F486934
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 301 | 964 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_101860463|Ga0075434_1018604632 |
| Length | 153 |
| Sequence | VTLEQQLTETLTRAIREKDQRTADVVRMLKTKITERRTAKGFTGEVDDAVILDVVGAYRKQLQKALGEYEKAGGDRVAAPIAQLRFEIGFCERYLPKGMDESALRALVKERIGTLGISDVKQAGRLVGDIMKTHKGQVDAADVKRVAEDLLRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 193 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 218 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 219 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 220 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 221 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 222 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.35 |
| Rhizosphere | 98.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10005819 | 3300003203 | Bacteria | 5707 |
| 2 | JGI25404J52841_10105087 | 3300003659 | Bacteria | 593 |
| 3 | Ga0065712_10141318 | 3300005290 | Bacteria | 1447 |
| 4 | Ga0065715_10113974 | 3300005293 | Bacteria | 2452 |
| 5 | Ga0065707_10185628 | 3300005295 | Bacteria | 1390 |
| 6 | Ga0065707_10244704 | 3300005295 | Bacteria | 1144 |
| 7 | Ga0065707_10479327 | 3300005295 | Unclassified | 775 |
| 8 | Ga0070658_10660707 | 3300005327 | Unclassified | 907 |
| 9 | Ga0070676_10000005 | 3300005328 | Bacteria | 76787 |
| 10 | Ga0070676_10011118 | 3300005328 | Bacteria | 4892 |
| 11 | Ga0070676_10237672 | 3300005328 | Bacteria | 1210 |
| 12 | Ga0070683_100038454 | 3300005329 | Bacteria | 4387 |
| 13 | Ga0070690_100256890 | 3300005330 | Bacteria | 1238 |
| 14 | Ga0070670_100001199 | 3300005331 | Bacteria | 20587 |
| 15 | Ga0070677_10213424 | 3300005333 | Bacteria | 938 |
| 16 | Ga0068869_100002745 | 3300005334 | Bacteria | 10659 |
| 17 | Ga0068869_100009337 | 3300005334 | Bacteria | 6361 |
| 18 | Ga0068869_100050419 | 3300005334 | Bacteria | 3017 |
| 19 | Ga0070666_10219720 | 3300005335 | Bacteria | 1340 |
| 20 | Ga0070680_100000094 | 3300005336 | Bacteria | 50344 |
| 21 | Ga0070680_100039088 | 3300005336 | Bacteria | 3839 |
| 22 | Ga0070680_100062111 | 3300005336 | Bacteria | 3058 |
| 23 | Ga0070680_100437265 | 3300005336 | Unclassified | 1117 |
| 24 | Ga0070680_101041210 | 3300005336 | Unclassified | 707 |
| 25 | Ga0070682_100003884 | 3300005337 | Bacteria | 8290 |
| 26 | Ga0068868_100014283 | 3300005338 | Bacteria | 5850 |
| 27 | Ga0068868_100133018 | 3300005338 | Bacteria | 2037 |
| 28 | Ga0070660_100003125 | 3300005339 | Bacteria | 11376 |
| 29 | Ga0070689_100003437 | 3300005340 | Bacteria | 10539 |
| 30 | Ga0070689_100419278 | 3300005340 | Bacteria | 1134 |
| 31 | Ga0070691_10006218 | 3300005341 | Bacteria | 5447 |
| 32 | Ga0070691_10049587 | 3300005341 | Bacteria | 2001 |
| 33 | Ga0070691_10093272 | 3300005341 | Bacteria | 1487 |
| 34 | Ga0070691_10537802 | 3300005341 | Bacteria | 681 |
| 35 | Ga0070687_100079182 | 3300005343 | Bacteria | 1788 |
| 36 | Ga0070661_100006165 | 3300005344 | Bacteria | 8266 |
| 37 | Ga0070692_10001646 | 3300005345 | Bacteria | 8240 |
| 38 | Ga0070692_10004232 | 3300005345 | Bacteria | 5954 |
| 39 | Ga0070668_100326905 | 3300005347 | Bacteria | 1292 |
| 40 | Ga0070668_100562170 | 3300005347 | Bacteria | 994 |
| 41 | Ga0070669_100040023 | 3300005353 | Bacteria | 3406 |
| 42 | Ga0070669_100068744 | 3300005353 | Bacteria | 2615 |
| 43 | Ga0070669_100101399 | 3300005353 | Bacteria | 2172 |
| 44 | Ga0070669_100164531 | 3300005353 | Bacteria | 1726 |
| 45 | Ga0070669_100623873 | 3300005353 | Unclassified | 905 |
| 46 | Ga0070671_100189336 | 3300005355 | Bacteria | 1744 |
| 47 | Ga0070674_100548612 | 3300005356 | Bacteria | 969 |
| 48 | Ga0070673_100017616 | 3300005364 | Bacteria | 5085 |
| 49 | Ga0070688_100135114 | 3300005365 | Bacteria | 1669 |
| 50 | Ga0070688_100386324 | 3300005365 | Bacteria | 1033 |
| 51 | Ga0070659_100001138 | 3300005366 | Bacteria | 19392 |
| 52 | Ga0070659_101987984 | 3300005366 | Unclassified | 522 |
| 53 | Ga0070703_10039928 | 3300005406 | Bacteria | 1457 |
| 54 | Ga0070703_10043334 | 3300005406 | Bacteria | 1411 |
| 55 | Ga0070703_10081142 | 3300005406 | Bacteria | 1105 |
| 56 | Ga0070703_10195063 | 3300005406 | Bacteria | 791 |
| 57 | Ga0070701_10046764 | 3300005438 | Bacteria | 2226 |
| 58 | Ga0070701_10097707 | 3300005438 | Bacteria | 1621 |
| 59 | Ga0070711_100107027 | 3300005439 | Bacteria | 2045 |
| 60 | Ga0070711_100259608 | 3300005439 | Bacteria | 1366 |
| 61 | Ga0070705_100028364 | 3300005440 | Bacteria | 3065 |
| 62 | Ga0070705_100029223 | 3300005440 | Bacteria | 3028 |
| 63 | Ga0070705_100031904 | 3300005440 | Bacteria | 2922 |
| 64 | Ga0070705_100038776 | 3300005440 | Bacteria | 2698 |
| 65 | Ga0070705_100215705 | 3300005440 | Bacteria | 1326 |
| 66 | Ga0070700_100051404 | 3300005441 | Bacteria | 2565 |
| 67 | Ga0070700_100095624 | 3300005441 | Bacteria | 1948 |
| 68 | Ga0070694_100002997 | 3300005444 | Bacteria | 10041 |
| 69 | Ga0070694_100004403 | 3300005444 | Bacteria | 8468 |
| 70 | Ga0070694_100115083 | 3300005444 | Bacteria | 1921 |
| 71 | Ga0070694_100331669 | 3300005444 | Bacteria | 1174 |
| 72 | Ga0070694_100795933 | 3300005444 | Unclassified | 775 |
| 73 | Ga0070708_100015531 | 3300005445 | Bacteria | 6292 |
| 74 | Ga0070708_100023561 | 3300005445 | Bacteria | 5237 |
| 75 | Ga0070708_100024205 | 3300005445 | Bacteria | 5175 |
| 76 | Ga0070708_100051214 | 3300005445 | Bacteria | 3658 |
| 77 | Ga0070708_100159238 | 3300005445 | Bacteria | 2103 |
| 78 | Ga0070708_100231582 | 3300005445 | Bacteria | 1733 |
| 79 | Ga0070708_100321554 | 3300005445 | Bacteria | 1457 |
| 80 | Ga0070708_100321786 | 3300005445 | Bacteria | 1457 |
| 81 | Ga0070708_100384527 | 3300005445 | Bacteria | 1323 |
| 82 | Ga0070708_101417996 | 3300005445 | Bacteria | 648 |
| 83 | Ga0070663_100000763 | 3300005455 | Bacteria | 17474 |
| 84 | Ga0070662_100042435 | 3300005457 | Bacteria | 3249 |
| 85 | Ga0070662_100081362 | 3300005457 | Bacteria | 2413 |
| 86 | Ga0070681_10034394 | 3300005458 | Bacteria | 5088 |
| 87 | Ga0070681_10058087 | 3300005458 | Bacteria | 3848 |
| 88 | Ga0070681_10062606 | 3300005458 | Bacteria | 3694 |
| 89 | Ga0070681_10390843 | 3300005458 | Bacteria | 1302 |
| 90 | Ga0068867_100002733 | 3300005459 | Bacteria | 12440 |
| 91 | Ga0068867_100019737 | 3300005459 | Bacteria | 4802 |
| 92 | Ga0068867_100157437 | 3300005459 | Bacteria | 1789 |
| 93 | Ga0068867_100884171 | 3300005459 | Bacteria | 803 |
| 94 | Ga0070706_100004618 | 3300005467 | Bacteria | 13217 |
| 95 | Ga0070706_100008662 | 3300005467 | Bacteria | 9481 |
| 96 | Ga0070706_100043566 | 3300005467 | Bacteria | 4147 |
| 97 | Ga0070706_100075697 | 3300005467 | Bacteria | 3115 |
| 98 | Ga0070706_100090200 | 3300005467 | Bacteria | 2842 |
| 99 | Ga0070706_100136905 | 3300005467 | Bacteria | 2285 |
| 100 | Ga0070706_100159881 | 3300005467 | Bacteria | 2103 |
| 101 | Ga0070706_100314395 | 3300005467 | Bacteria | 1461 |
| 102 | Ga0070706_100327919 | 3300005467 | Bacteria | 1427 |
| 103 | Ga0070706_100531695 | 3300005467 | Bacteria | 1094 |
| 104 | Ga0070707_100001786 | 3300005468 | Bacteria | 20710 |
| 105 | Ga0070707_100005318 | 3300005468 | Bacteria | 12047 |
| 106 | Ga0070707_100011093 | 3300005468 | Bacteria | 8393 |
| 107 | Ga0070707_100014433 | 3300005468 | Bacteria | 7404 |
| 108 | Ga0070707_100018600 | 3300005468 | Bacteria | 6537 |
| 109 | Ga0070707_100045167 | 3300005468 | Bacteria | 4216 |
| 110 | Ga0070707_100061661 | 3300005468 | Bacteria | 3597 |
| 111 | Ga0070707_100087596 | 3300005468 | Bacteria | 3011 |
| 112 | Ga0070707_100133354 | 3300005468 | Bacteria | 2416 |
| 113 | Ga0070707_100139937 | 3300005468 | Bacteria | 2355 |
| 114 | Ga0070707_100417330 | 3300005468 | Bacteria | 1302 |
| 115 | Ga0070707_100666676 | 3300005468 | Bacteria | 1003 |
| 116 | Ga0070707_100879946 | 3300005468 | Bacteria | 860 |
| 117 | Ga0070707_100975812 | 3300005468 | Bacteria | 812 |
| 118 | Ga0070698_100006315 | 3300005471 | Bacteria | 12870 |
| 119 | Ga0070698_100118659 | 3300005471 | Bacteria | 2606 |
| 120 | Ga0070698_100331196 | 3300005471 | Bacteria | 1454 |
| 121 | Ga0070698_100570296 | 3300005471 | Bacteria | 1072 |
| 122 | Ga0070698_100654502 | 3300005471 | Bacteria | 992 |
| 123 | Ga0070699_100002516 | 3300005518 | Bacteria | 16458 |
| 124 | Ga0070699_100019945 | 3300005518 | Bacteria | 5778 |
| 125 | Ga0070699_100037281 | 3300005518 | Bacteria | 4206 |
| 126 | Ga0070699_100051010 | 3300005518 | Bacteria | 3583 |
| 127 | Ga0070699_100081806 | 3300005518 | Bacteria | 2815 |
| 128 | Ga0070699_100091875 | 3300005518 | Bacteria | 2654 |
| 129 | Ga0070699_100185087 | 3300005518 | Bacteria | 1849 |
| 130 | Ga0070699_100294785 | 3300005518 | Bacteria | 1455 |
| 131 | Ga0070699_100319775 | 3300005518 | Bacteria | 1395 |
| 132 | Ga0070699_100350177 | 3300005518 | Unclassified | 1330 |
| 133 | Ga0070699_100445390 | 3300005518 | Bacteria | 1174 |
| 134 | Ga0070699_100489209 | 3300005518 | Bacteria | 1117 |
| 135 | Ga0070699_100917110 | 3300005518 | Unclassified | 802 |
| 136 | Ga0070679_100001113 | 3300005530 | Bacteria | 23470 |
| 137 | Ga0070679_100034545 | 3300005530 | Bacteria | 5012 |
| 138 | Ga0070679_100036717 | 3300005530 | Bacteria | 4863 |
| 139 | Ga0070679_100234132 | 3300005530 | Bacteria | 1796 |
| 140 | Ga0070679_100309895 | 3300005530 | Bacteria | 1528 |
| 141 | Ga0070684_100241528 | 3300005535 | Bacteria | 1650 |
| 142 | Ga0070697_100000676 | 3300005536 | Bacteria | 25620 |
| 143 | Ga0070697_100002183 | 3300005536 | Bacteria | 15009 |
| 144 | Ga0070697_100025430 | 3300005536 | Bacteria | 4723 |
| 145 | Ga0070697_100048316 | 3300005536 | Bacteria | 3450 |
| 146 | Ga0070697_100182974 | 3300005536 | Bacteria | 1777 |
| 147 | Ga0070697_100188915 | 3300005536 | Bacteria | 1748 |
| 148 | Ga0070697_100189402 | 3300005536 | Bacteria | 1746 |
| 149 | Ga0070697_100225229 | 3300005536 | Bacteria | 1598 |
| 150 | Ga0070697_100261986 | 3300005536 | Bacteria | 1480 |
| 151 | Ga0070697_100359912 | 3300005536 | Bacteria | 1258 |
| 152 | Ga0070697_100874309 | 3300005536 | Bacteria | 797 |
| 153 | Ga0068853_100008227 | 3300005539 | Bacteria | 8372 |
| 154 | Ga0070672_100024688 | 3300005543 | Bacteria | 4447 |
| 155 | Ga0070672_100164052 | 3300005543 | Bacteria | 1845 |
| 156 | Ga0070672_100448181 | 3300005543 | Bacteria | 1111 |
| 157 | Ga0070686_100310061 | 3300005544 | Bacteria | 1173 |
| 158 | Ga0070686_101247849 | 3300005544 | Bacteria | 619 |
| 159 | Ga0070695_100001443 | 3300005545 | Bacteria | 13186 |
| 160 | Ga0070695_100005056 | 3300005545 | Bacteria | 7770 |
| 161 | Ga0070695_100096571 | 3300005545 | Bacteria | 1983 |
| 162 | Ga0070695_100134677 | 3300005545 | Bacteria | 1706 |
| 163 | Ga0070696_100001369 | 3300005546 | Bacteria | 15910 |
| 164 | Ga0070696_100017182 | 3300005546 | Bacteria | 4882 |
| 165 | Ga0070696_100025044 | 3300005546 | Bacteria | 4055 |
| 166 | Ga0070696_100079526 | 3300005546 | Bacteria | 2320 |
| 167 | Ga0070696_100085349 | 3300005546 | Bacteria | 2241 |
| 168 | Ga0070696_100330285 | 3300005546 | Bacteria | 1176 |
| 169 | Ga0070696_101718551 | 3300005546 | Bacteria | 541 |
| 170 | Ga0070693_100000104 | 3300005547 | Bacteria | 37548 |
| 171 | Ga0070693_100356053 | 3300005547 | Unclassified | 1003 |
| 172 | Ga0070665_101162564 | 3300005548 | Unclassified | 783 |
| 173 | Ga0070704_100014114 | 3300005549 | Bacteria | 4981 |
| 174 | Ga0070704_100018081 | 3300005549 | Bacteria | 4498 |
| 175 | Ga0070704_100033390 | 3300005549 | Bacteria | 3479 |
| 176 | Ga0070704_100066200 | 3300005549 | Bacteria | 2604 |
| 177 | Ga0070704_100266623 | 3300005549 | Bacteria | 1413 |
| 178 | Ga0070704_100720848 | 3300005549 | Bacteria | 886 |
| 179 | Ga0070704_100881208 | 3300005549 | Bacteria | 804 |
| 180 | Ga0070704_100952440 | 3300005549 | Bacteria | 774 |
| 181 | Ga0070704_101587799 | 3300005549 | Bacteria | 603 |
| 182 | Ga0068855_100016998 | 3300005563 | Bacteria | 8749 |
| 183 | Ga0068855_100518680 | 3300005563 | Bacteria | 1293 |
| 184 | Ga0068855_100577014 | 3300005563 | Bacteria | 1215 |
| 185 | Ga0068855_100611731 | 3300005563 | Unclassified | 1174 |
| 186 | Ga0068857_100094550 | 3300005577 | Bacteria | 2677 |
| 187 | Ga0068857_100175503 | 3300005577 | Unclassified | 1949 |
| 188 | Ga0068857_100214239 | 3300005577 | Bacteria | 1758 |
| 189 | Ga0068854_100004651 | 3300005578 | Bacteria | 8662 |
| 190 | Ga0068856_100012614 | 3300005614 | Bacteria | 8180 |
| 191 | Ga0068856_100071511 | 3300005614 | Bacteria | 3434 |
| 192 | Ga0068856_100298801 | 3300005614 | Unclassified | 1627 |
| 193 | Ga0070702_100024931 | 3300005615 | Bacteria | 3198 |
| 194 | Ga0070702_101046941 | 3300005615 | Unclassified | 649 |
| 195 | Ga0068852_100389912 | 3300005616 | Bacteria | 1368 |
| 196 | Ga0068859_100001562 | 3300005617 | Bacteria | 23360 |
| 197 | Ga0068859_100127803 | 3300005617 | Bacteria | 2612 |
| 198 | Ga0068859_100268466 | 3300005617 | Bacteria | 1798 |
| 199 | Ga0068859_100338727 | 3300005617 | Unclassified | 1598 |
| 200 | Ga0068859_100446312 | 3300005617 | Bacteria | 1390 |
| 201 | Ga0068859_100501533 | 3300005617 | Bacteria | 1309 |
| 202 | Ga0068859_100641229 | 3300005617 | Bacteria | 1154 |
| 203 | Ga0068864_100000991 | 3300005618 | Bacteria | 23779 |
| 204 | Ga0068864_100047381 | 3300005618 | Bacteria | 3691 |
| 205 | Ga0068864_101256791 | 3300005618 | Bacteria | 740 |
| 206 | Ga0068866_10073428 | 3300005718 | Bacteria | 1815 |
| 207 | Ga0068866_10618098 | 3300005718 | Bacteria | 734 |
| 208 | Ga0068861_100018444 | 3300005719 | Bacteria | 4972 |
| 209 | Ga0068861_100154005 | 3300005719 | Bacteria | 1889 |
| 210 | Ga0068861_100237858 | 3300005719 | Bacteria | 1548 |
| 211 | Ga0068851_10198680 | 3300005834 | Bacteria | 1118 |
| 212 | Ga0068870_10002820 | 3300005840 | Bacteria | 7310 |
| 213 | Ga0068863_100010104 | 3300005841 | Bacteria | 9179 |
| 214 | Ga0068863_100708195 | 3300005841 | Bacteria | 1001 |
| 215 | Ga0068863_101154134 | 3300005841 | Bacteria | 780 |
| 216 | Ga0068863_101522666 | 3300005841 | Bacteria | 677 |
| 217 | Ga0068863_101948999 | 3300005841 | Bacteria | 597 |
| 218 | Ga0068858_100033406 | 3300005842 | Bacteria | 4775 |
| 219 | Ga0068858_100157079 | 3300005842 | Bacteria | 2140 |
| 220 | Ga0068860_100022117 | 3300005843 | Bacteria | 6156 |
| 221 | Ga0068860_100336400 | 3300005843 | Bacteria | 1484 |
| 222 | Ga0068860_100878726 | 3300005843 | Bacteria | 912 |
| 223 | Ga0068860_100882234 | 3300005843 | Bacteria | 910 |
| 224 | Ga0068862_100007685 | 3300005844 | Bacteria | 8919 |
| 225 | Ga0068862_100013048 | 3300005844 | Bacteria | 6873 |
| 226 | Ga0068862_100023027 | 3300005844 | Bacteria | 5216 |
| 227 | Ga0068862_100043608 | 3300005844 | Bacteria | 3825 |
| 228 | Ga0068862_100098268 | 3300005844 | Bacteria | 2557 |
| 229 | Ga0068862_100212790 | 3300005844 | Bacteria | 1747 |
| 230 | Ga0068862_100468936 | 3300005844 | Bacteria | 1190 |
| 231 | Ga0068862_100591516 | 3300005844 | Bacteria | 1064 |
| 232 | Ga0068862_101279850 | 3300005844 | Bacteria | 734 |
| 233 | Ga0081540_1001963 | 3300005983 | Bacteria | 17161 |
| 234 | Ga0081539_10000590 | 3300005985 | Bacteria | 74293 |
| 235 | Ga0075432_10080745 | 3300006058 | Bacteria | 1179 |
| 236 | Ga0070715_10267494 | 3300006163 | Unclassified | 901 |
| 237 | Ga0070715_11017775 | 3300006163 | Bacteria | 517 |
| 238 | Ga0070716_100007870 | 3300006173 | Bacteria | 5272 |
| 239 | Ga0075427_10021528 | 3300006194 | Bacteria | 1026 |
| 240 | Ga0097621_101244755 | 3300006237 | Bacteria | 702 |
| 241 | Ga0068871_100762236 | 3300006358 | Bacteria | 890 |
| 242 | Ga0075428_100000730 | 3300006844 | Bacteria | 34154 |
| 243 | Ga0075428_100008047 | 3300006844 | Bacteria | 11701 |
| 244 | Ga0075428_100017939 | 3300006844 | Bacteria | 7821 |
| 245 | Ga0075428_100030783 | 3300006844 | Bacteria | 5934 |
| 246 | Ga0075428_100063364 | 3300006844 | Bacteria | 4047 |
| 247 | Ga0075428_100161255 | 3300006844 | Bacteria | 2434 |
| 248 | Ga0075428_100175668 | 3300006844 | Unclassified | 2320 |
| 249 | Ga0075428_100188259 | 3300006844 | Bacteria | 2232 |
| 250 | Ga0075428_100304698 | 3300006844 | Bacteria | 1713 |
| 251 | Ga0075428_100466585 | 3300006844 | Bacteria | 1352 |
| 252 | Ga0075428_100563045 | 3300006844 | Unclassified | 1218 |
| 253 | Ga0075428_100842283 | 3300006844 | Bacteria | 974 |
| 254 | Ga0075428_101009790 | 3300006844 | Bacteria | 881 |
| 255 | Ga0075430_100002036 | 3300006846 | Bacteria | 16684 |
| 256 | Ga0075430_100006370 | 3300006846 | Bacteria | 9952 |
| 257 | Ga0075430_100018856 | 3300006846 | Bacteria | 5869 |
| 258 | Ga0075430_100111721 | 3300006846 | Bacteria | 2279 |
| 259 | Ga0075430_100176534 | 3300006846 | Bacteria | 1777 |
