F486933

General Info

Members Datasets Scaffolds Average Seq Length
964 350 1928 244

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10070424|Ga0075433_100704242
Length 273
Sequence VLTVDFRRFPVGPGDRVLDLGCGGGRHAHEAYRRGADVVACDADLGELGTVADMAAAMHEAGEAPATAHARPVAGDGTVMPFGSEVFDRVIAAEVLEHIGDDQRALNEIARVLRPGGLLAVTVPAWLPERICWRLSDDYHNIPGGHVRIYTRPELEAKLRRAGLTVGGHHHAHGLHSPYWWLKCAVGVGDDDHPLARAYHRLLVWDIMKRPAATRVAERALNPLIGKSLVLYARKPVPPGGDGHGEGSADRGGAARRSADRDASRPERAHAGA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
91 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
171 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
210 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
340 2643221641 Nocardioides sp. Root122 Isolate Unclassified
341 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
342 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
343 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
344 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
345 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
346 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
347 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
348 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
349 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
350 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 0.41
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 0.62
Nodule 0.1
Rhizoplane 7.16
Rhizosphere 90.46
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10070424 3300006852 Bacteria 3073
2 MBSR1b_contig_4503056 2162886012 Bacteria 1083
3 LJQas_1002216 3300000549 Bacteria 2740
4 LJQas_1005280 3300000549 Bacteria 1646
5 JGI25404J52841_10007904 3300003659 Bacteria 2257
6 Ga0070658_10062310 3300005327 Bacteria 3039
7 Ga0070683_100292681 3300005329 Bacteria 1549
8 Ga0070690_100221277 3300005330 Bacteria 1326
9 Ga0070682_100044302 3300005337 Bacteria 2754
10 Ga0068868_100200272 3300005338 Bacteria 1664
11 Ga0068868_100248708 3300005338 Bacteria 1496
12 Ga0070660_100324824 3300005339 Bacteria 1264
13 Ga0070689_100205556 3300005340 Bacteria 1610
14 Ga0070661_100034192 3300005344 Bacteria 3685
15 Ga0070692_10054061 3300005345 Bacteria 2095
16 Ga0070668_100145070 3300005347 Bacteria 1915
17 Ga0070669_100085306 3300005353 Bacteria 2358
18 Ga0070669_100164889 3300005353 Bacteria 1724
19 Ga0070675_100110283 3300005354 Bacteria 2327
20 Ga0070675_100294337 3300005354 Bacteria 1429
21 Ga0070671_100225384 3300005355 Bacteria 1590
22 Ga0070671_100449315 3300005355 Bacteria 1106
23 Ga0070671_100498713 3300005355 Bacteria 1047
24 Ga0070674_100351482 3300005356 Bacteria 1191
25 Ga0070673_100188377 3300005364 Bacteria 1770
26 Ga0070659_100080447 3300005366 Bacteria 2601
27 Ga0070709_10000293 3300005434 Bacteria 31656
28 Ga0070709_10080490 3300005434 Bacteria 2124
29 Ga0070709_10179554 3300005434 Bacteria 1485
30 Ga0070709_10266136 3300005434 Bacteria 1240
31 Ga0070714_100013140 3300005435 Bacteria 6629
32 Ga0070714_100017411 3300005435 Bacteria 5820
33 Ga0070714_100055138 3300005435 Bacteria 3397
34 Ga0070714_100660553 3300005435 Bacteria 1007
35 Ga0070713_100021561 3300005436 Bacteria 4959
36 Ga0070713_100031308 3300005436 Bacteria 4236
37 Ga0070713_100050178 3300005436 Bacteria 3445
38 Ga0070713_100412669 3300005436 Bacteria 1263
39 Ga0070710_10003256 3300005437 Bacteria 7698
40 Ga0070710_10063550 3300005437 Bacteria 2109
41 Ga0070710_10086358 3300005437 Bacteria 1842
42 Ga0070711_100006437 3300005439 Bacteria 7081
43 Ga0070711_100015362 3300005439 Bacteria 4846
44 Ga0070711_100183901 3300005439 Bacteria 1601
45 Ga0070700_100067335 3300005441 Bacteria 2275
46 Ga0070694_100276674 3300005444 Bacteria 1278
47 Ga0070708_100002499 3300005445 Bacteria 14189
48 Ga0070708_100007308 3300005445 Bacteria 8839
49 Ga0070708_100008434 3300005445 Bacteria 8271
50 Ga0070708_100036014 3300005445 Bacteria 4314
51 Ga0070708_100064148 3300005445 Bacteria 3290
52 Ga0070708_100222667 3300005445 Bacteria 1769
53 Ga0070678_100068342 3300005456 Bacteria 2648
54 Ga0070681_10109484 3300005458 Bacteria 2702
55 Ga0070685_10054414 3300005466 Bacteria 2321
56 Ga0070706_100000821 3300005467 Bacteria 34271
57 Ga0070706_100012251 3300005467 Bacteria 7947
58 Ga0070706_100026028 3300005467 Bacteria 5384
59 Ga0070706_100072290 3300005467 Bacteria 3192
60 Ga0070706_100105320 3300005467 Bacteria 2624
61 Ga0070706_100131481 3300005467 Bacteria 2335
62 Ga0070706_100200810 3300005467 Bacteria 1862
63 Ga0070706_100240642 3300005467 Bacteria 1690
64 Ga0070706_100487897 3300005467 Bacteria 1146
65 Ga0070706_100652523 3300005467 Bacteria 977
66 Ga0070707_100000127 3300005468 Bacteria 71273
67 Ga0070707_100005476 3300005468 Bacteria 11869
68 Ga0070707_100011395 3300005468 Bacteria 8291
69 Ga0070707_100056141 3300005468 Bacteria 3776
70 Ga0070707_100084429 3300005468 Bacteria 3068
71 Ga0070707_100178396 3300005468 Bacteria 2071
72 Ga0070707_100189646 3300005468 Bacteria 2004
73 Ga0070707_100227558 3300005468 Bacteria 1816
74 Ga0070707_100340617 3300005468 Bacteria 1457
75 Ga0070698_100000991 3300005471 Bacteria 31258
76 Ga0070698_100001111 3300005471 Bacteria 29683
77 Ga0070698_100001614 3300005471 Bacteria 25100
78 Ga0070698_100006941 3300005471 Bacteria 12264
79 Ga0070698_100039365 3300005471 Bacteria 4866
80 Ga0070698_100101309 3300005471 Bacteria 2851
81 Ga0070698_100392966 3300005471 Bacteria 1320
82 Ga0070699_100001261 3300005518 Bacteria 23319
83 Ga0070699_100037119 3300005518 Bacteria 4216
84 Ga0070699_100166608 3300005518 Bacteria 1952
85 Ga0070699_100196601 3300005518 Bacteria 1793
86 Ga0070679_100122886 3300005530 Bacteria 2580
87 Ga0070679_100546748 3300005530 Bacteria 1102
88 Ga0070679_101044614 3300005530 Bacteria 761
89 Ga0070684_100108726 3300005535 Bacteria 2484
90 Ga0070684_100169923 3300005535 Bacteria 1980
91 Ga0070684_100307033 3300005535 Bacteria 1456
92 Ga0070697_100018646 3300005536 Bacteria 5473
93 Ga0070697_100232197 3300005536 Bacteria 1574
94 Ga0068853_100148960 3300005539 Bacteria 2105
95 Ga0068853_100589575 3300005539 Bacteria 1055
96 Ga0070672_100226477 3300005543 Bacteria 1569
97 Ga0070686_100045356 3300005544 Bacteria 2768
98 Ga0070686_100140224 3300005544 Bacteria 1682
99 Ga0070695_100032198 3300005545 Bacteria 3277
100 Ga0070696_100254839 3300005546 Bacteria 1328
101 Ga0070693_100058626 3300005547 Bacteria 2229
102 Ga0070693_100217594 3300005547 Bacteria 1250
103 Ga0070665_100223229 3300005548 Bacteria 1885
104 Ga0070665_100498795 3300005548 Bacteria 1228
105 Ga0070704_100057288 3300005549 Bacteria 2770
106 Ga0070704_100076553 3300005549 Bacteria 2447
107 Ga0068855_100091730 3300005563 Bacteria 3504
108 Ga0070664_100130112 3300005564 Bacteria 2210
109 Ga0070664_100403871 3300005564 Bacteria 1250
110 Ga0068856_100135864 3300005614 Bacteria 2464
111 Ga0068856_100347834 3300005614 Bacteria 1501
112 Ga0068852_100061594 3300005616 Bacteria 3261
113 Ga0068852_100381114 3300005616 Bacteria 1383
114 Ga0068859_100478543 3300005617 Bacteria 1341
115 Ga0068864_100124815 3300005618 Bacteria 2305
116 Ga0068864_100139546 3300005618 Bacteria 2185
117 Ga0068864_100339540 3300005618 Bacteria 1415
118 Ga0068861_100170483 3300005719 Bacteria 1803
119 Ga0068861_100596540 3300005719 Bacteria 1013
120 Ga0068870_10037551 3300005840 Bacteria 2497
121 Ga0068863_100138833 3300005841 Bacteria 2323
122 Ga0068858_100120268 3300005842 Bacteria 2455
123 Ga0068860_100831676 3300005843 Bacteria 937
124 Ga0081540_1001333 3300005983 Bacteria 21517
125 Ga0081540_1016514 3300005983 Bacteria 4614
126 Ga0070717_10001020 3300006028 Bacteria 18788
127 Ga0070717_10009294 3300006028 Bacteria 7386
128 Ga0070717_10011549 3300006028 Bacteria 6710
129 Ga0070717_10012759 3300006028 Bacteria 6414
130 Ga0070717_10047815 3300006028 Bacteria 3506
131 Ga0070717_10357577 3300006028 Bacteria 1306
132 Ga0070717_10477366 3300006028 Bacteria 1126
133 Ga0075363_100032602 3300006048 Bacteria 2707
134 Ga0075363_100066133 3300006048 Bacteria 1956
135 Ga0070715_10010346 3300006163 Bacteria 3322
136 Ga0070715_10019130 3300006163 Bacteria 2621
137 Ga0070715_10029471 3300006163 Bacteria 2211
138 Ga0070715_10064352 3300006163 Bacteria 1619
139 Ga0070716_100000033 3300006173 Bacteria 57092
140 Ga0070716_100005591 3300006173 Bacteria 6102
141 Ga0070716_100097761 3300006173 Bacteria 1792
142 Ga0070716_100116560 3300006173 Bacteria 1664
143 Ga0070716_100145979 3300006173 Bacteria 1515
144 Ga0070716_100239739 3300006173 Bacteria 1229
145 Ga0070712_100007693 3300006175 Bacteria 6739
146 Ga0070712_100294010 3300006175 Bacteria 1312
147 Ga0070712_100452809 3300006175 Bacteria 1069
148 Ga0075367_10250915 3300006178 Bacteria 1110
149 Ga0097621_100108230 3300006237 Bacteria 2346
150 Ga0097621_100164273 3300006237 Bacteria 1910
151 Ga0097621_100584969 3300006237 Bacteria 1019
152 Ga0068871_100053084 3300006358 Bacteria 3284
153 Ga0068871_100254483 3300006358 Bacteria 1530
154 Ga0075428_100076214 3300006844 Bacteria 3662
155 Ga0075428_100092168 3300006844 Bacteria 3304
156 Ga0075428_100930327 3300006844 Bacteria 921
157 Ga0075430_100002290 3300006846 Bacteria 15866
158 Ga0075430_100151889 3300006846 Bacteria 1928
159 Ga0075431_100029054 3300006847 Bacteria 5688
160 Ga0075431_100071846 3300006847 Bacteria 3571
161 Ga0075431_100083479 3300006847 Bacteria 3298
162 Ga0075431_100567217 3300006847 Bacteria 1121
163 Ga0075433_10071211 3300006852 Bacteria 3056
164 Ga0075434_100026313 3300006871 Bacteria 5698
165 Ga0075434_100291665 3300006871 Bacteria 1651
166 Ga0075429_100001611 3300006880 Bacteria 18624
167 Ga0075429_100005255 3300006880 Bacteria 11135
168 Ga0075429_100663565 3300006880 Bacteria 914
169 Ga0075436_100051322 3300006914 Bacteria 2846
170 Ga0075436_100068691 3300006914 Bacteria 2448
171 Ga0075436_100233217 3300006914 Bacteria 1308
172 Ga0075436_100364468 3300006914 Bacteria 1043
173 Ga0097620_100478559 3300006931 Bacteria 1341
174 Ga0075435_100004822 3300007076 Bacteria 9330
175 Ga0075435_100078033 3300007076 Bacteria 2715
176 Ga0075435_100247692 3300007076 Bacteria 1516
177 Ga0099794_10052186 3300007265 Bacteria 1971
