| 1806 | Ga0501039_0007936 | |||
| 1807 | Ga0501040_0043993 | |||
| 1808 | Ga0501041_0044080 | |||
| 1809 | Ga0501042_0021677 | |||
| 1810 | Ga0501042_0053726 | |||
| 1811 | Ga0501042_0058647 | |||
| 1812 | Ga0501042_0175898 | |||
| 1813 | Ga0501043_0011613 | |||
| 1814 | Ga0501043_0120385 | |||
| 1815 | Ga0501043_0128504 | |||
| 1816 | Ga0501046_0007199 | |||
| 1817 | Ga0501046_0008028 | |||
| 1818 | Ga0501047_0012050 | |||
| 1819 | Ga0501047_0211162 | |||
| 1820 | Ga0501048_0007791 | |||
| 1821 | Ga0501048_0041177 | |||
| 1822 | Ga0501067_0002053 | |||
| 1823 | Ga0501068_0062779 | |||
| 1824 | Ga0501068_0081858 | |||
| 1825 | Ga0501069_0050892 | |||
| 1826 | Ga0501069_0101767 | |||
| 1827 | Ga0501070_0003699 | |||
| 1828 | Ga0501070_0006215 | |||
| 1829 | Ga0501070_0359151 | |||
| 1830 | Ga0501071_0010142 | |||
| 1831 | Ga0501073_0012664 | |||
| 1832 | Ga0501073_0041947 | |||
| 1833 | Ga0501074_0000839 | |||
| 1834 | Ga0501076_0068482 | |||
| 1835 | Ga0501076_0089718 | |||
| 1836 | Ga0501077_0002353 | |||
| 1837 | Ga0501209_037301 | |||
| 1838 | Ga0501079_0056339 | |||
| 1839 | Ga0501079_0065564 | |||
| 1840 | Ga0501080_0006490 | |||
| 1841 | Ga0501081_0191365 | |||
| 1842 | Ga0501083_0027628 | |||
| 1843 | Ga0501035_0028393 | |||
| 1844 | Ga0501035_0446334 | |||
| 1845 | Ga0501044_0021785 | |||
| 1846 | Ga0501044_0038130 | |||
| 1847 | Ga0501044_0057823 | |||
| 1848 | Ga0501044_0323078 | |||
| 1849 | Ga0501044_0574624 | |||
| 1850 | Ga0501045_0351914 | |||
| 1851 | nmdc:mga03n38_10458_c1 | |||
| 1852 | nmdc:mga0yw44_33714_c1 | |||
| 1853 | nmdc:mga05p37_260330_c1 | |||
| 1854 | nmdc:mga05p37_268844_c1 | |||
| 1855 | nmdc:mga05p37_31168_c1 | |||
| 1856 | nmdc:mga05p37_35256_c1 | |||
| 1857 | nmdc:mga05p37_747895_c1 | |||
| 1858 | nmdc:mga05p37_935669_c1 | |||
| 1859 | nmdc:mga09592_117507_c1 | |||
| 1860 | nmdc:mga09592_12387_c1 | |||
| 1861 | nmdc:mga09592_6580_c1 | |||
| 1862 | nmdc:mga0qj67_314243_c1 | |||
| 1863 | nmdc:mga0qj67_59393_c1 | |||
| 1864 | nmdc:mga0qj67_87402_c1 | |||
| 1865 | nmdc:mga06r32_15774_c1 | |||
| 1866 | nmdc:mga06r32_29633_c1 | |||
| 1867 | nmdc:mga06r32_863151_c1 | |||
| 1868 | nmdc:mga08y16_206354_c1 | |||
| 1869 | nmdc:mga08y16_473481_c1 | |||
| 1870 | nmdc:mga0n895_101040_c1 | |||
| 1871 | nmdc:mga0n895_116954_c1 | |||
| 1872 | nmdc:mga0n895_171467_c1 | |||
| 1873 | nmdc:mga0n895_28600_c1 | |||
| 1874 | nmdc:mga0n895_75766_c1 | |||
| 1875 | nmdc:mga0rr50_11746_c1 | |||
| 1876 | nmdc:mga0rr50_238794_c1 | |||
| 1877 | nmdc:mga0rr50_28281_c1 | |||
| 1878 | nmdc:mga0rr50_375337_c1 | |||
| 1879 | nmdc:mga0rr50_72921_c1 | |||
| 1880 | nmdc:mga08x19_220840_c1 | |||
| 1881 | nmdc:mga08x19_263015_c1 | |||
| 1882 | nmdc:mga08x19_37258_c1 | |||
| 1883 | nmdc:mga08x19_57784_c1 | |||
| 1884 | nmdc:mga0a205_193307_c1 | |||
| 1885 | nmdc:mga0a205_40338_c1 | |||
| 1886 | nmdc:mga0a205_5351_c1 | |||
| 1887 | Ga0495601_0035492 | |||
| 1888 | Ga0495601_0072009 | |||