| 260 | Ga0075430_100198464 | 3300006846 | Bacteria | 1666 |
| 261 | Ga0075430_100309158 | 3300006846 | Bacteria | 1307 |
| 262 | Ga0075430_100350342 | 3300006846 | Unclassified | 1219 |
| 263 | Ga0075430_100395150 | 3300006846 | Unclassified | 1141 |
| 264 | Ga0075430_100490427 | 3300006846 | Bacteria | 1014 |
| 265 | Ga0075431_100007203 | 3300006847 | Bacteria | 11065 |
| 266 | Ga0075431_100008661 | 3300006847 | Bacteria | 10194 |
| 267 | Ga0075431_100010364 | 3300006847 | Bacteria | 9365 |
| 268 | Ga0075431_100019710 | 3300006847 | Bacteria | 6883 |
| 269 | Ga0075431_100035297 | 3300006847 | Bacteria | 5147 |
| 270 | Ga0075431_100070228 | 3300006847 | Bacteria | 3613 |
| 271 | Ga0075431_100089673 | 3300006847 | Bacteria | 3174 |
| 272 | Ga0075431_100093074 | 3300006847 | Bacteria | 3111 |
| 273 | Ga0075431_100110736 | 3300006847 | Bacteria | 2833 |
| 274 | Ga0075431_100219357 | 3300006847 | Bacteria | 1940 |
| 275 | Ga0075431_100270914 | 3300006847 | Bacteria | 1720 |
| 276 | Ga0075431_100307066 | 3300006847 | Bacteria | 1602 |
| 277 | Ga0075431_100471721 | 3300006847 | Bacteria | 1249 |
| 278 | Ga0075431_100781618 | 3300006847 | Bacteria | 929 |
| 279 | Ga0075431_101567585 | 3300006847 | Bacteria | 617 |
| 280 | Ga0075433_10001209 | 3300006852 | Bacteria | 18826 |
| 281 | Ga0075433_10002879 | 3300006852 | Bacteria | 13188 |
| 282 | Ga0075433_10005890 | 3300006852 | Bacteria | 9653 |
| 283 | Ga0075433_10018092 | 3300006852 | Bacteria | 5850 |
| 284 | Ga0075433_10022899 | 3300006852 | Bacteria | 5250 |
| 285 | Ga0075433_10025739 | 3300006852 | Bacteria | 4975 |
| 286 | Ga0075433_10040876 | 3300006852 | Bacteria | 4016 |
| 287 | Ga0075433_10080500 | 3300006852 | Bacteria | 2872 |
| 288 | Ga0075433_10085717 | 3300006852 | Bacteria | 2781 |
| 289 | Ga0075433_10086269 | 3300006852 | Bacteria | 2772 |
| 290 | Ga0075433_10088588 | 3300006852 | Bacteria | 2735 |
| 291 | Ga0075433_10161430 | 3300006852 | Bacteria | 1995 |
| 292 | Ga0075433_10444063 | 3300006852 | Bacteria | 1144 |
| 293 | Ga0075433_10536391 | 3300006852 | Unclassified | 1029 |
| 294 | Ga0075433_10819915 | 3300006852 | Bacteria | 813 |
| 295 | Ga0075434_100000039 | 3300006871 | Bacteria | 59823 |
| 296 | Ga0075434_100004221 | 3300006871 | Bacteria | 12880 |
| 297 | Ga0075434_100011543 | 3300006871 | Bacteria | 8335 |
| 298 | Ga0075434_100061715 | 3300006871 | Bacteria | 3730 |
| 299 | Ga0075434_100071242 | 3300006871 | Bacteria | 3467 |
| 300 | Ga0075434_100092860 | 3300006871 | Bacteria | 3021 |
| 301 | Ga0075434_100118891 | 3300006871 | Bacteria | 2657 |
| 302 | Ga0075434_100120734 | 3300006871 | Bacteria | 2636 |
| 303 | Ga0075434_100149544 | 3300006871 | Unclassified | 2355 |
| 304 | Ga0075434_100185820 | 3300006871 | Bacteria | 2099 |
| 305 | Ga0075434_100235777 | 3300006871 | Bacteria | 1850 |
| 306 | Ga0075434_100436959 | 3300006871 | Bacteria | 1330 |
| 307 | Ga0075434_100597562 | 3300006871 | Bacteria | 1123 |
| 308 | Ga0075434_100911680 | 3300006871 | Bacteria | 894 |
| 309 | Ga0075434_101756525 | 3300006871 | Bacteria | 628 |
| 310 | Ga0075434_101860463 | 3300006871 | Bacteria | 608 |
| 311 | Ga0075429_100002010 | 3300006880 | Bacteria | 16905 |
| 312 | Ga0075429_100010977 | 3300006880 | Bacteria | 7838 |
| 313 | Ga0075429_100011741 | 3300006880 | Bacteria | 7597 |
| 314 | Ga0075429_100013899 | 3300006880 | Bacteria | 6982 |
| 315 | Ga0075429_100014322 | 3300006880 | Bacteria | 6878 |
| 316 | Ga0075429_100023491 | 3300006880 | Bacteria | 5351 |
| 317 | Ga0075429_100095349 | 3300006880 | Bacteria | 2595 |
| 318 | Ga0075429_100102898 | 3300006880 | Bacteria | 2494 |
| 319 | Ga0075429_100175753 | 3300006880 | Bacteria | 1876 |
| 320 | Ga0075429_100178014 | 3300006880 | Bacteria | 1863 |
| 321 | Ga0075429_100183632 | 3300006880 | Bacteria | 1833 |
| 322 | Ga0075429_100230963 | 3300006880 | Bacteria | 1620 |
| 323 | Ga0075429_100312326 | 3300006880 | Unclassified | 1376 |
| 324 | Ga0068865_100078896 | 3300006881 | Bacteria | 2357 |
| 325 | Ga0068865_100080105 | 3300006881 | Bacteria | 2341 |
| 326 | Ga0075436_100044437 | 3300006914 | Bacteria | 3063 |
| 327 | Ga0075436_100084670 | 3300006914 | Bacteria | 2200 |
| 328 | Ga0075436_100086429 | 3300006914 | Bacteria | 2178 |
| 329 | Ga0075436_100127043 | 3300006914 | Bacteria | 1787 |
| 330 | Ga0075436_100383659 | 3300006914 | Unclassified | 1016 |
| 331 | Ga0075436_100466309 | 3300006914 | Bacteria | 921 |
| 332 | Ga0075436_100625026 | 3300006914 | Archaea | 794 |
| 333 | Ga0097620_100001562 | 3300006931 | Bacteria | 23360 |
| 334 | Ga0097620_100127803 | 3300006931 | Bacteria | 2612 |
| 335 | Ga0097620_100268459 | 3300006931 | Bacteria | 1798 |
| 336 | Ga0097620_100338733 | 3300006931 | Unclassified | 1598 |
| 337 | Ga0097620_100446301 | 3300006931 | Bacteria | 1390 |
| 338 | Ga0097620_100501536 | 3300006931 | Bacteria | 1309 |
| 339 | Ga0097620_100641246 | 3300006931 | Bacteria | 1154 |
| 340 | Ga0075435_100008582 | 3300007076 | Bacteria | 7343 |
| 341 | Ga0075435_100017075 | 3300007076 | Bacteria | 5484 |
| 342 | Ga0075435_100028763 | 3300007076 | Bacteria | 4360 |
| 343 | Ga0075435_100041954 | 3300007076 | Bacteria | 3658 |
| 344 | Ga0075435_100065361 | 3300007076 | Bacteria | 2957 |
| 345 | Ga0075435_100128630 | 3300007076 | Bacteria | 2118 |
| 346 | Ga0075435_100142348 | 3300007076 | Bacteria | 2012 |
| 347 | Ga0075435_100222577 | 3300007076 | Bacteria | 1603 |
| 348 | Ga0075435_100711065 | 3300007076 | Archaea | 873 |
| 349 | Ga0075435_100750633 | 3300007076 | Bacteria | 849 |
| 350 | Ga0099794_10003785 | 3300007265 | Bacteria | 5836 |
| 351 | Ga0099794_10007317 | 3300007265 | Bacteria | 4528 |
| 352 | Ga0099794_10053082 | 3300007265 | Bacteria | 1954 |
| 353 | Ga0099794_10399742 | 3300007265 | Bacteria | 717 |
| 354 | Ga0099794_10455910 | 3300007265 | Unclassified | 671 |
| 355 | Ga0111539_10000715 | 3300009094 | Bacteria | 43156 |
| 356 | Ga0111539_10000819 | 3300009094 | Bacteria | 40336 |
| 357 | Ga0111539_10001430 | 3300009094 | Bacteria | 31850 |
| 358 | Ga0111539_10047551 | 3300009094 | Bacteria | 5128 |
| 359 | Ga0111539_10076175 | 3300009094 | Bacteria | 3950 |
| 360 | Ga0105245_10800644 | 3300009098 | Bacteria | 980 |
| 361 | Ga0114129_10000409 | 3300009147 | Bacteria | 50603 |
| 362 | Ga0114129_10003438 | 3300009147 | Bacteria | 22264 |
| 363 | Ga0114129_10005405 | 3300009147 | Bacteria | 18037 |
| 364 | Ga0114129_10008975 | 3300009147 | Bacteria | 14257 |
| 365 | Ga0114129_10059492 | 3300009147 | Bacteria | 5341 |
| 366 | Ga0114129_10077976 | 3300009147 | Bacteria | 4608 |
| 367 | Ga0114129_10082816 | 3300009147 | Bacteria | 4457 |
| 368 | Ga0114129_10083036 | 3300009147 | Bacteria | 4451 |
| 369 | Ga0114129_10097283 | 3300009147 | Bacteria | 4075 |
| 370 | Ga0114129_10138195 | 3300009147 | Bacteria | 3343 |
| 371 | Ga0114129_10143481 | 3300009147 | Bacteria | 3272 |
| 372 | Ga0114129_10199854 | 3300009147 | Bacteria | 2708 |
| 373 | Ga0114129_10224251 | 3300009147 | Bacteria | 2534 |
| 374 | Ga0114129_10335894 | 3300009147 | Bacteria | 2005 |
| 375 | Ga0114129_10542462 | 3300009147 | Bacteria | 1513 |
| 376 | Ga0114129_10990084 | 3300009147 | Bacteria | 1059 |
| 377 | Ga0114129_11239651 | 3300009147 | Bacteria | 927 |
| 378 | Ga0114129_11562390 | 3300009147 | Bacteria | 809 |
| 379 | Ga0105243_10161636 | 3300009148 | Bacteria | 1931 |
| 380 | Ga0105243_10338732 | 3300009148 | Bacteria | 1377 |
| 381 | Ga0105243_10613718 | 3300009148 | Bacteria | 1049 |
| 382 | Ga0105241_10001344 | 3300009174 | Bacteria | 18669 |
| 383 | Ga0105241_10615983 | 3300009174 | Bacteria | 982 |
| 384 | Ga0105242_10021975 | 3300009176 | Bacteria | 5014 |
| 385 | Ga0105242_10190262 | 3300009176 | Bacteria | 1816 |
| 386 | Ga0105248_10186725 | 3300009177 | Bacteria | 2336 |
| 387 | Ga0105248_10189571 | 3300009177 | Bacteria | 2317 |
| 388 | Ga0105248_11738923 | 3300009177 | Unclassified | 707 |
| 389 | Ga0105237_10058839 | 3300009545 | Bacteria | 3846 |
| 390 | Ga0105238_10389887 | 3300009551 | Unclassified | 1385 |
| 391 | Ga0105249_10061301 | 3300009553 | Bacteria | 3452 |
| 392 | Ga0105249_10096471 | 3300009553 | Bacteria | 2774 |
| 393 | Ga0105249_10099318 | 3300009553 | Bacteria | 2735 |
| 394 | Ga0105249_10147254 | 3300009553 | Bacteria | 2263 |
| 395 | Ga0105249_10333816 | 3300009553 | Bacteria | 1531 |
| 396 | Ga0105249_10575338 | 3300009553 | Bacteria | 1179 |
| 397 | Ga0105249_11114596 | 3300009553 | Bacteria | 859 |
| 398 | Ga0105249_11652903 | 3300009553 | Bacteria | 713 |
| 399 | Ga0105246_10012663 | 3300011119 | Bacteria | 5269 |
| 400 | Ga0157373_10000101 | 3300013100 | Bacteria | 68799 |
| 401 | Ga0157371_10437079 | 3300013102 | Bacteria | 961 |
| 402 | Ga0157370_10275494 | 3300013104 | Bacteria | 1555 |
| 403 | Ga0157369_10012134 | 3300013105 | Bacteria | 9783 |
| 404 | Ga0157374_10446432 | 3300013296 | Bacteria | 1294 |
| 405 | Ga0157374_11080543 | 3300013296 | Bacteria | 823 |
| 406 | Ga0157378_10058823 | 3300013297 | Bacteria | 3428 |
| 407 | Ga0157378_12506964 | 3300013297 | Bacteria | 568 |
| 408 | Ga0163162_10489108 | 3300013306 | Bacteria | 1362 |
| 409 | Ga0163162_10884082 | 3300013306 | Bacteria | 1007 |
| 410 | Ga0157372_10000703 | 3300013307 | Bacteria | 36772 |
| 411 | Ga0157372_11118195 | 3300013307 | Bacteria | 911 |
| 412 | Ga0157375_10048022 | 3300013308 | Bacteria | 4173 |
| 413 | Ga0157375_10524051 | 3300013308 | Bacteria | 1348 |
| 414 | Ga0157375_10711959 | 3300013308 | Bacteria | 1157 |
| 415 | Ga0157375_12641858 | 3300013308 | Bacteria | 600 |
| 416 | Ga0163163_10152202 | 3300014325 | Bacteria | 2357 |
| 417 | Ga0163163_10159045 | 3300014325 | Archaea | 2304 |
| 418 | Ga0163163_10736290 | 3300014325 | Bacteria | 1049 |
| 419 | Ga0157380_10056424 | 3300014326 | Bacteria | 3123 |
| 420 | Ga0157380_10162064 | 3300014326 | Bacteria | 1945 |
| 421 | Ga0157380_10496505 | 3300014326 | Bacteria | 1184 |
| 422 | Ga0182008_10397785 | 3300014497 | Bacteria | 739 |
| 423 | Ga0157377_10303813 | 3300014745 | Bacteria | 1054 |
| 424 | Ga0157379_10166896 | 3300014968 | Bacteria | 1987 |
| 425 | Ga0157379_10902559 | 3300014968 | Bacteria | 838 |
| 426 | Ga0163161_10224342 | 3300017792 | Unclassified | 1456 |
| 427 | Ga0163161_11869771 | 3300017792 | Bacteria | 534 |
| 428 | Ga0206356_11442960 | 3300020070 | Bacteria | 782 |
| 429 | Ga0206354_10938711 | 3300020081 | Bacteria | 909 |
| 430 | Ga0207656_10067904 | 3300025321 | Bacteria | 1579 |
| 431 | Ga0207653_10019640 | 3300025885 | Bacteria | 2132 |
| 432 | Ga0207653_10071663 | 3300025885 | Bacteria | 1185 |
| 433 | Ga0207653_10229018 | 3300025885 | Bacteria | 708 |
| 434 | Ga0207692_10397937 | 3300025898 | Bacteria | 858 |
| 435 | Ga0207642_10292696 | 3300025899 | Bacteria | 941 |
| 436 | Ga0207642_10805140 | 3300025899 | Bacteria | 598 |
| 437 | Ga0207680_10158576 | 3300025903 | Bacteria | 1515 |
| 438 | Ga0207647_10049061 | 3300025904 | Bacteria | 2620 |
| 439 | Ga0207645_10000852 | 3300025907 | Bacteria | 25412 |
| 440 | Ga0207645_10013648 | 3300025907 | Bacteria | 5467 |
| 441 | Ga0207643_10000150 | 3300025908 | Bacteria | 47605 |
| 442 | Ga0207684_10000996 | 3300025910 | Bacteria | 31775 |
| 443 | Ga0207684_10001569 | 3300025910 | Bacteria | 24376 |
| 444 | Ga0207684_10002411 | 3300025910 | Bacteria | 18877 |
| 445 | Ga0207684_10008157 | 3300025910 | Bacteria | 9330 |
| 446 | Ga0207684_10028553 | 3300025910 | Bacteria | 4753 |
| 447 | Ga0207684_10052166 | 3300025910 | Bacteria | 3471 |
| 448 | Ga0207684_10182336 | 3300025910 | Bacteria | 1810 |
| 449 | Ga0207684_10239761 | 3300025910 | Bacteria | 1564 |
| 450 | Ga0207684_10284387 | 3300025910 | Bacteria | 1426 |
| 451 | Ga0207684_10313165 | 3300025910 | Bacteria | 1353 |
| 452 | Ga0207684_10387267 | 3300025910 | Bacteria | 1202 |
| 453 | Ga0207684_10462277 | 3300025910 | Bacteria | 1089 |
| 454 | Ga0207684_10506424 | 3300025910 | Bacteria | 1035 |
| 455 | Ga0207684_10521690 | 3300025910 | Bacteria | 1017 |
| 456 | Ga0207654_10029377 | 3300025911 | Bacteria | 3009 |
| 457 | Ga0207654_10119642 | 3300025911 | Bacteria | 1652 |
| 458 | Ga0207707_10000076 | 3300025912 | Bacteria | 100491 |
| 459 | Ga0207707_10031856 | 3300025912 | Bacteria | 4616 |
| 460 | Ga0207707_10102064 | 3300025912 | Bacteria | 2507 |
| 461 | Ga0207707_10140157 | 3300025912 | Bacteria | 2115 |
| 462 | Ga0207707_10336183 | 3300025912 | Bacteria | 1303 |
| 463 | Ga0207663_10698262 | 3300025916 | Bacteria | 803 |
| 464 | Ga0207660_10000022 | 3300025917 | Bacteria | 72537 |
| 465 | Ga0207660_10048361 | 3300025917 | Bacteria | 3009 |
| 466 | Ga0207662_10023135 | 3300025918 | Bacteria | 3567 |
| 467 | Ga0207657_10000005 | 3300025919 | Bacteria | 213481 |
| 468 | Ga0207649_10003591 | 3300025920 | Bacteria | 8473 |
| 469 | Ga0207652_10000060 | 3300025921 | Bacteria | 113511 |
| 470 | Ga0207652_10023677 | 3300025921 | Bacteria | 5088 |
| 471 | Ga0207652_10069077 | 3300025921 | Bacteria | 3066 |
| 472 | Ga0207652_10078641 | 3300025921 | Bacteria | 2880 |
| 473 | Ga0207652_10349596 | 3300025921 | Bacteria | 1334 |
| 474 | Ga0207646_10001766 | 3300025922 | Bacteria | 26193 |
| 475 | Ga0207646_10006356 | 3300025922 | Bacteria | 12224 |
| 476 | Ga0207646_10008955 | 3300025922 | Bacteria | 9961 |
| 477 | Ga0207646_10016669 | 3300025922 | Bacteria | 6891 |
| 478 | Ga0207646_10040356 | 3300025922 | Bacteria | 4197 |
| 479 | Ga0207646_10114641 | 3300025922 | Bacteria | 2420 |
| 480 | Ga0207646_10141204 | 3300025922 | Bacteria | 2169 |
| 481 | Ga0207646_10159756 | 3300025922 | Bacteria | 2033 |
| 482 | Ga0207646_10424425 | 3300025922 | Unclassified | 1200 |
| 483 | Ga0207646_10487366 | 3300025922 | Unclassified | 1111 |
| 484 | Ga0207646_10601260 | 3300025922 | Bacteria | 987 |
| 485 | Ga0207646_11349769 | 3300025922 | Bacteria | 621 |
| 486 | Ga0207681_10007091 | 3300025923 | Bacteria | 6872 |
| 487 | Ga0207681_10211310 | 3300025923 | Unclassified | 1496 |
| 488 | Ga0207681_10459040 | 3300025923 | Bacteria | 1037 |
| 489 | Ga0207681_10605141 | 3300025923 | Unclassified | 906 |
| 490 | Ga0207681_10681995 | 3300025923 | Bacteria | 853 |
| 491 | Ga0207694_11095009 | 3300025924 | Unclassified | 674 |
| 492 | Ga0207694_11661090 | 3300025924 | Bacteria | 538 |
| 493 | Ga0207650_10072410 | 3300025925 | Bacteria | 2594 |
| 494 | Ga0207659_10248049 | 3300025926 | Bacteria | 1444 |
| 495 | Ga0207659_10916707 | 3300025926 | Unclassified | 753 |
| 496 | Ga0207644_10458373 | 3300025931 | Bacteria | 1048 |
| 497 | Ga0207690_10006358 | 3300025932 | Bacteria | 7000 |
| 498 | Ga0207706_10027460 | 3300025933 | Bacteria | 5088 |
| 499 | Ga0207706_10063115 | 3300025933 | Bacteria | 3262 |
| 500 | Ga0207686_10322557 | 3300025934 | Bacteria | 1154 |
| 501 | Ga0207709_10017341 | 3300025935 | Bacteria | 4018 |
| 502 | Ga0207709_10380646 | 3300025935 | Bacteria | 1074 |
| 503 | Ga0207709_10697026 | 3300025935 | Bacteria | 812 |
| 504 | Ga0207709_10725893 | 3300025935 | Bacteria | 797 |
| 505 | Ga0207670_10008129 | 3300025936 | Bacteria | 5903 |
| 506 | Ga0207704_10233523 | 3300025938 | Bacteria | 1369 |
| 507 | Ga0207704_10308151 | 3300025938 | Bacteria | 1216 |
| 508 | Ga0207704_10502297 | 3300025938 | Bacteria | 978 |
| 509 | Ga0207665_10005354 | 3300025939 | Bacteria | 8566 |
| 510 | Ga0207691_10037324 | 3300025940 | Bacteria | 4499 |
| 511 | Ga0207691_10216845 | 3300025940 | Bacteria | 1660 |
| 512 | Ga0207711_10279211 | 3300025941 | Bacteria | 1538 |
| 513 | Ga0207711_11332540 | 3300025941 | Bacteria | 660 |
| 514 | Ga0207689_10000050 | 3300025942 | Bacteria | 88556 |
| 515 | Ga0207689_10004262 | 3300025942 | Bacteria | 13006 |
| 516 | Ga0207689_10198354 | 3300025942 | Bacteria | 1656 |
| 517 | Ga0207661_10109543 | 3300025944 | Bacteria | 2333 |
| 518 | Ga0207661_10436733 | 3300025944 | Bacteria | 1191 |
| 519 | Ga0207661_10651228 | 3300025944 | Unclassified | 968 |
| 520 | Ga0207679_10002376 | 3300025945 | Bacteria | 11579 |
| 521 | Ga0207667_10000587 | 3300025949 | Bacteria | 47372 |
| 522 | Ga0207667_10343624 | 3300025949 | Unclassified | 1523 |
| 523 | Ga0207651_10011721 | 3300025960 | Bacteria | 4920 |
| 524 | Ga0207712_10050600 | 3300025961 | Bacteria | 2902 |
| 525 | Ga0207712_10306567 | 3300025961 | Bacteria | 1305 |
| 526 | Ga0207712_10670257 | 3300025961 | Bacteria | 903 |
| 527 | Ga0207712_10768261 | 3300025961 | Bacteria | 845 |
| 528 | Ga0207712_11199756 | 3300025961 | Bacteria | 677 |
| 529 | Ga0207668_10401152 | 3300025972 | Bacteria | 1159 |
| 530 | Ga0207668_10630763 | 3300025972 | Bacteria | 936 |
| 531 | Ga0207640_10049758 | 3300025981 | Bacteria | 2715 |
| 532 | Ga0207640_10211929 | 3300025981 | Bacteria | 1476 |