178 Ga0099795_10205588 3300007788 Bacteria 832
179 Ga0105251_10036723 3300009011 Bacteria 2409
180 Ga0105250_10037039 3300009092 Bacteria 1957
181 Ga0105240_10303024 3300009093 Bacteria 1827
182 Ga0111539_10022313 3300009094 Bacteria 7779
183 Ga0111539_10271458 3300009094 Bacteria 1974
184 Ga0111539_10658800 3300009094 Bacteria 1219
185 Ga0111539_10684655 3300009094 Bacteria 1194
186 Ga0111539_11514946 3300009094 Bacteria 778
187 Ga0105245_10746402 3300009098 Bacteria 1014
188 Ga0105247_10157558 3300009101 Bacteria 1501
189 Ga0114129_10002251 3300009147 Bacteria 26657
190 Ga0114129_10004683 3300009147 Bacteria 19326
191 Ga0114129_10271758 3300009147 Bacteria 2267
192 Ga0114129_10771310 3300009147 Bacteria 1229
193 Ga0114129_11027368 3300009147 Bacteria 1036
194 Ga0114129_11275324 3300009147 Bacteria 912
195 Ga0105243_10400014 3300009148 Bacteria 1276
196 Ga0105243_10553506 3300009148 Bacteria 1100
197 Ga0105243_10623051 3300009148 Bacteria 1042
198 Ga0105243_10807812 3300009148 Bacteria 925
199 Ga0105243_11233985 3300009148 Bacteria 762
200 Ga0105248_10870744 3300009177 Bacteria 1017
201 Ga0105238_10416675 3300009551 Bacteria 1337
202 Ga0105249_10220934 3300009553 Bacteria 1864
203 Ga0105239_10029474 3300010375 Bacteria 6034
204 Ga0105246_10087057 3300011119 Bacteria 2241
205 Ga0105246_10101216 3300011119 Bacteria 2098
206 Ga0157344_1001969 3300012476 Bacteria 1044
207 Ga0157338_1001773 3300012515 Bacteria 1602
208 Ga0157373_10146731 3300013100 Bacteria 1659
209 Ga0157370_10053773 3300013104 Bacteria 3840
210 Ga0157369_10148649 3300013105 Bacteria 2476
211 Ga0157369_10249367 3300013105 Bacteria 1853
212 Ga0157369_10555681 3300013105 Bacteria 1186
213 Ga0157369_10675561 3300013105 Bacteria 1064
214 Ga0157374_10052816 3300013296 Bacteria 3787
215 Ga0157378_10130263 3300013297 Bacteria 2328
216 Ga0157372_11605052 3300013307 Bacteria 749
217 Ga0157375_10329798 3300013308 Bacteria 1691
218 Ga0157375_10388596 3300013308 Bacteria 1562
219 Ga0157375_11271779 3300013308 Bacteria 864
220 Ga0163163_10128939 3300014325 Bacteria 2569
221 Ga0163163_10163292 3300014325 Bacteria 2273
222 Ga0157380_10193693 3300014326 Bacteria 1797
223 Ga0157380_10266561 3300014326 Bacteria 1559
224 Ga0182008_10084040 3300014497 Bacteria 1567
225 Ga0157377_10056996 3300014745 Bacteria 2220
226 Ga0157379_10139694 3300014968 Bacteria 2183
227 Ga0157379_10510242 3300014968 Bacteria 1115
228 Ga0157376_10260982 3300014969 Bacteria 1623
229 Ga0157376_11009867 3300014969 Bacteria 855
230 Ga0163161_10189921 3300017792 Bacteria 1579
231 Ga0206356_10031144 3300020070 Bacteria 2419
232 Ga0206354_11350309 3300020081 Bacteria 803
233 Ga0213873_10028432 3300021358 Bacteria 1371
234 Ga0207692_10022881 3300025898 Bacteria 2882
235 Ga0207692_10074608 3300025898 Bacteria 1798
236 Ga0207692_10244671 3300025898 Bacteria 1072
237 Ga0207642_10171567 3300025899 Bacteria 1174
238 Ga0207688_10033053 3300025901 Bacteria 2859
239 Ga0207685_10004309 3300025905 Bacteria 3600
240 Ga0207699_10000215 3300025906 Bacteria 34196
241 Ga0207699_10003454 3300025906 Bacteria 7535
242 Ga0207699_10024246 3300025906 Bacteria 3315
243 Ga0207699_10215395 3300025906 Bacteria 1308
244 Ga0207643_10053128 3300025908 Bacteria 2301
245 Ga0207684_10001704 3300025910 Bacteria 23348
246 Ga0207684_10004662 3300025910 Bacteria 12874
247 Ga0207684_10010229 3300025910 Bacteria 8258
248 Ga0207684_10029960 3300025910 Bacteria 4633
249 Ga0207684_10061894 3300025910 Bacteria 3177
250 Ga0207684_10066482 3300025910 Bacteria 3061
251 Ga0207684_10066544 3300025910 Bacteria 3060
252 Ga0207684_10079683 3300025910 Bacteria 2786
253 Ga0207684_10104224 3300025910 Bacteria 2425
254 Ga0207684_10126755 3300025910 Bacteria 2191
255 Ga0207684_10176946 3300025910 Bacteria 1839
256 Ga0207684_10232891 3300025910 Bacteria 1589
257 Ga0207707_10192607 3300025912 Bacteria 1778
258 Ga0207707_10211329 3300025912 Bacteria 1690
259 Ga0207707_10227070 3300025912 Bacteria 1625
260 Ga0207707_10453441 3300025912 Bacteria 1097
261 Ga0207693_10018514 3300025915 Bacteria 5546
262 Ga0207693_10024549 3300025915 Bacteria 4782
263 Ga0207693_10030599 3300025915 Bacteria 4253
264 Ga0207693_10185606 3300025915 Bacteria 1637
265 Ga0207693_10260883 3300025915 Bacteria 1359
266 Ga0207663_10031674 3300025916 Bacteria 3132
267 Ga0207663_10057750 3300025916 Bacteria 2446
268 Ga0207662_10042542 3300025918 Bacteria 2678
269 Ga0207657_10103294 3300025919 Bacteria 2362
270 Ga0207649_10064837 3300025920 Bacteria 2311
271 Ga0207649_10195943 3300025920 Bacteria 1424
272 Ga0207646_10000264 3300025922 Bacteria 71299
273 Ga0207646_10007362 3300025922 Bacteria 11210
274 Ga0207646_10010104 3300025922 Bacteria 9249
275 Ga0207646_10013014 3300025922 Bacteria 7969
276 Ga0207646_10065507 3300025922 Bacteria 3244
277 Ga0207646_10100885 3300025922 Bacteria 2587
278 Ga0207646_10143808 3300025922 Bacteria 2149
279 Ga0207646_10154536 3300025922 Bacteria 2069
280 Ga0207646_10236417 3300025922 Bacteria 1651
281 Ga0207646_10413858 3300025922 Bacteria 1217
282 Ga0207650_10202093 3300025925 Bacteria 1592
283 Ga0207659_10149137 3300025926 Bacteria 1824
284 Ga0207687_10061398 3300025927 Bacteria 2654
285 Ga0207687_10140536 3300025927 Bacteria 1831
286 Ga0207687_10167063 3300025927 Bacteria 1694
287 Ga0207700_10000237 3300025928 Bacteria 32998
288 Ga0207700_10001853 3300025928 Bacteria 11977
289 Ga0207700_10016470 3300025928 Bacteria 4912
290 Ga0207700_10037335 3300025928 Bacteria 3517
291 Ga0207700_10105031 3300025928 Bacteria 2261
292 Ga0207700_10105775 3300025928 Bacteria 2254
293 Ga0207700_10273880 3300025928 Bacteria 1449
294 Ga0207700_10493850 3300025928 Bacteria 1083
295 Ga0207664_10000276 3300025929 Bacteria 38889
296 Ga0207664_10001948 3300025929 Bacteria 13584
297 Ga0207664_10002105 3300025929 Bacteria 13093
298 Ga0207664_10046981 3300025929 Bacteria 3390
299 Ga0207664_10060628 3300025929 Bacteria 3016
300 Ga0207664_10104128 3300025929 Bacteria 2349
301 Ga0207664_10549967 3300025929 Bacteria 1036
302 Ga0207690_10463986 3300025932 Bacteria 1020
303 Ga0207706_10273696 3300025933 Bacteria 1473
304 Ga0207709_10067553 3300025935 Bacteria 2256
305 Ga0207709_10258183 3300025935 Bacteria 1276
306 Ga0207670_10358109 3300025936 Bacteria 1157
307 Ga0207704_10015167 3300025938 Bacteria 3917
308 Ga0207665_10000079 3300025939 Bacteria 62721
309 Ga0207665_10005128 3300025939 Bacteria 8746
310 Ga0207665_10068352 3300025939 Bacteria 2421
311 Ga0207665_10082801 3300025939 Bacteria 2212
312 Ga0207665_10098394 3300025939 Bacteria 2038
313 Ga0207691_10102634 3300025940 Bacteria 2551
314 Ga0207689_10087196 3300025942 Bacteria 2564
315 Ga0207689_10201397 3300025942 Bacteria 1643
316 Ga0207661_10462431 3300025944 Bacteria 1157
317 Ga0207667_10137171 3300025949 Bacteria 2519
318 Ga0207712_10023288 3300025961 Bacteria 4086
319 Ga0207712_10153084 3300025961 Bacteria 1783
320 Ga0207712_10488781 3300025961 Bacteria 1050
321 Ga0207640_10103556 3300025981 Bacteria 2001
322 Ga0207640_10590255 3300025981 Bacteria 939
323 Ga0207658_10460975 3300025986 Bacteria 1127
324 Ga0207677_10303872 3300026023 Bacteria 1319
325 Ga0207703_10074917 3300026035 Bacteria 2803
326 Ga0207678_10052664 3300026067 Bacteria 3510
327 Ga0207708_10052111 3300026075 Bacteria 3117
328 Ga0207702_10171277 3300026078 Bacteria 1991
329 Ga0207702_10731314 3300026078 Bacteria 976
330 Ga0207676_10470729 3300026095 Bacteria 1188
331 Ga0207676_10821750 3300026095 Bacteria 908
332 Ga0207674_10016544 3300026116 Bacteria 8068
333 Ga0207674_10029717 3300026116 Bacteria 5751
334 Ga0207675_100071147 3300026118 Bacteria 3251
335 Ga0207675_100242890 3300026118 Bacteria 1740
336 Ga0207683_10001961 3300026121 Bacteria 18223
337 Ga0207683_10239461 3300026121 Bacteria 1655
338 Ga0207698_10556498 3300026142 Bacteria 1125
339 Ga0207428_10267784 3300027907 Bacteria 1271
340 Ga0268266_10509921 3300028379 Bacteria 1149
341 Ga0265338_10000931 3300028800 Bacteria 49350
342 Ga0265338_10002733 3300028800 Bacteria 25888
343 Ga0265338_10007759 3300028800 Bacteria 13203
344 Ga0265760_10099131 3300031090 Bacteria 919
345 Ga0265325_10000666 3300031241 Bacteria 25053
346 Ga0265331_10034269 3300031250 Bacteria 2505
347 Ga0265327_10009735 3300031251 Bacteria 6877
348 Ga0265327_10029452 3300031251 Bacteria 3123
349 Ga0265327_10066785 3300031251 Bacteria 1813
350 Ga0265327_10081088 3300031251 Bacteria 1603
351 Ga0265316_10022142 3300031344 Bacteria 5368
352 Ga0265313_10000421 3300031595 Bacteria 45317
353 Ga0265314_10099761 3300031711 Bacteria 1869
354 Ga0316576_10326660 3300031727 Bacteria 1144
355 Ga0307413_10008822 3300031824 Bacteria 4787
356 Ga0307407_10182180 3300031903 Bacteria 1393
357 Ga0307412_10067286 3300031911 Bacteria 2432
358 Ga0307409_100066270 3300031995 Bacteria 2847
359 Ga0307409_100326338 3300031995 Bacteria 1438
360 Ga0307409_100346976 3300031995 Bacteria 1399
361 Ga0307416_100011074 3300032002 Bacteria 5995
362 Ga0307416_100780410 3300032002 Bacteria 1050
363 Ga0307411_10161550 3300032005 Bacteria 1679
364 Ga0307415_100003889 3300032126 Bacteria 7673
365 Ga0307415_100023156 3300032126 Bacteria 3850
366 Ga0373930_0017303 3300034816 Bacteria 1373
367 Ga0373950_0022418 3300034818 Bacteria 1123
368 Ga0373958_0038218 3300034819 Bacteria 971
369 Ga0373926_0007799 3300035083 Bacteria 3565
370 Ga0373926_0038875 3300035083 Bacteria 1695
371 Ga0373928_0032986 3300035084 Bacteria 1157
372 Ga0373929_0008257 3300035085 Bacteria 1918
373 Ga0373929_0012072 3300035085 Bacteria 1637
374 Ga0373934_0000147 3300035086 Bacteria 25688
375 Ga0373934_0002032 3300035086 Bacteria 7431
376 Ga0373934_0008979 3300035086 Bacteria 3736
377 Ga0373934_0043062 3300035086 Bacteria 1784
378 Ga0373934_0043712 3300035086 Bacteria 1770
379 Ga0373944_0001945 3300035089 Bacteria 5233
380 Ga0373944_0049699 3300035089 Bacteria 1318
381 Ga0373949_0023503 3300035090 Bacteria 1427
382 Ga0373923_0006138 3300035111 Bacteria 4130
383 Ga0373923_0023993 3300035111 Bacteria 2405
384 Ga0373923_0026639 3300035111 Bacteria 2301
385 Ga0373923_0113291 3300035111 Bacteria 1206
386 Ga0373932_0016797 3300035112 Bacteria 1872