| 1889 | Ga0495601_0183868 | |||
| 1890 | Ga0495601_0224367 | |||
| 1891 | Ga0495601_0251480 | |||
| 1892 | Ga0495601_0410142 | |||
| 1893 | Ga0495612_0009026 | |||
| 1894 | Ga0495595_0011120 | |||
| 1895 | Ga0495595_0029393 | |||
| 1896 | Ga0495595_0056235 | |||
| 1897 | Ga0495595_0141802 | |||
| 1898 | Ga0495595_0143512 | |||
| 1899 | Ga0495619_0004343 | |||
| 1900 | Ga0495619_0004905 | |||
| 1901 | Ga0495619_0006518 | |||
| 1902 | Ga0495619_0012772 | |||
| 1903 | Ga0495619_0017109 | |||
| 1904 | Ga0495619_0198079 | |||
| 1905 | Ga0495619_0333996 | |||
| 1906 | Ga0495619_0342402 | |||
| 1907 | Ga0500616_0001211 | |||
| 1908 | Ga0501084_0000044 | |||
| 1909 | Ga0501084_0011106 | |||
| 1910 | Ga0501084_0104758 | |||
| 1911 | Ga0501084_0419470 | |||
| 1912 | Ga0501082_0007063 | |||
| 1913 | Ga0501082_0943635 | |||
| 1914 | Ga0466962_0006441 | |||
| 1915 | Ga0466962_0089850 | |||
| 1916 | Ga0530510_0009732 | |||
| 1917 | Ga0530510_0538320 | |||
| 1918 | 2644229354 | |||
| 1919 | 2645721831 | |||
| 1920 | 2676489071 | |||
| 1921 | 2689996318 | |||
| 1922 | 2884702679 | |||
| 1923 | 2895436407 | |||
| 1924 | 2895452179 | |||
| 1925 | 2984580261 | |||
| 1926 | 2990259111 | |||
| 1927 | 8055069263 | |||
| 1928 | 8055172973 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qdj-assembly1.cif.gz_A | crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sam | 0.8791 | 13 | 169 |
| 7pd7-assembly1.cif.gz_A | crocagin methyl transferase cgnl | 0.8627 | 7 | 125 |
| 2nxn-assembly1.cif.gz_A | t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 | 0.8421 | 12 | 169 |
| 6zxy-assembly1.cif.gz_B | structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme | 0.838 | 9 | 129 |
| 3cjr-assembly1.cif.gz_A | ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin. | 0.8345 | 12 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0DEH3_59_207_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9712 | 12 | 57 | 3.40.50.150 |
| af_Q9VBJ3_147_316_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8845 | 14 | 123 | 3.40.50.150 |
| 4qdjA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.879 | 13 | 169 | 3.40.50.150 |
| af_O44410_182_343_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8727 | 13 | 237 | 3.40.50.150 |
| af_A0A1D6ET91_93_186_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8708 | 11 | 117 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8L815-F1-model_v4 | Methyltransferase domain-containing protein | 0.9716 | 1 | 236 |
GO:0008757
GO:0032259 |
| AF-A0A7Y8L815-F1-model_v4 | Methyltransferase domain-containing protein | 0.9675 | 1 | 236 |
GO:0008757
GO:0032259 |
| AF-A0A7C2WDB1-F1-model_v4 | deleted | 0.9653 | 1 | 236 |
|
| AF-A0A7W4W9X6-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE | 0.9644 | 1 | 236 |
GO:0008757
GO:0032259 |
| AF-A0A7W4W9X6-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE | 0.9485 | 1 | 236 |
GO:0008757
GO:0032259 |