| 533 | Ga0207640_11060467 | 3300025981 | Bacteria | 715 |
| 534 | Ga0207677_10436860 | 3300026023 | Unclassified | 1118 |
| 535 | Ga0207677_10836824 | 3300026023 | Bacteria | 826 |
| 536 | Ga0207703_10060648 | 3300026035 | Bacteria | 3093 |
| 537 | Ga0207639_10049105 | 3300026041 | Bacteria | 3197 |
| 538 | Ga0207639_11404783 | 3300026041 | Unclassified | 655 |
| 539 | Ga0207678_10001742 | 3300026067 | Bacteria | 19912 |
| 540 | Ga0207678_10318709 | 3300026067 | Bacteria | 1337 |
| 541 | Ga0207708_10124948 | 3300026075 | Bacteria | 2007 |
| 542 | Ga0207708_10542310 | 3300026075 | Bacteria | 980 |
| 543 | Ga0207702_10098091 | 3300026078 | Bacteria | 2580 |
| 544 | Ga0207702_10691902 | 3300026078 | Bacteria | 1004 |
| 545 | Ga0207702_10928924 | 3300026078 | Bacteria | 862 |
| 546 | Ga0207641_10022956 | 3300026088 | Bacteria | 5139 |
| 547 | Ga0207641_10335830 | 3300026088 | Bacteria | 1437 |
| 548 | Ga0207641_10520199 | 3300026088 | Bacteria | 1157 |
| 549 | Ga0207641_11021133 | 3300026088 | Bacteria | 824 |
| 550 | Ga0207648_10005797 | 3300026089 | Bacteria | 12374 |
| 551 | Ga0207648_10038731 | 3300026089 | Bacteria | 4194 |
| 552 | Ga0207648_10067171 | 3300026089 | Bacteria | 3126 |
| 553 | Ga0207648_10131629 | 3300026089 | Bacteria | 2202 |
| 554 | Ga0207648_10146922 | 3300026089 | Bacteria | 2080 |
| 555 | Ga0207676_10061331 | 3300026095 | Bacteria | 2977 |
| 556 | Ga0207676_10197607 | 3300026095 | Bacteria | 1774 |
| 557 | Ga0207676_11038288 | 3300026095 | Unclassified | 809 |
| 558 | Ga0207674_10000075 | 3300026116 | Bacteria | 105297 |
| 559 | Ga0207674_10036958 | 3300026116 | Bacteria | 5082 |
| 560 | Ga0207674_10067327 | 3300026116 | Bacteria | 3605 |
| 561 | Ga0207674_10084664 | 3300026116 | Bacteria | 3168 |
| 562 | Ga0207675_100012152 | 3300026118 | Bacteria | 8042 |
| 563 | Ga0207675_100229606 | 3300026118 | Bacteria | 1790 |
| 564 | Ga0210000_1009137 | 3300027462 | Bacteria | 1457 |
| 565 | Ga0209983_1022072 | 3300027665 | Bacteria | 1333 |
| 566 | Ga0209588_1002125 | 3300027671 | Bacteria | 5346 |
| 567 | Ga0209588_1077971 | 3300027671 | Bacteria | 1071 |
| 568 | Ga0209998_10141696 | 3300027717 | Bacteria | 614 |
| 569 | Ga0209974_10046506 | 3300027876 | Bacteria | 1451 |
| 570 | Ga0207428_10000009 | 3300027907 | Bacteria | 410565 |
| 571 | Ga0207428_10000631 | 3300027907 | Bacteria | 41443 |
| 572 | Ga0207428_10109497 | 3300027907 | Bacteria | 2127 |
| 573 | Ga0207428_10560977 | 3300027907 | Bacteria | 825 |
| 574 | Ga0207428_10970037 | 3300027907 | Bacteria | 598 |
| 575 | Ga0268266_10873953 | 3300028379 | Unclassified | 869 |
| 576 | Ga0268265_10007375 | 3300028380 | Bacteria | 7425 |
| 577 | Ga0268265_10067642 | 3300028380 | Bacteria | 2766 |
| 578 | Ga0268265_10090858 | 3300028380 | Bacteria | 2440 |
| 579 | Ga0268265_10177003 | 3300028380 | Unclassified | 1829 |
| 580 | Ga0268265_10467559 | 3300028380 | Bacteria | 1181 |
| 581 | Ga0268265_10945312 | 3300028380 | Unclassified | 849 |
| 582 | Ga0268264_10020679 | 3300028381 | Bacteria | 5377 |
| 583 | Ga0268264_10030980 | 3300028381 | Bacteria | 4386 |
| 584 | Ga0268264_10092992 | 3300028381 | Bacteria | 2604 |
| 585 | Ga0268264_10260110 | 3300028381 | Bacteria | 1616 |
| 586 | Ga0268264_10657248 | 3300028381 | Bacteria | 1038 |
| 587 | Ga0268264_10710385 | 3300028381 | Bacteria | 999 |
| 588 | Ga0268264_11928651 | 3300028381 | Bacteria | 600 |
| 589 | Ga0265325_10005355 | 3300031241 | Bacteria | 7935 |
| 590 | Ga0307509_10067942 | 3300031507 | Bacteria | 3731 |
| 591 | Ga0307408_100029740 | 3300031548 | Bacteria | 3788 |
| 592 | Ga0307408_100044097 | 3300031548 | Bacteria | 3177 |
| 593 | Ga0307408_100222053 | 3300031548 | Bacteria | 1542 |
| 594 | Ga0307405_10111668 | 3300031731 | Unclassified | 1853 |
| 595 | Ga0307405_10273264 | 3300031731 | Bacteria | 1268 |
| 596 | Ga0307410_11763437 | 3300031852 | Unclassified | 549 |
| 597 | Ga0307406_10078084 | 3300031901 | Bacteria | 2192 |
| 598 | Ga0307407_10585805 | 3300031903 | Bacteria | 829 |
| 599 | Ga0307412_10923570 | 3300031911 | Bacteria | 766 |
| 600 | Ga0307416_100001116 | 3300032002 | Bacteria | 14425 |
| 601 | Ga0307416_100521610 | 3300032002 | Bacteria | 1256 |
| 602 | Ga0307416_102064962 | 3300032002 | Bacteria | 672 |
| 603 | Ga0307411_10100729 | 3300032005 | Bacteria | 2042 |
| 604 | Ga0307411_10491308 | 3300032005 | Bacteria | 1036 |
| 605 | Ga0307411_10961862 | 3300032005 | Bacteria | 762 |
| 606 | Ga0307415_100263008 | 3300032126 | Bacteria | 1409 |
| 607 | Ga0307415_101943541 | 3300032126 | Bacteria | 572 |
| 608 | Ga0373930_0045200 | 3300034816 | Bacteria | 948 |
| 609 | Ga0373948_0022860 | 3300034817 | Bacteria | 1208 |
| 610 | Ga0373958_0038403 | 3300034819 | Unclassified | 970 |
| 611 | Ga0373959_0011123 | 3300034820 | Bacteria | 1584 |
| 612 | Ga0373934_0263500 | 3300035086 | Bacteria | 713 |
| 613 | Ga0373940_0002057 | 3300035088 | Bacteria | 3821 |
| 614 | Ga0373940_0022837 | 3300035088 | Bacteria | 1610 |
| 615 | Ga0373949_0001137 | 3300035090 | Bacteria | 7993 |
| 616 | Ga0373949_0154028 | 3300035090 | Bacteria | 666 |
| 617 | Ga0373951_0021372 | 3300035091 | Bacteria | 1486 |
| 618 | Ga0373952_0051068 | 3300035092 | Bacteria | 986 |
| 619 | Ga0373952_0066762 | 3300035092 | Bacteria | 891 |
| 620 | Ga0373932_0114584 | 3300035112 | Bacteria | 892 |
| 621 | Ga0373939_0390273 | 3300035114 | Bacteria | 575 |
| 622 | Ga0373941_0124486 | 3300035115 | Bacteria | 922 |
| 623 | Ga0373945_0460582 | 3300035116 | Unclassified | 563 |
| 624 | Ga0373960_0032851 | 3300035121 | Bacteria | 1459 |
| 625 | Ga0373960_0246812 | 3300035121 | Unclassified | 647 |
| 626 | Ga0373943_0011173 | 3300035170 | Bacteria | 4037 |
| 627 | Ga0373942_0057071 | 3300035207 | Bacteria | 1110 |
| 628 | Ga0373942_0080498 | 3300035207 | Bacteria | 966 |
| 629 | Ga0373961_0003927 | 3300035241 | Bacteria | 3630 |
| 630 | Ga0373961_0076866 | 3300035241 | Bacteria | 1043 |
| 631 | Ga0373962_0006756 | 3300035242 | Bacteria | 2786 |
| 632 | Ga0373962_0011889 | 3300035242 | Bacteria | 2188 |
| 633 | Ga0373931_0005358 | 3300035691 | Bacteria | 5920 |
| 634 | Ga0373931_0009773 | 3300035691 | Bacteria | 4594 |
| 635 | Ga0373931_0104028 | 3300035691 | Bacteria | 1601 |
| 636 | Ga0373931_0315703 | 3300035691 | Bacteria | 969 |
| 637 | Ga0373933_0329719 | 3300035724 | Bacteria | 990 |
| 638 | Ga0395899_0005710 | 3300037312 | Bacteria | 9659 |
| 639 | Ga0395900_0005301 | 3300037418 | Bacteria | 13516 |
| 640 | Ga0395900_0254312 | 3300037418 | Bacteria | 1757 |
| 641 | Ga0395898_0007244 | 3300037466 | Bacteria | 11772 |
| 642 | Ga0395898_1322176 | 3300037466 | Unclassified | 650 |
| 643 | Ga0395905_0048060 | 3300037471 | Bacteria | 3999 |
| 644 | Ga0395901_0137841 | 3300038443 | Bacteria | 2564 |
| 645 | Ga0395901_0718524 | 3300038443 | Bacteria | 995 |
| 646 | Ga0395901_0915858 | 3300038443 | Bacteria | 858 |
| 647 | Ga0436361_0067535 | 3300039447 | Unclassified | 1083 |
| 648 | Ga0436363_0822832 | 3300039450 | Unclassified | 615 |
| 649 | Ga0436363_1398976 | 3300039450 | Unclassified | 731 |
| 650 | Ga0439448_0020856 | 3300042005 | Bacteria | 2031 |
| 651 | Ga0439455_0025065 | 3300042012 | Bacteria | 1447 |
| 652 | Ga0439455_0049398 | 3300042012 | Bacteria | 1096 |
| 653 | Ga0450889_013854 | 3300042144 | Bacteria | 855 |
| 654 | Ga0439458_0008415 | 3300042157 | Bacteria | 2296 |
| 655 | Ga0439459_0024084 | 3300042438 | Unclassified | 1191 |
| 656 | Ga0439459_0046145 | 3300042438 | Bacteria | 942 |
| 657 | Ga0439460_0077985 | 3300042461 | Bacteria | 1036 |
| 658 | Ga0451577_0003313 | 3300042876 | Bacteria | 18095 |
| 659 | Ga0451577_0054622 | 3300042876 | Bacteria | 3565 |
| 660 | Ga0451577_0100573 | 3300042876 | Bacteria | 2582 |
| 661 | Ga0451577_0182142 | 3300042876 | Bacteria | 1894 |
| 662 | Ga0451577_0510865 | 3300042876 | Bacteria | 1091 |
| 663 | Ga0466972_0207976 | 3300044658 | Bacteria | 916 |
| 664 | Ga0453683_0008769 | 3300044673 | Bacteria | 6778 |
| 665 | Ga0453683_0107187 | 3300044673 | Unclassified | 1756 |
| 666 | Ga0453683_0137695 | 3300044673 | Bacteria | 1540 |
| 667 | Ga0466961_0608984 | 3300044693 | Bacteria | 657 |
| 668 | Ga0453684_0023688 | 3300044712 | Bacteria | 9021 |
| 669 | Ga0453684_0030957 | 3300044712 | Bacteria | 7540 |
| 670 | Ga0453684_0082959 | 3300044712 | Bacteria | 3991 |
| 671 | Ga0451576_0006637 | 3300045051 | Bacteria | 14133 |
| 672 | Ga0451576_0022946 | 3300045051 | Bacteria | 6762 |
| 673 | Ga0451576_0024715 | 3300045051 | Bacteria | 6486 |
| 674 | Ga0451576_0029219 | 3300045051 | Bacteria | 5899 |
| 675 | Ga0451576_0051221 | 3300045051 | Bacteria | 4328 |
| 676 | Ga0451576_0678385 | 3300045051 | Bacteria | 1083 |
| 677 | Ga0466967_0536850 | 3300045976 | Bacteria | 1150 |
| 678 | Ga0466967_1580040 | 3300045976 | Bacteria | 653 |
| 679 | Ga0466967_2054182 | 3300045976 | Bacteria | 568 |
| 680 | Ga0495603_0538655 | 3300046455 | Bacteria | 669 |
| 681 | Ga0495651_0537884 | 3300046462 | Bacteria | 744 |
| 682 | Ga0495580_0001861 | 3300046472 | Bacteria | 18550 |
| 683 | Ga0495580_0472434 | 3300046472 | Bacteria | 839 |
| 684 | Ga0495584_0669906 | 3300046491 | Bacteria | 529 |
| 685 | Ga0495584_0674244 | 3300046491 | Unclassified | 527 |
| 686 | Ga0495594_0091689 | 3300046499 | Bacteria | 1703 |
| 687 | Ga0495607_0335206 | 3300046501 | Bacteria | 702 |
| 688 | Ga0495628_0289371 | 3300046516 | Bacteria | 1215 |
| 689 | Ga0495642_0098964 | 3300046528 | Bacteria | 1240 |
| 690 | Ga0495642_0402460 | 3300046528 | Bacteria | 604 |
| 691 | Ga0495642_0528914 | 3300046528 | Bacteria | 523 |
| 692 | Ga0495652_0554207 | 3300046529 | Bacteria | 790 |
| 693 | Ga0495656_0350537 | 3300046615 | Bacteria | 765 |
| 694 | Ga0495599_0178882 | 3300046678 | Bacteria | 1308 |
| 695 | Ga0495623_0102012 | 3300046679 | Bacteria | 1748 |
| 696 | Ga0495646_0522226 | 3300046680 | Bacteria | 608 |
| 697 | Ga0495669_0099714 | 3300046684 | Bacteria | 1348 |
| 698 | Ga0495669_0637634 | 3300046684 | Bacteria | 518 |
| 699 | Ga0495613_0474799 | 3300046689 | Bacteria | 845 |
| 700 | Ga0495636_0592228 | 3300047318 | Bacteria | 542 |
| 701 | Ga0495674_1209400 | 3300047319 | Bacteria | 571 |
| 702 | Ga0495602_0056861 | 3300048088 | Bacteria | 3437 |
| 703 | Ga0495602_0190760 | 3300048088 | Unclassified | 1572 |
| 704 | Ga0496102_0030748 | 3300048905 | Bacteria | 4808 |
| 705 | Ga0496102_0100319 | 3300048905 | Bacteria | 2688 |
| 706 | Ga0496104_0307557 | 3300048907 | Bacteria | 1498 |
| 707 | Ga0496106_0066708 | 3300048909 | Bacteria | 2742 |
| 708 | Ga0496106_0165429 | 3300048909 | Bacteria | 1751 |
| 709 | Ga0496107_0155165 | 3300048910 | Bacteria | 1695 |
| 710 | Ga0496109_0350859 | 3300048912 | Bacteria | 1394 |
| 711 | Ga0496109_0833305 | 3300048912 | Bacteria | 860 |
| 712 | Ga0496110_0166215 | 3300048913 | Bacteria | 2001 |
| 713 | Ga0496111_0188069 | 3300048914 | Bacteria | 1535 |
| 714 | Ga0496112_0037103 | 3300048915 | Bacteria | 4758 |
| 715 | Ga0496112_0812371 | 3300048915 | Unclassified | 859 |
| 716 | Ga0496113_0344742 | 3300048916 | Unclassified | 1195 |
| 717 | Ga0501298_043407 | 3300049521 | Bacteria | 916 |
| 718 | Ga0501033_0060859 | 3300049570 | Bacteria | 2784 |
| 719 | Ga0501034_0430056 | 3300049571 | Unclassified | 1240 |
| 720 | Ga0501036_0497695 | 3300049572 | Bacteria | 1014 |
| 721 | Ga0501036_0949161 | 3300049572 | Bacteria | 705 |
| 722 | Ga0501036_1038556 | 3300049572 | Unclassified | 670 |
| 723 | Ga0501037_0167325 | 3300049573 | Bacteria | 1565 |
| 724 | Ga0501037_0970061 | 3300049573 | Unclassified | 555 |
| 725 | Ga0501038_0372246 | 3300049574 | Bacteria | 1109 |
| 726 | Ga0501038_0394070 | 3300049574 | Bacteria | 1072 |
| 727 | Ga0501039_0073727 | 3300049575 | Bacteria | 2652 |
| 728 | Ga0501040_0005074 | 3300049576 | Bacteria | 8508 |
| 729 | Ga0501040_0033093 | 3300049576 | Bacteria | 3500 |
| 730 | Ga0501040_0050315 | 3300049576 | Bacteria | 2850 |
| 731 | Ga0501040_0169625 | 3300049576 | Bacteria | 1545 |
| 732 | Ga0501040_1098407 | 3300049576 | Bacteria | 577 |
| 733 | Ga0501041_0059321 | 3300049577 | Bacteria | 2342 |
| 734 | Ga0501041_0200888 | 3300049577 | Bacteria | 1249 |
| 735 | Ga0501041_0318678 | 3300049577 | Bacteria | 981 |
| 736 | Ga0501041_0712555 | 3300049577 | Unclassified | 642 |
| 737 | Ga0501042_0135706 | 3300049578 | Bacteria | 1774 |
| 738 | Ga0501042_0531805 | 3300049578 | Bacteria | 854 |
| 739 | Ga0501042_1023688 | 3300049578 | Bacteria | 602 |
| 740 | Ga0501043_0361466 | 3300049579 | Bacteria | 1102 |
| 741 | Ga0501043_0548862 | 3300049579 | Bacteria | 859 |
| 742 | Ga0501043_0738110 | 3300049579 | Bacteria | 717 |
| 743 | Ga0501043_0814236 | 3300049579 | Bacteria | 675 |
| 744 | Ga0501043_0940766 | 3300049579 | Bacteria | 618 |
| 745 | Ga0501046_0090245 | 3300049580 | Bacteria | 2358 |
| 746 | Ga0501046_0486811 | 3300049580 | Unclassified | 885 |
| 747 | Ga0501048_0078831 | 3300049582 | Bacteria | 2325 |
| 748 | Ga0501048_0556054 | 3300049582 | Bacteria | 823 |
| 749 | Ga0501067_0018104 | 3300049583 | Bacteria | 3901 |
| 750 | Ga0501067_0065519 | 3300049583 | Bacteria | 2011 |
| 751 | Ga0501068_0029632 | 3300049584 | Bacteria | 3242 |
| 752 | Ga0501068_0077246 | 3300049584 | Bacteria | 2039 |
| 753 | Ga0501068_0195644 | 3300049584 | Bacteria | 1282 |
| 754 | Ga0501068_0442146 | 3300049584 | Bacteria | 841 |
| 755 | Ga0501069_0030340 | 3300049585 | Bacteria | 2969 |
| 756 | Ga0501069_0129532 | 3300049585 | Bacteria | 1444 |
| 757 | Ga0501069_0475263 | 3300049585 | Bacteria | 744 |
| 758 | Ga0501071_0074452 | 3300049587 | Bacteria | 2478 |
| 759 | Ga0501071_0128859 | 3300049587 | Bacteria | 1879 |
| 760 | Ga0501071_0302888 | 3300049587 | Bacteria | 1212 |
| 761 | Ga0501072_0136345 | 3300049588 | Bacteria | 1957 |
| 762 | Ga0501072_0181917 | 3300049588 | Bacteria | 1677 |
| 763 | Ga0501072_0206515 | 3300049588 | Bacteria | 1566 |
| 764 | Ga0501072_0935520 | 3300049588 | Bacteria | 677 |
| 765 | Ga0501072_1383178 | 3300049588 | Bacteria | 544 |
| 766 | Ga0501074_0219130 | 3300049590 | Bacteria | 1355 |
| 767 | Ga0501074_0381183 | 3300049590 | Bacteria | 1000 |
| 768 | Ga0501074_0439368 | 3300049590 | Bacteria | 925 |
| 769 | Ga0501074_0921760 | 3300049590 | Bacteria | 615 |
| 770 | Ga0501075_0039504 | 3300049591 | Bacteria | 3532 |
| 771 | Ga0501075_0050064 | 3300049591 | Bacteria | 3140 |
| 772 | Ga0501075_0103517 | 3300049591 | Bacteria | 2163 |
| 773 | Ga0501075_0108776 | 3300049591 | Bacteria | 2107 |
| 774 | Ga0501075_0120193 | 3300049591 | Bacteria | 1999 |
| 775 | Ga0501075_0143600 | 3300049591 | Bacteria | 1819 |
| 776 | Ga0501075_0178358 | 3300049591 | Bacteria | 1621 |
| 777 | Ga0501075_0181089 | 3300049591 | Unclassified | 1607 |
| 778 | Ga0501075_0324184 | 3300049591 | Bacteria | 1174 |
| 779 | Ga0501075_0427783 | 3300049591 | Bacteria | 1009 |
| 780 | Ga0501075_0595065 | 3300049591 | Unclassified | 844 |
| 781 | Ga0501075_0630076 | 3300049591 | Bacteria | 818 |
| 782 | Ga0501076_0016029 | 3300049592 | Bacteria | 5672 |
| 783 | Ga0501076_0019510 | 3300049592 | Bacteria | 5184 |
| 784 | Ga0501076_0178291 | 3300049592 | Bacteria | 1732 |
| 785 | Ga0501076_0986157 | 3300049592 | Unclassified | 694 |
| 786 | Ga0501077_0020298 | 3300049593 | Bacteria | 4205 |
| 787 | Ga0501077_0023045 | 3300049593 | Bacteria | 3949 |
| 788 | Ga0501077_0057806 | 3300049593 | Bacteria | 2462 |
| 789 | Ga0501077_0526450 | 3300049593 | Bacteria | 758 |
| 790 | Ga0501077_0585850 | 3300049593 | Bacteria | 716 |
| 791 | Ga0501077_0800068 | 3300049593 | Unclassified | 606 |
| 792 | Ga0501235_180068 | 3300049669 | Bacteria | 563 |
| 793 | Ga0501236_032159 | 3300049670 | Bacteria | 835 |
| 794 | Ga0501239_072033 | 3300049672 | Bacteria | 539 |
| 795 | Ga0501079_0002847 | 3300049741 | Bacteria | 12617 |
| 796 | Ga0501079_0035747 | 3300049741 | Bacteria | 3825 |
| 797 | Ga0501079_0083660 | 3300049741 | Bacteria | 2468 |
| 798 | Ga0501079_0186289 | 3300049741 | Bacteria | 1620 |
| 799 | Ga0501079_0256263 | 3300049741 | Bacteria | 1367 |
| 800 | Ga0501079_0344740 | 3300049741 | Unclassified | 1167 |
| 801 | Ga0501079_0404663 | 3300049741 | Bacteria | 1070 |
| 802 | Ga0501079_1232217 | 3300049741 | Bacteria | 589 |
| 803 | Ga0501080_0074798 | 3300049742 | Bacteria | 3151 |
| 804 | Ga0501080_0364878 | 3300049742 | Unclassified | 1303 |
| 805 | Ga0501080_0660533 | 3300049742 | Bacteria | 924 |
| 806 | Ga0501080_0957166 | 3300049742 | Bacteria | 744 |
| 807 | Ga0501081_0003659 | 3300049743 | Bacteria | 9845 |
| 808 | Ga0501081_0054040 | 3300049743 | Bacteria | 2774 |
| 809 | Ga0501081_0056281 | 3300049743 | Bacteria | 2718 |