387 Ga0373936_0001334 3300035113 Bacteria 8956
388 Ga0373936_0001833 3300035113 Bacteria 7824
389 Ga0373936_0049328 3300035113 Bacteria 1700
390 Ga0373939_0025030 3300035114 Bacteria 1669
391 Ga0373941_0146569 3300035115 Bacteria 863
392 Ga0373945_0001276 3300035116 Bacteria 7645
393 Ga0373945_0001451 3300035116 Bacteria 7231
394 Ga0373953_0000058 3300035117 Bacteria 28394
395 Ga0373953_0011227 3300035117 Bacteria 3139
396 Ga0373953_0011364 3300035117 Bacteria 3123
397 Ga0373953_0021950 3300035117 Bacteria 2401
398 Ga0373953_0082699 3300035117 Bacteria 1336
399 Ga0373953_0111418 3300035117 Bacteria 1157
400 Ga0373954_0036587 3300035118 Bacteria 2279
401 Ga0373954_0133439 3300035118 Bacteria 1209
402 Ga0373956_0000532 3300035119 Bacteria 15593
403 Ga0373956_0022918 3300035119 Bacteria 2676
404 Ga0373956_0054261 3300035119 Bacteria 1805
405 Ga0373956_0060718 3300035119 Bacteria 1712
406 Ga0373956_0145723 3300035119 Bacteria 1113
407 Ga0373957_0005875 3300035120 Bacteria 3832
408 Ga0373957_0013383 3300035120 Bacteria 2783
409 Ga0373957_0120707 3300035120 Bacteria 1061
410 Ga0373960_0022395 3300035121 Bacteria 1691
411 Ga0373943_0001034 3300035170 Bacteria 12360
412 Ga0373943_0001717 3300035170 Bacteria 9929
413 Ga0373943_0332646 3300035170 Bacteria 868
414 Ga0373946_0001997 3300035171 Bacteria 7141
415 Ga0373946_0007314 3300035171 Bacteria 4030
416 Ga0373946_0020811 3300035171 Bacteria 2538
417 Ga0373946_0033724 3300035171 Bacteria 2063
418 Ga0373946_0044196 3300035171 Bacteria 1839
419 Ga0373955_0001363 3300035172 Bacteria 10382
420 Ga0373955_0003228 3300035172 Bacteria 7143
421 Ga0373955_0007678 3300035172 Bacteria 4967
422 Ga0373955_0018334 3300035172 Bacteria 3479
423 Ga0373955_0071122 3300035172 Bacteria 1945
424 Ga0373961_0014919 3300035241 Bacteria 1979
425 Ga0316574_0095529 3300035398 Bacteria 1899
426 Ga0316574_0166129 3300035398 Bacteria 1421
427 Ga0373924_0000537 3300035410 Bacteria 11689
428 Ga0373924_0001574 3300035410 Bacteria 7455
429 Ga0373924_0004757 3300035410 Bacteria 4764
430 Ga0373924_0032163 3300035410 Bacteria 2113
431 Ga0373924_0042310 3300035410 Bacteria 1868
432 Ga0373924_0107855 3300035410 Bacteria 1201
433 Ga0373931_0059827 3300035691 Bacteria 2049
434 Ga0373935_0000168 3300035692 Bacteria 30620
435 Ga0373935_0005165 3300035692 Bacteria 7684
436 Ga0373935_0005683 3300035692 Bacteria 7360
437 Ga0373935_0079030 3300035692 Bacteria 2135
438 Ga0373927_0027084 3300035695 Bacteria 3745
439 Ga0373927_0030375 3300035695 Bacteria 3525
440 Ga0373927_0163752 3300035695 Bacteria 1457
441 Ga0373927_0483336 3300035695 Bacteria 818
442 Ga0373933_0000002 3300035724 Bacteria 151785
443 Ga0373933_0012052 3300035724 Bacteria 4774
444 Ga0373933_0046479 3300035724 Bacteria 2578
445 Ga0373933_0073712 3300035724 Bacteria 2080
446 Ga0373933_0100991 3300035724 Bacteria 1790
447 Ga0373933_0153466 3300035724 Bacteria 1459
448 Ga0373947_0000007 3300035725 Bacteria 192259
449 Ga0373947_0000631 3300035725 Bacteria 20809
450 Ga0373947_0021996 3300035725 Bacteria 3695
451 Ga0373947_0137456 3300035725 Bacteria 1565
452 Ga0373947_0333284 3300035725 Bacteria 1016
453 Ga0373937_0000014 3300036401 Bacteria 151785
454 Ga0373937_0003979 3300036401 Bacteria 12502
455 Ga0373937_0023082 3300036401 Bacteria 5598
456 Ga0373937_0082916 3300036401 Bacteria 2966
457 Ga0373937_0100751 3300036401 Bacteria 2680
458 Ga0373937_0116213 3300036401 Bacteria 2491
459 Ga0373937_0139157 3300036401 Bacteria 2270
460 Ga0373937_0147637 3300036401 Bacteria 2202
461 Ga0373937_0457909 3300036401 Bacteria 1211
462 Ga0373937_0668570 3300036401 Bacteria 984
463 Ga0373937_0818233 3300036401 Bacteria 879
464 Ga0316582_0543542 3300036647 Bacteria 800
465 Ga0316584_0277669 3300036712 Bacteria 1218
466 Ga0373925_0002113 3300037068 Bacteria 16308
467 Ga0373925_0004222 3300037068 Bacteria 10907
468 Ga0373925_0015186 3300037068 Bacteria 5567
469 Ga0373925_0021959 3300037068 Bacteria 4652
470 Ga0436364_0735026 3300037853 Bacteria 6279
471 Ga0436364_0914140 3300037853 Bacteria 18948
472 Ga0436360_1165953 3300039438 Bacteria 2381
473 Ga0436361_0058011 3300039447 Bacteria 718
474 Ga0436363_0094543 3300039450 Bacteria 1053
475 Ga0436363_0198794 3300039450 Bacteria 1531
476 Ga0436363_1712497 3300039450 Bacteria 1526
477 Ga0436362_0562836 3300039453 Bacteria 1507
478 Ga0436362_0951630 3300039453 Bacteria 5013
479 Ga0436362_1061215 3300039453 Bacteria 4679
480 Ga0439438_036712 3300041405 Bacteria 1284
481 Ga0439447_060972 3300041407 Bacteria 887
482 Ga0451853_0314525 3300041512 Bacteria 4190
483 Ga0439431_0013818 3300041997 Bacteria 1865
484 Ga0439446_0027658 3300042156 Bacteria 1628
485 Ga0466965_0016093 3300044683 Bacteria 3554
486 Ga0466965_0097229 3300044683 Bacteria 1503
487 Ga0466966_0078499 3300044684 Bacteria 2058
488 Ga0466961_0024031 3300044693 Bacteria 3921
489 Ga0466961_0072354 3300044693 Bacteria 2187
490 Ga0466961_0101793 3300044693 Bacteria 1809
491 Ga0466963_0026729 3300044694 Bacteria 3693
492 Ga0466964_0012828 3300044706 Bacteria 3174
493 Ga0466971_0028679 3300044719 Bacteria 2489
494 Ga0466971_0082617 3300044719 Bacteria 1466
495 Ga0466970_0024199 3300044765 Bacteria 3175
496 Ga0466970_0029227 3300044765 Bacteria 2901
497 Ga0466970_0116116 3300044765 Bacteria 1464
498 Ga0466957_0016152 3300044842 Bacteria 4364
499 Ga0466960_0033457 3300044901 Bacteria 2389
500 Ga0466960_0100214 3300044901 Bacteria 1491
501 Ga0466960_0105888 3300044901 Bacteria 1454
502 Ga0466959_0108272 3300045049 Bacteria 1985
503 Ga0466959_0147955 3300045049 Bacteria 1657
504 Ga0466958_0010458 3300045836 Bacteria 5198
505 Ga0466958_0380035 3300045836 Bacteria 911
506 Ga0466967_0005049 3300045976 Bacteria 9047
507 Ga0466967_0586912 3300045976 Bacteria 1099
508 Ga0466967_0708812 3300045976 Bacteria 997
509 Ga0495592_0000133 3300046454 Bacteria 66075
510 Ga0495592_0011180 3300046454 Bacteria 6780
511 Ga0495592_0018646 3300046454 Bacteria 5281
512 Ga0495592_0091562 3300046454 Bacteria 2180
513 Ga0495592_0095463 3300046454 Bacteria 2127
514 Ga0495592_0100167 3300046454 Bacteria 2066
515 Ga0495603_0007688 3300046455 Bacteria 6493
516 Ga0495603_0088065 3300046455 Bacteria 1817
517 Ga0495603_0181329 3300046455 Bacteria 1218
518 Ga0495629_0002868 3300046459 Bacteria 13174
519 Ga0495629_0028696 3300046459 Bacteria 3949
520 Ga0495629_0034052 3300046459 Bacteria 3601
521 Ga0495629_0047594 3300046459 Bacteria 3008
522 Ga0495629_0253780 3300046459 Bacteria 1210
523 Ga0495629_0315659 3300046459 Bacteria 1069
524 Ga0495641_0012372 3300046461 Bacteria 4778
525 Ga0495641_0016724 3300046461 Bacteria 3853
526 Ga0495641_0073790 3300046461 Bacteria 1530
527 Ga0495641_0309201 3300046461 Unclassified 713
528 Ga0495651_0000470 3300046462 Bacteria 30998
529 Ga0495651_0001347 3300046462 Bacteria 19012
530 Ga0495651_0012416 3300046462 Bacteria 6568
531 Ga0495651_0018081 3300046462 Bacteria 5457
532 Ga0495651_0020335 3300046462 Bacteria 5152
533 Ga0495651_0045457 3300046462 Bacteria 3401
534 Ga0495651_0073204 3300046462 Bacteria 2601
535 Ga0495653_0021798 3300046463 Bacteria 5186
536 Ga0495653_0022407 3300046463 Bacteria 5112
537 Ga0495653_0028427 3300046463 Bacteria 4469
538 Ga0495653_0031442 3300046463 Bacteria 4219
539 Ga0495653_0046286 3300046463 Bacteria 3369
540 Ga0495653_0068420 3300046463 Bacteria 2663
541 Ga0495653_0120145 3300046463 Bacteria 1874
542 Ga0495653_0162076 3300046463 Bacteria 1551
543 Ga0495580_0011155 3300046472 Bacteria 6961
544 Ga0495580_0072122 3300046472 Bacteria 2412
545 Ga0495580_0284629 3300046472 Bacteria 1127
546 Ga0495582_0000564 3300046473 Bacteria 20477
547 Ga0495582_0014717 3300046473 Bacteria 4299
548 Ga0495582_0080952 3300046473 Bacteria 1803
549 Ga0495639_0000320 3300046475 Bacteria 23322
550 Ga0495639_0012003 3300046475 Bacteria 3736
551 Ga0495639_0060948 3300046475 Bacteria 1729
552 Ga0495662_0002566 3300046476 Bacteria 9168
553 Ga0495662_0004176 3300046476 Bacteria 7275
554 Ga0495662_0006002 3300046476 Bacteria 6075
555 Ga0495662_0035173 3300046476 Bacteria 2417
556 Ga0495664_0000448 3300046477 Bacteria 20228
557 Ga0495664_0008540 3300046477 Bacteria 5710
558 Ga0495664_0032453 3300046477 Bacteria 3064
559 Ga0495664_0084001 3300046477 Bacteria 1910
560 Ga0495664_0102439 3300046477 Bacteria 1725
561 Ga0495664_0269277 3300046477 Bacteria 1029
562 Ga0495664_0273126 3300046477 Bacteria 1021
563 Ga0495608_0000028 3300046511 Bacteria 151829
564 Ga0495608_0005511 3300046511 Bacteria 9037
565 Ga0495608_0018095 3300046511 Bacteria 4867
566 Ga0495608_0024564 3300046511 Bacteria 4119
567 Ga0495608_0029548 3300046511 Bacteria 3716
568 Ga0495608_0056210 3300046511 Bacteria 2599
569 Ga0495608_0083484 3300046511 Bacteria 2074
570 Ga0495608_0083910 3300046511 Bacteria 2068
571 Ga0495608_0207861 3300046511 Bacteria 1231
572 Ga0495618_0018754 3300046514 Bacteria 4250
573 Ga0495618_0061533 3300046514 Bacteria 2382
574 Ga0495618_0104710 3300046514 Bacteria 1812
575 Ga0495618_0270399 3300046514 Bacteria 1062
576 Ga0495618_0306229 3300046514 Bacteria 986
577 Ga0495628_0000371 3300046516 Bacteria 41228
578 Ga0495628_0009484 3300046516 Bacteria 8308
579 Ga0495628_0071155 3300046516 Bacteria 2711
580 Ga0495628_0083266 3300046516 Bacteria 2484
581 Ga0495628_0100045 3300046516 Bacteria 2238
582 Ga0495628_0104685 3300046516 Bacteria 2180
583 Ga0495628_0128986 3300046516 Bacteria 1935
584 Ga0495628_0159230 3300046516 Bacteria 1716
585 Ga0495628_0170652 3300046516 Bacteria 1649
586 Ga0495628_0171807 3300046516 Bacteria 1643
587 Ga0495628_0198464 3300046516 Bacteria 1512
588 Ga0495628_0216447 3300046516 Bacteria 1440
589 Ga0495628_0264617 3300046516 Bacteria 1280
590 Ga0495630_0039791 3300046517 Bacteria 3514
591 Ga0495630_0081973 3300046517 Bacteria 2434
592 Ga0495630_0092051 3300046517 Bacteria 2291
593 Ga0495630_0116237 3300046517 Bacteria 2027
594 Ga0495630_0123366 3300046517 Bacteria 1966
595 Ga0495630_0155421 3300046517 Bacteria 1741
596 Ga0495630_0284589 3300046517 Bacteria 1263
597 Ga0495630_0567314 3300046517 Bacteria 870
598 Ga0495666_0001809 3300046526 Bacteria 10565
599 Ga0495666_0021044 3300046526 Bacteria 3229
600 Ga0495666_0039596 3300046526 Bacteria 2288
601 Ga0495666_0055293 3300046526 Bacteria 1902
602 Ga0495652_0000031 3300046529 Bacteria 151765
603 Ga0495652_0006866 3300046529 Bacteria 10536
604 Ga0495652_0063281 3300046529 Bacteria 3115
605 Ga0495652_0077351 3300046529 Bacteria 2758
606 Ga0495652_0081177 3300046529 Bacteria 2675
607 Ga0495652_0118260 3300046529 Bacteria 2118
608 Ga0495652_0121714 3300046529 Bacteria 2079
609 Ga0495652_0132782 3300046529 Bacteria 1968
610 Ga0495665_0000756 3300046531 Bacteria 16765
611 Ga0495665_0016699 3300046531 Bacteria 3954
612 Ga0495665_0025410 3300046531 Bacteria 3181
613 Ga0495665_0062049 3300046531 Bacteria 1973
614 Ga0495640_0007267 3300046533 Bacteria 8726
615 Ga0495640_0032524 3300046533 Bacteria 3714
616 Ga0495640_0033050 3300046533 Bacteria 3679
617 Ga0495640_0033878 3300046533 Bacteria 3627
618 Ga0495640_0061722 3300046533 Bacteria 2545
619 Ga0495640_0076132 3300046533 Bacteria 2239
620 Ga0495640_0143060 3300046533 Bacteria 1541
621 Ga0495640_0358298 3300046533 Bacteria 899
622 Ga0495586_0002211 3300046535 Bacteria 10567
623 Ga0495586_0265090 3300046535 Bacteria 981
624 Ga0495587_0000023 3300046536 Bacteria 151763
625 Ga0495587_0005276 3300046536 Bacteria 8446
626 Ga0495587_0018386 3300046536 Bacteria 4336
627 Ga0495587_0025920 3300046536 Bacteria 3578
628 Ga0495587_0144175 3300046536 Bacteria 1358
629 Ga0495645_0028213 3300046543 Bacteria 4078
630 Ga0495645_0206569 3300046543 Bacteria 1328
631 Ga0495667_0000054 3300046559 Bacteria 105009
632 Ga0495667_0004964 3300046559 Bacteria 8999
633 Ga0495667_0015283 3300046559 Bacteria 5184
634 Ga0495667_0021989 3300046559 Bacteria 4300
635 Ga0495667_0022231 3300046559 Bacteria 4274
636 Ga0495667_0042258 3300046559 Bacteria 3022
637 Ga0495667_0054602 3300046559 Bacteria 2628
638 Ga0495667_0194090 3300046559 Bacteria 1300
639 Ga0495667_0271471 3300046559 Bacteria 1077
640 Ga0495656_0084799 3300046615 Bacteria 1438
641 Ga0495634_0026344 3300046642 Bacteria 4058
642 Ga0495634_0073890 3300046642 Bacteria 2241
643 Ga0495634_0195835 3300046642 Bacteria 1257
644 Ga0495634_0295734 3300046642 Bacteria 980
645 Ga0495634_0311030 3300046642 Bacteria 950
646 Ga0495635_0001747 3300046663 Bacteria 14637
647 Ga0495635_0007937 3300046663 Bacteria 7415
648 Ga0495635_0027968 3300046663 Bacteria 3920
649 Ga0495635_0034608 3300046663 Bacteria 3504
650 Ga0495635_0112018 3300046663 Bacteria 1864
651 Ga0495635_0275647 3300046663 Bacteria 1130
652 Ga0495657_0000022 3300046675 Bacteria 151837
653 Ga0495657_0002646 3300046675 Bacteria 14974
654 Ga0495657_0017242 3300046675 Bacteria 5246
655 Ga0495657_0019711 3300046675 Bacteria 4862
656 Ga0495657_0032342 3300046675 Bacteria 3650
657 Ga0495657_0037823 3300046675 Bacteria 3324
658 Ga0495599_0000236 3300046678 Bacteria 34674
659 Ga0495599_0021152 3300046678 Bacteria 4057
660 Ga0495599_0033930 3300046678 Bacteria 3207
661 Ga0495599_0058238 3300046678 Bacteria 2417
662 Ga0495599_0086958 3300046678 Bacteria 1951
663 Ga0495599_0093224 3300046678 Bacteria 1879
664 Ga0495599_0135255 3300046678 Bacteria 1530
665 Ga0495623_0001803 3300046679 Bacteria 14395
666 Ga0495623_0024139 3300046679 Bacteria 3922
667 Ga0495623_0027986 3300046679 Bacteria 3629
668 Ga0495623_0041308 3300046679 Bacteria 2942
669 Ga0495623_0207738 3300046679 Bacteria 1122
670 Ga0495646_0005340 3300046680 Bacteria 8111
671 Ga0495646_0010149 3300046680 Bacteria 5988
672 Ga0495646_0014616 3300046680 Bacteria 4989
673 Ga0495646_0118768 3300046680 Bacteria 1498
674 Ga0495647_0004740 3300046681 Bacteria 4436
675 Ga0495647_0021880 3300046681 Bacteria 2307
676 Ga0495658_0009682 3300046683 Bacteria 4806
677 Ga0495658_0022731 3300046683 Bacteria 3320
678 Ga0495658_0040437 3300046683 Bacteria 2592
679 Ga0495613_0011190 3300046689 Bacteria 6664
680 Ga0495613_0026219 3300046689 Bacteria 4342
681 Ga0495613_0066560 3300046689 Bacteria 2631
682 Ga0495613_0237503 3300046689 Bacteria 1275
683 Ga0495613_0438784 3300046689 Bacteria 886
684 Ga0495624_0001756 3300046690 Bacteria 16592
685 Ga0495624_0001919 3300046690 Bacteria 15831
686 Ga0495624_0013711 3300046690 Bacteria 5519
687 Ga0495624_0090949 3300046690 Bacteria 1883
688 Ga0495600_0004257 3300046809 Bacteria 8546
689 Ga0495600_0008322 3300046809 Bacteria 6368
690 Ga0495600_0010830 3300046809 Bacteria 5670
691 Ga0495600_0022765 3300046809 Bacteria 4026
692 Ga0495600_0031230 3300046809 Bacteria 3450
693 Ga0495600_0049556 3300046809 Bacteria 2740
694 Ga0495600_0074472 3300046809 Bacteria 2217
695 Ga0495600_0108367 3300046809 Bacteria 1809
696 Ga0495600_0241530 3300046809 Bacteria 1151
697 Ga0495581_0001057 3300047315 Bacteria 14925
698 Ga0495581_0012081 3300047315 Bacteria 4996
699 Ga0495581_0049758 3300047315 Bacteria 2420
700 Ga0495604_0000022 3300047317 Bacteria 151744
701 Ga0495604_0001853 3300047317 Bacteria 17235
702 Ga0495604_0017016 3300047317 Bacteria 5815
703 Ga0495604_0018581 3300047317 Bacteria 5568
704 Ga0495604_0074648 3300047317 Bacteria 2555
705 Ga0495604_0153676 3300047317 Bacteria 1632
706 Ga0495604_0178897 3300047317 Bacteria 1485
707 Ga0495604_0188536 3300047317 Bacteria 1438
708 Ga0495604_0250625 3300047317 Bacteria 1207
709 Ga0495674_0003145 3300047319 Bacteria 16037
710 Ga0495674_0007792 3300047319 Bacteria 10224
711 Ga0495674_0042408 3300047319 Bacteria 4058
712 Ga0495674_0051880 3300047319 Bacteria 3613
713 Ga0495674_0053849 3300047319 Bacteria 3535
714 Ga0495674_0072201 3300047319 Bacteria 2977
715 Ga0495676_0003179 3300047321 Bacteria 14842
716 Ga0495676_0127487 3300047321 Bacteria 1842
717 Ga0495680_0000271 3300047322 Bacteria 57595
718 Ga0495680_0006193 3300047322 Bacteria 11151
719 Ga0495680_0007684 3300047322 Bacteria 9841
720 Ga0495680_0044719 3300047322 Bacteria 3500
721 Ga0495680_0050667 3300047322 Bacteria 3245
722 Ga0495680_0052558 3300047322 Bacteria 3175
723 Ga0495680_0093708 3300047322 Bacteria 2247
724 Ga0495680_0109534 3300047322 Bacteria 2048
725 Ga0495680_0195976 3300047322 Bacteria 1451
726 Ga0495680_0215007 3300047322 Bacteria 1374
727 Ga0495675_0002876 3300047444 Bacteria 10327
728 Ga0495675_0017842 3300047444 Bacteria 4500
729 Ga0495675_0026629 3300047444 Bacteria 3688
730 Ga0495675_0036613 3300047444 Bacteria 3128
731 Ga0495675_0053260 3300047444 Bacteria 2569
732 Ga0495675_0059915 3300047444 Bacteria 2413
733 Ga0495675_0063539 3300047444 Bacteria 2335
734 Ga0495675_0235896 3300047444 Bacteria 1102
735 Ga0495675_0253348 3300047444 Bacteria 1056
736 Ga0495684_0002493 3300047471 Bacteria 14670
737 Ga0495684_0015783 3300047471 Bacteria 5812
738 Ga0495684_0023986 3300047471 Bacteria 4692
739 Ga0495684_0147408 3300047471 Bacteria 1761
740 Ga0495684_0154016 3300047471 Bacteria 1717
741 Ga0495684_0173246 3300047471 Bacteria 1603
742 Ga0495684_0293427 3300047471 Bacteria 1170
743 Ga0495593_0001295 3300047673 Bacteria 14668
744 Ga0495593_0026522 3300047673 Bacteria 3198
745 Ga0495593_0033280 3300047673 Bacteria 2807
746 Ga0495593_0061503 3300047673 Bacteria 1964
747 Ga0495602_0000390 3300048088 Bacteria 41015
748 Ga0495602_0005560 3300048088 Bacteria 13223
749 Ga0495602_0040901 3300048088 Bacteria 4240
750 Ga0495602_0045188 3300048088 Bacteria 3987
751 Ga0495602_0045765 3300048088 Bacteria 3957
752 Ga0495602_0132266 3300048088 Bacteria 1987
753 Ga0495602_0297071 3300048088 Bacteria 1183
754 Ga0495602_0350753 3300048088 Bacteria 1065
755 Ga0495614_0158368 3300048089 Bacteria 1012
756 Ga0496100_0058723 3300048903 Bacteria 2526
757 Ga0496100_0161424 3300048903 Bacteria 1607
758 Ga0496101_0291735 3300048904 Bacteria 1276
759 Ga0496101_0316119 3300048904 Bacteria 1225
760 Ga0496102_0071268 3300048905 Bacteria 3191
761 Ga0496102_0115326 3300048905 Bacteria 2506
762 Ga0496102_0165043 3300048905 Bacteria 2084
763 Ga0496102_0288707 3300048905 Bacteria 1546
764 Ga0496102_0610907 3300048905 Bacteria 1013
765 Ga0496103_0052153 3300048906 Bacteria 2533
766 Ga0496103_0073907 3300048906 Bacteria 2136
767 Ga0496104_0005347 3300048907 Bacteria 11236
768 Ga0496104_0063047 3300048907 Bacteria 3515
769 Ga0496104_0074849 3300048907 Bacteria 3223
770 Ga0496104_0109580 3300048907 Bacteria 2646
771 Ga0496104_0113883 3300048907 Bacteria 2593
772 Ga0496104_0508933 3300048907 Bacteria 1115
773 Ga0496105_0000120 3300048908 Bacteria 53984
774 Ga0496105_0001446 3300048908 Bacteria 16716
775 Ga0496105_0032956 3300048908 Bacteria 4253
776 Ga0496105_0050079 3300048908 Bacteria 3450
777 Ga0496105_0081889 3300048908 Bacteria 2666
778 Ga0496105_0112057 3300048908 Bacteria 2251
779 Ga0496105_0238822 3300048908 Bacteria 1475
780 Ga0496106_0014173 3300048909 Bacteria 5888
781 Ga0496106_0050724 3300048909 Bacteria 3127
782 Ga0496107_0012223 3300048910 Bacteria 5990
783 Ga0496107_0059096 3300048910 Bacteria 2774
784 Ga0496107_0061382 3300048910 Bacteria 2721
785 Ga0496107_0149131 3300048910 Bacteria 1730
786 Ga0496108_0003930 3300048911 Bacteria 11933
787 Ga0496108_0013769 3300048911 Bacteria 6598
788 Ga0496108_0099415 3300048911 Bacteria 2480
789 Ga0496108_0201341 3300048911 Bacteria 1728
790 Ga0496108_0201397 3300048911 Bacteria 1728
791 Ga0496108_0354668 3300048911 Bacteria 1280
792 Ga0496109_0050712 3300048912 Bacteria 3779
793 Ga0496109_0066117 3300048912 Bacteria 3310
794 Ga0496109_0078784 3300048912 Bacteria 3034
795 Ga0496109_0105266 3300048912 Bacteria 2620
796 Ga0496109_0110142 3300048912 Bacteria 2560
797 Ga0496109_0116456 3300048912 Bacteria 2487
798 Ga0496109_0214334 3300048912 Bacteria 1811
799 Ga0496109_0306374 3300048912 Bacteria 1498
800 Ga0496110_0052690 3300048913 Bacteria 3576
801 Ga0496110_0248671 3300048913 Bacteria 1618
802 Ga0496110_0401932 3300048913 Bacteria 1249
803 Ga0496110_0448696 3300048913 Bacteria 1175
804 Ga0496110_0666359 3300048913 Bacteria 941
805 Ga0496111_0057011 3300048914 Bacteria 2828
806 Ga0496111_0059336 3300048914 Bacteria 2772
807 Ga0496111_0318746 3300048914 Bacteria 1151
808 Ga0496112_0019980 3300048915 Bacteria 6339
809 Ga0496112_0100925 3300048915 Bacteria 2855
810 Ga0496112_0110877 3300048915 Bacteria 2714
811 Ga0496112_0734130 3300048915 Bacteria 914
812 Ga0496112_1109155 3300048915 Bacteria 709