| 810 | Ga0501081_0094403 | 3300049743 | Bacteria | 2107 |
| 811 | Ga0501081_0173265 | 3300049743 | Bacteria | 1558 |
| 812 | Ga0501081_0296014 | 3300049743 | Bacteria | 1187 |
| 813 | Ga0501081_0644455 | 3300049743 | Bacteria | 794 |
| 814 | Ga0501081_1271718 | 3300049743 | Unclassified | 558 |
| 815 | Ga0501081_1351810 | 3300049743 | Bacteria | 540 |
| 816 | Ga0501083_0506763 | 3300049744 | Bacteria | 786 |
| 817 | Ga0501035_0503081 | 3300049822 | Bacteria | 997 |
| 818 | Ga0501045_0075038 | 3300049824 | Bacteria | 2490 |
| 819 | Ga0501045_0182607 | 3300049824 | Unclassified | 1563 |
| 820 | Ga0501045_0279710 | 3300049824 | Unclassified | 1242 |
| 821 | Ga0501045_0408178 | 3300049824 | Bacteria | 1011 |
| 822 | Ga0501045_0536946 | 3300049824 | Bacteria | 868 |
| 823 | Ga0501045_0622047 | 3300049824 | Unclassified | 799 |
| 824 | Ga0501045_0762198 | 3300049824 | Unclassified | 713 |
| 825 | Ga0501045_1002928 | 3300049824 | Bacteria | 612 |
| 826 | nmdc:mga05p37_100067_c1 | 3300050507 | Bacteria | 3570 |
| 827 | nmdc:mga05p37_109212_c1 | 3300050507 | Bacteria | 3403 |
| 828 | nmdc:mga05p37_110969_c2 | 3300050507 | Bacteria | 2096 |
| 829 | nmdc:mga05p37_11843_c1 | 3300050507 | Bacteria | 10394 |
| 830 | nmdc:mga05p37_168904_c1 | 3300050507 | Bacteria | 2669 |
| 831 | nmdc:mga05p37_17944_c1 | 3300050507 | Bacteria | 8544 |
| 832 | nmdc:mga05p37_219498_c1 | 3300050507 | Bacteria | 2295 |
| 833 | nmdc:mga05p37_251625_c1 | 3300050507 | Bacteria | 2119 |
| 834 | nmdc:mga05p37_358580_c1 | 3300050507 | Bacteria | 1715 |
| 835 | nmdc:mga05p37_3637_c1 | 3300050507 | Bacteria | 18022 |
| 836 | nmdc:mga05p37_43265_c1 | 3300050507 | Bacteria | 5540 |
| 837 | nmdc:mga05p37_434265_c1 | 3300050507 | Bacteria | 1525 |
| 838 | nmdc:mga05p37_449532_c1 | 3300050507 | Bacteria | 1492 |
| 839 | nmdc:mga05p37_56510_c1 | 3300050507 | Bacteria | 4833 |
| 840 | nmdc:mga05p37_634435_c1 | 3300050507 | Archaea | 1200 |
| 841 | nmdc:mga05p37_72141_c1 | 3300050507 | Bacteria | 4248 |
| 842 | nmdc:mga05p37_8064_c1 | 3300050507 | Bacteria | 12441 |
| 843 | nmdc:mga05p37_8089_c1 | 3300050507 | Bacteria | 12428 |
| 844 | nmdc:mga09592_108170_c1 | 3300050508 | Bacteria | 2385 |
| 845 | nmdc:mga09592_1470980_c1 | 3300050508 | Unclassified | 555 |
| 846 | nmdc:mga09592_153742_c1 | 3300050508 | Bacteria | 1985 |
| 847 | nmdc:mga09592_254165_c1 | 3300050508 | Bacteria | 1523 |
| 848 | nmdc:mga09592_26657_c1 | 3300050508 | Bacteria | 4790 |
| 849 | nmdc:mga09592_302111_c1 | 3300050508 | Bacteria | 1388 |
| 850 | nmdc:mga09592_313007_c1 | 3300050508 | Unclassified | 1360 |
| 851 | nmdc:mga09592_333651_c1 | 3300050508 | Bacteria | 1313 |
| 852 | nmdc:mga09592_417946_c1 | 3300050508 | Bacteria | 1159 |
| 853 | nmdc:mga09592_4377_c1 | 3300050508 | Bacteria | 11419 |
| 854 | nmdc:mga09592_7564_c1 | 3300050508 | Bacteria | 8838 |
| 855 | nmdc:mga09592_780320_c1 | 3300050508 | Bacteria | 809 |
| 856 | nmdc:mga09592_818_c1 | 3300050508 | Bacteria | 24062 |
| 857 | nmdc:mga09592_82381_c1 | 3300050508 | Bacteria | 2742 |
| 858 | nmdc:mga09592_95033_c1 | 3300050508 | Bacteria | 2549 |
| 859 | nmdc:mga0qj67_18174_c1 | 3300050509 | Bacteria | 5356 |
| 860 | nmdc:mga0qj67_247092_c1 | 3300050509 | Bacteria | 1448 |
| 861 | nmdc:mga0qj67_316281_c1 | 3300050509 | Bacteria | 1264 |
| 862 | nmdc:mga0qj67_392533_c1 | 3300050509 | Unclassified | 1120 |
| 863 | nmdc:mga0qj67_39748_c1 | 3300050509 | Bacteria | 3696 |
| 864 | nmdc:mga0qj67_638740_c1 | 3300050509 | Bacteria | 850 |
| 865 | nmdc:mga0qj67_67554_c1 | 3300050509 | Bacteria | 2848 |
| 866 | nmdc:mga0qj67_68714_c1 | 3300050509 | Bacteria | 2824 |
| 867 | nmdc:mga0qj67_730_c1 | 3300050509 | Bacteria | 22368 |
| 868 | nmdc:mga0qj67_93875_c1 | 3300050509 | Bacteria | 2413 |
| 869 | nmdc:mga0qj67_9771_c1 | 3300050509 | Bacteria | 7148 |
| 870 | nmdc:mga06r32_1170494_c1 | 3300050510 | Unclassified | 716 |
| 871 | nmdc:mga06r32_117512_c1 | 3300050510 | Bacteria | 2621 |
| 872 | nmdc:mga06r32_128690_c1 | 3300050510 | Bacteria | 2502 |
| 873 | nmdc:mga06r32_12991_c1 | 3300050510 | Bacteria | 7532 |
| 874 | nmdc:mga06r32_14279_c1 | 3300050510 | Bacteria | 7204 |
| 875 | nmdc:mga06r32_2111_c1 | 3300050510 | Bacteria | 17801 |
| 876 | nmdc:mga06r32_237426_c1 | 3300050510 | Bacteria | 1811 |
| 877 | nmdc:mga06r32_326076_c1 | 3300050510 | Bacteria | 1521 |
| 878 | nmdc:mga06r32_399277_c1 | 3300050510 | Bacteria | 1357 |
| 879 | nmdc:mga06r32_41550_c1 | 3300050510 | Bacteria | 4370 |
| 880 | nmdc:mga06r32_454447_c1 | 3300050510 | Bacteria | 1260 |
| 881 | nmdc:mga06r32_4632_c1 | 3300050510 | Bacteria | 12337 |
| 882 | nmdc:mga06r32_484863_c1 | 3300050510 | Bacteria | 1214 |
| 883 | nmdc:mga06r32_786815_c1 | 3300050510 | Bacteria | 913 |
| 884 | nmdc:mga06r32_828564_c1 | 3300050510 | Bacteria | 885 |
| 885 | nmdc:mga08y16_1317_c1 | 3300050511 | Bacteria | 24673 |
| 886 | nmdc:mga08y16_162187_c1 | 3300050511 | Bacteria | 2323 |
| 887 | nmdc:mga08y16_171_c1 | 3300050511 | Bacteria | 56769 |
| 888 | nmdc:mga08y16_1739795_c1 | 3300050511 | Bacteria | 578 |
| 889 | nmdc:mga08y16_428483_c1 | 3300050511 | Bacteria | 1351 |
| 890 | nmdc:mga08y16_64546_c1 | 3300050511 | Bacteria | 3823 |
| 891 | nmdc:mga08y16_7918_c1 | 3300050511 | Bacteria | 11120 |
| 892 | nmdc:mga0n895_10084_c1 | 3300050512 | Bacteria | 8317 |
| 893 | nmdc:mga0n895_152601_c1 | 3300050512 | Bacteria | 2341 |
| 894 | nmdc:mga0n895_17404_c1 | 3300050512 | Bacteria | 6622 |
| 895 | nmdc:mga0n895_19948_c1 | 3300050512 | Bacteria | 6242 |
| 896 | nmdc:mga0n895_334791_c1 | 3300050512 | Bacteria | 1534 |
| 897 | nmdc:mga0n895_43883_c2 | 3300050512 | Bacteria | 2657 |
| 898 | nmdc:mga0n895_4527_c1 | 3300050512 | Bacteria | 11439 |
| 899 | nmdc:mga0n895_47458_c1 | 3300050512 | Unclassified | 4199 |
| 900 | nmdc:mga0n895_51094_c1 | 3300050512 | Bacteria | 4055 |
| 901 | nmdc:mga0n895_544513_c1 | 3300050512 | Bacteria | 1167 |
| 902 | nmdc:mga0n895_709893_c1 | 3300050512 | Bacteria | 1001 |
| 903 | nmdc:mga0n895_75696_c1 | 3300050512 | Bacteria | 3346 |
| 904 | nmdc:mga0n895_861910_c1 | 3300050512 | Bacteria | 893 |
| 905 | nmdc:mga0rr50_1027680_c1 | 3300050513 | Bacteria | 702 |
| 906 | nmdc:mga0rr50_1280_c1 | 3300050513 | Bacteria | 13707 |
| 907 | nmdc:mga0rr50_139984_c1 | 3300050513 | Bacteria | 1946 |
| 908 | nmdc:mga0rr50_1590746_c1 | 3300050513 | Bacteria | 552 |
| 909 | nmdc:mga0rr50_1684107_c1 | 3300050513 | Bacteria | 535 |
| 910 | nmdc:mga0rr50_26347_c1 | 3300050513 | Bacteria | 4055 |
| 911 | nmdc:mga0rr50_32838_c1 | 3300050513 | Bacteria | 3703 |
| 912 | nmdc:mga0rr50_5599_c1 | 3300050513 | Bacteria | 7516 |
| 913 | nmdc:mga0rr50_91452_c1 | 3300050513 | Bacteria | 2370 |
| 914 | nmdc:mga08x19_361052_c1 | 3300050514 | Unclassified | 1015 |
| 915 | nmdc:mga08x19_45966_c1 | 3300050514 | Bacteria | 2791 |
| 916 | nmdc:mga08x19_5649_c1 | 3300050514 | Bacteria | 7392 |
| 917 | nmdc:mga08x19_601847_c1 | 3300050514 | Bacteria | 779 |
| 918 | nmdc:mga08x19_76845_c1 | 3300050514 | Bacteria | 2186 |
| 919 | nmdc:mga08x19_9252_c1 | 3300050514 | Bacteria | 5888 |
| 920 | nmdc:mga0a205_111571_c1 | 3300050515 | Bacteria | 2634 |
| 921 | nmdc:mga0a205_120630_c1 | 3300050515 | Bacteria | 2521 |
| 922 | nmdc:mga0a205_144582_c1 | 3300050515 | Bacteria | 2278 |
| 923 | nmdc:mga0a205_178729_c1 | 3300050515 | Bacteria | 2017 |
| 924 | nmdc:mga0a205_189823_c1 | 3300050515 | Bacteria | 1947 |
| 925 | nmdc:mga0a205_19596_c1 | 3300050515 | Bacteria | 6381 |
| 926 | nmdc:mga0a205_24698_c1 | 3300050515 | Bacteria | 5718 |
| 927 | nmdc:mga0a205_4101_c1 | 3300050515 | Bacteria | 13035 |
| 928 | nmdc:mga0a205_480572_c1 | 3300050515 | Bacteria | 1101 |
| 929 | nmdc:mga0a205_49683_c1 | 3300050515 | Bacteria | 3129 |
| 930 | nmdc:mga0a205_502462_c1 | 3300050515 | Unclassified | 1069 |
| 931 | nmdc:mga0a205_64423_c1 | 3300050515 | Bacteria | 3540 |
| 932 | nmdc:mga0a205_72713_c1 | 3300050515 | Bacteria | 3322 |
| 933 | nmdc:mga0a205_7301_c1 | 3300050515 | Bacteria | 6084 |
| 934 | nmdc:mga0a205_747144_c1 | 3300050515 | Bacteria | 827 |
| 935 | nmdc:mga0a205_796_c1 | 3300050515 | Bacteria | 25603 |
| 936 | nmdc:mga0a205_9201_c1 | 3300050515 | Bacteria | 9018 |
| 937 | Ga0495619_0430549 | 3300053085 | Bacteria | 910 |
| 938 | Ga0501084_0007316 | 3300054114 | Bacteria | 9092 |
| 939 | Ga0501084_0019852 | 3300054114 | Bacteria | 5601 |
| 940 | Ga0501084_0039408 | 3300054114 | Bacteria | 3952 |
| 941 | Ga0501084_0111022 | 3300054114 | Bacteria | 2304 |
| 942 | Ga0501084_0117599 | 3300054114 | Bacteria | 2235 |
| 943 | Ga0501084_0139932 | 3300054114 | Bacteria | 2038 |
| 944 | Ga0501084_0522945 | 3300054114 | Bacteria | 1003 |
| 945 | Ga0501084_0843721 | 3300054114 | Bacteria | 771 |
| 946 | Ga0501084_1442183 | 3300054114 | Unclassified | 576 |
| 947 | Ga0590075_016660 | 3300059424 | Bacteria | 1808 |
| 948 | Ga0590075_024665 | 3300059424 | Bacteria | 1510 |
| 949 | Ga0501082_0070725 | 3300060353 | Bacteria | 3004 |
| 950 | Ga0501082_0083559 | 3300060353 | Bacteria | 2755 |
| 951 | Ga0501082_0090616 | 3300060353 | Bacteria | 2640 |
| 952 | Ga0501082_0168589 | 3300060353 | Bacteria | 1903 |
| 953 | Ga0501082_0222579 | 3300060353 | Bacteria | 1642 |
| 954 | Ga0501082_0483426 | 3300060353 | Unclassified | 1082 |
| 955 | Ga0501082_0536677 | 3300060353 | Bacteria | 1023 |
| 956 | Ga0501082_0566207 | 3300060353 | Bacteria | 994 |
| 957 | Ga0501082_1090843 | 3300060353 | Bacteria | 698 |
| 958 | Ga0530510_0029602 | 3300061734 | Bacteria | 3931 |
| 959 | Ga0530510_0047462 | 3300061734 | Bacteria | 3103 |
| 960 | Ga0530510_0064878 | 3300061734 | Bacteria | 2645 |
| 961 | Ga0530510_0091456 | 3300061734 | Bacteria | 2220 |
| 962 | Ga0530510_0312353 | 3300061734 | Unclassified | 1177 |
| 963 | Ga0530510_0529217 | 3300061734 | Bacteria | 894 |
| 964 | Ga0530510_0572390 | 3300061734 | Bacteria | 858 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0372246 | Ga0501038_0372246_11_388 | 125 |
| 2 | 3300037418 | Ga0395900_0254312 | Ga0395900_0254312_976_1434 | 136 |
| 3 | 3300037471 | Ga0395905_0048060 | Ga0395905_0048060_2483_2971 | 136 |
| 4 | 3300006914 | Ga0075436_100383659 | Ga0075436_1003836592 | 138 |
| 5 | 3300048912 | Ga0496109_0833305 | Ga0496109_0833305_426_845 | 138 |
| 6 | 3300049576 | Ga0501040_0033093 | Ga0501040_0033093_10_426 | 138 |
| 7 | 3300049824 | Ga0501045_0622047 | Ga0501045_0622047_25_450 | 138 |
| 8 | 3300050514 | nmdc:mga08x19_361052_c1 | nmdc:mga08x19_361052_c1_278_742 | 138 |
| 9 | 3300005468 | Ga0070707_100045167 | Ga0070707_1000451672 | 139 |
| 10 | 3300005536 | Ga0070697_100359912 | Ga0070697_1003599122 | 139 |
| 11 | 3300005544 | Ga0070686_101247849 | Ga0070686_1012478491 | 139 |
| 12 | 3300005340 | Ga0070689_100419278 | Ga0070689_1004192782 | 141 |
| 13 | 3300005471 | Ga0070698_100331196 | Ga0070698_1003311962 | 144 |
| 14 | 3300025922 | Ga0207646_10040356 | Ga0207646_100403562 | 144 |
| 15 | 3300005471 | Ga0070698_100654502 | Ga0070698_1006545022 | 150 |
| 16 | 3300006847 | Ga0075431_101567585 | Ga0075431_1015675851 | 150 |
| 17 | 3300005336 | Ga0070680_101041210 | Ga0070680_1010412101 | 151 |
| 18 | 3300005459 | Ga0068867_100884171 | Ga0068867_1008841712 | 151 |
| 19 | 3300005546 | Ga0070696_100079526 | Ga0070696_1000795264 | 151 |
| 20 | 3300005547 | Ga0070693_100356053 | Ga0070693_1003560532 | 151 |
| 21 | 3300005549 | Ga0070704_100018081 | Ga0070704_1000180815 | 151 |
| 22 | 3300005549 | Ga0070704_100266623 | Ga0070704_1002666232 | 151 |
| 23 | 3300005549 | Ga0070704_100881208 | Ga0070704_1008812082 | 151 |
| 24 | 3300005617 | Ga0068859_100446312 | Ga0068859_1004463122 | 151 |
| 25 | 3300005718 | Ga0068866_10073428 | Ga0068866_100734282 | 151 |
| 26 | 3300005843 | Ga0068860_100878726 | Ga0068860_1008787262 | 151 |
| 27 | 3300006844 | Ga0075428_100563045 | Ga0075428_1005630452 | 151 |
| 28 | 3300006852 | Ga0075433_10819915 | Ga0075433_108199152 | 151 |
| 29 | 3300006871 | Ga0075434_100911680 | Ga0075434_1009116802 | 151 |
| 30 | 3300006931 | Ga0097620_100446301 | Ga0097620_1004463012 | 151 |
| 31 | 3300007265 | Ga0099794_10007317 | Ga0099794_100073177 | 151 |
| 32 | 3300009094 | Ga0111539_10076175 | Ga0111539_100761753 | 151 |
| 33 | 3300013297 | Ga0157378_10058823 | Ga0157378_100588234 | 151 |
| 34 | 3300017792 | Ga0163161_11869771 | Ga0163161_118697711 | 151 |
| 35 | 3300025934 | Ga0207686_10322557 | Ga0207686_103225572 | 151 |
| 36 | 3300026075 | Ga0207708_10542310 | Ga0207708_105423102 | 151 |
| 37 | 3300026089 | Ga0207648_10067171 | Ga0207648_100671714 | 151 |
| 38 | 3300027907 | Ga0207428_10970037 | Ga0207428_109700372 | 151 |
| 39 | 3300031507 | Ga0307509_10067942 | Ga0307509_100679421 | 151 |
| 40 | 3300031548 | Ga0307408_100029740 | Ga0307408_1000297405 | 151 |
| 41 | 3300031903 | Ga0307407_10585805 | Ga0307407_105858052 | 151 |
| 42 | 3300031911 | Ga0307412_10923570 | Ga0307412_109235702 | 151 |
| 43 | 3300032002 | Ga0307416_100001116 | Ga0307416_10000111613 | 151 |
| 44 | 3300032005 | Ga0307411_10100729 | Ga0307411_101007292 | 151 |
| 45 | 3300035116 | Ga0373945_0460582 | Ga0373945_0460582_20_499 | 151 |
| 46 | 3300035121 | Ga0373960_0246812 | Ga0373960_0246812_101_562 | 151 |
| 47 | 3300046528 | Ga0495642_0402460 | Ga0495642_0402460_17_478 | 151 |
| 48 | 3300049521 | Ga0501298_043407 | Ga0501298_043407_223_678 | 151 |
| 49 | 3300049579 | Ga0501043_0548862 | Ga0501043_0548862_351_812 | 151 |
| 50 | 3300049591 | Ga0501075_0120193 | Ga0501075_0120193_349_804 | 151 |
| 51 | 3300049672 | Ga0501239_072033 | Ga0501239_072033_18_473 | 151 |
| 52 | 3300050511 | nmdc:mga08y16_64546_c1 | nmdc:mga08y16_64546_c1_941_1402 | 151 |
| 53 | 3300050512 | nmdc:mga0n895_75696_c1 | nmdc:mga0n895_75696_c1_749_1210 | 151 |
| 54 | 3300050515 | nmdc:mga0a205_747144_c1 | nmdc:mga0a205_747144_c1_198_659 | 151 |
| 55 | 3300054114 | Ga0501084_1442183 | Ga0501084_1442183_70_531 | 151 |
| 56 | 3300061734 | Ga0530510_0047462 | Ga0530510_0047462_2571_3029 | 151 |
| 57 | 3300003203 | JGI25406J46586_10005819 | JGI25406J46586_100058192 | 152 |
| 58 | 3300003659 | JGI25404J52841_10105087 | JGI25404J52841_101050871 | 152 |
| 59 | 3300005290 | Ga0065712_10141318 | Ga0065712_101413183 | 152 |
| 60 | 3300005293 | Ga0065715_10113974 | Ga0065715_101139742 | 152 |
| 61 | 3300005295 | Ga0065707_10185628 | Ga0065707_101856282 | 152 |
| 62 | 3300005295 | Ga0065707_10244704 | Ga0065707_102447042 | 152 |
| 63 | 3300005295 | Ga0065707_10479327 | Ga0065707_104793272 | 152 |
| 64 | 3300005327 | Ga0070658_10660707 | Ga0070658_106607072 | 152 |
| 65 | 3300005328 | Ga0070676_10000005 | Ga0070676_100000059 | 152 |
| 66 | 3300005328 | Ga0070676_10011118 | Ga0070676_100111185 | 152 |
| 67 | 3300005328 | Ga0070676_10237672 | Ga0070676_102376721 | 152 |
| 68 | 3300005329 | Ga0070683_100038454 | Ga0070683_1000384543 | 152 |
| 69 | 3300005330 | Ga0070690_100256890 | Ga0070690_1002568902 | 152 |
| 70 | 3300005331 | Ga0070670_100001199 | Ga0070670_10000119914 | 152 |
| 71 | 3300005333 | Ga0070677_10213424 | Ga0070677_102134242 | 152 |
| 72 | 3300005334 | Ga0068869_100002745 | Ga0068869_1000027458 | 152 |
| 73 | 3300005334 | Ga0068869_100009337 | Ga0068869_1000093375 | 152 |
| 74 | 3300005334 | Ga0068869_100050419 | Ga0068869_1000504195 | 152 |
| 75 | 3300005335 | Ga0070666_10219720 | Ga0070666_102197202 | 152 |
| 76 | 3300005336 | Ga0070680_100000094 | Ga0070680_10000009443 | 152 |
| 77 | 3300005336 | Ga0070680_100039088 | Ga0070680_1000390884 | 152 |
| 78 | 3300005336 | Ga0070680_100062111 | Ga0070680_1000621112 | 152 |
| 79 | 3300005336 | Ga0070680_100437265 | Ga0070680_1004372652 | 152 |
| 80 | 3300005337 | Ga0070682_100003884 | Ga0070682_1000038846 | 152 |
| 81 | 3300005338 | Ga0068868_100014283 | Ga0068868_1000142835 | 152 |
| 82 | 3300005338 | Ga0068868_100133018 | Ga0068868_1001330182 | 152 |
| 83 | 3300005339 | Ga0070660_100003125 | Ga0070660_1000031257 | 152 |
| 84 | 3300005340 | Ga0070689_100003437 | Ga0070689_10000343710 | 152 |
| 85 | 3300005341 | Ga0070691_10006218 | Ga0070691_100062183 | 152 |
| 86 | 3300005341 | Ga0070691_10049587 | Ga0070691_100495872 | 152 |
| 87 | 3300005341 | Ga0070691_10093272 | Ga0070691_100932722 | 152 |
| 88 | 3300005341 | Ga0070691_10537802 | Ga0070691_105378021 | 152 |
| 89 | 3300005343 | Ga0070687_100079182 | Ga0070687_1000791823 | 152 |
| 90 | 3300005344 | Ga0070661_100006165 | Ga0070661_1000061657 | 152 |
| 91 | 3300005345 | Ga0070692_10001646 | Ga0070692_100016467 | 152 |
| 92 | 3300005345 | Ga0070692_10004232 | Ga0070692_100042323 | 152 |
| 93 | 3300005347 | Ga0070668_100326905 | Ga0070668_1003269052 | 152 |
| 94 | 3300005347 | Ga0070668_100562170 | Ga0070668_1005621702 | 152 |