813 Ga0496113_0018578 3300048916 Bacteria 4844
814 Ga0496113_0060279 3300048916 Bacteria 2860
815 Ga0496113_0133702 3300048916 Bacteria 1948
816 Ga0496114_0029335 3300048917 Bacteria 4520
817 Ga0496114_0140488 3300048917 Bacteria 2090
818 Ga0496114_0232865 3300048917 Bacteria 1619
819 Ga0496114_0561245 3300048917 Bacteria 1008
820 Ga0496115_0024636 3300048918 Bacteria 4680
821 Ga0496115_0057015 3300048918 Bacteria 3141
822 Ga0496115_0251032 3300048918 Bacteria 1456
823 Ga0496115_0253264 3300048918 Bacteria 1449
824 Ga0496115_0293654 3300048918 Bacteria 1333
825 Ga0496126_0015540 3300048929 Bacteria 7649
826 Ga0501318_006305 3300049534 Bacteria 1208
827 Ga0501032_0004992 3300049569 Bacteria 9922
828 Ga0501033_0011495 3300049570 Bacteria 6776
829 Ga0501033_0064498 3300049570 Bacteria 2696
830 Ga0501034_0026588 3300049571 Bacteria 5892
831 Ga0501034_0046611 3300049571 Bacteria 4379
832 Ga0501034_0101105 3300049571 Bacteria 2877
833 Ga0501034_0488103 3300049571 Bacteria 1146
834 Ga0501036_0001691 3300049572 Bacteria 17131
835 Ga0501036_0234518 3300049572 Bacteria 1539
836 Ga0501037_0004582 3300049573 Bacteria 10045
837 Ga0501037_0060222 3300049573 Bacteria 2769
838 Ga0501037_0170740 3300049573 Bacteria 1546
839 Ga0501038_0006532 3300049574 Bacteria 10786
840 Ga0501038_0063465 3300049574 Bacteria 3152
841 Ga0501038_0227512 3300049574 Bacteria 1486
842 Ga0501039_0007936 3300049575 Bacteria 8085
843 Ga0501040_0043993 3300049576 Bacteria 3044
844 Ga0501041_0044080 3300049577 Bacteria 2712
845 Ga0501042_0021677 3300049578 Bacteria 4481
846 Ga0501042_0053726 3300049578 Bacteria 2874
847 Ga0501042_0058647 3300049578 Bacteria 2748
848 Ga0501042_0175898 3300049578 Bacteria 1544
849 Ga0501043_0011613 3300049579 Bacteria 6894
850 Ga0501043_0120385 3300049579 Bacteria 2058
851 Ga0501043_0128504 3300049579 Bacteria 1986
852 Ga0501046_0007199 3300049580 Bacteria 9781
853 Ga0501046_0008028 3300049580 Bacteria 9225
854 Ga0501047_0012050 3300049581 Bacteria 8182
855 Ga0501047_0211162 3300049581 Bacteria 1799
856 Ga0501048_0007791 3300049582 Bacteria 8120
857 Ga0501048_0041177 3300049582 Bacteria 3310
858 Ga0501067_0002053 3300049583 Bacteria 11111
859 Ga0501068_0062779 3300049584 Bacteria 2259
860 Ga0501068_0081858 3300049584 Bacteria 1982
861 Ga0501069_0050892 3300049585 Bacteria 2304
862 Ga0501069_0101767 3300049585 Bacteria 1631
863 Ga0501070_0003699 3300049586 Bacteria 13215
864 Ga0501070_0006215 3300049586 Bacteria 10167
865 Ga0501070_0359151 3300049586 Bacteria 1182
866 Ga0501071_0010142 3300049587 Bacteria 6304
867 Ga0501073_0012664 3300049589 Bacteria 6151
868 Ga0501073_0041947 3300049589 Bacteria 3231
869 Ga0501074_0000839 3300049590 Bacteria 19548
870 Ga0501076_0068482 3300049592 Bacteria 2835
871 Ga0501076_0089718 3300049592 Bacteria 2472
872 Ga0501077_0002353 3300049593 Bacteria 11388
873 Ga0501209_037301 3300049656 Bacteria 1268
874 Ga0501079_0056339 3300049741 Bacteria 3033
875 Ga0501079_0065564 3300049741 Bacteria 2802
876 Ga0501080_0006490 3300049742 Bacteria 10503
877 Ga0501081_0191365 3300049743 Bacteria 1482
878 Ga0501083_0027628 3300049744 Bacteria 3914
879 Ga0501035_0028393 3300049822 Bacteria 5107
880 Ga0501035_0446334 3300049822 Bacteria 1071
881 Ga0501044_0021785 3300049823 Bacteria 6834
882 Ga0501044_0038130 3300049823 Bacteria 5019
883 Ga0501044_0057823 3300049823 Bacteria 3978
884 Ga0501044_0323078 3300049823 Bacteria 1467
885 Ga0501044_0574624 3300049823 Bacteria 1022
886 Ga0501045_0351914 3300049824 Bacteria 1096
887 nmdc:mga03n38_10458_c1 3300050490 Bacteria 3414
888 nmdc:mga0yw44_33714_c1 3300050492 Bacteria 2994
889 nmdc:mga05p37_260330_c1 3300050507 Bacteria 2076
890 nmdc:mga05p37_268844_c1 3300050507 Bacteria 2038
891 nmdc:mga05p37_31168_c1 3300050507 Bacteria 6513
892 nmdc:mga05p37_35256_c1 3300050507 Bacteria 6133
893 nmdc:mga05p37_747895_c1 3300050507 Bacteria 1078
894 nmdc:mga05p37_935669_c1 3300050507 Bacteria 930
895 nmdc:mga09592_117507_c1 3300050508 Bacteria 2282
896 nmdc:mga09592_12387_c1 3300050508 Bacteria 6946
897 nmdc:mga09592_6580_c1 3300050508 Bacteria 9463
898 nmdc:mga0qj67_314243_c1 3300050509 Bacteria 1269
899 nmdc:mga0qj67_59393_c1 3300050509 Bacteria 3032
900 nmdc:mga0qj67_87402_c1 3300050509 Bacteria 2502
901 nmdc:mga06r32_15774_c1 3300050510 Bacteria 6868
902 nmdc:mga06r32_29633_c1 3300050510 Bacteria 5132
903 nmdc:mga06r32_863151_c1 3300050510 Bacteria 863
904 nmdc:mga08y16_206354_c1 3300050511 Bacteria 2036
905 nmdc:mga08y16_473481_c1 3300050511 Bacteria 778
906 nmdc:mga0n895_101040_c1 3300050512 Bacteria 2894
907 nmdc:mga0n895_116954_c1 3300050512 Bacteria 2685
908 nmdc:mga0n895_171467_c1 3300050512 Bacteria 2202
909 nmdc:mga0n895_28600_c1 3300050512 Bacteria 5304
910 nmdc:mga0n895_75766_c1 3300050512 Bacteria 3344
911 nmdc:mga0rr50_11746_c1 3300050513 Bacteria 5621
912 nmdc:mga0rr50_238794_c1 3300050513 Bacteria 1506
913 nmdc:mga0rr50_28281_c1 3300050513 Bacteria 3939
914 nmdc:mga0rr50_375337_c1 3300050513 Bacteria 1198
915 nmdc:mga0rr50_72921_c1 3300050513 Bacteria 2623
916 nmdc:mga08x19_220840_c1 3300050514 Bacteria 1302
917 nmdc:mga08x19_263015_c1 3300050514 Bacteria 1193
918 nmdc:mga08x19_37258_c1 3300050514 Bacteria 3086
919 nmdc:mga08x19_57784_c1 3300050514 Bacteria 2508
920 nmdc:mga0a205_193307_c1 3300050515 Bacteria 1926
921 nmdc:mga0a205_40338_c1 3300050515 Bacteria 4494
922 nmdc:mga0a205_5351_c1 3300050515 Bacteria 10049
923 Ga0495601_0035492 3300053077 Bacteria 3113
924 Ga0495601_0072009 3300053077 Bacteria 2207
925 Ga0495601_0183868 3300053077 Bacteria 1366
926 Ga0495601_0224367 3300053077 Bacteria 1227
927 Ga0495601_0251480 3300053077 Bacteria 1154
928 Ga0495601_0410142 3300053077 Bacteria 878
929 Ga0495612_0009026 3300053078 Bacteria 4044
930 Ga0495595_0011120 3300053084 Bacteria 3757
931 Ga0495595_0029393 3300053084 Bacteria 2459
932 Ga0495595_0056235 3300053084 Bacteria 1833
933 Ga0495595_0141802 3300053084 Bacteria 1179
934 Ga0495595_0143512 3300053084 Bacteria 1172
935 Ga0495619_0004343 3300053085 Bacteria 9041
936 Ga0495619_0004905 3300053085 Bacteria 8494
937 Ga0495619_0006518 3300053085 Bacteria 7388
938 Ga0495619_0012772 3300053085 Bacteria 5287
939 Ga0495619_0017109 3300053085 Bacteria 4594
940 Ga0495619_0198079 3300053085 Bacteria 1390
941 Ga0495619_0333996 3300053085 Bacteria 1049
942 Ga0495619_0342402 3300053085 Bacteria 1035
943 Ga0500616_0001211 3300053153 Bacteria 26057
944 Ga0501084_0000044 3300054114 Bacteria 97657
945 Ga0501084_0011106 3300054114 Bacteria 7459
946 Ga0501084_0104758 3300054114 Bacteria 2375
947 Ga0501084_0419470 3300054114 Bacteria 1131
948 Ga0501082_0007063 3300060353 Bacteria 9688
949 Ga0501082_0943635 3300060353 Unclassified 754
950 Ga0466962_0006441 3300061719 Bacteria 5634
951 Ga0466962_0089850 3300061719 Bacteria 1471
952 Ga0530510_0009732 3300061734 Bacteria 6745
953 Ga0530510_0538320 3300061734 Bacteria 886
954 2644229354 2643221641 Bacteria 4490190
955 2645721831 2643221961 Bacteria 3919167
956 2676489071 2675903060 Bacteria 10051191
957 2689996318 2687453743 Bacteria 8361025
958 2884702679 2884693830 Bacteria 11273186
959 2895436407 2895427314 Bacteria 13147766
960 2895452179 2895442618 Bacteria 11027144
961 2984580261 2984576629 Bacteria 4248407
962 2990259111 2990256926 Bacteria 4252839
963 8055069263 8055066027 Bacteria 9479577
964 8055172973 8055172936 Bacteria 9305943
965 Ga0075433_10070424
966 MBSR1b_contig_4503056
967 LJQas_1002216
968 LJQas_1005280
969 JGI25404J52841_10007904
970 Ga0070658_10062310
971 Ga0070683_100292681
972 Ga0070690_100221277
973 Ga0070682_100044302
974 Ga0068868_100200272
975 Ga0068868_100248708
976 Ga0070660_100324824
977 Ga0070689_100205556
978 Ga0070661_100034192
979 Ga0070692_10054061
980 Ga0070668_100145070
981 Ga0070669_100085306
982 Ga0070669_100164889
983 Ga0070675_100110283
984 Ga0070675_100294337
985 Ga0070671_100225384
986 Ga0070671_100449315
987 Ga0070671_100498713
988 Ga0070674_100351482
989 Ga0070673_100188377
990 Ga0070659_100080447
991 Ga0070709_10000293
992 Ga0070709_10080490
993 Ga0070709_10179554
994 Ga0070709_10266136
995 Ga0070714_100013140
996 Ga0070714_100017411
997 Ga0070714_100055138
998 Ga0070714_100660553
999 Ga0070713_100021561
1000 Ga0070713_100031308
1001 Ga0070713_100050178
1002 Ga0070713_100412669
1003 Ga0070710_10003256
1004 Ga0070710_10063550
1005 Ga0070710_10086358
1006 Ga0070711_100006437
1007 Ga0070711_100015362
1008 Ga0070711_100183901
1009 Ga0070700_100067335
1010 Ga0070694_100276674
1011 Ga0070708_100002499
1012 Ga0070708_100007308
1013 Ga0070708_100008434
1014 Ga0070708_100036014
1015 Ga0070708_100064148
1016 Ga0070708_100222667
1017 Ga0070678_100068342
1018 Ga0070681_10109484
1019 Ga0070685_10054414
1020 Ga0070706_100000821
1021 Ga0070706_100012251
1022 Ga0070706_100026028
1023 Ga0070706_100072290
1024 Ga0070706_100105320
1025 Ga0070706_100131481
1026 Ga0070706_100200810
1027 Ga0070706_100240642
1028 Ga0070706_100487897
1029 Ga0070706_100652523
1030 Ga0070707_100000127
1031 Ga0070707_100005476
1032 Ga0070707_100011395
1033 Ga0070707_100056141
1034 Ga0070707_100084429
1035 Ga0070707_100178396
1036 Ga0070707_100189646
1037 Ga0070707_100227558
1038 Ga0070707_100340617
1039 Ga0070698_100000991
1040 Ga0070698_100001111
1041 Ga0070698_100001614
1042 Ga0070698_100006941
1043 Ga0070698_100039365
1044 Ga0070698_100101309
1045 Ga0070698_100392966
1046 Ga0070699_100001261
1047 Ga0070699_100037119
1048 Ga0070699_100166608
1049 Ga0070699_100196601
1050 Ga0070679_100122886
1051 Ga0070679_100546748
1052 Ga0070679_101044614
1053 Ga0070684_100108726
1054 Ga0070684_100169923
1055 Ga0070684_100307033
1056 Ga0070697_100018646
1057 Ga0070697_100232197
1058 Ga0068853_100148960
1059 Ga0068853_100589575
1060 Ga0070672_100226477
1061 Ga0070686_100045356
1062 Ga0070686_100140224
1063 Ga0070695_100032198
1064 Ga0070696_100254839
1065 Ga0070693_100058626
1066 Ga0070693_100217594
1067 Ga0070665_100223229
1068 Ga0070665_100498795
1069 Ga0070704_100057288
1070 Ga0070704_100076553
1071 Ga0068855_100091730
1072 Ga0070664_100130112
1073 Ga0070664_100403871
1074 Ga0068856_100135864
1075 Ga0068856_100347834
1076 Ga0068852_100061594
1077 Ga0068852_100381114
1078 Ga0068859_100478543
1079 Ga0068864_100124815
1080 Ga0068864_100139546
1081 Ga0068864_100339540
1082 Ga0068861_100170483
1083 Ga0068861_100596540
1084 Ga0068870_10037551
1085 Ga0068863_100138833
1086 Ga0068858_100120268
1087 Ga0068860_100831676
1088 Ga0081540_1001333
1089 Ga0081540_1016514
1090 Ga0070717_10001020
1091 Ga0070717_10009294
1092 Ga0070717_10011549
1093 Ga0070717_10012759
1094 Ga0070717_10047815
1095 Ga0070717_10357577
1096 Ga0070717_10477366
1097 Ga0075363_100032602
1098 Ga0075363_100066133
1099 Ga0070715_10010346
1100 Ga0070715_10019130
1101 Ga0070715_10029471
1102 Ga0070715_10064352
1103 Ga0070716_100000033
1104 Ga0070716_100005591
1105 Ga0070716_100097761
1106 Ga0070716_100116560
1107 Ga0070716_100145979
1108 Ga0070716_100239739
1109 Ga0070712_100007693
1110 Ga0070712_100294010
1111 Ga0070712_100452809
1112 Ga0075367_10250915
1113 Ga0097621_100108230
1114 Ga0097621_100164273
1115 Ga0097621_100584969
1116 Ga0068871_100053084
1117 Ga0068871_100254483
1118 Ga0075428_100076214
1119 Ga0075428_100092168
1120 Ga0075428_100930327
1121 Ga0075430_100002290
1122 Ga0075430_100151889
1123 Ga0075431_100029054
1124 Ga0075431_100071846
1125 Ga0075431_100083479
1126 Ga0075431_100567217
1127 Ga0075433_10071211
1128 Ga0075434_100026313
1129 Ga0075434_100291665
1130 Ga0075429_100001611
1131 Ga0075429_100005255
1132 Ga0075429_100663565
1133 Ga0075436_100051322
1134 Ga0075436_100068691
1135 Ga0075436_100233217
1136 Ga0075436_100364468
1137 Ga0097620_100478559
1138 Ga0075435_100004822
1139 Ga0075435_100078033
1140 Ga0075435_100247692
1141 Ga0099794_10052186
1142 Ga0099795_10205588
1143 Ga0105251_10036723
1144 Ga0105250_10037039
1145 Ga0105240_10303024
1146 Ga0111539_10022313
1147 Ga0111539_10271458
1148 Ga0111539_10658800
1149 Ga0111539_10684655
1150 Ga0111539_11514946
1151 Ga0105245_10746402
1152 Ga0105247_10157558
1153 Ga0114129_10002251
1154 Ga0114129_10004683
1155 Ga0114129_10271758
1156 Ga0114129_10771310
1157 Ga0114129_11027368
1158 Ga0114129_11275324
1159 Ga0105243_10400014
1160 Ga0105243_10553506
1161 Ga0105243_10623051
1162 Ga0105243_10807812
1163 Ga0105243_11233985
1164 Ga0105248_10870744
1165 Ga0105238_10416675
1166 Ga0105249_10220934
1167 Ga0105239_10029474
1168 Ga0105246_10087057
1169 Ga0105246_10101216
1170 Ga0157344_1001969
1171 Ga0157338_1001773
1172 Ga0157373_10146731
1173 Ga0157370_10053773
1174 Ga0157369_10148649
1175 Ga0157369_10249367
1176 Ga0157369_10555681
1177 Ga0157369_10675561
1178 Ga0157374_10052816
1179 Ga0157378_10130263
1180 Ga0157372_11605052
1181 Ga0157375_10329798
1182 Ga0157375_10388596
1183 Ga0157375_11271779
1184 Ga0163163_10128939
1185 Ga0163163_10163292
1186 Ga0157380_10193693
1187 Ga0157380_10266561
1188 Ga0182008_10084040
1189 Ga0157377_10056996
1190 Ga0157379_10139694
1191 Ga0157379_10510242
1192 Ga0157376_10260982
1193 Ga0157376_11009867
1194 Ga0163161_10189921
1195 Ga0206356_10031144
1196 Ga0206354_11350309
1197 Ga0213873_10028432
1198 Ga0207692_10022881
1199 Ga0207692_10074608
1200 Ga0207692_10244671
1201 Ga0207642_10171567
1202 Ga0207688_10033053
1203 Ga0207685_10004309
1204 Ga0207699_10000215
1205 Ga0207699_10003454
1206 Ga0207699_10024246
1207 Ga0207699_10215395
1208 Ga0207643_10053128
1209 Ga0207684_10001704
1210 Ga0207684_10004662
1211 Ga0207684_10010229
1212 Ga0207684_10029960
1213 Ga0207684_10061894
1214 Ga0207684_10066482
1215 Ga0207684_10066544
1216 Ga0207684_10079683
1217 Ga0207684_10104224
1218 Ga0207684_10126755
1219 Ga0207684_10176946
1220 Ga0207684_10232891
1221 Ga0207707_10192607
1222 Ga0207707_10211329
1223 Ga0207707_10227070
1224 Ga0207707_10453441
1225 Ga0207693_10018514
1226 Ga0207693_10024549
1227 Ga0207693_10030599
1228 Ga0207693_10185606
1229 Ga0207693_10260883
1230 Ga0207663_10031674
1231 Ga0207663_10057750
1232 Ga0207662_10042542
1233 Ga0207657_10103294
1234 Ga0207649_10064837
1235 Ga0207649_10195943
1236 Ga0207646_10000264
1237 Ga0207646_10007362
1238 Ga0207646_10010104
1239 Ga0207646_10013014
1240 Ga0207646_10065507
1241 Ga0207646_10100885
1242 Ga0207646_10143808
1243 Ga0207646_10154536
1244 Ga0207646_10236417
1245 Ga0207646_10413858
1246 Ga0207650_10202093
1247 Ga0207659_10149137
1248 Ga0207687_10061398
1249 Ga0207687_10140536
1250 Ga0207687_10167063
1251 Ga0207700_10000237
1252 Ga0207700_10001853
1253 Ga0207700_10016470
1254 Ga0207700_10037335
1255 Ga0207700_10105031
1256 Ga0207700_10105775
1257 Ga0207700_10273880
1258 Ga0207700_10493850
1259 Ga0207664_10000276
1260 Ga0207664_10001948
1261 Ga0207664_10002105
1262 Ga0207664_10046981
1263 Ga0207664_10060628
1264 Ga0207664_10104128
1265 Ga0207664_10549967
1266 Ga0207690_10463986
1267 Ga0207706_10273696
1268 Ga0207709_10067553
1269 Ga0207709_10258183
1270 Ga0207670_10358109
1271 Ga0207704_10015167
1272 Ga0207665_10000079
1273 Ga0207665_10005128
1274 Ga0207665_10068352
1275 Ga0207665_10082801
1276 Ga0207665_10098394
1277 Ga0207691_10102634
1278 Ga0207689_10087196
1279 Ga0207689_10201397
1280 Ga0207661_10462431
1281 Ga0207667_10137171
1282 Ga0207712_10023288
1283 Ga0207712_10153084
1284 Ga0207712_10488781
1285 Ga0207640_10103556
1286 Ga0207640_10590255
1287 Ga0207658_10460975
1288 Ga0207677_10303872
1289 Ga0207703_10074917
1290 Ga0207678_10052664
1291 Ga0207708_10052111
1292 Ga0207702_10171277
1293 Ga0207702_10731314
1294 Ga0207676_10470729
1295 Ga0207676_10821750
1296 Ga0207674_10016544
1297 Ga0207674_10029717
1298 Ga0207675_100071147
1299 Ga0207675_100242890
1300 Ga0207683_10001961
1301 Ga0207683_10239461
1302 Ga0207698_10556498
1303 Ga0207428_10267784
1304 Ga0268266_10509921
1305 Ga0265338_10000931
1306 Ga0265338_10002733
1307 Ga0265338_10007759
1308 Ga0265760_10099131
1309 Ga0265325_10000666
1310 Ga0265331_10034269
1311 Ga0265327_10009735
1312 Ga0265327_10029452
1313 Ga0265327_10066785
1314 Ga0265327_10081088
1315 Ga0265316_10022142
1316 Ga0265313_10000421
1317 Ga0265314_10099761
1318 Ga0316576_10326660
1319 Ga0307413_10008822
1320 Ga0307407_10182180
1321 Ga0307412_10067286
1322 Ga0307409_100066270
1323 Ga0307409_100326338
1324 Ga0307409_100346976
1325 Ga0307416_100011074
1326 Ga0307416_100780410
1327 Ga0307411_10161550
1328 Ga0307415_100003889
1329 Ga0307415_100023156
1330 Ga0373930_0017303
1331 Ga0373950_0022418
1332 Ga0373958_0038218
1333 Ga0373926_0007799
1334 Ga0373926_0038875
1335 Ga0373928_0032986
1336 Ga0373929_0008257
1337 Ga0373929_0012072
1338 Ga0373934_0000147
1339 Ga0373934_0002032
1340 Ga0373934_0008979
1341 Ga0373934_0043062
1342 Ga0373934_0043712
1343 Ga0373944_0001945
1344 Ga0373944_0049699
1345 Ga0373949_0023503
1346 Ga0373923_0006138
1347 Ga0373923_0023993
1348 Ga0373923_0026639
1349 Ga0373923_0113291
1350 Ga0373932_0016797
1351 Ga0373936_0001334
1352 Ga0373936_0001833
1353 Ga0373936_0049328
1354 Ga0373939_0025030
1355 Ga0373941_0146569
1356 Ga0373945_0001276
1357 Ga0373945_0001451
1358 Ga0373953_0000058
1359 Ga0373953_0011227
1360 Ga0373953_0011364
1361 Ga0373953_0021950
1362 Ga0373953_0082699
1363 Ga0373953_0111418
1364 Ga0373954_0036587
1365 Ga0373954_0133439
1366 Ga0373956_0000532
1367 Ga0373956_0022918
1368 Ga0373956_0054261
1369 Ga0373956_0060718
1370 Ga0373956_0145723
1371 Ga0373957_0005875
1372 Ga0373957_0013383
1373 Ga0373957_0120707
1374 Ga0373960_0022395
1375 Ga0373943_0001034
1376 Ga0373943_0001717
1377 Ga0373943_0332646
1378 Ga0373946_0001997
1379 Ga0373946_0007314
1380 Ga0373946_0020811
1381 Ga0373946_0033724
1382 Ga0373946_0044196
1383 Ga0373955_0001363
1384 Ga0373955_0003228
1385 Ga0373955_0007678
1386 Ga0373955_0018334
1387 Ga0373955_0071122
1388 Ga0373961_0014919
1389 Ga0316574_0095529
1390 Ga0316574_0166129
1391 Ga0373924_0000537
1392 Ga0373924_0001574
1393 Ga0373924_0004757
1394 Ga0373924_0032163
1395 Ga0373924_0042310
1396 Ga0373924_0107855
1397 Ga0373931_0059827
1398 Ga0373935_0000168
1399 Ga0373935_0005165
1400 Ga0373935_0005683
1401 Ga0373935_0079030
1402 Ga0373927_0027084
1403 Ga0373927_0030375
1404 Ga0373927_0163752
1405 Ga0373927_0483336
1406 Ga0373933_0000002
1407 Ga0373933_0012052
1408 Ga0373933_0046479
1409 Ga0373933_0073712
1410 Ga0373933_0100991
1411 Ga0373933_0153466
1412 Ga0373947_0000007
1413 Ga0373947_0000631
1414 Ga0373947_0021996
1415 Ga0373947_0137456
1416 Ga0373947_0333284
1417 Ga0373937_0000014
1418 Ga0373937_0003979
1419 Ga0373937_0023082
1420 Ga0373937_0082916
1421 Ga0373937_0100751
1422 Ga0373937_0116213
1423 Ga0373937_0139157
1424 Ga0373937_0147637
1425 Ga0373937_0457909
1426 Ga0373937_0668570
1427 Ga0373937_0818233
1428 Ga0316582_0543542
1429 Ga0316584_0277669
1430 Ga0373925_0002113
1431 Ga0373925_0004222
1432 Ga0373925_0015186
1433 Ga0373925_0021959
1434 Ga0436364_0735026
1435 Ga0436364_0914140
1436 Ga0436360_1165953
1437 Ga0436361_0058011
1438 Ga0436363_0094543
1439 Ga0436363_0198794
1440 Ga0436363_1712497
1441 Ga0436362_0562836
1442 Ga0436362_0951630
1443 Ga0436362_1061215
1444 Ga0439438_036712
1445 Ga0439447_060972
1446 Ga0451853_0314525
1447 Ga0439431_0013818
1448 Ga0439446_0027658
1449 Ga0466965_0016093
1450 Ga0466965_0097229
1451 Ga0466966_0078499
1452 Ga0466961_0024031
1453 Ga0466961_0072354
1454 Ga0466961_0101793
1455 Ga0466963_0026729
1456 Ga0466964_0012828
1457 Ga0466971_0028679
1458 Ga0466971_0082617
1459 Ga0466970_0024199
1460 Ga0466970_0029227
1461 Ga0466970_0116116
1462 Ga0466957_0016152
1463 Ga0466960_0033457
1464 Ga0466960_0100214
1465 Ga0466960_0105888
1466 Ga0466959_0108272
1467 Ga0466959_0147955
1468 Ga0466958_0010458
1469 Ga0466958_0380035
1470 Ga0466967_0005049
1471 Ga0466967_0586912
1472 Ga0466967_0708812
1473 Ga0495592_0000133
1474 Ga0495592_0011180
1475 Ga0495592_0018646
1476 Ga0495592_0091562
1477 Ga0495592_0095463
1478 Ga0495592_0100167
1479 Ga0495603_0007688
1480 Ga0495603_0088065
1481 Ga0495603_0181329
1482 Ga0495629_0002868
1483 Ga0495629_0028696
1484 Ga0495629_0034052
1485 Ga0495629_0047594
1486 Ga0495629_0253780
1487 Ga0495629_0315659
1488 Ga0495641_0012372
1489 Ga0495641_0016724
1490 Ga0495641_0073790
1491 Ga0495641_0309201
1492 Ga0495651_0000470
1493 Ga0495651_0001347
1494 Ga0495651_0012416
1495 Ga0495651_0018081
1496 Ga0495651_0020335
1497 Ga0495651_0045457