| 95 | 3300005353 | Ga0070669_100040023 | Ga0070669_1000400234 | 152 |
| 96 | 3300005353 | Ga0070669_100068744 | Ga0070669_1000687443 | 152 |
| 97 | 3300005353 | Ga0070669_100101399 | Ga0070669_1001013994 | 152 |
| 98 | 3300005353 | Ga0070669_100164531 | Ga0070669_1001645311 | 152 |
| 99 | 3300005353 | Ga0070669_100623873 | Ga0070669_1006238732 | 152 |
| 100 | 3300005355 | Ga0070671_100189336 | Ga0070671_1001893362 | 152 |
| 101 | 3300005356 | Ga0070674_100548612 | Ga0070674_1005486122 | 152 |
| 102 | 3300005364 | Ga0070673_100017616 | Ga0070673_1000176166 | 152 |
| 103 | 3300005365 | Ga0070688_100135114 | Ga0070688_1001351142 | 152 |
| 104 | 3300005365 | Ga0070688_100386324 | Ga0070688_1003863241 | 152 |
| 105 | 3300005366 | Ga0070659_100001138 | Ga0070659_1000011382 | 152 |
| 106 | 3300005366 | Ga0070659_101987984 | Ga0070659_1019879841 | 152 |
| 107 | 3300005406 | Ga0070703_10039928 | Ga0070703_100399283 | 152 |
| 108 | 3300005406 | Ga0070703_10043334 | Ga0070703_100433342 | 152 |
| 109 | 3300005406 | Ga0070703_10081142 | Ga0070703_100811422 | 152 |
| 110 | 3300005406 | Ga0070703_10195063 | Ga0070703_101950631 | 152 |
| 111 | 3300005438 | Ga0070701_10046764 | Ga0070701_100467643 | 152 |
| 112 | 3300005438 | Ga0070701_10097707 | Ga0070701_100977072 | 152 |
| 113 | 3300005439 | Ga0070711_100107027 | Ga0070711_1001070272 | 152 |
| 114 | 3300005439 | Ga0070711_100259608 | Ga0070711_1002596081 | 152 |
| 115 | 3300005440 | Ga0070705_100028364 | Ga0070705_1000283643 | 152 |
| 116 | 3300005440 | Ga0070705_100029223 | Ga0070705_1000292232 | 152 |
| 117 | 3300005440 | Ga0070705_100031904 | Ga0070705_1000319043 | 152 |
| 118 | 3300005440 | Ga0070705_100038776 | Ga0070705_1000387762 | 152 |
| 119 | 3300005440 | Ga0070705_100215705 | Ga0070705_1002157052 | 152 |
| 120 | 3300005441 | Ga0070700_100051404 | Ga0070700_1000514043 | 152 |
| 121 | 3300005441 | Ga0070700_100095624 | Ga0070700_1000956243 | 152 |
| 122 | 3300005444 | Ga0070694_100002997 | Ga0070694_1000029974 | 152 |
| 123 | 3300005444 | Ga0070694_100004403 | Ga0070694_1000044033 | 152 |
| 124 | 3300005444 | Ga0070694_100115083 | Ga0070694_1001150832 | 152 |
| 125 | 3300005444 | Ga0070694_100331669 | Ga0070694_1003316692 | 152 |
| 126 | 3300005444 | Ga0070694_100795933 | Ga0070694_1007959332 | 152 |
| 127 | 3300005445 | Ga0070708_100015531 | Ga0070708_1000155315 | 152 |
| 128 | 3300005445 | Ga0070708_100023561 | Ga0070708_1000235616 | 152 |
| 129 | 3300005445 | Ga0070708_100024205 | Ga0070708_1000242053 | 152 |
| 130 | 3300005445 | Ga0070708_100051214 | Ga0070708_1000512145 | 152 |
| 131 | 3300005445 | Ga0070708_100159238 | Ga0070708_1001592382 | 152 |
| 132 | 3300005445 | Ga0070708_100231582 | Ga0070708_1002315823 | 152 |
| 133 | 3300005445 | Ga0070708_100321554 | Ga0070708_1003215542 | 152 |
| 134 | 3300005445 | Ga0070708_100321786 | Ga0070708_1003217861 | 152 |
| 135 | 3300005445 | Ga0070708_100384527 | Ga0070708_1003845272 | 152 |
| 136 | 3300005445 | Ga0070708_101417996 | Ga0070708_1014179961 | 152 |
| 137 | 3300005455 | Ga0070663_100000763 | Ga0070663_1000007636 | 152 |
| 138 | 3300005457 | Ga0070662_100042435 | Ga0070662_1000424352 | 152 |
| 139 | 3300005457 | Ga0070662_100081362 | Ga0070662_1000813623 | 152 |
| 140 | 3300005458 | Ga0070681_10034394 | Ga0070681_100343942 | 152 |
| 141 | 3300005458 | Ga0070681_10058087 | Ga0070681_100580873 | 152 |
| 142 | 3300005458 | Ga0070681_10062606 | Ga0070681_100626063 | 152 |
| 143 | 3300005458 | Ga0070681_10390843 | Ga0070681_103908432 | 152 |
| 144 | 3300005459 | Ga0068867_100002733 | Ga0068867_1000027336 | 152 |
| 145 | 3300005459 | Ga0068867_100019737 | Ga0068867_1000197372 | 152 |
| 146 | 3300005459 | Ga0068867_100157437 | Ga0068867_1001574372 | 152 |
| 147 | 3300005467 | Ga0070706_100004618 | Ga0070706_1000046184 | 152 |
| 148 | 3300005467 | Ga0070706_100008662 | Ga0070706_1000086623 | 152 |
| 149 | 3300005467 | Ga0070706_100043566 | Ga0070706_1000435665 | 152 |
| 150 | 3300005467 | Ga0070706_100075697 | Ga0070706_1000756973 | 152 |
| 151 | 3300005467 | Ga0070706_100090200 | Ga0070706_1000902004 | 152 |
| 152 | 3300005467 | Ga0070706_100136905 | Ga0070706_1001369053 | 152 |
| 153 | 3300005467 | Ga0070706_100159881 | Ga0070706_1001598812 | 152 |
| 154 | 3300005467 | Ga0070706_100314395 | Ga0070706_1003143952 | 152 |
| 155 | 3300005467 | Ga0070706_100327919 | Ga0070706_1003279192 | 152 |
| 156 | 3300005467 | Ga0070706_100531695 | Ga0070706_1005316952 | 152 |
| 157 | 3300005468 | Ga0070707_100001786 | Ga0070707_10000178622 | 152 |
| 158 | 3300005468 | Ga0070707_100005318 | Ga0070707_1000053185 | 152 |
| 159 | 3300005468 | Ga0070707_100011093 | Ga0070707_1000110934 | 152 |
| 160 | 3300005468 | Ga0070707_100014433 | Ga0070707_1000144337 | 152 |
| 161 | 3300005468 | Ga0070707_100018600 | Ga0070707_1000186004 | 152 |
| 162 | 3300005468 | Ga0070707_100061661 | Ga0070707_1000616614 | 152 |
| 163 | 3300005468 | Ga0070707_100087596 | Ga0070707_1000875962 | 152 |
| 164 | 3300005468 | Ga0070707_100133354 | Ga0070707_1001333543 | 152 |
| 165 | 3300005468 | Ga0070707_100139937 | Ga0070707_1001399373 | 152 |
| 166 | 3300005468 | Ga0070707_100417330 | Ga0070707_1004173302 | 152 |
| 167 | 3300005468 | Ga0070707_100666676 | Ga0070707_1006666762 | 152 |
| 168 | 3300005468 | Ga0070707_100879946 | Ga0070707_1008799462 | 152 |
| 169 | 3300005468 | Ga0070707_100975812 | Ga0070707_1009758121 | 152 |
| 170 | 3300005471 | Ga0070698_100006315 | Ga0070698_1000063159 | 152 |
| 171 | 3300005471 | Ga0070698_100118659 | Ga0070698_1001186591 | 152 |
| 172 | 3300005471 | Ga0070698_100570296 | Ga0070698_1005702962 | 152 |
| 173 | 3300005518 | Ga0070699_100002516 | Ga0070699_1000025163 | 152 |
| 174 | 3300005518 | Ga0070699_100019945 | Ga0070699_1000199454 | 152 |
| 175 | 3300005518 | Ga0070699_100037281 | Ga0070699_1000372812 | 152 |
| 176 | 3300005518 | Ga0070699_100051010 | Ga0070699_1000510103 | 152 |
| 177 | 3300005518 | Ga0070699_100081806 | Ga0070699_1000818062 | 152 |
| 178 | 3300005518 | Ga0070699_100091875 | Ga0070699_1000918752 | 152 |
| 179 | 3300005518 | Ga0070699_100185087 | Ga0070699_1001850872 | 152 |
| 180 | 3300005518 | Ga0070699_100294785 | Ga0070699_1002947852 | 152 |
| 181 | 3300005518 | Ga0070699_100319775 | Ga0070699_1003197751 | 152 |
| 182 | 3300005518 | Ga0070699_100350177 | Ga0070699_1003501771 | 152 |
| 183 | 3300005518 | Ga0070699_100445390 | Ga0070699_1004453902 | 152 |
| 184 | 3300005518 | Ga0070699_100489209 | Ga0070699_1004892092 | 152 |
| 185 | 3300005518 | Ga0070699_100917110 | Ga0070699_1009171102 | 152 |
| 186 | 3300005530 | Ga0070679_100001113 | Ga0070679_10000111317 | 152 |
| 187 | 3300005530 | Ga0070679_100034545 | Ga0070679_1000345452 | 152 |
| 188 | 3300005530 | Ga0070679_100036717 | Ga0070679_1000367172 | 152 |
| 189 | 3300005530 | Ga0070679_100234132 | Ga0070679_1002341323 | 152 |
| 190 | 3300005530 | Ga0070679_100309895 | Ga0070679_1003098952 | 152 |
| 191 | 3300005535 | Ga0070684_100241528 | Ga0070684_1002415282 | 152 |
| 192 | 3300005536 | Ga0070697_100000676 | Ga0070697_10000067616 | 152 |
| 193 | 3300005536 | Ga0070697_100002183 | Ga0070697_1000021831 | 152 |
| 194 | 3300005536 | Ga0070697_100025430 | Ga0070697_1000254303 | 152 |
| 195 | 3300005536 | Ga0070697_100048316 | Ga0070697_1000483164 | 152 |
| 196 | 3300005536 | Ga0070697_100182974 | Ga0070697_1001829742 | 152 |
| 197 | 3300005536 | Ga0070697_100188915 | Ga0070697_1001889153 | 152 |
| 198 | 3300005536 | Ga0070697_100189402 | Ga0070697_1001894022 | 152 |
| 199 | 3300005536 | Ga0070697_100225229 | Ga0070697_1002252292 | 152 |
| 200 | 3300005536 | Ga0070697_100261986 | Ga0070697_1002619862 | 152 |
| 201 | 3300005536 | Ga0070697_100874309 | Ga0070697_1008743091 | 152 |
| 202 | 3300005539 | Ga0068853_100008227 | Ga0068853_1000082275 | 152 |
| 203 | 3300005543 | Ga0070672_100024688 | Ga0070672_1000246883 | 152 |
| 204 | 3300005543 | Ga0070672_100164052 | Ga0070672_1001640522 | 152 |
| 205 | 3300005543 | Ga0070672_100448181 | Ga0070672_1004481812 | 152 |
| 206 | 3300005544 | Ga0070686_100310061 | Ga0070686_1003100612 | 152 |
| 207 | 3300005545 | Ga0070695_100001443 | Ga0070695_1000014434 | 152 |
| 208 | 3300005545 | Ga0070695_100005056 | Ga0070695_1000050563 | 152 |
| 209 | 3300005545 | Ga0070695_100096571 | Ga0070695_1000965712 | 152 |
| 210 | 3300005545 | Ga0070695_100134677 | Ga0070695_1001346772 | 152 |
| 211 | 3300005546 | Ga0070696_100001369 | Ga0070696_10000136911 | 152 |
| 212 | 3300005546 | Ga0070696_100017182 | Ga0070696_1000171825 | 152 |
| 213 | 3300005546 | Ga0070696_100025044 | Ga0070696_1000250442 | 152 |
| 214 | 3300005546 | Ga0070696_100085349 | Ga0070696_1000853492 | 152 |
| 215 | 3300005546 | Ga0070696_100330285 | Ga0070696_1003302851 | 152 |
| 216 | 3300005546 | Ga0070696_101718551 | Ga0070696_1017185511 | 152 |
| 217 | 3300005547 | Ga0070693_100000104 | Ga0070693_10000010422 | 152 |
| 218 | 3300005548 | Ga0070665_101162564 | Ga0070665_1011625642 | 152 |
| 219 | 3300005549 | Ga0070704_100014114 | Ga0070704_1000141145 | 152 |
| 220 | 3300005549 | Ga0070704_100033390 | Ga0070704_1000333903 | 152 |
| 221 | 3300005549 | Ga0070704_100066200 | Ga0070704_1000662002 | 152 |
| 222 | 3300005549 | Ga0070704_100720848 | Ga0070704_1007208481 | 152 |
| 223 | 3300005549 | Ga0070704_100952440 | Ga0070704_1009524401 | 152 |
| 224 | 3300005549 | Ga0070704_101587799 | Ga0070704_1015877991 | 152 |
| 225 | 3300005563 | Ga0068855_100016998 | Ga0068855_1000169982 | 152 |
| 226 | 3300005563 | Ga0068855_100518680 | Ga0068855_1005186802 | 152 |
| 227 | 3300005563 | Ga0068855_100577014 | Ga0068855_1005770142 | 152 |
| 228 | 3300005563 | Ga0068855_100611731 | Ga0068855_1006117312 | 152 |
| 229 | 3300005577 | Ga0068857_100094550 | Ga0068857_1000945502 | 152 |
| 230 | 3300005577 | Ga0068857_100175503 | Ga0068857_1001755033 | 152 |
| 231 | 3300005577 | Ga0068857_100214239 | Ga0068857_1002142392 | 152 |
| 232 | 3300005578 | Ga0068854_100004651 | Ga0068854_1000046515 | 152 |
| 233 | 3300005614 | Ga0068856_100012614 | Ga0068856_1000126145 | 152 |
| 234 | 3300005614 | Ga0068856_100071511 | Ga0068856_1000715113 | 152 |
| 235 | 3300005614 | Ga0068856_100298801 | Ga0068856_1002988012 | 152 |
| 236 | 3300005615 | Ga0070702_100024931 | Ga0070702_1000249314 | 152 |
| 237 | 3300005615 | Ga0070702_101046941 | Ga0070702_1010469411 | 152 |
| 238 | 3300005616 | Ga0068852_100389912 | Ga0068852_1003899122 | 152 |
| 239 | 3300005617 | Ga0068859_100001562 | Ga0068859_1000015625 | 152 |
| 240 | 3300005617 | Ga0068859_100127803 | Ga0068859_1001278033 | 152 |
| 241 | 3300005617 | Ga0068859_100268466 | Ga0068859_1002684662 | 152 |
| 242 | 3300005617 | Ga0068859_100338727 | Ga0068859_1003387272 | 152 |
| 243 | 3300005617 | Ga0068859_100501533 | Ga0068859_1005015332 | 152 |
| 244 | 3300005617 | Ga0068859_100641229 | Ga0068859_1006412291 | 152 |
| 245 | 3300005618 | Ga0068864_100000991 | Ga0068864_10000099110 | 152 |
| 246 | 3300005618 | Ga0068864_100047381 | Ga0068864_1000473812 | 152 |
| 247 | 3300005618 | Ga0068864_101256791 | Ga0068864_1012567912 | 152 |
| 248 | 3300005718 | Ga0068866_10618098 | Ga0068866_106180981 | 152 |
| 249 | 3300005719 | Ga0068861_100018444 | Ga0068861_1000184442 | 152 |
| 250 | 3300005719 | Ga0068861_100154005 | Ga0068861_1001540052 | 152 |
| 251 | 3300005719 | Ga0068861_100237858 | Ga0068861_1002378583 | 152 |
| 252 | 3300005834 | Ga0068851_10198680 | Ga0068851_101986802 | 152 |
| 253 | 3300005840 | Ga0068870_10002820 | Ga0068870_100028205 | 152 |
| 254 | 3300005841 | Ga0068863_100010104 | Ga0068863_1000101046 | 152 |
| 255 | 3300005841 | Ga0068863_100708195 | Ga0068863_1007081951 | 152 |
| 256 | 3300005841 | Ga0068863_101154134 | Ga0068863_1011541342 | 152 |
| 257 | 3300005841 | Ga0068863_101522666 | Ga0068863_1015226662 | 152 |
| 258 | 3300005841 | Ga0068863_101948999 | Ga0068863_1019489991 | 152 |
| 259 | 3300005842 | Ga0068858_100033406 | Ga0068858_1000334064 | 152 |
| 260 | 3300005842 | Ga0068858_100157079 | Ga0068858_1001570791 | 152 |
| 261 | 3300005843 | Ga0068860_100022117 | Ga0068860_1000221174 | 152 |
| 262 | 3300005843 | Ga0068860_100336400 | Ga0068860_1003364003 | 152 |
| 263 | 3300005843 | Ga0068860_100882234 | Ga0068860_1008822341 | 152 |
| 264 | 3300005844 | Ga0068862_100007685 | Ga0068862_1000076856 | 152 |
| 265 | 3300005844 | Ga0068862_100013048 | Ga0068862_1000130483 | 152 |
| 266 | 3300005844 | Ga0068862_100023027 | Ga0068862_1000230275 | 152 |
| 267 | 3300005844 | Ga0068862_100043608 | Ga0068862_1000436083 | 152 |
| 268 | 3300005844 | Ga0068862_100098268 | Ga0068862_1000982682 | 152 |
| 269 | 3300005844 | Ga0068862_100212790 | Ga0068862_1002127902 | 152 |
| 270 | 3300005844 | Ga0068862_100468936 | Ga0068862_1004689362 | 152 |
| 271 | 3300005844 | Ga0068862_100591516 | Ga0068862_1005915162 | 152 |
| 272 | 3300005844 | Ga0068862_101279850 | Ga0068862_1012798502 | 152 |
| 273 | 3300005983 | Ga0081540_1001963 | Ga0081540_10019638 | 152 |
| 274 | 3300005985 | Ga0081539_10000590 | Ga0081539_1000059011 | 152 |
| 275 | 3300006058 | Ga0075432_10080745 | Ga0075432_100807452 | 152 |
| 276 | 3300006163 | Ga0070715_10267494 | Ga0070715_102674942 | 152 |
| 277 | 3300006163 | Ga0070715_11017775 | Ga0070715_110177751 | 152 |
| 278 | 3300006173 | Ga0070716_100007870 | Ga0070716_1000078706 | 152 |
| 279 | 3300006194 | Ga0075427_10021528 | Ga0075427_100215282 | 152 |
| 280 | 3300006237 | Ga0097621_101244755 | Ga0097621_1012447552 | 152 |
| 281 | 3300006358 | Ga0068871_100762236 | Ga0068871_1007622362 | 152 |
| 282 | 3300006844 | Ga0075428_100000730 | Ga0075428_10000073037 | 152 |
| 283 | 3300006844 | Ga0075428_100008047 | Ga0075428_1000080474 | 152 |
| 284 | 3300006844 | Ga0075428_100017939 | Ga0075428_1000179399 | 152 |
| 285 | 3300006844 | Ga0075428_100030783 | Ga0075428_1000307836 | 152 |
| 286 | 3300006844 | Ga0075428_100063364 | Ga0075428_1000633643 | 152 |
| 287 | 3300006844 | Ga0075428_100161255 | Ga0075428_1001612552 | 152 |
| 288 | 3300006844 | Ga0075428_100175668 | Ga0075428_1001756682 | 152 |
| 289 | 3300006844 | Ga0075428_100188259 | Ga0075428_1001882592 | 152 |
| 290 | 3300006844 | Ga0075428_100304698 | Ga0075428_1003046984 | 152 |
| 291 | 3300006844 | Ga0075428_100466585 | Ga0075428_1004665852 | 152 |
| 292 | 3300006844 | Ga0075428_100842283 | Ga0075428_1008422832 | 152 |
| 293 | 3300006844 | Ga0075428_101009790 | Ga0075428_1010097902 | 152 |
| 294 | 3300006846 | Ga0075430_100002036 | Ga0075430_1000020367 | 152 |
| 295 | 3300006846 | Ga0075430_100006370 | Ga0075430_1000063702 | 152 |
| 296 | 3300006846 | Ga0075430_100018856 | Ga0075430_1000188567 | 152 |
| 297 | 3300006846 | Ga0075430_100111721 | Ga0075430_1001117213 | 152 |
| 298 | 3300006846 | Ga0075430_100176534 | Ga0075430_1001765342 | 152 |
| 299 | 3300006846 | Ga0075430_100198464 | Ga0075430_1001984642 | 152 |
| 300 | 3300006846 | Ga0075430_100309158 | Ga0075430_1003091583 | 152 |
| 301 | 3300006846 | Ga0075430_100350342 | Ga0075430_1003503422 | 152 |
| 302 | 3300006846 | Ga0075430_100395150 | Ga0075430_1003951502 | 152 |
| 303 | 3300006846 | Ga0075430_100490427 | Ga0075430_1004904272 | 152 |
| 304 | 3300006847 | Ga0075431_100007203 | Ga0075431_1000072033 | 152 |
| 305 | 3300006847 | Ga0075431_100008661 | Ga0075431_1000086616 | 152 |
| 306 | 3300006847 | Ga0075431_100010364 | Ga0075431_1000103649 | 152 |
| 307 | 3300006847 | Ga0075431_100019710 | Ga0075431_1000197107 | 152 |
| 308 | 3300006847 | Ga0075431_100035297 | Ga0075431_1000352974 | 152 |
| 309 | 3300006847 | Ga0075431_100070228 | Ga0075431_1000702283 | 152 |
| 310 | 3300006847 | Ga0075431_100089673 | Ga0075431_1000896733 | 152 |
| 311 | 3300006847 | Ga0075431_100093074 | Ga0075431_1000930746 | 152 |
| 312 | 3300006847 | Ga0075431_100110736 | Ga0075431_1001107361 | 152 |
| 313 | 3300006847 | Ga0075431_100219357 | Ga0075431_1002193572 | 152 |
| 314 | 3300006847 | Ga0075431_100270914 | Ga0075431_1002709142 | 152 |
| 315 | 3300006847 | Ga0075431_100307066 | Ga0075431_1003070663 | 152 |
| 316 | 3300006847 | Ga0075431_100471721 | Ga0075431_1004717212 | 152 |
| 317 | 3300006847 | Ga0075431_100781618 | Ga0075431_1007816182 | 152 |
| 318 | 3300006852 | Ga0075433_10001209 | Ga0075433_1000120910 | 152 |
| 319 | 3300006852 | Ga0075433_10002879 | Ga0075433_100028795 | 152 |
| 320 | 3300006852 | Ga0075433_10005890 | Ga0075433_100058905 | 152 |
| 321 | 3300006852 | Ga0075433_10018092 | Ga0075433_100180924 | 152 |
| 322 | 3300006852 | Ga0075433_10022899 | Ga0075433_100228994 | 152 |
| 323 | 3300006852 | Ga0075433_10025739 | Ga0075433_100257397 | 152 |
| 324 | 3300006852 | Ga0075433_10040876 | Ga0075433_100408764 | 152 |