1498 Ga0495651_0073204
1499 Ga0495653_0021798
1500 Ga0495653_0022407
1501 Ga0495653_0028427
1502 Ga0495653_0031442
1503 Ga0495653_0046286
1504 Ga0495653_0068420
1505 Ga0495653_0120145
1506 Ga0495653_0162076
1507 Ga0495580_0011155
1508 Ga0495580_0072122
1509 Ga0495580_0284629
1510 Ga0495582_0000564
1511 Ga0495582_0014717
1512 Ga0495582_0080952
1513 Ga0495639_0000320
1514 Ga0495639_0012003
1515 Ga0495639_0060948
1516 Ga0495662_0002566
1517 Ga0495662_0004176
1518 Ga0495662_0006002
1519 Ga0495662_0035173
1520 Ga0495664_0000448
1521 Ga0495664_0008540
1522 Ga0495664_0032453
1523 Ga0495664_0084001
1524 Ga0495664_0102439
1525 Ga0495664_0269277
1526 Ga0495664_0273126
1527 Ga0495608_0000028
1528 Ga0495608_0005511
1529 Ga0495608_0018095
1530 Ga0495608_0024564
1531 Ga0495608_0029548
1532 Ga0495608_0056210
1533 Ga0495608_0083484
1534 Ga0495608_0083910
1535 Ga0495608_0207861
1536 Ga0495618_0018754
1537 Ga0495618_0061533
1538 Ga0495618_0104710
1539 Ga0495618_0270399
1540 Ga0495618_0306229
1541 Ga0495628_0000371
1542 Ga0495628_0009484
1543 Ga0495628_0071155
1544 Ga0495628_0083266
1545 Ga0495628_0100045
1546 Ga0495628_0104685
1547 Ga0495628_0128986
1548 Ga0495628_0159230
1549 Ga0495628_0170652
1550 Ga0495628_0171807
1551 Ga0495628_0198464
1552 Ga0495628_0216447
1553 Ga0495628_0264617
1554 Ga0495630_0039791
1555 Ga0495630_0081973
1556 Ga0495630_0092051
1557 Ga0495630_0116237
1558 Ga0495630_0123366
1559 Ga0495630_0155421
1560 Ga0495630_0284589
1561 Ga0495630_0567314
1562 Ga0495666_0001809
1563 Ga0495666_0021044
1564 Ga0495666_0039596
1565 Ga0495666_0055293
1566 Ga0495652_0000031
1567 Ga0495652_0006866
1568 Ga0495652_0063281
1569 Ga0495652_0077351
1570 Ga0495652_0081177
1571 Ga0495652_0118260
1572 Ga0495652_0121714
1573 Ga0495652_0132782
1574 Ga0495665_0000756
1575 Ga0495665_0016699
1576 Ga0495665_0025410
1577 Ga0495665_0062049
1578 Ga0495640_0007267
1579 Ga0495640_0032524
1580 Ga0495640_0033050
1581 Ga0495640_0033878
1582 Ga0495640_0061722
1583 Ga0495640_0076132
1584 Ga0495640_0143060
1585 Ga0495640_0358298
1586 Ga0495586_0002211
1587 Ga0495586_0265090
1588 Ga0495587_0000023
1589 Ga0495587_0005276
1590 Ga0495587_0018386
1591 Ga0495587_0025920
1592 Ga0495587_0144175
1593 Ga0495645_0028213
1594 Ga0495645_0206569
1595 Ga0495667_0000054
1596 Ga0495667_0004964
1597 Ga0495667_0015283
1598 Ga0495667_0021989
1599 Ga0495667_0022231
1600 Ga0495667_0042258
1601 Ga0495667_0054602
1602 Ga0495667_0194090
1603 Ga0495667_0271471
1604 Ga0495656_0084799
1605 Ga0495634_0026344
1606 Ga0495634_0073890
1607 Ga0495634_0195835
1608 Ga0495634_0295734
1609 Ga0495634_0311030
1610 Ga0495635_0001747
1611 Ga0495635_0007937
1612 Ga0495635_0027968
1613 Ga0495635_0034608
1614 Ga0495635_0112018
1615 Ga0495635_0275647
1616 Ga0495657_0000022
1617 Ga0495657_0002646
1618 Ga0495657_0017242
1619 Ga0495657_0019711
1620 Ga0495657_0032342
1621 Ga0495657_0037823
1622 Ga0495599_0000236
1623 Ga0495599_0021152
1624 Ga0495599_0033930
1625 Ga0495599_0058238
1626 Ga0495599_0086958
1627 Ga0495599_0093224
1628 Ga0495599_0135255
1629 Ga0495623_0001803
1630 Ga0495623_0024139
1631 Ga0495623_0027986
1632 Ga0495623_0041308
1633 Ga0495623_0207738
1634 Ga0495646_0005340
1635 Ga0495646_0010149
1636 Ga0495646_0014616
1637 Ga0495646_0118768
1638 Ga0495647_0004740
1639 Ga0495647_0021880
1640 Ga0495658_0009682
1641 Ga0495658_0022731
1642 Ga0495658_0040437
1643 Ga0495613_0011190
1644 Ga0495613_0026219
1645 Ga0495613_0066560
1646 Ga0495613_0237503
1647 Ga0495613_0438784
1648 Ga0495624_0001756
1649 Ga0495624_0001919
1650 Ga0495624_0013711
1651 Ga0495624_0090949
1652 Ga0495600_0004257
1653 Ga0495600_0008322
1654 Ga0495600_0010830
1655 Ga0495600_0022765
1656 Ga0495600_0031230
1657 Ga0495600_0049556
1658 Ga0495600_0074472
1659 Ga0495600_0108367
1660 Ga0495600_0241530
1661 Ga0495581_0001057
1662 Ga0495581_0012081
1663 Ga0495581_0049758
1664 Ga0495604_0000022
1665 Ga0495604_0001853
1666 Ga0495604_0017016
1667 Ga0495604_0018581
1668 Ga0495604_0074648
1669 Ga0495604_0153676
1670 Ga0495604_0178897
1671 Ga0495604_0188536
1672 Ga0495604_0250625
1673 Ga0495674_0003145
1674 Ga0495674_0007792
1675 Ga0495674_0042408
1676 Ga0495674_0051880
1677 Ga0495674_0053849
1678 Ga0495674_0072201
1679 Ga0495676_0003179
1680 Ga0495676_0127487
1681 Ga0495680_0000271
1682 Ga0495680_0006193
1683 Ga0495680_0007684
1684 Ga0495680_0044719
1685 Ga0495680_0050667
1686 Ga0495680_0052558
1687 Ga0495680_0093708
1688 Ga0495680_0109534
1689 Ga0495680_0195976
1690 Ga0495680_0215007
1691 Ga0495675_0002876
1692 Ga0495675_0017842
1693 Ga0495675_0026629
1694 Ga0495675_0036613
1695 Ga0495675_0053260
1696 Ga0495675_0059915
1697 Ga0495675_0063539
1698 Ga0495675_0235896
1699 Ga0495675_0253348
1700 Ga0495684_0002493
1701 Ga0495684_0015783
1702 Ga0495684_0023986
1703 Ga0495684_0147408
1704 Ga0495684_0154016
1705 Ga0495684_0173246
1706 Ga0495684_0293427
1707 Ga0495593_0001295
1708 Ga0495593_0026522
1709 Ga0495593_0033280
1710 Ga0495593_0061503
1711 Ga0495602_0000390
1712 Ga0495602_0005560
1713 Ga0495602_0040901
1714 Ga0495602_0045188
1715 Ga0495602_0045765
1716 Ga0495602_0132266
1717 Ga0495602_0297071
1718 Ga0495602_0350753
1719 Ga0495614_0158368
1720 Ga0496100_0058723
1721 Ga0496100_0161424
1722 Ga0496101_0291735
1723 Ga0496101_0316119
1724 Ga0496102_0071268
1725 Ga0496102_0115326
1726 Ga0496102_0165043
1727 Ga0496102_0288707
1728 Ga0496102_0610907
1729 Ga0496103_0052153
1730 Ga0496103_0073907
1731 Ga0496104_0005347
1732 Ga0496104_0063047
1733 Ga0496104_0074849
1734 Ga0496104_0109580
1735 Ga0496104_0113883
1736 Ga0496104_0508933
1737 Ga0496105_0000120
1738 Ga0496105_0001446
1739 Ga0496105_0032956
1740 Ga0496105_0050079
1741 Ga0496105_0081889
1742 Ga0496105_0112057
1743 Ga0496105_0238822
1744 Ga0496106_0014173
1745 Ga0496106_0050724
1746 Ga0496107_0012223
1747 Ga0496107_0059096
1748 Ga0496107_0061382
1749 Ga0496107_0149131
1750 Ga0496108_0003930
1751 Ga0496108_0013769
1752 Ga0496108_0099415
1753 Ga0496108_0201341
1754 Ga0496108_0201397
1755 Ga0496108_0354668
1756 Ga0496109_0050712
1757 Ga0496109_0066117
1758 Ga0496109_0078784
1759 Ga0496109_0105266
1760 Ga0496109_0110142
1761 Ga0496109_0116456
1762 Ga0496109_0214334
1763 Ga0496109_0306374
1764 Ga0496110_0052690
1765 Ga0496110_0248671
1766 Ga0496110_0401932
1767 Ga0496110_0448696
1768 Ga0496110_0666359
1769 Ga0496111_0057011
1770 Ga0496111_0059336
1771 Ga0496111_0318746
1772 Ga0496112_0019980
1773 Ga0496112_0100925
1774 Ga0496112_0110877
1775 Ga0496112_0734130
1776 Ga0496112_1109155
1777 Ga0496113_0018578
1778 Ga0496113_0060279
1779 Ga0496113_0133702
1780 Ga0496114_0029335
1781 Ga0496114_0140488
1782 Ga0496114_0232865
1783 Ga0496114_0561245
1784 Ga0496115_0024636
1785 Ga0496115_0057015
1786 Ga0496115_0251032
1787 Ga0496115_0253264
1788 Ga0496115_0293654
1789 Ga0496126_0015540
1790 Ga0501318_006305
1791 Ga0501032_0004992
1792 Ga0501033_0011495
1793 Ga0501033_0064498
1794 Ga0501034_0026588
1795 Ga0501034_0046611
1796 Ga0501034_0101105
1797 Ga0501034_0488103
1798 Ga0501036_0001691
1799 Ga0501036_0234518
1800 Ga0501037_0004582
1801 Ga0501037_0060222
1802 Ga0501037_0170740
1803 Ga0501038_0006532
1804 Ga0501038_0063465
1805 Ga0501038_0227512
1806 Ga0501039_0007936
1807 Ga0501040_0043993
1808 Ga0501041_0044080
1809 Ga0501042_0021677
1810 Ga0501042_0053726
1811 Ga0501042_0058647
1812 Ga0501042_0175898
1813 Ga0501043_0011613
1814 Ga0501043_0120385
1815 Ga0501043_0128504
1816 Ga0501046_0007199
1817 Ga0501046_0008028
1818 Ga0501047_0012050
1819 Ga0501047_0211162
1820 Ga0501048_0007791
1821 Ga0501048_0041177
1822 Ga0501067_0002053
1823 Ga0501068_0062779
1824 Ga0501068_0081858
1825 Ga0501069_0050892
1826 Ga0501069_0101767
1827 Ga0501070_0003699
1828 Ga0501070_0006215
1829 Ga0501070_0359151
1830 Ga0501071_0010142
1831 Ga0501073_0012664
1832 Ga0501073_0041947
1833 Ga0501074_0000839
1834 Ga0501076_0068482
1835 Ga0501076_0089718
1836 Ga0501077_0002353
1837 Ga0501209_037301
1838 Ga0501079_0056339
1839 Ga0501079_0065564
1840 Ga0501080_0006490
1841 Ga0501081_0191365
1842 Ga0501083_0027628
1843 Ga0501035_0028393
1844 Ga0501035_0446334
1845 Ga0501044_0021785
1846 Ga0501044_0038130
1847 Ga0501044_0057823
1848 Ga0501044_0323078
1849 Ga0501044_0574624
1850 Ga0501045_0351914
1851 nmdc:mga03n38_10458_c1
1852 nmdc:mga0yw44_33714_c1
1853 nmdc:mga05p37_260330_c1
1854 nmdc:mga05p37_268844_c1
1855 nmdc:mga05p37_31168_c1
1856 nmdc:mga05p37_35256_c1
1857 nmdc:mga05p37_747895_c1
1858 nmdc:mga05p37_935669_c1
1859 nmdc:mga09592_117507_c1
1860 nmdc:mga09592_12387_c1
1861 nmdc:mga09592_6580_c1
1862 nmdc:mga0qj67_314243_c1
1863 nmdc:mga0qj67_59393_c1
1864 nmdc:mga0qj67_87402_c1
1865 nmdc:mga06r32_15774_c1
1866 nmdc:mga06r32_29633_c1
1867 nmdc:mga06r32_863151_c1
1868 nmdc:mga08y16_206354_c1
1869 nmdc:mga08y16_473481_c1
1870 nmdc:mga0n895_101040_c1
1871 nmdc:mga0n895_116954_c1
1872 nmdc:mga0n895_171467_c1
1873 nmdc:mga0n895_28600_c1
1874 nmdc:mga0n895_75766_c1
1875 nmdc:mga0rr50_11746_c1
1876 nmdc:mga0rr50_238794_c1
1877 nmdc:mga0rr50_28281_c1
1878 nmdc:mga0rr50_375337_c1
1879 nmdc:mga0rr50_72921_c1
1880 nmdc:mga08x19_220840_c1
1881 nmdc:mga08x19_263015_c1
1882 nmdc:mga08x19_37258_c1
1883 nmdc:mga08x19_57784_c1
1884 nmdc:mga0a205_193307_c1
1885 nmdc:mga0a205_40338_c1
1886 nmdc:mga0a205_5351_c1
1887 Ga0495601_0035492
1888 Ga0495601_0072009
1889 Ga0495601_0183868
1890 Ga0495601_0224367
1891 Ga0495601_0251480
1892 Ga0495601_0410142
1893 Ga0495612_0009026
1894 Ga0495595_0011120
1895 Ga0495595_0029393
1896 Ga0495595_0056235
1897 Ga0495595_0141802
1898 Ga0495595_0143512
1899 Ga0495619_0004343
1900 Ga0495619_0004905
1901 Ga0495619_0006518
1902 Ga0495619_0012772
1903 Ga0495619_0017109
1904 Ga0495619_0198079
1905 Ga0495619_0333996
1906 Ga0495619_0342402
1907 Ga0500616_0001211
1908 Ga0501084_0000044
1909 Ga0501084_0011106
1910 Ga0501084_0104758
1911 Ga0501084_0419470
1912 Ga0501082_0007063
1913 Ga0501082_0943635
1914 Ga0466962_0006441
1915 Ga0466962_0089850
1916 Ga0530510_0009732
1917 Ga0530510_0538320
1918 2644229354
1919 2645721831
1920 2676489071
1921 2689996318
1922 2884702679
1923 2895436407
1924 2895452179
1925 2984580261
1926 2990259111
1927 8055069263
1928 8055172973

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

18

121

0.86

PF13649

Methyltransf_25

Methyltransferase domain

17

117

0.84

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

6

126

0.78

PF13847

Methyltransf_31

Methyltransferase domain

12

143

0.77

PF08242

Methyltransf_12

Methyltransferase domain

18

119

0.76

PF13489

Methyltransf_23

Methyltransferase domain

6

167

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qdj-assembly1.cif.gz_A crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sam 0.8791 13 169
7pd7-assembly1.cif.gz_A crocagin methyl transferase cgnl 0.8627 7 125
2nxn-assembly1.cif.gz_A t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 0.8421 12 169
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.838 9 129
3cjr-assembly1.cif.gz_A ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin. 0.8345 12 169
ID Description Score Start End Superfamily
af_Q0DEH3_59_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9712 12 57 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8845 14 123 3.40.50.150
4qdjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.879 13 169 3.40.50.150
af_O44410_182_343_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8727 13 237 3.40.50.150
af_A0A1D6ET91_93_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8708 11 117 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7Y8L815-F1-model_v4 Methyltransferase domain-containing protein 0.9716 1 236 GO:0008757
GO:0032259
AF-A0A7Y8L815-F1-model_v4 Methyltransferase domain-containing protein 0.9675 1 236 GO:0008757
GO:0032259
AF-A0A7C2WDB1-F1-model_v4 deleted 0.9653 1 236
AF-A0A7W4W9X6-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methylase UbiE 0.9644 1 236 GO:0008757
GO:0032259
AF-A0A7W4W9X6-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methylase UbiE 0.9485 1 236 GO:0008757
GO:0032259

Map