| 325 | 3300006852 | Ga0075433_10080500 | Ga0075433_100805003 | 152 |
| 326 | 3300006852 | Ga0075433_10085717 | Ga0075433_100857174 | 152 |
| 327 | 3300006852 | Ga0075433_10086269 | Ga0075433_100862692 | 152 |
| 328 | 3300006852 | Ga0075433_10088588 | Ga0075433_100885884 | 152 |
| 329 | 3300006852 | Ga0075433_10161430 | Ga0075433_101614302 | 152 |
| 330 | 3300006852 | Ga0075433_10444063 | Ga0075433_104440633 | 152 |
| 331 | 3300006852 | Ga0075433_10536391 | Ga0075433_105363911 | 152 |
| 332 | 3300006871 | Ga0075434_100000039 | Ga0075434_10000003919 | 152 |
| 333 | 3300006871 | Ga0075434_100004221 | Ga0075434_1000042215 | 152 |
| 334 | 3300006871 | Ga0075434_100011543 | Ga0075434_1000115435 | 152 |
| 335 | 3300006871 | Ga0075434_100061715 | Ga0075434_1000617155 | 152 |
| 336 | 3300006871 | Ga0075434_100071242 | Ga0075434_1000712423 | 152 |
| 337 | 3300006871 | Ga0075434_100092860 | Ga0075434_1000928602 | 152 |
| 338 | 3300006871 | Ga0075434_100118891 | Ga0075434_1001188912 | 152 |
| 339 | 3300006871 | Ga0075434_100120734 | Ga0075434_1001207343 | 152 |
| 340 | 3300006871 | Ga0075434_100149544 | Ga0075434_1001495442 | 152 |
| 341 | 3300006871 | Ga0075434_100185820 | Ga0075434_1001858203 | 152 |
| 342 | 3300006871 | Ga0075434_100235777 | Ga0075434_1002357773 | 152 |
| 343 | 3300006871 | Ga0075434_100436959 | Ga0075434_1004369591 | 152 |
| 344 | 3300006871 | Ga0075434_100597562 | Ga0075434_1005975622 | 152 |
| 345 | 3300006871 | Ga0075434_101756525 | Ga0075434_1017565251 | 152 |
| 346 | 3300006871 | Ga0075434_101860463 | Ga0075434_1018604632 | 152 |
| 347 | 3300006880 | Ga0075429_100002010 | Ga0075429_10000201011 | 152 |
| 348 | 3300006880 | Ga0075429_100010977 | Ga0075429_1000109774 | 152 |
| 349 | 3300006880 | Ga0075429_100011741 | Ga0075429_1000117416 | 152 |
| 350 | 3300006880 | Ga0075429_100013899 | Ga0075429_1000138992 | 152 |
| 351 | 3300006880 | Ga0075429_100014322 | Ga0075429_1000143223 | 152 |
| 352 | 3300006880 | Ga0075429_100023491 | Ga0075429_1000234915 | 152 |
| 353 | 3300006880 | Ga0075429_100095349 | Ga0075429_1000953493 | 152 |
| 354 | 3300006880 | Ga0075429_100102898 | Ga0075429_1001028982 | 152 |
| 355 | 3300006880 | Ga0075429_100175753 | Ga0075429_1001757532 | 152 |
| 356 | 3300006880 | Ga0075429_100178014 | Ga0075429_1001780142 | 152 |
| 357 | 3300006880 | Ga0075429_100183632 | Ga0075429_1001836322 | 152 |
| 358 | 3300006880 | Ga0075429_100230963 | Ga0075429_1002309632 | 152 |
| 359 | 3300006880 | Ga0075429_100312326 | Ga0075429_1003123262 | 152 |
| 360 | 3300006881 | Ga0068865_100078896 | Ga0068865_1000788963 | 152 |
| 361 | 3300006881 | Ga0068865_100080105 | Ga0068865_1000801052 | 152 |
| 362 | 3300006914 | Ga0075436_100044437 | Ga0075436_1000444373 | 152 |
| 363 | 3300006914 | Ga0075436_100084670 | Ga0075436_1000846702 | 152 |
| 364 | 3300006914 | Ga0075436_100086429 | Ga0075436_1000864292 | 152 |
| 365 | 3300006914 | Ga0075436_100127043 | Ga0075436_1001270432 | 152 |
| 366 | 3300006914 | Ga0075436_100466309 | Ga0075436_1004663092 | 152 |
| 367 | 3300006914 | Ga0075436_100625026 | Ga0075436_1006250262 | 152 |
| 368 | 3300006931 | Ga0097620_100001562 | Ga0097620_1000015625 | 152 |
| 369 | 3300006931 | Ga0097620_100127803 | Ga0097620_1001278032 | 152 |
| 370 | 3300006931 | Ga0097620_100268459 | Ga0097620_1002684592 | 152 |
| 371 | 3300006931 | Ga0097620_100338733 | Ga0097620_1003387332 | 152 |
| 372 | 3300006931 | Ga0097620_100501536 | Ga0097620_1005015362 | 152 |
| 373 | 3300006931 | Ga0097620_100641246 | Ga0097620_1006412461 | 152 |
| 374 | 3300007076 | Ga0075435_100008582 | Ga0075435_1000085825 | 152 |
| 375 | 3300007076 | Ga0075435_100017075 | Ga0075435_1000170755 | 152 |
| 376 | 3300007076 | Ga0075435_100028763 | Ga0075435_1000287633 | 152 |
| 377 | 3300007076 | Ga0075435_100041954 | Ga0075435_1000419545 | 152 |
| 378 | 3300007076 | Ga0075435_100065361 | Ga0075435_1000653612 | 152 |
| 379 | 3300007076 | Ga0075435_100128630 | Ga0075435_1001286302 | 152 |
| 380 | 3300007076 | Ga0075435_100142348 | Ga0075435_1001423483 | 152 |
| 381 | 3300007076 | Ga0075435_100222577 | Ga0075435_1002225772 | 152 |
| 382 | 3300007076 | Ga0075435_100711065 | Ga0075435_1007110652 | 152 |
| 383 | 3300007076 | Ga0075435_100750633 | Ga0075435_1007506332 | 152 |
| 384 | 3300007265 | Ga0099794_10003785 | Ga0099794_100037853 | 152 |
| 385 | 3300007265 | Ga0099794_10053082 | Ga0099794_100530822 | 152 |
| 386 | 3300007265 | Ga0099794_10399742 | Ga0099794_103997422 | 152 |
| 387 | 3300007265 | Ga0099794_10455910 | Ga0099794_104559102 | 152 |
| 388 | 3300009094 | Ga0111539_10000715 | Ga0111539_100007153 | 152 |
| 389 | 3300009094 | Ga0111539_10000819 | Ga0111539_1000081944 | 152 |
| 390 | 3300009094 | Ga0111539_10001430 | Ga0111539_1000143021 | 152 |
| 391 | 3300009094 | Ga0111539_10047551 | Ga0111539_100475515 | 152 |
| 392 | 3300009098 | Ga0105245_10800644 | Ga0105245_108006441 | 152 |
| 393 | 3300009147 | Ga0114129_10000409 | Ga0114129_1000040954 | 152 |
| 394 | 3300009147 | Ga0114129_10003438 | Ga0114129_1000343817 | 152 |
| 395 | 3300009147 | Ga0114129_10005405 | Ga0114129_1000540515 | 152 |
| 396 | 3300009147 | Ga0114129_10008975 | Ga0114129_1000897515 | 152 |
| 397 | 3300009147 | Ga0114129_10059492 | Ga0114129_100594922 | 152 |
| 398 | 3300009147 | Ga0114129_10077976 | Ga0114129_100779764 | 152 |
| 399 | 3300009147 | Ga0114129_10082816 | Ga0114129_100828162 | 152 |
| 400 | 3300009147 | Ga0114129_10083036 | Ga0114129_100830364 | 152 |
| 401 | 3300009147 | Ga0114129_10097283 | Ga0114129_100972835 | 152 |
| 402 | 3300009147 | Ga0114129_10138195 | Ga0114129_101381953 | 152 |
| 403 | 3300009147 | Ga0114129_10143481 | Ga0114129_101434814 | 152 |
| 404 | 3300009147 | Ga0114129_10199854 | Ga0114129_101998542 | 152 |
| 405 | 3300009147 | Ga0114129_10224251 | Ga0114129_102242512 | 152 |
| 406 | 3300009147 | Ga0114129_10335894 | Ga0114129_103358942 | 152 |
| 407 | 3300009147 | Ga0114129_10542462 | Ga0114129_105424622 | 152 |
| 408 | 3300009147 | Ga0114129_10990084 | Ga0114129_109900841 | 152 |
| 409 | 3300009147 | Ga0114129_11239651 | Ga0114129_112396512 | 152 |
| 410 | 3300009147 | Ga0114129_11562390 | Ga0114129_115623902 | 152 |
| 411 | 3300009148 | Ga0105243_10161636 | Ga0105243_101616362 | 152 |
| 412 | 3300009148 | Ga0105243_10338732 | Ga0105243_103387322 | 152 |
| 413 | 3300009148 | Ga0105243_10613718 | Ga0105243_106137182 | 152 |
| 414 | 3300009174 | Ga0105241_10001344 | Ga0105241_100013448 | 152 |
| 415 | 3300009174 | Ga0105241_10615983 | Ga0105241_106159831 | 152 |
| 416 | 3300009176 | Ga0105242_10021975 | Ga0105242_100219757 | 152 |
| 417 | 3300009176 | Ga0105242_10190262 | Ga0105242_101902623 | 152 |
| 418 | 3300009177 | Ga0105248_10186725 | Ga0105248_101867252 | 152 |
| 419 | 3300009177 | Ga0105248_10189571 | Ga0105248_101895713 | 152 |
| 420 | 3300009177 | Ga0105248_11738923 | Ga0105248_117389231 | 152 |
| 421 | 3300009545 | Ga0105237_10058839 | Ga0105237_100588394 | 152 |
| 422 | 3300009551 | Ga0105238_10389887 | Ga0105238_103898872 | 152 |
| 423 | 3300009553 | Ga0105249_10061301 | Ga0105249_100613012 | 152 |
| 424 | 3300009553 | Ga0105249_10096471 | Ga0105249_100964712 | 152 |
| 425 | 3300009553 | Ga0105249_10099318 | Ga0105249_100993182 | 152 |
| 426 | 3300009553 | Ga0105249_10147254 | Ga0105249_101472543 | 152 |
| 427 | 3300009553 | Ga0105249_10333816 | Ga0105249_103338163 | 152 |
| 428 | 3300009553 | Ga0105249_10575338 | Ga0105249_105753381 | 152 |
| 429 | 3300009553 | Ga0105249_11114596 | Ga0105249_111145961 | 152 |
| 430 | 3300009553 | Ga0105249_11652903 | Ga0105249_116529032 | 152 |
| 431 | 3300011119 | Ga0105246_10012663 | Ga0105246_100126636 | 152 |
| 432 | 3300013100 | Ga0157373_10000101 | Ga0157373_1000010151 | 152 |
| 433 | 3300013102 | Ga0157371_10437079 | Ga0157371_104370792 | 152 |
| 434 | 3300013104 | Ga0157370_10275494 | Ga0157370_102754942 | 152 |
| 435 | 3300013105 | Ga0157369_10012134 | Ga0157369_1001213410 | 152 |
| 436 | 3300013296 | Ga0157374_10446432 | Ga0157374_104464322 | 152 |
| 437 | 3300013296 | Ga0157374_11080543 | Ga0157374_110805432 | 152 |
| 438 | 3300013297 | Ga0157378_12506964 | Ga0157378_125069641 | 152 |
| 439 | 3300013306 | Ga0163162_10489108 | Ga0163162_104891083 | 152 |
| 440 | 3300013306 | Ga0163162_10884082 | Ga0163162_108840822 | 152 |
| 441 | 3300013307 | Ga0157372_10000703 | Ga0157372_1000070320 | 152 |
| 442 | 3300013307 | Ga0157372_11118195 | Ga0157372_111181952 | 152 |
| 443 | 3300013308 | Ga0157375_10048022 | Ga0157375_100480224 | 152 |
| 444 | 3300013308 | Ga0157375_10524051 | Ga0157375_105240512 | 152 |
| 445 | 3300013308 | Ga0157375_10711959 | Ga0157375_107119592 | 152 |
| 446 | 3300013308 | Ga0157375_12641858 | Ga0157375_126418581 | 152 |
| 447 | 3300014325 | Ga0163163_10152202 | Ga0163163_101522024 | 152 |
| 448 | 3300014325 | Ga0163163_10159045 | Ga0163163_101590453 | 152 |
| 449 | 3300014325 | Ga0163163_10736290 | Ga0163163_107362902 | 152 |
| 450 | 3300014326 | Ga0157380_10056424 | Ga0157380_100564244 | 152 |
| 451 | 3300014326 | Ga0157380_10162064 | Ga0157380_101620643 | 152 |
| 452 | 3300014326 | Ga0157380_10496505 | Ga0157380_104965051 | 152 |
| 453 | 3300014497 | Ga0182008_10397785 | Ga0182008_103977851 | 152 |
| 454 | 3300014745 | Ga0157377_10303813 | Ga0157377_103038132 | 152 |
| 455 | 3300014968 | Ga0157379_10166896 | Ga0157379_101668963 | 152 |
| 456 | 3300014968 | Ga0157379_10902559 | Ga0157379_109025592 | 152 |
| 457 | 3300017792 | Ga0163161_10224342 | Ga0163161_102243423 | 152 |
| 458 | 3300020070 | Ga0206356_11442960 | Ga0206356_114429601 | 152 |
| 459 | 3300020081 | Ga0206354_10938711 | Ga0206354_109387112 | 152 |
| 460 | 3300025321 | Ga0207656_10067904 | Ga0207656_100679042 | 152 |
| 461 | 3300025885 | Ga0207653_10019640 | Ga0207653_100196403 | 152 |
| 462 | 3300025885 | Ga0207653_10071663 | Ga0207653_100716632 | 152 |
| 463 | 3300025885 | Ga0207653_10229018 | Ga0207653_102290182 | 152 |
| 464 | 3300025898 | Ga0207692_10397937 | Ga0207692_103979372 | 152 |
| 465 | 3300025899 | Ga0207642_10292696 | Ga0207642_102926962 | 152 |
| 466 | 3300025899 | Ga0207642_10805140 | Ga0207642_108051401 | 152 |
| 467 | 3300025903 | Ga0207680_10158576 | Ga0207680_101585762 | 152 |
| 468 | 3300025904 | Ga0207647_10049061 | Ga0207647_100490613 | 152 |
| 469 | 3300025907 | Ga0207645_10000852 | Ga0207645_1000085224 | 152 |
| 470 | 3300025907 | Ga0207645_10013648 | Ga0207645_100136485 | 152 |
| 471 | 3300025908 | Ga0207643_10000150 | Ga0207643_100001506 | 152 |
| 472 | 3300025910 | Ga0207684_10000996 | Ga0207684_1000099623 | 152 |
| 473 | 3300025910 | Ga0207684_10001569 | Ga0207684_1000156922 | 152 |
| 474 | 3300025910 | Ga0207684_10002411 | Ga0207684_100024118 | 152 |
| 475 | 3300025910 | Ga0207684_10008157 | Ga0207684_100081572 | 152 |
| 476 | 3300025910 | Ga0207684_10028553 | Ga0207684_100285534 | 152 |
| 477 | 3300025910 | Ga0207684_10052166 | Ga0207684_100521663 | 152 |
| 478 | 3300025910 | Ga0207684_10182336 | Ga0207684_101823363 | 152 |
| 479 | 3300025910 | Ga0207684_10239761 | Ga0207684_102397612 | 152 |
| 480 | 3300025910 | Ga0207684_10284387 | Ga0207684_102843872 | 152 |
| 481 | 3300025910 | Ga0207684_10313165 | Ga0207684_103131652 | 152 |
| 482 | 3300025910 | Ga0207684_10387267 | Ga0207684_103872672 | 152 |
| 483 | 3300025910 | Ga0207684_10462277 | Ga0207684_104622772 | 152 |
| 484 | 3300025910 | Ga0207684_10506424 | Ga0207684_105064241 | 152 |
| 485 | 3300025910 | Ga0207684_10521690 | Ga0207684_105216902 | 152 |
| 486 | 3300025911 | Ga0207654_10029377 | Ga0207654_100293774 | 152 |
| 487 | 3300025911 | Ga0207654_10119642 | Ga0207654_101196422 | 152 |
| 488 | 3300025912 | Ga0207707_10000076 | Ga0207707_1000007617 | 152 |
| 489 | 3300025912 | Ga0207707_10031856 | Ga0207707_100318563 | 152 |
| 490 | 3300025912 | Ga0207707_10102064 | Ga0207707_101020641 | 152 |
| 491 | 3300025912 | Ga0207707_10140157 | Ga0207707_101401573 | 152 |
| 492 | 3300025912 | Ga0207707_10336183 | Ga0207707_103361832 | 152 |
| 493 | 3300025916 | Ga0207663_10698262 | Ga0207663_106982622 | 152 |
| 494 | 3300025917 | Ga0207660_10000022 | Ga0207660_1000002261 | 152 |
| 495 | 3300025917 | Ga0207660_10048361 | Ga0207660_100483612 | 152 |
| 496 | 3300025918 | Ga0207662_10023135 | Ga0207662_100231354 | 152 |
| 497 | 3300025919 | Ga0207657_10000005 | Ga0207657_10000005120 | 152 |
| 498 | 3300025920 | Ga0207649_10003591 | Ga0207649_100035914 | 152 |
| 499 | 3300025921 | Ga0207652_10000060 | Ga0207652_1000006096 | 152 |
| 500 | 3300025921 | Ga0207652_10023677 | Ga0207652_100236775 | 152 |
| 501 | 3300025921 | Ga0207652_10069077 | Ga0207652_100690772 | 152 |
| 502 | 3300025921 | Ga0207652_10078641 | Ga0207652_100786412 | 152 |
| 503 | 3300025921 | Ga0207652_10349596 | Ga0207652_103495962 | 152 |
| 504 | 3300025922 | Ga0207646_10001766 | Ga0207646_100017665 | 152 |
| 505 | 3300025922 | Ga0207646_10006356 | Ga0207646_1000635611 | 152 |
| 506 | 3300025922 | Ga0207646_10008955 | Ga0207646_100089556 | 152 |
| 507 | 3300025922 | Ga0207646_10016669 | Ga0207646_100166696 | 152 |
| 508 | 3300025922 | Ga0207646_10114641 | Ga0207646_101146412 | 152 |
| 509 | 3300025922 | Ga0207646_10141204 | Ga0207646_101412043 | 152 |
| 510 | 3300025922 | Ga0207646_10159756 | Ga0207646_101597562 | 152 |
| 511 | 3300025922 | Ga0207646_10424425 | Ga0207646_104244252 | 152 |
| 512 | 3300025922 | Ga0207646_10487366 | Ga0207646_104873662 | 152 |
| 513 | 3300025922 | Ga0207646_10601260 | Ga0207646_106012602 | 152 |
| 514 | 3300025922 | Ga0207646_11349769 | Ga0207646_113497691 | 152 |
| 515 | 3300025923 | Ga0207681_10007091 | Ga0207681_100070916 | 152 |
| 516 | 3300025923 | Ga0207681_10211310 | Ga0207681_102113103 | 152 |
| 517 | 3300025923 | Ga0207681_10459040 | Ga0207681_104590402 | 152 |
| 518 | 3300025923 | Ga0207681_10605141 | Ga0207681_106051412 | 152 |
| 519 | 3300025923 | Ga0207681_10681995 | Ga0207681_106819952 | 152 |
| 520 | 3300025924 | Ga0207694_11095009 | Ga0207694_110950091 | 152 |
| 521 | 3300025924 | Ga0207694_11661090 | Ga0207694_116610901 | 152 |
| 522 | 3300025925 | Ga0207650_10072410 | Ga0207650_100724102 | 152 |
| 523 | 3300025926 | Ga0207659_10248049 | Ga0207659_102480493 | 152 |
| 524 | 3300025926 | Ga0207659_10916707 | Ga0207659_109167071 | 152 |
| 525 | 3300025931 | Ga0207644_10458373 | Ga0207644_104583732 | 152 |
| 526 | 3300025932 | Ga0207690_10006358 | Ga0207690_100063586 | 152 |
| 527 | 3300025933 | Ga0207706_10027460 | Ga0207706_100274604 | 152 |
| 528 | 3300025933 | Ga0207706_10063115 | Ga0207706_100631152 | 152 |
| 529 | 3300025935 | Ga0207709_10017341 | Ga0207709_100173413 | 152 |
| 530 | 3300025935 | Ga0207709_10380646 | Ga0207709_103806462 | 152 |
| 531 | 3300025935 | Ga0207709_10697026 | Ga0207709_106970262 | 152 |
| 532 | 3300025935 | Ga0207709_10725893 | Ga0207709_107258931 | 152 |
| 533 | 3300025936 | Ga0207670_10008129 | Ga0207670_100081296 | 152 |
| 534 | 3300025938 | Ga0207704_10233523 | Ga0207704_102335232 | 152 |
| 535 | 3300025938 | Ga0207704_10308151 | Ga0207704_103081512 | 152 |
| 536 | 3300025938 | Ga0207704_10502297 | Ga0207704_105022972 | 152 |
| 537 | 3300025939 | Ga0207665_10005354 | Ga0207665_100053544 | 152 |
| 538 | 3300025940 | Ga0207691_10037324 | Ga0207691_100373243 | 152 |
| 539 | 3300025940 | Ga0207691_10216845 | Ga0207691_102168452 | 152 |
| 540 | 3300025941 | Ga0207711_10279211 | Ga0207711_102792112 | 152 |
| 541 | 3300025941 | Ga0207711_11332540 | Ga0207711_113325401 | 152 |
| 542 | 3300025942 | Ga0207689_10000050 | Ga0207689_1000005059 | 152 |
| 543 | 3300025942 | Ga0207689_10004262 | Ga0207689_100042625 | 152 |
| 544 | 3300025942 | Ga0207689_10198354 | Ga0207689_101983542 | 152 |
| 545 | 3300025944 | Ga0207661_10109543 | Ga0207661_101095433 | 152 |
| 546 | 3300025944 | Ga0207661_10436733 | Ga0207661_104367332 | 152 |
| 547 | 3300025944 | Ga0207661_10651228 | Ga0207661_106512282 | 152 |
| 548 | 3300025945 | Ga0207679_10002376 | Ga0207679_100023767 | 152 |
| 549 | 3300025949 | Ga0207667_10000587 | Ga0207667_1000058733 | 152 |
| 550 | 3300025949 | Ga0207667_10343624 | Ga0207667_103436242 | 152 |
| 551 | 3300025960 | Ga0207651_10011721 | Ga0207651_100117213 | 152 |
| 552 | 3300025961 | Ga0207712_10050600 | Ga0207712_100506002 | 152 |
| 553 | 3300025961 | Ga0207712_10306567 | Ga0207712_103065673 | 152 |
| 554 | 3300025961 | Ga0207712_10670257 | Ga0207712_106702571 | 152 |
| 555 | 3300025961 | Ga0207712_10768261 | Ga0207712_107682611 | 152 |
| 556 | 3300025961 | Ga0207712_11199756 | Ga0207712_111997562 | 152 |
| 557 | 3300025972 | Ga0207668_10401152 | Ga0207668_104011522 | 152 |
| 558 | 3300025972 | Ga0207668_10630763 | Ga0207668_106307632 | 152 |
| 559 | 3300025981 | Ga0207640_10049758 | Ga0207640_100497582 | 152 |
| 560 | 3300025981 | Ga0207640_10211929 | Ga0207640_102119291 | 152 |
| 561 | 3300025981 | Ga0207640_11060467 | Ga0207640_110604672 | 152 |
| 562 | 3300026023 | Ga0207677_10436860 | Ga0207677_104368602 | 152 |
| 563 | 3300026023 | Ga0207677_10836824 | Ga0207677_108368242 | 152 |
| 564 | 3300026035 | Ga0207703_10060648 | Ga0207703_100606483 | 152 |
| 565 | 3300026041 | Ga0207639_10049105 | Ga0207639_100491054 | 152 |
| 566 | 3300026041 | Ga0207639_11404783 | Ga0207639_114047831 | 152 |
| 567 | 3300026067 | Ga0207678_10001742 | Ga0207678_100017427 | 152 |
| 568 | 3300026067 | Ga0207678_10318709 | Ga0207678_103187092 | 152 |
| 569 | 3300026075 | Ga0207708_10124948 | Ga0207708_101249483 | 152 |
| 570 | 3300026078 | Ga0207702_10098091 | Ga0207702_100980914 | 152 |
| 571 | 3300026078 | Ga0207702_10691902 | Ga0207702_106919022 | 152 |
| 572 | 3300026078 | Ga0207702_10928924 | Ga0207702_109289242 | 152 |
| 573 | 3300026088 | Ga0207641_10022956 | Ga0207641_100229564 | 152 |
| 574 | 3300026088 | Ga0207641_10335830 | Ga0207641_103358302 | 152 |
| 575 | 3300026088 | Ga0207641_10520199 | Ga0207641_105201992 | 152 |
| 576 | 3300026088 | Ga0207641_11021133 | Ga0207641_110211331 | 152 |
| 577 | 3300026089 | Ga0207648_10005797 | Ga0207648_1000579711 | 152 |
| 578 | 3300026089 | Ga0207648_10038731 | Ga0207648_100387312 | 152 |
| 579 | 3300026089 | Ga0207648_10131629 | Ga0207648_101316293 | 152 |
| 580 | 3300026089 | Ga0207648_10146922 | Ga0207648_101469222 | 152 |
| 581 | 3300026095 | Ga0207676_10061331 | Ga0207676_100613314 | 152 |
| 582 | 3300026095 | Ga0207676_10197607 | Ga0207676_101976071 | 152 |
| 583 | 3300026095 | Ga0207676_11038288 | Ga0207676_110382882 | 152 |
| 584 | 3300026116 | Ga0207674_10000075 | Ga0207674_1000007553 | 152 |
| 585 | 3300026116 | Ga0207674_10036958 | Ga0207674_100369585 | 152 |
| 586 | 3300026116 | Ga0207674_10067327 | Ga0207674_100673273 | 152 |
| 587 | 3300026116 | Ga0207674_10084664 | Ga0207674_100846644 | 152 |
| 588 | 3300026118 | Ga0207675_100012152 | Ga0207675_1000121525 | 152 |
| 589 | 3300026118 | Ga0207675_100229606 | Ga0207675_1002296062 | 152 |
| 590 | 3300027462 | Ga0210000_1009137 | Ga0210000_10091372 | 152 |
| 591 | 3300027665 | Ga0209983_1022072 | Ga0209983_10220722 | 152 |
| 592 | 3300027671 | Ga0209588_1002125 | Ga0209588_10021255 | 152 |
| 593 | 3300027671 | Ga0209588_1077971 | Ga0209588_10779712 | 152 |
| 594 | 3300027717 | Ga0209998_10141696 | Ga0209998_101416962 | 152 |
| 595 | 3300027876 | Ga0209974_10046506 | Ga0209974_100465063 | 152 |
| 596 | 3300027907 | Ga0207428_10000009 | Ga0207428_10000009259 | 152 |
| 597 | 3300027907 | Ga0207428_10000631 | Ga0207428_1000063141 | 152 |
| 598 | 3300027907 | Ga0207428_10109497 | Ga0207428_101094972 | 152 |
| 599 | 3300027907 | Ga0207428_10560977 | Ga0207428_105609771 | 152 |
| 600 | 3300028379 | Ga0268266_10873953 | Ga0268266_108739532 | 152 |
| 601 | 3300028380 | Ga0268265_10007375 | Ga0268265_100073754 | 152 |
| 602 | 3300028380 | Ga0268265_10067642 | Ga0268265_100676424 | 152 |
| 603 | 3300028380 | Ga0268265_10090858 | Ga0268265_100908583 | 152 |
| 604 | 3300028380 | Ga0268265_10177003 | Ga0268265_101770031 | 152 |
| 605 | 3300028380 | Ga0268265_10467559 | Ga0268265_104675592 | 152 |
| 606 | 3300028380 | Ga0268265_10945312 | Ga0268265_109453122 | 152 |
| 607 | 3300028381 | Ga0268264_10020679 | Ga0268264_100206792 | 152 |
| 608 | 3300028381 | Ga0268264_10030980 | Ga0268264_100309803 | 152 |
| 609 | 3300028381 | Ga0268264_10092992 | Ga0268264_100929924 | 152 |
| 610 | 3300028381 | Ga0268264_10260110 | Ga0268264_102601102 | 152 |
| 611 | 3300028381 | Ga0268264_10657248 | Ga0268264_106572482 | 152 |
| 612 | 3300028381 | Ga0268264_10710385 | Ga0268264_107103852 | 152 |
| 613 | 3300028381 | Ga0268264_11928651 | Ga0268264_119286511 | 152 |
| 614 | 3300031241 | Ga0265325_10005355 | Ga0265325_100053552 | 152 |
| 615 | 3300031548 | Ga0307408_100044097 | Ga0307408_1000440975 | 152 |
| 616 | 3300031548 | Ga0307408_100222053 | Ga0307408_1002220532 | 152 |
| 617 | 3300031731 | Ga0307405_10111668 | Ga0307405_101116683 | 152 |
| 618 | 3300031731 | Ga0307405_10273264 | Ga0307405_102732642 | 152 |
| 619 | 3300031852 | Ga0307410_11763437 | Ga0307410_117634371 | 152 |
| 620 | 3300031901 | Ga0307406_10078084 | Ga0307406_100780842 | 152 |
| 621 | 3300032002 | Ga0307416_100521610 | Ga0307416_1005216102 | 152 |
| 622 | 3300032002 | Ga0307416_102064962 | Ga0307416_1020649621 | 152 |
| 623 | 3300032005 | Ga0307411_10491308 | Ga0307411_104913082 | 152 |
| 624 | 3300032005 | Ga0307411_10961862 | Ga0307411_109618622 | 152 |
| 625 | 3300032126 | Ga0307415_100263008 | Ga0307415_1002630082 | 152 |
| 626 | 3300032126 | Ga0307415_101943541 | Ga0307415_1019435411 | 152 |
| 627 | 3300034816 | Ga0373930_0045200 | Ga0373930_0045200_40_498 | 152 |
| 628 | 3300034817 | Ga0373948_0022860 | Ga0373948_0022860_481_939 | 152 |
| 629 | 3300034819 | Ga0373958_0038403 | Ga0373958_0038403_94_552 | 152 |
| 630 | 3300034820 | Ga0373959_0011123 | Ga0373959_0011123_709_1167 | 152 |
| 631 | 3300035086 | Ga0373934_0263500 | Ga0373934_0263500_127_585 | 152 |
| 632 | 3300035088 | Ga0373940_0002057 | Ga0373940_0002057_2822_3280 | 152 |
| 633 | 3300035088 | Ga0373940_0022837 | Ga0373940_0022837_1036_1494 | 152 |
| 634 | 3300035090 | Ga0373949_0001137 | Ga0373949_0001137_2993_3451 | 152 |
| 635 | 3300035090 | Ga0373949_0154028 | Ga0373949_0154028_147_605 | 152 |
| 636 | 3300035091 | Ga0373951_0021372 | Ga0373951_0021372_73_531 | 152 |
| 637 | 3300035092 | Ga0373952_0051068 | Ga0373952_0051068_280_738 | 152 |
| 638 | 3300035092 | Ga0373952_0066762 | Ga0373952_0066762_61_519 | 152 |
| 639 | 3300035112 | Ga0373932_0114584 | Ga0373932_0114584_382_840 | 152 |
| 640 | 3300035114 | Ga0373939_0390273 | Ga0373939_0390273_51_512 | 152 |
| 641 | 3300035115 | Ga0373941_0124486 | Ga0373941_0124486_432_890 | 152 |
| 642 | 3300035121 | Ga0373960_0032851 | Ga0373960_0032851_659_1117 | 152 |
| 643 | 3300035170 | Ga0373943_0011173 | Ga0373943_0011173_1073_1537 | 152 |
| 644 | 3300035207 | Ga0373942_0057071 | Ga0373942_0057071_554_1012 | 152 |
| 645 | 3300035207 | Ga0373942_0080498 | Ga0373942_0080498_88_546 | 152 |
| 646 | 3300035241 | Ga0373961_0003927 | Ga0373961_0003927_204_662 | 152 |
| 647 | 3300035241 | Ga0373961_0076866 | Ga0373961_0076866_383_841 | 152 |
| 648 | 3300035242 | Ga0373962_0006756 | Ga0373962_0006756_1971_2429 | 152 |
| 649 | 3300035242 | Ga0373962_0011889 | Ga0373962_0011889_1049_1507 | 152 |
| 650 | 3300035691 | Ga0373931_0005358 | Ga0373931_0005358_3740_4198 | 152 |
| 651 | 3300035691 | Ga0373931_0009773 | Ga0373931_0009773_2559_3017 | 152 |
| 652 | 3300035691 | Ga0373931_0104028 | Ga0373931_0104028_17_475 | 152 |
| 653 | 3300035691 | Ga0373931_0315703 | Ga0373931_0315703_42_503 | 152 |
| 654 | 3300035724 | Ga0373933_0329719 | Ga0373933_0329719_205_663 | 152 |
| 655 | 3300037312 | Ga0395899_0005710 | Ga0395899_0005710_4308_4766 | 152 |
| 656 | 3300037418 | Ga0395900_0005301 | Ga0395900_0005301_7431_7889 | 152 |
| 657 | 3300037466 | Ga0395898_0007244 | Ga0395898_0007244_5532_5990 | 152 |
| 658 | 3300037466 | Ga0395898_1322176 | Ga0395898_1322176_167_631 | 152 |
| 659 | 3300038443 | Ga0395901_0137841 | Ga0395901_0137841_1663_2121 | 152 |
| 660 | 3300038443 | Ga0395901_0718524 | Ga0395901_0718524_459_923 | 152 |
| 661 | 3300038443 | Ga0395901_0915858 | Ga0395901_0915858_223_681 | 152 |
| 662 | 3300039447 | Ga0436361_0067535 | Ga0436361_0067535_213_671 | 152 |
| 663 | 3300039450 | Ga0436363_0822832 | Ga0436363_0822832_35_496 | 152 |
| 664 | 3300039450 | Ga0436363_1398976 | Ga0436363_1398976_89_550 | 152 |
| 665 | 3300042005 | Ga0439448_0020856 | Ga0439448_0020856_769_1227 | 152 |
| 666 | 3300042012 | Ga0439455_0025065 | Ga0439455_0025065_140_598 | 152 |
| 667 | 3300042012 | Ga0439455_0049398 | Ga0439455_0049398_235_693 | 152 |
| 668 | 3300042144 | Ga0450889_013854 | Ga0450889_013854_217_675 | 152 |
| 669 | 3300042157 | Ga0439458_0008415 | Ga0439458_0008415_38_496 | 152 |
| 670 | 3300042438 | Ga0439459_0024084 | Ga0439459_0024084_321_779 | 152 |
| 671 | 3300042438 | Ga0439459_0046145 | Ga0439459_0046145_304_762 | 152 |
| 672 | 3300042461 | Ga0439460_0077985 | Ga0439460_0077985_519_977 | 152 |
| 673 | 3300042876 | Ga0451577_0003313 | Ga0451577_0003313_16916_17392 | 152 |
| 674 | 3300042876 | Ga0451577_0054622 | Ga0451577_0054622_1036_1494 | 152 |
| 675 | 3300042876 | Ga0451577_0100573 | Ga0451577_0100573_53_511 | 152 |
| 676 | 3300042876 | Ga0451577_0182142 | Ga0451577_0182142_678_1136 | 152 |
| 677 | 3300042876 | Ga0451577_0510865 | Ga0451577_0510865_103_561 | 152 |
| 678 | 3300044658 | Ga0466972_0207976 | Ga0466972_0207976_339_890 | 152 |
| 679 | 3300044673 | Ga0453683_0008769 | Ga0453683_0008769_5216_5674 | 152 |
| 680 | 3300044673 | Ga0453683_0107187 | Ga0453683_0107187_638_1114 | 152 |
| 681 | 3300044673 | Ga0453683_0137695 | Ga0453683_0137695_306_767 | 152 |
| 682 | 3300044693 | Ga0466961_0608984 | Ga0466961_0608984_34_498 | 152 |
| 683 | 3300044712 | Ga0453684_0023688 | Ga0453684_0023688_7890_8348 | 152 |
| 684 | 3300044712 | Ga0453684_0030957 | Ga0453684_0030957_3088_3546 | 152 |
| 685 | 3300044712 | Ga0453684_0082959 | Ga0453684_0082959_1600_2076 | 152 |
| 686 | 3300045051 | Ga0451576_0006637 | Ga0451576_0006637_12329_12805 | 152 |
| 687 | 3300045051 | Ga0451576_0022946 | Ga0451576_0022946_2313_2771 | 152 |
| 688 | 3300045051 | Ga0451576_0024715 | Ga0451576_0024715_2479_2937 | 152 |
| 689 | 3300045051 | Ga0451576_0029219 | Ga0451576_0029219_2689_3147 | 152 |
| 690 | 3300045051 | Ga0451576_0051221 | Ga0451576_0051221_2315_2773 | 152 |
| 691 | 3300045051 | Ga0451576_0678385 | Ga0451576_0678385_13_471 | 152 |
| 692 | 3300045976 | Ga0466967_0536850 | Ga0466967_0536850_440_898 | 152 |
| 693 | 3300045976 | Ga0466967_1580040 | Ga0466967_1580040_88_546 | 152 |
| 694 | 3300045976 | Ga0466967_2054182 | Ga0466967_2054182_43_507 | 152 |
| 695 | 3300046455 | Ga0495603_0538655 | Ga0495603_0538655_78_542 | 152 |
| 696 | 3300046462 | Ga0495651_0537884 | Ga0495651_0537884_13_474 | 152 |
| 697 | 3300046472 | Ga0495580_0001861 | Ga0495580_0001861_15628_16086 | 152 |
| 698 | 3300046472 | Ga0495580_0472434 | Ga0495580_0472434_58_516 | 152 |
| 699 | 3300046491 | Ga0495584_0669906 | Ga0495584_0669906_51_509 | 152 |
| 700 | 3300046491 | Ga0495584_0674244 | Ga0495584_0674244_30_488 | 152 |
| 701 | 3300046499 | Ga0495594_0091689 | Ga0495594_0091689_794_1258 | 152 |
| 702 | 3300046501 | Ga0495607_0335206 | Ga0495607_0335206_153_611 | 152 |
| 703 | 3300046516 | Ga0495628_0289371 | Ga0495628_0289371_133_594 | 152 |
| 704 | 3300046528 | Ga0495642_0098964 | Ga0495642_0098964_280_744 | 152 |
| 705 | 3300046528 | Ga0495642_0528914 | Ga0495642_0528914_22_480 | 152 |
| 706 | 3300046529 | Ga0495652_0554207 | Ga0495652_0554207_36_497 | 152 |
| 707 | 3300046615 | Ga0495656_0350537 | Ga0495656_0350537_113_577 | 152 |
| 708 | 3300046678 | Ga0495599_0178882 | Ga0495599_0178882_773_1234 | 152 |
| 709 | 3300046679 | Ga0495623_0102012 | Ga0495623_0102012_1180_1641 | 152 |
| 710 | 3300046680 | Ga0495646_0522226 | Ga0495646_0522226_44_505 | 152 |
| 711 | 3300046684 | Ga0495669_0099714 | Ga0495669_0099714_631_1095 | 152 |
| 712 | 3300046684 | Ga0495669_0637634 | Ga0495669_0637634_21_479 | 152 |
| 713 | 3300046689 | Ga0495613_0474799 | Ga0495613_0474799_56_520 | 152 |
| 714 | 3300047318 | Ga0495636_0592228 | Ga0495636_0592228_46_504 | 152 |
| 715 | 3300047319 | Ga0495674_1209400 | Ga0495674_1209400_21_482 | 152 |
| 716 | 3300048088 | Ga0495602_0056861 | Ga0495602_0056861_862_1323 | 152 |
| 717 | 3300048088 | Ga0495602_0190760 | Ga0495602_0190760_187_648 | 152 |
| 718 | 3300048905 | Ga0496102_0030748 | Ga0496102_0030748_3029_3487 | 152 |
| 719 | 3300048905 | Ga0496102_0100319 | Ga0496102_0100319_1656_2114 | 152 |
| 720 | 3300048907 | Ga0496104_0307557 | Ga0496104_0307557_657_1115 | 152 |
| 721 | 3300048909 | Ga0496106_0066708 | Ga0496106_0066708_889_1347 | 152 |
| 722 | 3300048909 | Ga0496106_0165429 | Ga0496106_0165429_593_1051 | 152 |
| 723 | 3300048910 | Ga0496107_0155165 | Ga0496107_0155165_433_891 | 152 |
| 724 | 3300048912 | Ga0496109_0350859 | Ga0496109_0350859_73_531 | 152 |
| 725 | 3300048913 | Ga0496110_0166215 | Ga0496110_0166215_593_1051 | 152 |
| 726 | 3300048914 | Ga0496111_0188069 | Ga0496111_0188069_351_809 | 152 |
| 727 | 3300048915 | Ga0496112_0037103 | Ga0496112_0037103_2673_3131 | 152 |
| 728 | 3300048915 | Ga0496112_0812371 | Ga0496112_0812371_214_675 | 152 |
| 729 | 3300048916 | Ga0496113_0344742 | Ga0496113_0344742_347_805 | 152 |
| 730 | 3300049570 | Ga0501033_0060859 | Ga0501033_0060859_82_540 | 152 |
| 731 | 3300049571 | Ga0501034_0430056 | Ga0501034_0430056_388_873 | 152 |
| 732 | 3300049572 | Ga0501036_0497695 | Ga0501036_0497695_256_714 | 152 |
| 733 | 3300049572 | Ga0501036_0949161 | Ga0501036_0949161_118_576 | 152 |
| 734 | 3300049572 | Ga0501036_1038556 | Ga0501036_1038556_132_635 | 152 |
| 735 | 3300049573 | Ga0501037_0167325 | Ga0501037_0167325_838_1296 | 152 |
| 736 | 3300049573 | Ga0501037_0970061 | Ga0501037_0970061_36_539 | 152 |
| 737 | 3300049574 | Ga0501038_0394070 | Ga0501038_0394070_188_646 | 152 |
| 738 | 3300049575 | Ga0501039_0073727 | Ga0501039_0073727_727_1185 | 152 |
| 739 | 3300049576 | Ga0501040_0005074 | Ga0501040_0005074_7803_8261 | 152 |
| 740 | 3300049576 | Ga0501040_0050315 | Ga0501040_0050315_335_793 | 152 |
| 741 | 3300049576 | Ga0501040_0169625 | Ga0501040_0169625_1020_1478 | 152 |
| 742 | 3300049576 | Ga0501040_1098407 | Ga0501040_1098407_91_549 | 152 |
| 743 | 3300049577 | Ga0501041_0059321 | Ga0501041_0059321_1695_2153 | 152 |
| 744 | 3300049577 | Ga0501041_0200888 | Ga0501041_0200888_215_673 | 152 |
| 745 | 3300049577 | Ga0501041_0318678 | Ga0501041_0318678_311_814 | 152 |
| 746 | 3300049577 | Ga0501041_0712555 | Ga0501041_0712555_138_596 | 152 |
| 747 | 3300049578 | Ga0501042_0135706 | Ga0501042_0135706_426_884 | 152 |
| 748 | 3300049578 | Ga0501042_0531805 | Ga0501042_0531805_274_732 | 152 |
| 749 | 3300049578 | Ga0501042_1023688 | Ga0501042_1023688_121_579 | 152 |
| 750 | 3300049579 | Ga0501043_0361466 | Ga0501043_0361466_444_902 | 152 |
| 751 | 3300049579 | Ga0501043_0738110 | Ga0501043_0738110_180_638 | 152 |
| 752 | 3300049579 | Ga0501043_0814236 | Ga0501043_0814236_106_570 | 152 |
| 753 | 3300049579 | Ga0501043_0940766 | Ga0501043_0940766_141_599 | 152 |
| 754 | 3300049580 | Ga0501046_0090245 | Ga0501046_0090245_805_1263 | 152 |
| 755 | 3300049580 | Ga0501046_0486811 | Ga0501046_0486811_68_529 | 152 |
| 756 | 3300049582 | Ga0501048_0078831 | Ga0501048_0078831_132_590 | 152 |
| 757 | 3300049582 | Ga0501048_0556054 | Ga0501048_0556054_147_605 | 152 |
| 758 | 3300049583 | Ga0501067_0018104 | Ga0501067_0018104_3358_3816 | 152 |
| 759 | 3300049583 | Ga0501067_0065519 | Ga0501067_0065519_1462_1920 | 152 |
| 760 | 3300049584 | Ga0501068_0029632 | Ga0501068_0029632_53_511 | 152 |
| 761 | 3300049584 | Ga0501068_0077246 | Ga0501068_0077246_968_1426 | 152 |
| 762 | 3300049584 | Ga0501068_0195644 | Ga0501068_0195644_94_552 | 152 |
| 763 | 3300049584 | Ga0501068_0442146 | Ga0501068_0442146_208_666 | 152 |
| 764 | 3300049585 | Ga0501069_0030340 | Ga0501069_0030340_1817_2275 | 152 |
| 765 | 3300049585 | Ga0501069_0129532 | Ga0501069_0129532_18_476 | 152 |
| 766 | 3300049585 | Ga0501069_0475263 | Ga0501069_0475263_231_689 | 152 |
| 767 | 3300049587 | Ga0501071_0074452 | Ga0501071_0074452_1800_2258 | 152 |
| 768 | 3300049587 | Ga0501071_0128859 | Ga0501071_0128859_989_1447 | 152 |
| 769 | 3300049587 | Ga0501071_0302888 | Ga0501071_0302888_498_959 | 152 |
| 770 | 3300049588 | Ga0501072_0136345 | Ga0501072_0136345_479_943 | 152 |
| 771 | 3300049588 | Ga0501072_0181917 | Ga0501072_0181917_530_1018 | 152 |
| 772 | 3300049588 | Ga0501072_0206515 | Ga0501072_0206515_193_651 | 152 |
| 773 | 3300049588 | Ga0501072_0935520 | Ga0501072_0935520_35_499 | 152 |
| 774 | 3300049588 | Ga0501072_1383178 | Ga0501072_1383178_22_480 | 152 |
| 775 | 3300049590 | Ga0501074_0219130 | Ga0501074_0219130_829_1287 | 152 |
| 776 | 3300049590 | Ga0501074_0381183 | Ga0501074_0381183_206_664 | 152 |
| 777 | 3300049590 | Ga0501074_0439368 | Ga0501074_0439368_97_555 | 152 |
| 778 | 3300049590 | Ga0501074_0921760 | Ga0501074_0921760_124_582 | 152 |
| 779 | 3300049591 | Ga0501075_0039504 | Ga0501075_0039504_521_979 | 152 |
| 780 | 3300049591 | Ga0501075_0050064 | Ga0501075_0050064_1035_1499 | 152 |
| 781 | 3300049591 | Ga0501075_0103517 | Ga0501075_0103517_1305_1763 | 152 |
| 782 | 3300049591 | Ga0501075_0108776 | Ga0501075_0108776_1348_1806 | 152 |
| 783 | 3300049591 | Ga0501075_0143600 | Ga0501075_0143600_45_503 | 152 |
| 784 | 3300049591 | Ga0501075_0178358 | Ga0501075_0178358_861_1319 | 152 |
| 785 | 3300049591 | Ga0501075_0181089 | Ga0501075_0181089_830_1369 | 152 |
| 786 | 3300049591 | Ga0501075_0324184 | Ga0501075_0324184_104_562 | 152 |
| 787 | 3300049591 | Ga0501075_0427783 | Ga0501075_0427783_132_590 | 152 |
| 788 | 3300049591 | Ga0501075_0595065 | Ga0501075_0595065_233_700 | 152 |
| 789 | 3300049591 | Ga0501075_0630076 | Ga0501075_0630076_210_689 | 152 |
| 790 | 3300049592 | Ga0501076_0016029 | Ga0501076_0016029_4912_5370 | 152 |
| 791 | 3300049592 | Ga0501076_0019510 | Ga0501076_0019510_2958_3422 | 152 |
| 792 | 3300049592 | Ga0501076_0178291 | Ga0501076_0178291_388_846 | 152 |
| 793 | 3300049592 | Ga0501076_0986157 | Ga0501076_0986157_92_553 | 152 |
| 794 | 3300049593 | Ga0501077_0020298 | Ga0501077_0020298_3169_3627 | 152 |
| 795 | 3300049593 | Ga0501077_0023045 | Ga0501077_0023045_419_877 | 152 |
| 796 | 3300049593 | Ga0501077_0057806 | Ga0501077_0057806_727_1185 | 152 |
| 797 | 3300049593 | Ga0501077_0526450 | Ga0501077_0526450_132_590 | 152 |
| 798 | 3300049593 | Ga0501077_0585850 | Ga0501077_0585850_27_485 | 152 |
| 799 | 3300049593 | Ga0501077_0800068 | Ga0501077_0800068_12_470 | 152 |
| 800 | 3300049669 | Ga0501235_180068 | Ga0501235_180068_22_486 | 152 |
| 801 | 3300049670 | Ga0501236_032159 | Ga0501236_032159_173_631 | 152 |
| 802 | 3300049741 | Ga0501079_0002847 | Ga0501079_0002847_11046_11504 | 152 |
| 803 | 3300049741 | Ga0501079_0035747 | Ga0501079_0035747_2530_2988 | 152 |
| 804 | 3300049741 | Ga0501079_0083660 | Ga0501079_0083660_277_735 | 152 |
| 805 | 3300049741 | Ga0501079_0186289 | Ga0501079_0186289_1151_1609 | 152 |
| 806 | 3300049741 | Ga0501079_0256263 | Ga0501079_0256263_276_740 | 152 |
| 807 | 3300049741 | Ga0501079_0344740 | Ga0501079_0344740_274_813 | 152 |
| 808 | 3300049741 | Ga0501079_0404663 | Ga0501079_0404663_351_809 | 152 |
| 809 | 3300049741 | Ga0501079_1232217 | Ga0501079_1232217_105_563 | 152 |
| 810 | 3300049742 | Ga0501080_0074798 | Ga0501080_0074798_2164_2622 | 152 |
| 811 | 3300049742 | Ga0501080_0364878 | Ga0501080_0364878_173_637 | 152 |
| 812 | 3300049742 | Ga0501080_0660533 | Ga0501080_0660533_335_793 | 152 |
| 813 | 3300049742 | Ga0501080_0957166 | Ga0501080_0957166_211_669 | 152 |
| 814 | 3300049743 | Ga0501081_0003659 | Ga0501081_0003659_7058_7516 | 152 |
| 815 | 3300049743 | Ga0501081_0054040 | Ga0501081_0054040_1395_1853 | 152 |
| 816 | 3300049743 | Ga0501081_0056281 | Ga0501081_0056281_863_1321 | 152 |
| 817 | 3300049743 | Ga0501081_0094403 | Ga0501081_0094403_1493_1951 | 152 |
| 818 | 3300049743 | Ga0501081_0173265 | Ga0501081_0173265_605_1069 | 152 |
| 819 | 3300049743 | Ga0501081_0296014 | Ga0501081_0296014_552_1010 | 152 |
| 820 | 3300049743 | Ga0501081_0644455 | Ga0501081_0644455_260_721 | 152 |
| 821 | 3300049743 | Ga0501081_1271718 | Ga0501081_1271718_58_516 | 152 |
| 822 | 3300049743 | Ga0501081_1351810 | Ga0501081_1351810_13_477 | 152 |
| 823 | 3300049744 | Ga0501083_0506763 | Ga0501083_0506763_116_574 | 152 |
| 824 | 3300049822 | Ga0501035_0503081 | Ga0501035_0503081_325_783 | 152 |
| 825 | 3300049824 | Ga0501045_0075038 | Ga0501045_0075038_1745_2203 | 152 |
| 826 | 3300049824 | Ga0501045_0182607 | Ga0501045_0182607_484_942 | 152 |
| 827 | 3300049824 | Ga0501045_0279710 | Ga0501045_0279710_674_1213 | 152 |
| 828 | 3300049824 | Ga0501045_0408178 | Ga0501045_0408178_213_671 | 152 |
| 829 | 3300049824 | Ga0501045_0536946 | Ga0501045_0536946_387_851 | 152 |
| 830 | 3300049824 | Ga0501045_0762198 | Ga0501045_0762198_127_597 | 152 |
| 831 | 3300049824 | Ga0501045_1002928 | Ga0501045_1002928_128_586 | 152 |
| 832 | 3300050507 | nmdc:mga05p37_100067_c1 | nmdc:mga05p37_100067_c1_282_740 | 152 |
| 833 | 3300050507 | nmdc:mga05p37_109212_c1 | nmdc:mga05p37_109212_c1_2791_3249 | 152 |
| 834 | 3300050507 | nmdc:mga05p37_110969_c2 | nmdc:mga05p37_110969_c2_1512_1973 | 152 |
| 835 | 3300050507 | nmdc:mga05p37_11843_c1 | nmdc:mga05p37_11843_c1_6765_7223 | 152 |
| 836 | 3300050507 | nmdc:mga05p37_168904_c1 | nmdc:mga05p37_168904_c1_1964_2422 | 152 |
| 837 | 3300050507 | nmdc:mga05p37_17944_c1 | nmdc:mga05p37_17944_c1_5976_6434 | 152 |
| 838 | 3300050507 | nmdc:mga05p37_219498_c1 | nmdc:mga05p37_219498_c1_487_951 | 152 |
| 839 | 3300050507 | nmdc:mga05p37_251625_c1 | nmdc:mga05p37_251625_c1_1371_1835 | 152 |
| 840 | 3300050507 | nmdc:mga05p37_358580_c1 | nmdc:mga05p37_358580_c1_698_1156 | 152 |
| 841 | 3300050507 | nmdc:mga05p37_3637_c1 | nmdc:mga05p37_3637_c1_14937_15395 | 152 |
| 842 | 3300050507 | nmdc:mga05p37_43265_c1 | nmdc:mga05p37_43265_c1_301_789 | 152 |
| 843 | 3300050507 | nmdc:mga05p37_434265_c1 | nmdc:mga05p37_434265_c1_130_588 | 152 |
| 844 | 3300050507 | nmdc:mga05p37_449532_c1 | nmdc:mga05p37_449532_c1_157_615 | 152 |
| 845 | 3300050507 | nmdc:mga05p37_56510_c1 | nmdc:mga05p37_56510_c1_1674_2132 | 152 |
| 846 | 3300050507 | nmdc:mga05p37_634435_c1 | nmdc:mga05p37_634435_c1_547_1005 | 152 |
| 847 | 3300050507 | nmdc:mga05p37_72141_c1 | nmdc:mga05p37_72141_c1_771_1229 | 152 |
| 848 | 3300050507 | nmdc:mga05p37_8064_c1 | nmdc:mga05p37_8064_c1_8241_8699 | 152 |
| 849 | 3300050507 | nmdc:mga05p37_8089_c1 | nmdc:mga05p37_8089_c1_8437_8895 | 152 |
| 850 | 3300050508 | nmdc:mga09592_108170_c1 | nmdc:mga09592_108170_c1_1170_1628 | 152 |
| 851 | 3300050508 | nmdc:mga09592_1470980_c1 | nmdc:mga09592_1470980_c1_81_539 | 152 |
| 852 | 3300050508 | nmdc:mga09592_153742_c1 | nmdc:mga09592_153742_c1_219_686 | 152 |
| 853 | 3300050508 | nmdc:mga09592_254165_c1 | nmdc:mga09592_254165_c1_432_890 | 152 |
| 854 | 3300050508 | nmdc:mga09592_26657_c1 | nmdc:mga09592_26657_c1_478_936 | 152 |
| 855 | 3300050508 | nmdc:mga09592_302111_c1 | nmdc:mga09592_302111_c1_158_616 | 152 |
| 856 | 3300050508 | nmdc:mga09592_313007_c1 | nmdc:mga09592_313007_c1_521_988 | 152 |
| 857 | 3300050508 | nmdc:mga09592_333651_c1 | nmdc:mga09592_333651_c1_734_1192 | 152 |
| 858 | 3300050508 | nmdc:mga09592_417946_c1 | nmdc:mga09592_417946_c1_38_496 | 152 |
| 859 | 3300050508 | nmdc:mga09592_4377_c1 | nmdc:mga09592_4377_c1_6906_7364 | 152 |
| 860 | 3300050508 | nmdc:mga09592_7564_c1 | nmdc:mga09592_7564_c1_88_546 | 152 |
| 861 | 3300050508 | nmdc:mga09592_780320_c1 | nmdc:mga09592_780320_c1_260_724 | 152 |
| 862 | 3300050508 | nmdc:mga09592_818_c1 | nmdc:mga09592_818_c1_8146_8604 | 152 |
| 863 | 3300050508 | nmdc:mga09592_82381_c1 | nmdc:mga09592_82381_c1_626_1084 | 152 |
| 864 | 3300050508 | nmdc:mga09592_95033_c1 | nmdc:mga09592_95033_c1_405_863 | 152 |
| 865 | 3300050509 | nmdc:mga0qj67_18174_c1 | nmdc:mga0qj67_18174_c1_883_1341 | 152 |
| 866 | 3300050509 | nmdc:mga0qj67_247092_c1 | nmdc:mga0qj67_247092_c1_942_1400 | 152 |
| 867 | 3300050509 | nmdc:mga0qj67_316281_c1 | nmdc:mga0qj67_316281_c1_251_718 | 152 |
| 868 | 3300050509 | nmdc:mga0qj67_392533_c1 | nmdc:mga0qj67_392533_c1_262_729 | 152 |
| 869 | 3300050509 | nmdc:mga0qj67_39748_c1 | nmdc:mga0qj67_39748_c1_334_792 | 152 |
| 870 | 3300050509 | nmdc:mga0qj67_638740_c1 | nmdc:mga0qj67_638740_c1_208_666 | 152 |
| 871 | 3300050509 | nmdc:mga0qj67_67554_c1 | nmdc:mga0qj67_67554_c1_499_975 | 152 |
| 872 | 3300050509 | nmdc:mga0qj67_68714_c1 | nmdc:mga0qj67_68714_c1_935_1393 | 152 |
| 873 | 3300050509 | nmdc:mga0qj67_730_c1 | nmdc:mga0qj67_730_c1_6067_6525 | 152 |
| 874 | 3300050509 | nmdc:mga0qj67_93875_c1 | nmdc:mga0qj67_93875_c1_915_1373 | 152 |
| 875 | 3300050509 | nmdc:mga0qj67_9771_c1 | nmdc:mga0qj67_9771_c1_6636_7094 | 152 |
| 876 | 3300050510 | nmdc:mga06r32_1170494_c1 | nmdc:mga06r32_1170494_c1_189_647 | 152 |
| 877 | 3300050510 | nmdc:mga06r32_117512_c1 | nmdc:mga06r32_117512_c1_2118_2576 | 152 |
| 878 | 3300050510 | nmdc:mga06r32_128690_c1 | nmdc:mga06r32_128690_c1_537_995 | 152 |
| 879 | 3300050510 | nmdc:mga06r32_12991_c1 | nmdc:mga06r32_12991_c1_4190_4648 | 152 |
| 880 | 3300050510 | nmdc:mga06r32_14279_c1 | nmdc:mga06r32_14279_c1_510_968 | 152 |
| 881 | 3300050510 | nmdc:mga06r32_2111_c1 | nmdc:mga06r32_2111_c1_15973_16449 | 152 |
| 882 | 3300050510 | nmdc:mga06r32_237426_c1 | nmdc:mga06r32_237426_c1_842_1300 | 152 |
| 883 | 3300050510 | nmdc:mga06r32_326076_c1 | nmdc:mga06r32_326076_c1_142_600 | 152 |
| 884 | 3300050510 | nmdc:mga06r32_399277_c1 | nmdc:mga06r32_399277_c1_390_848 | 152 |
| 885 | 3300050510 | nmdc:mga06r32_41550_c1 | nmdc:mga06r32_41550_c1_1453_1911 | 152 |
| 886 | 3300050510 | nmdc:mga06r32_454447_c1 | nmdc:mga06r32_454447_c1_82_540 | 152 |
| 887 | 3300050510 | nmdc:mga06r32_4632_c1 | nmdc:mga06r32_4632_c1_6053_6511 | 152 |
| 888 | 3300050510 | nmdc:mga06r32_484863_c1 | nmdc:mga06r32_484863_c1_219_683 | 152 |
| 889 | 3300050510 | nmdc:mga06r32_786815_c1 | nmdc:mga06r32_786815_c1_408_896 | 152 |
| 890 | 3300050510 | nmdc:mga06r32_828564_c1 | nmdc:mga06r32_828564_c1_98_556 | 152 |
| 891 | 3300050511 | nmdc:mga08y16_1317_c1 | nmdc:mga08y16_1317_c1_22981_23457 | 152 |
| 892 | 3300050511 | nmdc:mga08y16_162187_c1 | nmdc:mga08y16_162187_c1_1351_1815 | 152 |
| 893 | 3300050511 | nmdc:mga08y16_171_c1 | nmdc:mga08y16_171_c1_19082_19540 | 152 |
| 894 | 3300050511 | nmdc:mga08y16_1739795_c1 | nmdc:mga08y16_1739795_c1_65_523 | 152 |
| 895 | 3300050511 | nmdc:mga08y16_428483_c1 | nmdc:mga08y16_428483_c1_744_1202 | 152 |
| 896 | 3300050511 | nmdc:mga08y16_7918_c1 | nmdc:mga08y16_7918_c1_4053_4511 | 152 |
| 897 | 3300050512 | nmdc:mga0n895_10084_c1 | nmdc:mga0n895_10084_c1_2463_2921 | 152 |
| 898 | 3300050512 | nmdc:mga0n895_152601_c1 | nmdc:mga0n895_152601_c1_1239_1697 | 152 |
| 899 | 3300050512 | nmdc:mga0n895_17404_c1 | nmdc:mga0n895_17404_c1_2168_2641 | 152 |
| 900 | 3300050512 | nmdc:mga0n895_19948_c1 | nmdc:mga0n895_19948_c1_1887_2345 | 152 |
| 901 | 3300050512 | nmdc:mga0n895_334791_c1 | nmdc:mga0n895_334791_c1_141_599 | 152 |
| 902 | 3300050512 | nmdc:mga0n895_43883_c2 | nmdc:mga0n895_43883_c2_1945_2403 | 152 |
| 903 | 3300050512 | nmdc:mga0n895_4527_c1 | nmdc:mga0n895_4527_c1_7815_8273 | 152 |
| 904 | 3300050512 | nmdc:mga0n895_47458_c1 | nmdc:mga0n895_47458_c1_2115_2573 | 152 |
| 905 | 3300050512 | nmdc:mga0n895_51094_c1 | nmdc:mga0n895_51094_c1_1206_1664 | 152 |
| 906 | 3300050512 | nmdc:mga0n895_544513_c1 | nmdc:mga0n895_544513_c1_19_477 | 152 |
| 907 | 3300050512 | nmdc:mga0n895_709893_c1 | nmdc:mga0n895_709893_c1_20_478 | 152 |
| 908 | 3300050512 | nmdc:mga0n895_861910_c1 | nmdc:mga0n895_861910_c1_385_846 | 152 |
| 909 | 3300050513 | nmdc:mga0rr50_1027680_c1 | nmdc:mga0rr50_1027680_c1_114_587 | 152 |
| 910 | 3300050513 | nmdc:mga0rr50_1280_c1 | nmdc:mga0rr50_1280_c1_8007_8465 | 152 |
| 911 | 3300050513 | nmdc:mga0rr50_139984_c1 | nmdc:mga0rr50_139984_c1_652_1110 | 152 |
| 912 | 3300050513 | nmdc:mga0rr50_1590746_c1 | nmdc:mga0rr50_1590746_c1_30_488 | 152 |
| 913 | 3300050513 | nmdc:mga0rr50_1684107_c1 | nmdc:mga0rr50_1684107_c1_58_516 | 152 |
| 914 | 3300050513 | nmdc:mga0rr50_26347_c1 | nmdc:mga0rr50_26347_c1_2392_2850 | 152 |
| 915 | 3300050513 | nmdc:mga0rr50_32838_c1 | nmdc:mga0rr50_32838_c1_488_946 | 152 |
| 916 | 3300050513 | nmdc:mga0rr50_5599_c1 | nmdc:mga0rr50_5599_c1_6387_6845 | 152 |
| 917 | 3300050513 | nmdc:mga0rr50_91452_c1 | nmdc:mga0rr50_91452_c1_785_1243 | 152 |
| 918 | 3300050514 | nmdc:mga08x19_45966_c1 | nmdc:mga08x19_45966_c1_20_478 | 152 |
| 919 | 3300050514 | nmdc:mga08x19_5649_c1 | nmdc:mga08x19_5649_c1_266_724 | 152 |
| 920 | 3300050514 | nmdc:mga08x19_601847_c1 | nmdc:mga08x19_601847_c1_264_722 | 152 |
| 921 | 3300050514 | nmdc:mga08x19_76845_c1 | nmdc:mga08x19_76845_c1_439_897 | 152 |
| 922 | 3300050514 | nmdc:mga08x19_9252_c1 | nmdc:mga08x19_9252_c1_317_805 | 152 |
| 923 | 3300050515 | nmdc:mga0a205_111571_c1 | nmdc:mga0a205_111571_c1_1006_1464 | 152 |
| 924 | 3300050515 | nmdc:mga0a205_120630_c1 | nmdc:mga0a205_120630_c1_447_905 | 152 |
| 925 | 3300050515 | nmdc:mga0a205_144582_c1 | nmdc:mga0a205_144582_c1_1526_1984 | 152 |
| 926 | 3300050515 | nmdc:mga0a205_178729_c1 | nmdc:mga0a205_178729_c1_1219_1677 | 152 |
| 927 | 3300050515 | nmdc:mga0a205_189823_c1 | nmdc:mga0a205_189823_c1_648_1106 | 152 |
| 928 | 3300050515 | nmdc:mga0a205_19596_c1 | nmdc:mga0a205_19596_c1_2868_3326 | 152 |
| 929 | 3300050515 | nmdc:mga0a205_24698_c1 | nmdc:mga0a205_24698_c1_3640_4128 | 152 |
| 930 | 3300050515 | nmdc:mga0a205_4101_c1 | nmdc:mga0a205_4101_c1_11244_11702 | 152 |
| 931 | 3300050515 | nmdc:mga0a205_480572_c1 | nmdc:mga0a205_480572_c1_56_514 | 152 |
| 932 | 3300050515 | nmdc:mga0a205_49683_c1 | nmdc:mga0a205_49683_c1_994_1452 | 152 |
| 933 | 3300050515 | nmdc:mga0a205_502462_c1 | nmdc:mga0a205_502462_c1_534_992 | 152 |
| 934 | 3300050515 | nmdc:mga0a205_64423_c1 | nmdc:mga0a205_64423_c1_1263_1736 | 152 |
| 935 | 3300050515 | nmdc:mga0a205_72713_c1 | nmdc:mga0a205_72713_c1_2337_2795 | 152 |
| 936 | 3300050515 | nmdc:mga0a205_7301_c1 | nmdc:mga0a205_7301_c1_4604_5080 | 152 |
| 937 | 3300050515 | nmdc:mga0a205_796_c1 | nmdc:mga0a205_796_c1_10100_10558 | 152 |
| 938 | 3300050515 | nmdc:mga0a205_9201_c1 | nmdc:mga0a205_9201_c1_3993_4469 | 152 |
| 939 | 3300053085 | Ga0495619_0430549 | Ga0495619_0430549_35_499 | 152 |
| 940 | 3300054114 | Ga0501084_0007316 | Ga0501084_0007316_3984_4442 | 152 |
| 941 | 3300054114 | Ga0501084_0019852 | Ga0501084_0019852_1041_1499 | 152 |
| 942 | 3300054114 | Ga0501084_0039408 | Ga0501084_0039408_3334_3792 | 152 |
| 943 | 3300054114 | Ga0501084_0111022 | Ga0501084_0111022_940_1398 | 152 |
| 944 | 3300054114 | Ga0501084_0117599 | Ga0501084_0117599_518_1006 | 152 |
| 945 | 3300054114 | Ga0501084_0139932 | Ga0501084_0139932_161_619 | 152 |
| 946 | 3300054114 | Ga0501084_0522945 | Ga0501084_0522945_460_918 | 152 |
| 947 | 3300054114 | Ga0501084_0843721 | Ga0501084_0843721_95_553 | 152 |
| 948 | 3300059424 | Ga0590075_016660 | Ga0590075_016660_733_1191 | 152 |
| 949 | 3300059424 | Ga0590075_024665 | Ga0590075_024665_12_473 | 152 |
| 950 | 3300060353 | Ga0501082_0070725 | Ga0501082_0070725_1357_1815 | 152 |
| 951 | 3300060353 | Ga0501082_0083559 | Ga0501082_0083559_830_1318 | 152 |
| 952 | 3300060353 | Ga0501082_0090616 | Ga0501082_0090616_485_943 | 152 |
| 953 | 3300060353 | Ga0501082_0168589 | Ga0501082_0168589_613_1071 | 152 |
| 954 | 3300060353 | Ga0501082_0222579 | Ga0501082_0222579_814_1272 | 152 |
| 955 | 3300060353 | Ga0501082_0483426 | Ga0501082_0483426_199_663 | 152 |
| 956 | 3300060353 | Ga0501082_0536677 | Ga0501082_0536677_538_996 | 152 |
| 957 | 3300060353 | Ga0501082_0566207 | Ga0501082_0566207_402_860 | 152 |
| 958 | 3300060353 | Ga0501082_1090843 | Ga0501082_1090843_81_557 | 152 |
| 959 | 3300061734 | Ga0530510_0029602 | Ga0530510_0029602_676_1146 | 152 |
| 960 | 3300061734 | Ga0530510_0064878 | Ga0530510_0064878_885_1343 | 152 |
| 961 | 3300061734 | Ga0530510_0091456 | Ga0530510_0091456_1629_2087 | 152 |
| 962 | 3300061734 | Ga0530510_0312353 | Ga0530510_0312353_482_946 | 152 |
| 963 | 3300061734 | Ga0530510_0529217 | Ga0530510_0529217_252_710 | 152 |
| 964 | 3300061734 | Ga0530510_0572390 | Ga0530510_0572390_316_774 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.7984 | 1 | 150 |
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.7891 | 1 | 150 |
| 7pds-assembly1.cif.gz_D | the structure of prirep1 with dsdna | 0.5298 | 118 | 150 |
| 5imq-assembly1.cif.gz_S | structure of ribosome bound to cofactor at 3.8 angstrom resolution | 0.4929 | 27 | 113 |
| 2rld-assembly1.cif.gz_E | crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution | 0.4926 | 3 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6X831_2_93_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9341 | 4 | 94 | 1.10.1510.10 |
| af_C6Y4B8_28_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9212 | 4 | 94 | 1.10.1510.10 |
| 1ng6A01 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9041 | 1 | 94 | 1.10.1510.10 |
| af_Q12032_29_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.8987 | 5 | 94 | 1.10.1510.10 |
| af_I6X831_2_93_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.8956 | 4 | 94 | 1.10.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V2IAW8-F1-model_v4 | GatB/YqeY domain-containing protein | 0.964 | 2 | 152 |
GO:0016884
|
| AF-A0A7S1UDL8-F1-model_v4 | Asn/Gln amidotransferase domain-containing protein | 0.955 | 1 | 150 |
GO:0016884
|
| AF-A0A7V2IAW8-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9517 | 2 | 152 |
GO:0016884
|
| AF-A0A7V4G0Y2-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9469 | 1 | 151 |
GO:0016884
|
| AF-A0A7T9G411-F1-model_v4 | deleted | 0.9469 | 3 | 151 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar