F486934

General Info

Members Datasets Scaffolds Average Seq Length
964 301 964 153

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_101860463|Ga0075434_1018604632
Length 153
Sequence VTLEQQLTETLTRAIREKDQRTADVVRMLKTKITERRTAKGFTGEVDDAVILDVVGAYRKQLQKALGEYEKAGGDRVAAPIAQLRFEIGFCERYLPKGMDESALRALVKERIGTLGISDVKQAGRLVGDIMKTHKGQVDAADVKRVAEDLLRG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
219 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
280 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
281 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.35
Rhizosphere 98.34
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005819 3300003203 Bacteria 5707
2 JGI25404J52841_10105087 3300003659 Bacteria 593
3 Ga0065712_10141318 3300005290 Bacteria 1447
4 Ga0065715_10113974 3300005293 Bacteria 2452
5 Ga0065707_10185628 3300005295 Bacteria 1390
6 Ga0065707_10244704 3300005295 Bacteria 1144
7 Ga0065707_10479327 3300005295 Unclassified 775
8 Ga0070658_10660707 3300005327 Unclassified 907
9 Ga0070676_10000005 3300005328 Bacteria 76787
10 Ga0070676_10011118 3300005328 Bacteria 4892
11 Ga0070676_10237672 3300005328 Bacteria 1210
12 Ga0070683_100038454 3300005329 Bacteria 4387
13 Ga0070690_100256890 3300005330 Bacteria 1238
14 Ga0070670_100001199 3300005331 Bacteria 20587
15 Ga0070677_10213424 3300005333 Bacteria 938
16 Ga0068869_100002745 3300005334 Bacteria 10659
17 Ga0068869_100009337 3300005334 Bacteria 6361
18 Ga0068869_100050419 3300005334 Bacteria 3017
19 Ga0070666_10219720 3300005335 Bacteria 1340
20 Ga0070680_100000094 3300005336 Bacteria 50344
21 Ga0070680_100039088 3300005336 Bacteria 3839
22 Ga0070680_100062111 3300005336 Bacteria 3058
23 Ga0070680_100437265 3300005336 Unclassified 1117
24 Ga0070680_101041210 3300005336 Unclassified 707
25 Ga0070682_100003884 3300005337 Bacteria 8290
26 Ga0068868_100014283 3300005338 Bacteria 5850
27 Ga0068868_100133018 3300005338 Bacteria 2037
28 Ga0070660_100003125 3300005339 Bacteria 11376
29 Ga0070689_100003437 3300005340 Bacteria 10539
30 Ga0070689_100419278 3300005340 Bacteria 1134
31 Ga0070691_10006218 3300005341 Bacteria 5447
32 Ga0070691_10049587 3300005341 Bacteria 2001
33 Ga0070691_10093272 3300005341 Bacteria 1487
34 Ga0070691_10537802 3300005341 Bacteria 681
35 Ga0070687_100079182 3300005343 Bacteria 1788
36 Ga0070661_100006165 3300005344 Bacteria 8266
37 Ga0070692_10001646 3300005345 Bacteria 8240
38 Ga0070692_10004232 3300005345 Bacteria 5954
39 Ga0070668_100326905 3300005347 Bacteria 1292
40 Ga0070668_100562170 3300005347 Bacteria 994
41 Ga0070669_100040023 3300005353 Bacteria 3406
42 Ga0070669_100068744 3300005353 Bacteria 2615
43 Ga0070669_100101399 3300005353 Bacteria 2172
44 Ga0070669_100164531 3300005353 Bacteria 1726
45 Ga0070669_100623873 3300005353 Unclassified 905
46 Ga0070671_100189336 3300005355 Bacteria 1744
47 Ga0070674_100548612 3300005356 Bacteria 969
48 Ga0070673_100017616 3300005364 Bacteria 5085
49 Ga0070688_100135114 3300005365 Bacteria 1669
50 Ga0070688_100386324 3300005365 Bacteria 1033
51 Ga0070659_100001138 3300005366 Bacteria 19392
52 Ga0070659_101987984 3300005366 Unclassified 522
53 Ga0070703_10039928 3300005406 Bacteria 1457
54 Ga0070703_10043334 3300005406 Bacteria 1411
55 Ga0070703_10081142 3300005406 Bacteria 1105
56 Ga0070703_10195063 3300005406 Bacteria 791
57 Ga0070701_10046764 3300005438 Bacteria 2226
58 Ga0070701_10097707 3300005438 Bacteria 1621
59 Ga0070711_100107027 3300005439 Bacteria 2045
60 Ga0070711_100259608 3300005439 Bacteria 1366
61 Ga0070705_100028364 3300005440 Bacteria 3065
62 Ga0070705_100029223 3300005440 Bacteria 3028
63 Ga0070705_100031904 3300005440 Bacteria 2922
64 Ga0070705_100038776 3300005440 Bacteria 2698
65 Ga0070705_100215705 3300005440 Bacteria 1326
66 Ga0070700_100051404 3300005441 Bacteria 2565
67 Ga0070700_100095624 3300005441 Bacteria 1948
68 Ga0070694_100002997 3300005444 Bacteria 10041
69 Ga0070694_100004403 3300005444 Bacteria 8468
70 Ga0070694_100115083 3300005444 Bacteria 1921
71 Ga0070694_100331669 3300005444 Bacteria 1174
72 Ga0070694_100795933 3300005444 Unclassified 775
73 Ga0070708_100015531 3300005445 Bacteria 6292
74 Ga0070708_100023561 3300005445 Bacteria 5237
75 Ga0070708_100024205 3300005445 Bacteria 5175
76 Ga0070708_100051214 3300005445 Bacteria 3658
77 Ga0070708_100159238 3300005445 Bacteria 2103
78 Ga0070708_100231582 3300005445 Bacteria 1733
79 Ga0070708_100321554 3300005445 Bacteria 1457
80 Ga0070708_100321786 3300005445 Bacteria 1457
81 Ga0070708_100384527 3300005445 Bacteria 1323
82 Ga0070708_101417996 3300005445 Bacteria 648
83 Ga0070663_100000763 3300005455 Bacteria 17474
84 Ga0070662_100042435 3300005457 Bacteria 3249
85 Ga0070662_100081362 3300005457 Bacteria 2413
86 Ga0070681_10034394 3300005458 Bacteria 5088
87 Ga0070681_10058087 3300005458 Bacteria 3848
88 Ga0070681_10062606 3300005458 Bacteria 3694
89 Ga0070681_10390843 3300005458 Bacteria 1302
90 Ga0068867_100002733 3300005459 Bacteria 12440
91 Ga0068867_100019737 3300005459 Bacteria 4802
92 Ga0068867_100157437 3300005459 Bacteria 1789
93 Ga0068867_100884171 3300005459 Bacteria 803
94 Ga0070706_100004618 3300005467 Bacteria 13217
95 Ga0070706_100008662 3300005467 Bacteria 9481
96 Ga0070706_100043566 3300005467 Bacteria 4147
97 Ga0070706_100075697 3300005467 Bacteria 3115
98 Ga0070706_100090200 3300005467 Bacteria 2842
99 Ga0070706_100136905 3300005467 Bacteria 2285
100 Ga0070706_100159881 3300005467 Bacteria 2103
101 Ga0070706_100314395 3300005467 Bacteria 1461
102 Ga0070706_100327919 3300005467 Bacteria 1427
103 Ga0070706_100531695 3300005467 Bacteria 1094
104 Ga0070707_100001786 3300005468 Bacteria 20710
105 Ga0070707_100005318 3300005468 Bacteria 12047
106 Ga0070707_100011093 3300005468 Bacteria 8393
107 Ga0070707_100014433 3300005468 Bacteria 7404
108 Ga0070707_100018600 3300005468 Bacteria 6537
109 Ga0070707_100045167 3300005468 Bacteria 4216
110 Ga0070707_100061661 3300005468 Bacteria 3597
111 Ga0070707_100087596 3300005468 Bacteria 3011
112 Ga0070707_100133354 3300005468 Bacteria 2416
113 Ga0070707_100139937 3300005468 Bacteria 2355
114 Ga0070707_100417330 3300005468 Bacteria 1302
115 Ga0070707_100666676 3300005468 Bacteria 1003
116 Ga0070707_100879946 3300005468 Bacteria 860
117 Ga0070707_100975812 3300005468 Bacteria 812
118 Ga0070698_100006315 3300005471 Bacteria 12870
119 Ga0070698_100118659 3300005471 Bacteria 2606
120 Ga0070698_100331196 3300005471 Bacteria 1454
121 Ga0070698_100570296 3300005471 Bacteria 1072
122 Ga0070698_100654502 3300005471 Bacteria 992
123 Ga0070699_100002516 3300005518 Bacteria 16458
124 Ga0070699_100019945 3300005518 Bacteria 5778
125 Ga0070699_100037281 3300005518 Bacteria 4206
126 Ga0070699_100051010 3300005518 Bacteria 3583
127 Ga0070699_100081806 3300005518 Bacteria 2815
128 Ga0070699_100091875 3300005518 Bacteria 2654
129 Ga0070699_100185087 3300005518 Bacteria 1849
130 Ga0070699_100294785 3300005518 Bacteria 1455
131 Ga0070699_100319775 3300005518 Bacteria 1395
132 Ga0070699_100350177 3300005518 Unclassified 1330
133 Ga0070699_100445390 3300005518 Bacteria 1174
134 Ga0070699_100489209 3300005518 Bacteria 1117
135 Ga0070699_100917110 3300005518 Unclassified 802
136 Ga0070679_100001113 3300005530 Bacteria 23470
137 Ga0070679_100034545 3300005530 Bacteria 5012
138 Ga0070679_100036717 3300005530 Bacteria 4863
139 Ga0070679_100234132 3300005530 Bacteria 1796
140 Ga0070679_100309895 3300005530 Bacteria 1528
141 Ga0070684_100241528 3300005535 Bacteria 1650
142 Ga0070697_100000676 3300005536 Bacteria 25620
143 Ga0070697_100002183 3300005536 Bacteria 15009
144 Ga0070697_100025430 3300005536 Bacteria 4723
145 Ga0070697_100048316 3300005536 Bacteria 3450
146 Ga0070697_100182974 3300005536 Bacteria 1777
147 Ga0070697_100188915 3300005536 Bacteria 1748
148 Ga0070697_100189402 3300005536 Bacteria 1746
149 Ga0070697_100225229 3300005536 Bacteria 1598
150 Ga0070697_100261986 3300005536 Bacteria 1480
151 Ga0070697_100359912 3300005536 Bacteria 1258
152 Ga0070697_100874309 3300005536 Bacteria 797
153 Ga0068853_100008227 3300005539 Bacteria 8372
154 Ga0070672_100024688 3300005543 Bacteria 4447
155 Ga0070672_100164052 3300005543 Bacteria 1845
156 Ga0070672_100448181 3300005543 Bacteria 1111
157 Ga0070686_100310061 3300005544 Bacteria 1173
158 Ga0070686_101247849 3300005544 Bacteria 619
159 Ga0070695_100001443 3300005545 Bacteria 13186
160 Ga0070695_100005056 3300005545 Bacteria 7770
161 Ga0070695_100096571 3300005545 Bacteria 1983
162 Ga0070695_100134677 3300005545 Bacteria 1706
163 Ga0070696_100001369 3300005546 Bacteria 15910
164 Ga0070696_100017182 3300005546 Bacteria 4882
165 Ga0070696_100025044 3300005546 Bacteria 4055
166 Ga0070696_100079526 3300005546 Bacteria 2320
167 Ga0070696_100085349 3300005546 Bacteria 2241
168 Ga0070696_100330285 3300005546 Bacteria 1176
169 Ga0070696_101718551 3300005546 Bacteria 541
170 Ga0070693_100000104 3300005547 Bacteria 37548
171 Ga0070693_100356053 3300005547 Unclassified 1003
172 Ga0070665_101162564 3300005548 Unclassified 783
173 Ga0070704_100014114 3300005549 Bacteria 4981
174 Ga0070704_100018081 3300005549 Bacteria 4498
175 Ga0070704_100033390 3300005549 Bacteria 3479
176 Ga0070704_100066200 3300005549 Bacteria 2604
177 Ga0070704_100266623 3300005549 Bacteria 1413
178 Ga0070704_100720848 3300005549 Bacteria 886
179 Ga0070704_100881208 3300005549 Bacteria 804
180 Ga0070704_100952440 3300005549 Bacteria 774
181 Ga0070704_101587799 3300005549 Bacteria 603
182 Ga0068855_100016998 3300005563 Bacteria 8749
183 Ga0068855_100518680 3300005563 Bacteria 1293
184 Ga0068855_100577014 3300005563 Bacteria 1215
185 Ga0068855_100611731 3300005563 Unclassified 1174
186 Ga0068857_100094550 3300005577 Bacteria 2677
187 Ga0068857_100175503 3300005577 Unclassified 1949
188 Ga0068857_100214239 3300005577 Bacteria 1758
189 Ga0068854_100004651 3300005578 Bacteria 8662
190 Ga0068856_100012614 3300005614 Bacteria 8180
191 Ga0068856_100071511 3300005614 Bacteria 3434
192 Ga0068856_100298801 3300005614 Unclassified 1627
193 Ga0070702_100024931 3300005615 Bacteria 3198
194 Ga0070702_101046941 3300005615 Unclassified 649
195 Ga0068852_100389912 3300005616 Bacteria 1368
196 Ga0068859_100001562 3300005617 Bacteria 23360
197 Ga0068859_100127803 3300005617 Bacteria 2612
198 Ga0068859_100268466 3300005617 Bacteria 1798
199 Ga0068859_100338727 3300005617 Unclassified 1598
200 Ga0068859_100446312 3300005617 Bacteria 1390
201 Ga0068859_100501533 3300005617 Bacteria 1309
202 Ga0068859_100641229 3300005617 Bacteria 1154
203 Ga0068864_100000991 3300005618 Bacteria 23779
204 Ga0068864_100047381 3300005618 Bacteria 3691
205 Ga0068864_101256791 3300005618 Bacteria 740
206 Ga0068866_10073428 3300005718 Bacteria 1815
207 Ga0068866_10618098 3300005718 Bacteria 734
208 Ga0068861_100018444 3300005719 Bacteria 4972
209 Ga0068861_100154005 3300005719 Bacteria 1889
210 Ga0068861_100237858 3300005719 Bacteria 1548
211 Ga0068851_10198680 3300005834 Bacteria 1118
212 Ga0068870_10002820 3300005840 Bacteria 7310
213 Ga0068863_100010104 3300005841 Bacteria 9179
214 Ga0068863_100708195 3300005841 Bacteria 1001
215 Ga0068863_101154134 3300005841 Bacteria 780
216 Ga0068863_101522666 3300005841 Bacteria 677
217 Ga0068863_101948999 3300005841 Bacteria 597
218 Ga0068858_100033406 3300005842 Bacteria 4775
219 Ga0068858_100157079 3300005842 Bacteria 2140
220 Ga0068860_100022117 3300005843 Bacteria 6156
221 Ga0068860_100336400 3300005843 Bacteria 1484
222 Ga0068860_100878726 3300005843 Bacteria 912
223 Ga0068860_100882234 3300005843 Bacteria 910
224 Ga0068862_100007685 3300005844 Bacteria 8919
225 Ga0068862_100013048 3300005844 Bacteria 6873
226 Ga0068862_100023027 3300005844 Bacteria 5216
227 Ga0068862_100043608 3300005844 Bacteria 3825
228 Ga0068862_100098268 3300005844 Bacteria 2557
229 Ga0068862_100212790 3300005844 Bacteria 1747
230 Ga0068862_100468936 3300005844 Bacteria 1190
231 Ga0068862_100591516 3300005844 Bacteria 1064
232 Ga0068862_101279850 3300005844 Bacteria 734
233 Ga0081540_1001963 3300005983 Bacteria 17161
234 Ga0081539_10000590 3300005985 Bacteria 74293
235 Ga0075432_10080745 3300006058 Bacteria 1179
236 Ga0070715_10267494 3300006163 Unclassified 901
237 Ga0070715_11017775 3300006163 Bacteria 517
238 Ga0070716_100007870 3300006173 Bacteria 5272
239 Ga0075427_10021528 3300006194 Bacteria 1026
240 Ga0097621_101244755 3300006237 Bacteria 702
241 Ga0068871_100762236 3300006358 Bacteria 890
242 Ga0075428_100000730 3300006844 Bacteria 34154
243 Ga0075428_100008047 3300006844 Bacteria 11701
244 Ga0075428_100017939 3300006844 Bacteria 7821
245 Ga0075428_100030783 3300006844 Bacteria 5934
246 Ga0075428_100063364 3300006844 Bacteria 4047
247 Ga0075428_100161255 3300006844 Bacteria 2434
248 Ga0075428_100175668 3300006844 Unclassified 2320
249 Ga0075428_100188259 3300006844 Bacteria 2232
250 Ga0075428_100304698 3300006844 Bacteria 1713
251 Ga0075428_100466585 3300006844 Bacteria 1352
252 Ga0075428_100563045 3300006844 Unclassified 1218
253 Ga0075428_100842283 3300006844 Bacteria 974
254 Ga0075428_101009790 3300006844 Bacteria 881
255 Ga0075430_100002036 3300006846 Bacteria 16684
256 Ga0075430_100006370 3300006846 Bacteria 9952
257 Ga0075430_100018856 3300006846 Bacteria 5869
258 Ga0075430_100111721 3300006846 Bacteria 2279
259 Ga0075430_100176534 3300006846 Bacteria 1777
260 Ga0075430_100198464 3300006846 Bacteria 1666
261 Ga0075430_100309158 3300006846 Bacteria 1307
262 Ga0075430_100350342 3300006846 Unclassified 1219
263 Ga0075430_100395150 3300006846 Unclassified 1141
264 Ga0075430_100490427 3300006846 Bacteria 1014
265 Ga0075431_100007203 3300006847 Bacteria 11065
266 Ga0075431_100008661 3300006847 Bacteria 10194
267 Ga0075431_100010364 3300006847 Bacteria 9365
268 Ga0075431_100019710 3300006847 Bacteria 6883
269 Ga0075431_100035297 3300006847 Bacteria 5147
270 Ga0075431_100070228 3300006847 Bacteria 3613
271 Ga0075431_100089673 3300006847 Bacteria 3174
272 Ga0075431_100093074 3300006847 Bacteria 3111
273 Ga0075431_100110736 3300006847 Bacteria 2833
274 Ga0075431_100219357 3300006847 Bacteria 1940
275 Ga0075431_100270914 3300006847 Bacteria 1720
276 Ga0075431_100307066 3300006847 Bacteria 1602
277 Ga0075431_100471721 3300006847 Bacteria 1249
278 Ga0075431_100781618 3300006847 Bacteria 929
279 Ga0075431_101567585 3300006847 Bacteria 617
280 Ga0075433_10001209 3300006852 Bacteria 18826
281 Ga0075433_10002879 3300006852 Bacteria 13188
282 Ga0075433_10005890 3300006852 Bacteria 9653
283 Ga0075433_10018092 3300006852 Bacteria 5850
284 Ga0075433_10022899 3300006852 Bacteria 5250
285 Ga0075433_10025739 3300006852 Bacteria 4975
286 Ga0075433_10040876 3300006852 Bacteria 4016
287 Ga0075433_10080500 3300006852 Bacteria 2872
288 Ga0075433_10085717 3300006852 Bacteria 2781
289 Ga0075433_10086269 3300006852 Bacteria 2772
290 Ga0075433_10088588 3300006852 Bacteria 2735
291 Ga0075433_10161430 3300006852 Bacteria 1995
292 Ga0075433_10444063 3300006852 Bacteria 1144
293 Ga0075433_10536391 3300006852 Unclassified 1029
294 Ga0075433_10819915 3300006852 Bacteria 813
295 Ga0075434_100000039 3300006871 Bacteria 59823
296 Ga0075434_100004221 3300006871 Bacteria 12880
297 Ga0075434_100011543 3300006871 Bacteria 8335
298 Ga0075434_100061715 3300006871 Bacteria 3730
299 Ga0075434_100071242 3300006871 Bacteria 3467
300 Ga0075434_100092860 3300006871 Bacteria 3021
301 Ga0075434_100118891 3300006871 Bacteria 2657
302 Ga0075434_100120734 3300006871 Bacteria 2636
303 Ga0075434_100149544 3300006871 Unclassified 2355
304 Ga0075434_100185820 3300006871 Bacteria 2099
305 Ga0075434_100235777 3300006871 Bacteria 1850
306 Ga0075434_100436959 3300006871 Bacteria 1330
307 Ga0075434_100597562 3300006871 Bacteria 1123
308 Ga0075434_100911680 3300006871 Bacteria 894
309 Ga0075434_101756525 3300006871 Bacteria 628
310 Ga0075434_101860463 3300006871 Bacteria 608
311 Ga0075429_100002010 3300006880 Bacteria 16905
312 Ga0075429_100010977 3300006880 Bacteria 7838
313 Ga0075429_100011741 3300006880 Bacteria 7597
314 Ga0075429_100013899 3300006880 Bacteria 6982
315 Ga0075429_100014322 3300006880 Bacteria 6878
316 Ga0075429_100023491 3300006880 Bacteria 5351
317 Ga0075429_100095349 3300006880 Bacteria 2595
318 Ga0075429_100102898 3300006880 Bacteria 2494
319 Ga0075429_100175753 3300006880 Bacteria 1876
320 Ga0075429_100178014 3300006880 Bacteria 1863
321 Ga0075429_100183632 3300006880 Bacteria 1833
322 Ga0075429_100230963 3300006880 Bacteria 1620
323 Ga0075429_100312326 3300006880 Unclassified 1376
324 Ga0068865_100078896 3300006881 Bacteria 2357
325 Ga0068865_100080105 3300006881 Bacteria 2341
326 Ga0075436_100044437 3300006914 Bacteria 3063
327 Ga0075436_100084670 3300006914 Bacteria 2200
328 Ga0075436_100086429 3300006914 Bacteria 2178
329 Ga0075436_100127043 3300006914 Bacteria 1787
330 Ga0075436_100383659 3300006914 Unclassified 1016
331 Ga0075436_100466309 3300006914 Bacteria 921
332 Ga0075436_100625026 3300006914 Archaea 794
333 Ga0097620_100001562 3300006931 Bacteria 23360
334 Ga0097620_100127803 3300006931 Bacteria 2612
335 Ga0097620_100268459 3300006931 Bacteria 1798
336 Ga0097620_100338733 3300006931 Unclassified 1598
337 Ga0097620_100446301 3300006931 Bacteria 1390
338 Ga0097620_100501536 3300006931 Bacteria 1309
339 Ga0097620_100641246 3300006931 Bacteria 1154
340 Ga0075435_100008582 3300007076 Bacteria 7343
341 Ga0075435_100017075 3300007076 Bacteria 5484
342 Ga0075435_100028763 3300007076 Bacteria 4360
343 Ga0075435_100041954 3300007076 Bacteria 3658
344 Ga0075435_100065361 3300007076 Bacteria 2957
345 Ga0075435_100128630 3300007076 Bacteria 2118
346 Ga0075435_100142348 3300007076 Bacteria 2012
347 Ga0075435_100222577 3300007076 Bacteria 1603
348 Ga0075435_100711065 3300007076 Archaea 873
349 Ga0075435_100750633 3300007076 Bacteria 849
350 Ga0099794_10003785 3300007265 Bacteria 5836
351 Ga0099794_10007317 3300007265 Bacteria 4528
352 Ga0099794_10053082 3300007265 Bacteria 1954
353 Ga0099794_10399742 3300007265 Bacteria 717
354 Ga0099794_10455910 3300007265 Unclassified 671
355 Ga0111539_10000715 3300009094 Bacteria 43156
356 Ga0111539_10000819 3300009094 Bacteria 40336
357 Ga0111539_10001430 3300009094 Bacteria 31850
358 Ga0111539_10047551 3300009094 Bacteria 5128
359 Ga0111539_10076175 3300009094 Bacteria 3950
360 Ga0105245_10800644 3300009098 Bacteria 980
361 Ga0114129_10000409 3300009147 Bacteria 50603
362 Ga0114129_10003438 3300009147 Bacteria 22264
363 Ga0114129_10005405 3300009147 Bacteria 18037
364 Ga0114129_10008975 3300009147 Bacteria 14257
365 Ga0114129_10059492 3300009147 Bacteria 5341
366 Ga0114129_10077976 3300009147 Bacteria 4608
367 Ga0114129_10082816 3300009147 Bacteria 4457
368 Ga0114129_10083036 3300009147 Bacteria 4451
369 Ga0114129_10097283 3300009147 Bacteria 4075
370 Ga0114129_10138195 3300009147 Bacteria 3343
371 Ga0114129_10143481 3300009147 Bacteria 3272
372 Ga0114129_10199854 3300009147 Bacteria 2708
373 Ga0114129_10224251 3300009147 Bacteria 2534
374 Ga0114129_10335894 3300009147 Bacteria 2005
375 Ga0114129_10542462 3300009147 Bacteria 1513
376 Ga0114129_10990084 3300009147 Bacteria 1059
377 Ga0114129_11239651 3300009147 Bacteria 927
378 Ga0114129_11562390 3300009147 Bacteria 809
379 Ga0105243_10161636 3300009148 Bacteria 1931
380 Ga0105243_10338732 3300009148 Bacteria 1377
381 Ga0105243_10613718 3300009148 Bacteria 1049
382 Ga0105241_10001344 3300009174 Bacteria 18669
383 Ga0105241_10615983 3300009174 Bacteria 982
384 Ga0105242_10021975 3300009176 Bacteria 5014
385 Ga0105242_10190262 3300009176 Bacteria 1816
386 Ga0105248_10186725 3300009177 Bacteria 2336
387 Ga0105248_10189571 3300009177 Bacteria 2317
388 Ga0105248_11738923 3300009177 Unclassified 707
389 Ga0105237_10058839 3300009545 Bacteria 3846
390 Ga0105238_10389887 3300009551 Unclassified 1385
391 Ga0105249_10061301 3300009553 Bacteria 3452
392 Ga0105249_10096471 3300009553 Bacteria 2774
393 Ga0105249_10099318 3300009553 Bacteria 2735
394 Ga0105249_10147254 3300009553 Bacteria 2263
395 Ga0105249_10333816 3300009553 Bacteria 1531
396 Ga0105249_10575338 3300009553 Bacteria 1179
397 Ga0105249_11114596 3300009553 Bacteria 859
398 Ga0105249_11652903 3300009553 Bacteria 713
399 Ga0105246_10012663 3300011119 Bacteria 5269
400 Ga0157373_10000101 3300013100 Bacteria 68799
401 Ga0157371_10437079 3300013102 Bacteria 961
402 Ga0157370_10275494 3300013104 Bacteria 1555
403 Ga0157369_10012134 3300013105 Bacteria 9783
404 Ga0157374_10446432 3300013296 Bacteria 1294
405 Ga0157374_11080543 3300013296 Bacteria 823
406 Ga0157378_10058823 3300013297 Bacteria 3428
407 Ga0157378_12506964 3300013297 Bacteria 568
408 Ga0163162_10489108 3300013306 Bacteria 1362
409 Ga0163162_10884082 3300013306 Bacteria 1007
410 Ga0157372_10000703 3300013307 Bacteria 36772
411 Ga0157372_11118195 3300013307 Bacteria 911
412 Ga0157375_10048022 3300013308 Bacteria 4173
413 Ga0157375_10524051 3300013308 Bacteria 1348
414 Ga0157375_10711959 3300013308 Bacteria 1157
415 Ga0157375_12641858 3300013308 Bacteria 600
416 Ga0163163_10152202 3300014325 Bacteria 2357
417 Ga0163163_10159045 3300014325 Archaea 2304
418 Ga0163163_10736290 3300014325 Bacteria 1049
419 Ga0157380_10056424 3300014326 Bacteria 3123
420 Ga0157380_10162064 3300014326 Bacteria 1945
421 Ga0157380_10496505 3300014326 Bacteria 1184
422 Ga0182008_10397785 3300014497 Bacteria 739
423 Ga0157377_10303813 3300014745 Bacteria 1054
424 Ga0157379_10166896 3300014968 Bacteria 1987
425 Ga0157379_10902559 3300014968 Bacteria 838
426 Ga0163161_10224342 3300017792 Unclassified 1456
427 Ga0163161_11869771 3300017792 Bacteria 534
428 Ga0206356_11442960 3300020070 Bacteria 782
429 Ga0206354_10938711 3300020081 Bacteria 909
430 Ga0207656_10067904 3300025321 Bacteria 1579
431 Ga0207653_10019640 3300025885 Bacteria 2132
432 Ga0207653_10071663 3300025885 Bacteria 1185
433 Ga0207653_10229018 3300025885 Bacteria 708
434 Ga0207692_10397937 3300025898 Bacteria 858
435 Ga0207642_10292696 3300025899 Bacteria 941
436 Ga0207642_10805140 3300025899 Bacteria 598
437 Ga0207680_10158576 3300025903 Bacteria 1515
438 Ga0207647_10049061 3300025904 Bacteria 2620
439 Ga0207645_10000852 3300025907 Bacteria 25412
440 Ga0207645_10013648 3300025907 Bacteria 5467
441 Ga0207643_10000150 3300025908 Bacteria 47605
442 Ga0207684_10000996 3300025910 Bacteria 31775
443 Ga0207684_10001569 3300025910 Bacteria 24376
444 Ga0207684_10002411 3300025910 Bacteria 18877
445 Ga0207684_10008157 3300025910 Bacteria 9330
446 Ga0207684_10028553 3300025910 Bacteria 4753
447 Ga0207684_10052166 3300025910 Bacteria 3471
448 Ga0207684_10182336 3300025910 Bacteria 1810
449 Ga0207684_10239761 3300025910 Bacteria 1564
450 Ga0207684_10284387 3300025910 Bacteria 1426
451 Ga0207684_10313165 3300025910 Bacteria 1353
452 Ga0207684_10387267 3300025910 Bacteria 1202
453 Ga0207684_10462277 3300025910 Bacteria 1089
454 Ga0207684_10506424 3300025910 Bacteria 1035
455 Ga0207684_10521690 3300025910 Bacteria 1017
456 Ga0207654_10029377 3300025911 Bacteria 3009
457 Ga0207654_10119642 3300025911 Bacteria 1652
458 Ga0207707_10000076 3300025912 Bacteria 100491
459 Ga0207707_10031856 3300025912 Bacteria 4616
460 Ga0207707_10102064 3300025912 Bacteria 2507
461 Ga0207707_10140157 3300025912 Bacteria 2115
462 Ga0207707_10336183 3300025912 Bacteria 1303
463 Ga0207663_10698262 3300025916 Bacteria 803
464 Ga0207660_10000022 3300025917 Bacteria 72537
465 Ga0207660_10048361 3300025917 Bacteria 3009
466 Ga0207662_10023135 3300025918 Bacteria 3567
467 Ga0207657_10000005 3300025919 Bacteria 213481
468 Ga0207649_10003591 3300025920 Bacteria 8473
469 Ga0207652_10000060 3300025921 Bacteria 113511
470 Ga0207652_10023677 3300025921 Bacteria 5088
471 Ga0207652_10069077 3300025921 Bacteria 3066
472 Ga0207652_10078641 3300025921 Bacteria 2880
473 Ga0207652_10349596 3300025921 Bacteria 1334
474 Ga0207646_10001766 3300025922 Bacteria 26193
475 Ga0207646_10006356 3300025922 Bacteria 12224
476 Ga0207646_10008955 3300025922 Bacteria 9961
477 Ga0207646_10016669 3300025922 Bacteria 6891
478 Ga0207646_10040356 3300025922 Bacteria 4197
479 Ga0207646_10114641 3300025922 Bacteria 2420
480 Ga0207646_10141204 3300025922 Bacteria 2169
481 Ga0207646_10159756 3300025922 Bacteria 2033
482 Ga0207646_10424425 3300025922 Unclassified 1200
483 Ga0207646_10487366 3300025922 Unclassified 1111
484 Ga0207646_10601260 3300025922 Bacteria 987
485 Ga0207646_11349769 3300025922 Bacteria 621
486 Ga0207681_10007091 3300025923 Bacteria 6872
487 Ga0207681_10211310 3300025923 Unclassified 1496
488 Ga0207681_10459040 3300025923 Bacteria 1037
489 Ga0207681_10605141 3300025923 Unclassified 906
490 Ga0207681_10681995 3300025923 Bacteria 853
491 Ga0207694_11095009 3300025924 Unclassified 674
492 Ga0207694_11661090 3300025924 Bacteria 538
493 Ga0207650_10072410 3300025925 Bacteria 2594
494 Ga0207659_10248049 3300025926 Bacteria 1444
495 Ga0207659_10916707 3300025926 Unclassified 753
496 Ga0207644_10458373 3300025931 Bacteria 1048
497 Ga0207690_10006358 3300025932 Bacteria 7000
498 Ga0207706_10027460 3300025933 Bacteria 5088
499 Ga0207706_10063115 3300025933 Bacteria 3262
500 Ga0207686_10322557 3300025934 Bacteria 1154
501 Ga0207709_10017341 3300025935 Bacteria 4018
502 Ga0207709_10380646 3300025935 Bacteria 1074
503 Ga0207709_10697026 3300025935 Bacteria 812
504 Ga0207709_10725893 3300025935 Bacteria 797
505 Ga0207670_10008129 3300025936 Bacteria 5903
506 Ga0207704_10233523 3300025938 Bacteria 1369
507 Ga0207704_10308151 3300025938 Bacteria 1216
508 Ga0207704_10502297 3300025938 Bacteria 978
509 Ga0207665_10005354 3300025939 Bacteria 8566
510 Ga0207691_10037324 3300025940 Bacteria 4499
511 Ga0207691_10216845 3300025940 Bacteria 1660
512 Ga0207711_10279211 3300025941 Bacteria 1538
513 Ga0207711_11332540 3300025941 Bacteria 660
514 Ga0207689_10000050 3300025942 Bacteria 88556
515 Ga0207689_10004262 3300025942 Bacteria 13006
516 Ga0207689_10198354 3300025942 Bacteria 1656
517 Ga0207661_10109543 3300025944 Bacteria 2333
518 Ga0207661_10436733 3300025944 Bacteria 1191
519 Ga0207661_10651228 3300025944 Unclassified 968
520 Ga0207679_10002376 3300025945 Bacteria 11579
521 Ga0207667_10000587 3300025949 Bacteria 47372
522 Ga0207667_10343624 3300025949 Unclassified 1523
523 Ga0207651_10011721 3300025960 Bacteria 4920
524 Ga0207712_10050600 3300025961 Bacteria 2902
525 Ga0207712_10306567 3300025961 Bacteria 1305
526 Ga0207712_10670257 3300025961 Bacteria 903
527 Ga0207712_10768261 3300025961 Bacteria 845
528 Ga0207712_11199756 3300025961 Bacteria 677
529 Ga0207668_10401152 3300025972 Bacteria 1159
530 Ga0207668_10630763 3300025972 Bacteria 936
531 Ga0207640_10049758 3300025981 Bacteria 2715
532 Ga0207640_10211929 3300025981 Bacteria 1476
533 Ga0207640_11060467 3300025981 Bacteria 715
534 Ga0207677_10436860 3300026023 Unclassified 1118
535 Ga0207677_10836824 3300026023 Bacteria 826
536 Ga0207703_10060648 3300026035 Bacteria 3093
537 Ga0207639_10049105 3300026041 Bacteria 3197
538 Ga0207639_11404783 3300026041 Unclassified 655
539 Ga0207678_10001742 3300026067 Bacteria 19912
540 Ga0207678_10318709 3300026067 Bacteria 1337
541 Ga0207708_10124948 3300026075 Bacteria 2007
542 Ga0207708_10542310 3300026075 Bacteria 980
543 Ga0207702_10098091 3300026078 Bacteria 2580
544 Ga0207702_10691902 3300026078 Bacteria 1004
545 Ga0207702_10928924 3300026078 Bacteria 862
546 Ga0207641_10022956 3300026088 Bacteria 5139
547 Ga0207641_10335830 3300026088 Bacteria 1437
548 Ga0207641_10520199 3300026088 Bacteria 1157
549 Ga0207641_11021133 3300026088 Bacteria 824
550 Ga0207648_10005797 3300026089 Bacteria 12374
551 Ga0207648_10038731 3300026089 Bacteria 4194
552 Ga0207648_10067171 3300026089 Bacteria 3126
553 Ga0207648_10131629 3300026089 Bacteria 2202
554 Ga0207648_10146922 3300026089 Bacteria 2080
555 Ga0207676_10061331 3300026095 Bacteria 2977
556 Ga0207676_10197607 3300026095 Bacteria 1774
557 Ga0207676_11038288 3300026095 Unclassified 809
558 Ga0207674_10000075 3300026116 Bacteria 105297
559 Ga0207674_10036958 3300026116 Bacteria 5082
560 Ga0207674_10067327 3300026116 Bacteria 3605
561 Ga0207674_10084664 3300026116 Bacteria 3168
562 Ga0207675_100012152 3300026118 Bacteria 8042
563 Ga0207675_100229606 3300026118 Bacteria 1790
564 Ga0210000_1009137 3300027462 Bacteria 1457
565 Ga0209983_1022072 3300027665 Bacteria 1333
566 Ga0209588_1002125 3300027671 Bacteria 5346
567 Ga0209588_1077971 3300027671 Bacteria 1071
568 Ga0209998_10141696 3300027717 Bacteria 614
569 Ga0209974_10046506 3300027876 Bacteria 1451
570 Ga0207428_10000009 3300027907 Bacteria 410565
571 Ga0207428_10000631 3300027907 Bacteria 41443
572 Ga0207428_10109497 3300027907 Bacteria 2127
573 Ga0207428_10560977 3300027907 Bacteria 825
574 Ga0207428_10970037 3300027907 Bacteria 598
575 Ga0268266_10873953 3300028379 Unclassified 869
576 Ga0268265_10007375 3300028380 Bacteria 7425
577 Ga0268265_10067642 3300028380 Bacteria 2766
578 Ga0268265_10090858 3300028380 Bacteria 2440
579 Ga0268265_10177003 3300028380 Unclassified 1829
580 Ga0268265_10467559 3300028380 Bacteria 1181
581 Ga0268265_10945312 3300028380 Unclassified 849
582 Ga0268264_10020679 3300028381 Bacteria 5377
583 Ga0268264_10030980 3300028381 Bacteria 4386
584 Ga0268264_10092992 3300028381 Bacteria 2604
585 Ga0268264_10260110 3300028381 Bacteria 1616
586 Ga0268264_10657248 3300028381 Bacteria 1038
587 Ga0268264_10710385 3300028381 Bacteria 999
588 Ga0268264_11928651 3300028381 Bacteria 600
589 Ga0265325_10005355 3300031241 Bacteria 7935
590 Ga0307509_10067942 3300031507 Bacteria 3731
591 Ga0307408_100029740 3300031548 Bacteria 3788
592 Ga0307408_100044097 3300031548 Bacteria 3177
593 Ga0307408_100222053 3300031548 Bacteria 1542
594 Ga0307405_10111668 3300031731 Unclassified 1853
595 Ga0307405_10273264 3300031731 Bacteria 1268
596 Ga0307410_11763437 3300031852 Unclassified 549
597 Ga0307406_10078084 3300031901 Bacteria 2192
598 Ga0307407_10585805 3300031903 Bacteria 829
599 Ga0307412_10923570 3300031911 Bacteria 766
600 Ga0307416_100001116 3300032002 Bacteria 14425
601 Ga0307416_100521610 3300032002 Bacteria 1256
602 Ga0307416_102064962 3300032002 Bacteria 672
603 Ga0307411_10100729 3300032005 Bacteria 2042
604 Ga0307411_10491308 3300032005 Bacteria 1036
605 Ga0307411_10961862 3300032005 Bacteria 762
606 Ga0307415_100263008 3300032126 Bacteria 1409
607 Ga0307415_101943541 3300032126 Bacteria 572
608 Ga0373930_0045200 3300034816 Bacteria 948
609 Ga0373948_0022860 3300034817 Bacteria 1208
610 Ga0373958_0038403 3300034819 Unclassified 970
611 Ga0373959_0011123 3300034820 Bacteria 1584
612 Ga0373934_0263500 3300035086 Bacteria 713
613 Ga0373940_0002057 3300035088 Bacteria 3821
614 Ga0373940_0022837 3300035088 Bacteria 1610
615 Ga0373949_0001137 3300035090 Bacteria 7993
616 Ga0373949_0154028 3300035090 Bacteria 666
617 Ga0373951_0021372 3300035091 Bacteria 1486
618 Ga0373952_0051068 3300035092 Bacteria 986
619 Ga0373952_0066762 3300035092 Bacteria 891
620 Ga0373932_0114584 3300035112 Bacteria 892
621 Ga0373939_0390273 3300035114 Bacteria 575
622 Ga0373941_0124486 3300035115 Bacteria 922
623 Ga0373945_0460582 3300035116 Unclassified 563
624 Ga0373960_0032851 3300035121 Bacteria 1459
625 Ga0373960_0246812 3300035121 Unclassified 647
626 Ga0373943_0011173 3300035170 Bacteria 4037
627 Ga0373942_0057071 3300035207 Bacteria 1110
628 Ga0373942_0080498 3300035207 Bacteria 966
629 Ga0373961_0003927 3300035241 Bacteria 3630
630 Ga0373961_0076866 3300035241 Bacteria 1043
631 Ga0373962_0006756 3300035242 Bacteria 2786
632 Ga0373962_0011889 3300035242 Bacteria 2188
633 Ga0373931_0005358 3300035691 Bacteria 5920
634 Ga0373931_0009773 3300035691 Bacteria 4594
635 Ga0373931_0104028 3300035691 Bacteria 1601
636 Ga0373931_0315703 3300035691 Bacteria 969
637 Ga0373933_0329719 3300035724 Bacteria 990
638 Ga0395899_0005710 3300037312 Bacteria 9659
639 Ga0395900_0005301 3300037418 Bacteria 13516
640 Ga0395900_0254312 3300037418 Bacteria 1757
641 Ga0395898_0007244 3300037466 Bacteria 11772
642 Ga0395898_1322176 3300037466 Unclassified 650
643 Ga0395905_0048060 3300037471 Bacteria 3999
644 Ga0395901_0137841 3300038443 Bacteria 2564
645 Ga0395901_0718524 3300038443 Bacteria 995
646 Ga0395901_0915858 3300038443 Bacteria 858
647 Ga0436361_0067535 3300039447 Unclassified 1083
648 Ga0436363_0822832 3300039450 Unclassified 615
649 Ga0436363_1398976 3300039450 Unclassified 731
650 Ga0439448_0020856 3300042005 Bacteria 2031
651 Ga0439455_0025065 3300042012 Bacteria 1447
652 Ga0439455_0049398 3300042012 Bacteria 1096
653 Ga0450889_013854 3300042144 Bacteria 855
654 Ga0439458_0008415 3300042157 Bacteria 2296
655 Ga0439459_0024084 3300042438 Unclassified 1191
656 Ga0439459_0046145 3300042438 Bacteria 942
657 Ga0439460_0077985 3300042461 Bacteria 1036
658 Ga0451577_0003313 3300042876 Bacteria 18095
659 Ga0451577_0054622 3300042876 Bacteria 3565
660 Ga0451577_0100573 3300042876 Bacteria 2582
661 Ga0451577_0182142 3300042876 Bacteria 1894
662 Ga0451577_0510865 3300042876 Bacteria 1091
663 Ga0466972_0207976 3300044658 Bacteria 916
664 Ga0453683_0008769 3300044673 Bacteria 6778
665 Ga0453683_0107187 3300044673 Unclassified 1756
666 Ga0453683_0137695 3300044673 Bacteria 1540
667 Ga0466961_0608984 3300044693 Bacteria 657
668 Ga0453684_0023688 3300044712 Bacteria 9021
669 Ga0453684_0030957 3300044712 Bacteria 7540
670 Ga0453684_0082959 3300044712 Bacteria 3991
671 Ga0451576_0006637 3300045051 Bacteria 14133
672 Ga0451576_0022946 3300045051 Bacteria 6762
673 Ga0451576_0024715 3300045051 Bacteria 6486
674 Ga0451576_0029219 3300045051 Bacteria 5899
675 Ga0451576_0051221 3300045051 Bacteria 4328
676 Ga0451576_0678385 3300045051 Bacteria 1083
677 Ga0466967_0536850 3300045976 Bacteria 1150
678 Ga0466967_1580040 3300045976 Bacteria 653
679 Ga0466967_2054182 3300045976 Bacteria 568
680 Ga0495603_0538655 3300046455 Bacteria 669
681 Ga0495651_0537884 3300046462 Bacteria 744
682 Ga0495580_0001861 3300046472 Bacteria 18550
683 Ga0495580_0472434 3300046472 Bacteria 839
684 Ga0495584_0669906 3300046491 Bacteria 529
685 Ga0495584_0674244 3300046491 Unclassified 527
686 Ga0495594_0091689 3300046499 Bacteria 1703
687 Ga0495607_0335206 3300046501 Bacteria 702
688 Ga0495628_0289371 3300046516 Bacteria 1215
689 Ga0495642_0098964 3300046528 Bacteria 1240
690 Ga0495642_0402460 3300046528 Bacteria 604
691 Ga0495642_0528914 3300046528 Bacteria 523
692 Ga0495652_0554207 3300046529 Bacteria 790
693 Ga0495656_0350537 3300046615 Bacteria 765
694 Ga0495599_0178882 3300046678 Bacteria 1308
695 Ga0495623_0102012 3300046679 Bacteria 1748
696 Ga0495646_0522226 3300046680 Bacteria 608
697 Ga0495669_0099714 3300046684 Bacteria 1348
698 Ga0495669_0637634 3300046684 Bacteria 518
699 Ga0495613_0474799 3300046689 Bacteria 845
700 Ga0495636_0592228 3300047318 Bacteria 542
701 Ga0495674_1209400 3300047319 Bacteria 571
702 Ga0495602_0056861 3300048088 Bacteria 3437
703 Ga0495602_0190760 3300048088 Unclassified 1572
704 Ga0496102_0030748 3300048905 Bacteria 4808
705 Ga0496102_0100319 3300048905 Bacteria 2688
706 Ga0496104_0307557 3300048907 Bacteria 1498
707 Ga0496106_0066708 3300048909 Bacteria 2742
708 Ga0496106_0165429 3300048909 Bacteria 1751
709 Ga0496107_0155165 3300048910 Bacteria 1695
710 Ga0496109_0350859 3300048912 Bacteria 1394
711 Ga0496109_0833305 3300048912 Bacteria 860
712 Ga0496110_0166215 3300048913 Bacteria 2001
713 Ga0496111_0188069 3300048914 Bacteria 1535
714 Ga0496112_0037103 3300048915 Bacteria 4758
715 Ga0496112_0812371 3300048915 Unclassified 859
716 Ga0496113_0344742 3300048916 Unclassified 1195
717 Ga0501298_043407 3300049521 Bacteria 916
718 Ga0501033_0060859 3300049570 Bacteria 2784
719 Ga0501034_0430056 3300049571 Unclassified 1240
720 Ga0501036_0497695 3300049572 Bacteria 1014
721 Ga0501036_0949161 3300049572 Bacteria 705
722 Ga0501036_1038556 3300049572 Unclassified 670
723 Ga0501037_0167325 3300049573 Bacteria 1565
724 Ga0501037_0970061 3300049573 Unclassified 555
725 Ga0501038_0372246 3300049574 Bacteria 1109
726 Ga0501038_0394070 3300049574 Bacteria 1072
727 Ga0501039_0073727 3300049575 Bacteria 2652
728 Ga0501040_0005074 3300049576 Bacteria 8508
729 Ga0501040_0033093 3300049576 Bacteria 3500
730 Ga0501040_0050315 3300049576 Bacteria 2850
731 Ga0501040_0169625 3300049576 Bacteria 1545
732 Ga0501040_1098407 3300049576 Bacteria 577
733 Ga0501041_0059321 3300049577 Bacteria 2342
734 Ga0501041_0200888 3300049577 Bacteria 1249
735 Ga0501041_0318678 3300049577 Bacteria 981
736 Ga0501041_0712555 3300049577 Unclassified 642
737 Ga0501042_0135706 3300049578 Bacteria 1774
738 Ga0501042_0531805 3300049578 Bacteria 854
739 Ga0501042_1023688 3300049578 Bacteria 602
740 Ga0501043_0361466 3300049579 Bacteria 1102
741 Ga0501043_0548862 3300049579 Bacteria 859
742 Ga0501043_0738110 3300049579 Bacteria 717
743 Ga0501043_0814236 3300049579 Bacteria 675
744 Ga0501043_0940766 3300049579 Bacteria 618
745 Ga0501046_0090245 3300049580 Bacteria 2358
746 Ga0501046_0486811 3300049580 Unclassified 885
747 Ga0501048_0078831 3300049582 Bacteria 2325
748 Ga0501048_0556054 3300049582 Bacteria 823
749 Ga0501067_0018104 3300049583 Bacteria 3901
750 Ga0501067_0065519 3300049583 Bacteria 2011
751 Ga0501068_0029632 3300049584 Bacteria 3242
752 Ga0501068_0077246 3300049584 Bacteria 2039
753 Ga0501068_0195644 3300049584 Bacteria 1282
754 Ga0501068_0442146 3300049584 Bacteria 841
755 Ga0501069_0030340 3300049585 Bacteria 2969
756 Ga0501069_0129532 3300049585 Bacteria 1444
757 Ga0501069_0475263 3300049585 Bacteria 744
758 Ga0501071_0074452 3300049587 Bacteria 2478
759 Ga0501071_0128859 3300049587 Bacteria 1879
760 Ga0501071_0302888 3300049587 Bacteria 1212
761 Ga0501072_0136345 3300049588 Bacteria 1957
762 Ga0501072_0181917 3300049588 Bacteria 1677
763 Ga0501072_0206515 3300049588 Bacteria 1566
764 Ga0501072_0935520 3300049588 Bacteria 677
765 Ga0501072_1383178 3300049588 Bacteria 544
766 Ga0501074_0219130 3300049590 Bacteria 1355
767 Ga0501074_0381183 3300049590 Bacteria 1000
768 Ga0501074_0439368 3300049590 Bacteria 925
769 Ga0501074_0921760 3300049590 Bacteria 615
770 Ga0501075_0039504 3300049591 Bacteria 3532
771 Ga0501075_0050064 3300049591 Bacteria 3140
772 Ga0501075_0103517 3300049591 Bacteria 2163
773 Ga0501075_0108776 3300049591 Bacteria 2107
774 Ga0501075_0120193 3300049591 Bacteria 1999
775 Ga0501075_0143600 3300049591 Bacteria 1819
776 Ga0501075_0178358 3300049591 Bacteria 1621
777 Ga0501075_0181089 3300049591 Unclassified 1607
778 Ga0501075_0324184 3300049591 Bacteria 1174
779 Ga0501075_0427783 3300049591 Bacteria 1009
780 Ga0501075_0595065 3300049591 Unclassified 844
781 Ga0501075_0630076 3300049591 Bacteria 818
782 Ga0501076_0016029 3300049592 Bacteria 5672
783 Ga0501076_0019510 3300049592 Bacteria 5184
784 Ga0501076_0178291 3300049592 Bacteria 1732
785 Ga0501076_0986157 3300049592 Unclassified 694
786 Ga0501077_0020298 3300049593 Bacteria 4205
787 Ga0501077_0023045 3300049593 Bacteria 3949
788 Ga0501077_0057806 3300049593 Bacteria 2462
789 Ga0501077_0526450 3300049593 Bacteria 758
790 Ga0501077_0585850 3300049593 Bacteria 716
791 Ga0501077_0800068 3300049593 Unclassified 606
792 Ga0501235_180068 3300049669 Bacteria 563
793 Ga0501236_032159 3300049670 Bacteria 835
794 Ga0501239_072033 3300049672 Bacteria 539
795 Ga0501079_0002847 3300049741 Bacteria 12617
796 Ga0501079_0035747 3300049741 Bacteria 3825
797 Ga0501079_0083660 3300049741 Bacteria 2468
798 Ga0501079_0186289 3300049741 Bacteria 1620
799 Ga0501079_0256263 3300049741 Bacteria 1367
800 Ga0501079_0344740 3300049741 Unclassified 1167
801 Ga0501079_0404663 3300049741 Bacteria 1070
802 Ga0501079_1232217 3300049741 Bacteria 589
803 Ga0501080_0074798 3300049742 Bacteria 3151
804 Ga0501080_0364878 3300049742 Unclassified 1303
805 Ga0501080_0660533 3300049742 Bacteria 924
806 Ga0501080_0957166 3300049742 Bacteria 744
807 Ga0501081_0003659 3300049743 Bacteria 9845
808 Ga0501081_0054040 3300049743 Bacteria 2774
809 Ga0501081_0056281 3300049743 Bacteria 2718
810 Ga0501081_0094403 3300049743 Bacteria 2107
811 Ga0501081_0173265 3300049743 Bacteria 1558
812 Ga0501081_0296014 3300049743 Bacteria 1187
813 Ga0501081_0644455 3300049743 Bacteria 794
814 Ga0501081_1271718 3300049743 Unclassified 558
815 Ga0501081_1351810 3300049743 Bacteria 540
816 Ga0501083_0506763 3300049744 Bacteria 786
817 Ga0501035_0503081 3300049822 Bacteria 997
818 Ga0501045_0075038 3300049824 Bacteria 2490
819 Ga0501045_0182607 3300049824 Unclassified 1563
820 Ga0501045_0279710 3300049824 Unclassified 1242
821 Ga0501045_0408178 3300049824 Bacteria 1011
822 Ga0501045_0536946 3300049824 Bacteria 868
823 Ga0501045_0622047 3300049824 Unclassified 799
824 Ga0501045_0762198 3300049824 Unclassified 713
825 Ga0501045_1002928 3300049824 Bacteria 612
826 nmdc:mga05p37_100067_c1 3300050507 Bacteria 3570
827 nmdc:mga05p37_109212_c1 3300050507 Bacteria 3403
828 nmdc:mga05p37_110969_c2 3300050507 Bacteria 2096
829 nmdc:mga05p37_11843_c1 3300050507 Bacteria 10394
830 nmdc:mga05p37_168904_c1 3300050507 Bacteria 2669
831 nmdc:mga05p37_17944_c1 3300050507 Bacteria 8544
832 nmdc:mga05p37_219498_c1 3300050507 Bacteria 2295
833 nmdc:mga05p37_251625_c1 3300050507 Bacteria 2119
834 nmdc:mga05p37_358580_c1 3300050507 Bacteria 1715
835 nmdc:mga05p37_3637_c1 3300050507 Bacteria 18022
836 nmdc:mga05p37_43265_c1 3300050507 Bacteria 5540
837 nmdc:mga05p37_434265_c1 3300050507 Bacteria 1525
838 nmdc:mga05p37_449532_c1 3300050507 Bacteria 1492
839 nmdc:mga05p37_56510_c1 3300050507 Bacteria 4833
840 nmdc:mga05p37_634435_c1 3300050507 Archaea 1200
841 nmdc:mga05p37_72141_c1 3300050507 Bacteria 4248
842 nmdc:mga05p37_8064_c1 3300050507 Bacteria 12441
843 nmdc:mga05p37_8089_c1 3300050507 Bacteria 12428
844 nmdc:mga09592_108170_c1 3300050508 Bacteria 2385
845 nmdc:mga09592_1470980_c1 3300050508 Unclassified 555
846 nmdc:mga09592_153742_c1 3300050508 Bacteria 1985
847 nmdc:mga09592_254165_c1 3300050508 Bacteria 1523
848 nmdc:mga09592_26657_c1 3300050508 Bacteria 4790
849 nmdc:mga09592_302111_c1 3300050508 Bacteria 1388
850 nmdc:mga09592_313007_c1 3300050508 Unclassified 1360
851 nmdc:mga09592_333651_c1 3300050508 Bacteria 1313
852 nmdc:mga09592_417946_c1 3300050508 Bacteria 1159
853 nmdc:mga09592_4377_c1 3300050508 Bacteria 11419
854 nmdc:mga09592_7564_c1 3300050508 Bacteria 8838
855 nmdc:mga09592_780320_c1 3300050508 Bacteria 809
856 nmdc:mga09592_818_c1 3300050508 Bacteria 24062
857 nmdc:mga09592_82381_c1 3300050508 Bacteria 2742
858 nmdc:mga09592_95033_c1 3300050508 Bacteria 2549
859 nmdc:mga0qj67_18174_c1 3300050509 Bacteria 5356
860 nmdc:mga0qj67_247092_c1 3300050509 Bacteria 1448
861 nmdc:mga0qj67_316281_c1 3300050509 Bacteria 1264
862 nmdc:mga0qj67_392533_c1 3300050509 Unclassified 1120
863 nmdc:mga0qj67_39748_c1 3300050509 Bacteria 3696
864 nmdc:mga0qj67_638740_c1 3300050509 Bacteria 850
865 nmdc:mga0qj67_67554_c1 3300050509 Bacteria 2848
866 nmdc:mga0qj67_68714_c1 3300050509 Bacteria 2824
867 nmdc:mga0qj67_730_c1 3300050509 Bacteria 22368
868 nmdc:mga0qj67_93875_c1 3300050509 Bacteria 2413
869 nmdc:mga0qj67_9771_c1 3300050509 Bacteria 7148
870 nmdc:mga06r32_1170494_c1 3300050510 Unclassified 716
871 nmdc:mga06r32_117512_c1 3300050510 Bacteria 2621
872 nmdc:mga06r32_128690_c1 3300050510 Bacteria 2502
873 nmdc:mga06r32_12991_c1 3300050510 Bacteria 7532
874 nmdc:mga06r32_14279_c1 3300050510 Bacteria 7204
875 nmdc:mga06r32_2111_c1 3300050510 Bacteria 17801
876 nmdc:mga06r32_237426_c1 3300050510 Bacteria 1811
877 nmdc:mga06r32_326076_c1 3300050510 Bacteria 1521
878 nmdc:mga06r32_399277_c1 3300050510 Bacteria 1357
879 nmdc:mga06r32_41550_c1 3300050510 Bacteria 4370
880 nmdc:mga06r32_454447_c1 3300050510 Bacteria 1260
881 nmdc:mga06r32_4632_c1 3300050510 Bacteria 12337
882 nmdc:mga06r32_484863_c1 3300050510 Bacteria 1214
883 nmdc:mga06r32_786815_c1 3300050510 Bacteria 913
884 nmdc:mga06r32_828564_c1 3300050510 Bacteria 885
885 nmdc:mga08y16_1317_c1 3300050511 Bacteria 24673
886 nmdc:mga08y16_162187_c1 3300050511 Bacteria 2323
887 nmdc:mga08y16_171_c1 3300050511 Bacteria 56769
888 nmdc:mga08y16_1739795_c1 3300050511 Bacteria 578
889 nmdc:mga08y16_428483_c1 3300050511 Bacteria 1351
890 nmdc:mga08y16_64546_c1 3300050511 Bacteria 3823
891 nmdc:mga08y16_7918_c1 3300050511 Bacteria 11120
892 nmdc:mga0n895_10084_c1 3300050512 Bacteria 8317
893 nmdc:mga0n895_152601_c1 3300050512 Bacteria 2341
894 nmdc:mga0n895_17404_c1 3300050512 Bacteria 6622
895 nmdc:mga0n895_19948_c1 3300050512 Bacteria 6242
896 nmdc:mga0n895_334791_c1 3300050512 Bacteria 1534
897 nmdc:mga0n895_43883_c2 3300050512 Bacteria 2657
898 nmdc:mga0n895_4527_c1 3300050512 Bacteria 11439
899 nmdc:mga0n895_47458_c1 3300050512 Unclassified 4199
900 nmdc:mga0n895_51094_c1 3300050512 Bacteria 4055
901 nmdc:mga0n895_544513_c1 3300050512 Bacteria 1167
902 nmdc:mga0n895_709893_c1 3300050512 Bacteria 1001
903 nmdc:mga0n895_75696_c1 3300050512 Bacteria 3346
904 nmdc:mga0n895_861910_c1 3300050512 Bacteria 893
905 nmdc:mga0rr50_1027680_c1 3300050513 Bacteria 702
906 nmdc:mga0rr50_1280_c1 3300050513 Bacteria 13707
907 nmdc:mga0rr50_139984_c1 3300050513 Bacteria 1946
908 nmdc:mga0rr50_1590746_c1 3300050513 Bacteria 552
909 nmdc:mga0rr50_1684107_c1 3300050513 Bacteria 535
910 nmdc:mga0rr50_26347_c1 3300050513 Bacteria 4055
911 nmdc:mga0rr50_32838_c1 3300050513 Bacteria 3703
912 nmdc:mga0rr50_5599_c1 3300050513 Bacteria 7516
913 nmdc:mga0rr50_91452_c1 3300050513 Bacteria 2370
914 nmdc:mga08x19_361052_c1 3300050514 Unclassified 1015
915 nmdc:mga08x19_45966_c1 3300050514 Bacteria 2791
916 nmdc:mga08x19_5649_c1 3300050514 Bacteria 7392
917 nmdc:mga08x19_601847_c1 3300050514 Bacteria 779
918 nmdc:mga08x19_76845_c1 3300050514 Bacteria 2186
919 nmdc:mga08x19_9252_c1 3300050514 Bacteria 5888
920 nmdc:mga0a205_111571_c1 3300050515 Bacteria 2634
921 nmdc:mga0a205_120630_c1 3300050515 Bacteria 2521
922 nmdc:mga0a205_144582_c1 3300050515 Bacteria 2278
923 nmdc:mga0a205_178729_c1 3300050515 Bacteria 2017
924 nmdc:mga0a205_189823_c1 3300050515 Bacteria 1947
925 nmdc:mga0a205_19596_c1 3300050515 Bacteria 6381
926 nmdc:mga0a205_24698_c1 3300050515 Bacteria 5718
927 nmdc:mga0a205_4101_c1 3300050515 Bacteria 13035
928 nmdc:mga0a205_480572_c1 3300050515 Bacteria 1101
929 nmdc:mga0a205_49683_c1 3300050515 Bacteria 3129
930 nmdc:mga0a205_502462_c1 3300050515 Unclassified 1069
931 nmdc:mga0a205_64423_c1 3300050515 Bacteria 3540
932 nmdc:mga0a205_72713_c1 3300050515 Bacteria 3322
933 nmdc:mga0a205_7301_c1 3300050515 Bacteria 6084
934 nmdc:mga0a205_747144_c1 3300050515 Bacteria 827
935 nmdc:mga0a205_796_c1 3300050515 Bacteria 25603
936 nmdc:mga0a205_9201_c1 3300050515 Bacteria 9018
937 Ga0495619_0430549 3300053085 Bacteria 910
938 Ga0501084_0007316 3300054114 Bacteria 9092
939 Ga0501084_0019852 3300054114 Bacteria 5601
940 Ga0501084_0039408 3300054114 Bacteria 3952
941 Ga0501084_0111022 3300054114 Bacteria 2304
942 Ga0501084_0117599 3300054114 Bacteria 2235
943 Ga0501084_0139932 3300054114 Bacteria 2038
944 Ga0501084_0522945 3300054114 Bacteria 1003
945 Ga0501084_0843721 3300054114 Bacteria 771
946 Ga0501084_1442183 3300054114 Unclassified 576
947 Ga0590075_016660 3300059424 Bacteria 1808
948 Ga0590075_024665 3300059424 Bacteria 1510
949 Ga0501082_0070725 3300060353 Bacteria 3004
950 Ga0501082_0083559 3300060353 Bacteria 2755
951 Ga0501082_0090616 3300060353 Bacteria 2640
952 Ga0501082_0168589 3300060353 Bacteria 1903
953 Ga0501082_0222579 3300060353 Bacteria 1642
954 Ga0501082_0483426 3300060353 Unclassified 1082
955 Ga0501082_0536677 3300060353 Bacteria 1023
956 Ga0501082_0566207 3300060353 Bacteria 994
957 Ga0501082_1090843 3300060353 Bacteria 698
958 Ga0530510_0029602 3300061734 Bacteria 3931
959 Ga0530510_0047462 3300061734 Bacteria 3103
960 Ga0530510_0064878 3300061734 Bacteria 2645
961 Ga0530510_0091456 3300061734 Bacteria 2220
962 Ga0530510_0312353 3300061734 Unclassified 1177
963 Ga0530510_0529217 3300061734 Bacteria 894
964 Ga0530510_0572390 3300061734 Bacteria 858

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0372246 Ga0501038_0372246_11_388 125
2 3300037418 Ga0395900_0254312 Ga0395900_0254312_976_1434 136
3 3300037471 Ga0395905_0048060 Ga0395905_0048060_2483_2971 136
4 3300006914 Ga0075436_100383659 Ga0075436_1003836592 138
5 3300048912 Ga0496109_0833305 Ga0496109_0833305_426_845 138
6 3300049576 Ga0501040_0033093 Ga0501040_0033093_10_426 138
7 3300049824 Ga0501045_0622047 Ga0501045_0622047_25_450 138
8 3300050514 nmdc:mga08x19_361052_c1 nmdc:mga08x19_361052_c1_278_742 138
9 3300005468 Ga0070707_100045167 Ga0070707_1000451672 139
10 3300005536 Ga0070697_100359912 Ga0070697_1003599122 139
11 3300005544 Ga0070686_101247849 Ga0070686_1012478491 139
12 3300005340 Ga0070689_100419278 Ga0070689_1004192782 141
13 3300005471 Ga0070698_100331196 Ga0070698_1003311962 144
14 3300025922 Ga0207646_10040356 Ga0207646_100403562 144
15 3300005471 Ga0070698_100654502 Ga0070698_1006545022 150
16 3300006847 Ga0075431_101567585 Ga0075431_1015675851 150
17 3300005336 Ga0070680_101041210 Ga0070680_1010412101 151
18 3300005459 Ga0068867_100884171 Ga0068867_1008841712 151
19 3300005546 Ga0070696_100079526 Ga0070696_1000795264 151
20 3300005547 Ga0070693_100356053 Ga0070693_1003560532 151
21 3300005549 Ga0070704_100018081 Ga0070704_1000180815 151
22 3300005549 Ga0070704_100266623 Ga0070704_1002666232 151
23 3300005549 Ga0070704_100881208 Ga0070704_1008812082 151
24 3300005617 Ga0068859_100446312 Ga0068859_1004463122 151
25 3300005718 Ga0068866_10073428 Ga0068866_100734282 151
26 3300005843 Ga0068860_100878726 Ga0068860_1008787262 151
27 3300006844 Ga0075428_100563045 Ga0075428_1005630452 151
28 3300006852 Ga0075433_10819915 Ga0075433_108199152 151
29 3300006871 Ga0075434_100911680 Ga0075434_1009116802 151
30 3300006931 Ga0097620_100446301 Ga0097620_1004463012 151
31 3300007265 Ga0099794_10007317 Ga0099794_100073177 151
32 3300009094 Ga0111539_10076175 Ga0111539_100761753 151
33 3300013297 Ga0157378_10058823 Ga0157378_100588234 151
34 3300017792 Ga0163161_11869771 Ga0163161_118697711 151
35 3300025934 Ga0207686_10322557 Ga0207686_103225572 151
36 3300026075 Ga0207708_10542310 Ga0207708_105423102 151
37 3300026089 Ga0207648_10067171 Ga0207648_100671714 151
38 3300027907 Ga0207428_10970037 Ga0207428_109700372 151
39 3300031507 Ga0307509_10067942 Ga0307509_100679421 151
40 3300031548 Ga0307408_100029740 Ga0307408_1000297405 151
41 3300031903 Ga0307407_10585805 Ga0307407_105858052 151
42 3300031911 Ga0307412_10923570 Ga0307412_109235702 151
43 3300032002 Ga0307416_100001116 Ga0307416_10000111613 151
44 3300032005 Ga0307411_10100729 Ga0307411_101007292 151
45 3300035116 Ga0373945_0460582 Ga0373945_0460582_20_499 151
46 3300035121 Ga0373960_0246812 Ga0373960_0246812_101_562 151
47 3300046528 Ga0495642_0402460 Ga0495642_0402460_17_478 151
48 3300049521 Ga0501298_043407 Ga0501298_043407_223_678 151
49 3300049579 Ga0501043_0548862 Ga0501043_0548862_351_812 151
50 3300049591 Ga0501075_0120193 Ga0501075_0120193_349_804 151
51 3300049672 Ga0501239_072033 Ga0501239_072033_18_473 151
52 3300050511 nmdc:mga08y16_64546_c1 nmdc:mga08y16_64546_c1_941_1402 151
53 3300050512 nmdc:mga0n895_75696_c1 nmdc:mga0n895_75696_c1_749_1210 151
54 3300050515 nmdc:mga0a205_747144_c1 nmdc:mga0a205_747144_c1_198_659 151
55 3300054114 Ga0501084_1442183 Ga0501084_1442183_70_531 151
56 3300061734 Ga0530510_0047462 Ga0530510_0047462_2571_3029 151
57 3300003203 JGI25406J46586_10005819 JGI25406J46586_100058192 152
58 3300003659 JGI25404J52841_10105087 JGI25404J52841_101050871 152
59 3300005290 Ga0065712_10141318 Ga0065712_101413183 152
60 3300005293 Ga0065715_10113974 Ga0065715_101139742 152
61 3300005295 Ga0065707_10185628 Ga0065707_101856282 152
62 3300005295 Ga0065707_10244704 Ga0065707_102447042 152
63 3300005295 Ga0065707_10479327 Ga0065707_104793272 152
64 3300005327 Ga0070658_10660707 Ga0070658_106607072 152
65 3300005328 Ga0070676_10000005 Ga0070676_100000059 152
66 3300005328 Ga0070676_10011118 Ga0070676_100111185 152
67 3300005328 Ga0070676_10237672 Ga0070676_102376721 152
68 3300005329 Ga0070683_100038454 Ga0070683_1000384543 152
69 3300005330 Ga0070690_100256890 Ga0070690_1002568902 152
70 3300005331 Ga0070670_100001199 Ga0070670_10000119914 152
71 3300005333 Ga0070677_10213424 Ga0070677_102134242 152
72 3300005334 Ga0068869_100002745 Ga0068869_1000027458 152
73 3300005334 Ga0068869_100009337 Ga0068869_1000093375 152
74 3300005334 Ga0068869_100050419 Ga0068869_1000504195 152
75 3300005335 Ga0070666_10219720 Ga0070666_102197202 152
76 3300005336 Ga0070680_100000094 Ga0070680_10000009443 152
77 3300005336 Ga0070680_100039088 Ga0070680_1000390884 152
78 3300005336 Ga0070680_100062111 Ga0070680_1000621112 152
79 3300005336 Ga0070680_100437265 Ga0070680_1004372652 152
80 3300005337 Ga0070682_100003884 Ga0070682_1000038846 152
81 3300005338 Ga0068868_100014283 Ga0068868_1000142835 152
82 3300005338 Ga0068868_100133018 Ga0068868_1001330182 152
83 3300005339 Ga0070660_100003125 Ga0070660_1000031257 152
84 3300005340 Ga0070689_100003437 Ga0070689_10000343710 152
85 3300005341 Ga0070691_10006218 Ga0070691_100062183 152
86 3300005341 Ga0070691_10049587 Ga0070691_100495872 152
87 3300005341 Ga0070691_10093272 Ga0070691_100932722 152
88 3300005341 Ga0070691_10537802 Ga0070691_105378021 152
89 3300005343 Ga0070687_100079182 Ga0070687_1000791823 152
90 3300005344 Ga0070661_100006165 Ga0070661_1000061657 152
91 3300005345 Ga0070692_10001646 Ga0070692_100016467 152
92 3300005345 Ga0070692_10004232 Ga0070692_100042323 152
93 3300005347 Ga0070668_100326905 Ga0070668_1003269052 152
94 3300005347 Ga0070668_100562170 Ga0070668_1005621702 152
95 3300005353 Ga0070669_100040023 Ga0070669_1000400234 152
96 3300005353 Ga0070669_100068744 Ga0070669_1000687443 152
97 3300005353 Ga0070669_100101399 Ga0070669_1001013994 152
98 3300005353 Ga0070669_100164531 Ga0070669_1001645311 152
99 3300005353 Ga0070669_100623873 Ga0070669_1006238732 152
100 3300005355 Ga0070671_100189336 Ga0070671_1001893362 152
101 3300005356 Ga0070674_100548612 Ga0070674_1005486122 152
102 3300005364 Ga0070673_100017616 Ga0070673_1000176166 152
103 3300005365 Ga0070688_100135114 Ga0070688_1001351142 152
104 3300005365 Ga0070688_100386324 Ga0070688_1003863241 152
105 3300005366 Ga0070659_100001138 Ga0070659_1000011382 152
106 3300005366 Ga0070659_101987984 Ga0070659_1019879841 152
107 3300005406 Ga0070703_10039928 Ga0070703_100399283 152
108 3300005406 Ga0070703_10043334 Ga0070703_100433342 152
109 3300005406 Ga0070703_10081142 Ga0070703_100811422 152
110 3300005406 Ga0070703_10195063 Ga0070703_101950631 152
111 3300005438 Ga0070701_10046764 Ga0070701_100467643 152
112 3300005438 Ga0070701_10097707 Ga0070701_100977072 152
113 3300005439 Ga0070711_100107027 Ga0070711_1001070272 152
114 3300005439 Ga0070711_100259608 Ga0070711_1002596081 152
115 3300005440 Ga0070705_100028364 Ga0070705_1000283643 152
116 3300005440 Ga0070705_100029223 Ga0070705_1000292232 152
117 3300005440 Ga0070705_100031904 Ga0070705_1000319043 152
118 3300005440 Ga0070705_100038776 Ga0070705_1000387762 152
119 3300005440 Ga0070705_100215705 Ga0070705_1002157052 152
120 3300005441 Ga0070700_100051404 Ga0070700_1000514043 152
121 3300005441 Ga0070700_100095624 Ga0070700_1000956243 152
122 3300005444 Ga0070694_100002997 Ga0070694_1000029974 152
123 3300005444 Ga0070694_100004403 Ga0070694_1000044033 152
124 3300005444 Ga0070694_100115083 Ga0070694_1001150832 152
125 3300005444 Ga0070694_100331669 Ga0070694_1003316692 152
126 3300005444 Ga0070694_100795933 Ga0070694_1007959332 152
127 3300005445 Ga0070708_100015531 Ga0070708_1000155315 152
128 3300005445 Ga0070708_100023561 Ga0070708_1000235616 152
129 3300005445 Ga0070708_100024205 Ga0070708_1000242053 152
130 3300005445 Ga0070708_100051214 Ga0070708_1000512145 152
131 3300005445 Ga0070708_100159238 Ga0070708_1001592382 152
132 3300005445 Ga0070708_100231582 Ga0070708_1002315823 152
133 3300005445 Ga0070708_100321554 Ga0070708_1003215542 152
134 3300005445 Ga0070708_100321786 Ga0070708_1003217861 152
135 3300005445 Ga0070708_100384527 Ga0070708_1003845272 152
136 3300005445 Ga0070708_101417996 Ga0070708_1014179961 152
137 3300005455 Ga0070663_100000763 Ga0070663_1000007636 152
138 3300005457 Ga0070662_100042435 Ga0070662_1000424352 152
139 3300005457 Ga0070662_100081362 Ga0070662_1000813623 152
140 3300005458 Ga0070681_10034394 Ga0070681_100343942 152
141 3300005458 Ga0070681_10058087 Ga0070681_100580873 152
142 3300005458 Ga0070681_10062606 Ga0070681_100626063 152
143 3300005458 Ga0070681_10390843 Ga0070681_103908432 152
144 3300005459 Ga0068867_100002733 Ga0068867_1000027336 152
145 3300005459 Ga0068867_100019737 Ga0068867_1000197372 152
146 3300005459 Ga0068867_100157437 Ga0068867_1001574372 152
147 3300005467 Ga0070706_100004618 Ga0070706_1000046184 152
148 3300005467 Ga0070706_100008662 Ga0070706_1000086623 152
149 3300005467 Ga0070706_100043566 Ga0070706_1000435665 152
150 3300005467 Ga0070706_100075697 Ga0070706_1000756973 152
151 3300005467 Ga0070706_100090200 Ga0070706_1000902004 152
152 3300005467 Ga0070706_100136905 Ga0070706_1001369053 152
153 3300005467 Ga0070706_100159881 Ga0070706_1001598812 152
154 3300005467 Ga0070706_100314395 Ga0070706_1003143952 152
155 3300005467 Ga0070706_100327919 Ga0070706_1003279192 152
156 3300005467 Ga0070706_100531695 Ga0070706_1005316952 152
157 3300005468 Ga0070707_100001786 Ga0070707_10000178622 152
158 3300005468 Ga0070707_100005318 Ga0070707_1000053185 152
159 3300005468 Ga0070707_100011093 Ga0070707_1000110934 152
160 3300005468 Ga0070707_100014433 Ga0070707_1000144337 152
161 3300005468 Ga0070707_100018600 Ga0070707_1000186004 152
162 3300005468 Ga0070707_100061661 Ga0070707_1000616614 152
163 3300005468 Ga0070707_100087596 Ga0070707_1000875962 152
164 3300005468 Ga0070707_100133354 Ga0070707_1001333543 152
165 3300005468 Ga0070707_100139937 Ga0070707_1001399373 152
166 3300005468 Ga0070707_100417330 Ga0070707_1004173302 152
167 3300005468 Ga0070707_100666676 Ga0070707_1006666762 152
168 3300005468 Ga0070707_100879946 Ga0070707_1008799462 152
169 3300005468 Ga0070707_100975812 Ga0070707_1009758121 152
170 3300005471 Ga0070698_100006315 Ga0070698_1000063159 152
171 3300005471 Ga0070698_100118659 Ga0070698_1001186591 152
172 3300005471 Ga0070698_100570296 Ga0070698_1005702962 152
173 3300005518 Ga0070699_100002516 Ga0070699_1000025163 152
174 3300005518 Ga0070699_100019945 Ga0070699_1000199454 152
175 3300005518 Ga0070699_100037281 Ga0070699_1000372812 152
176 3300005518 Ga0070699_100051010 Ga0070699_1000510103 152
177 3300005518 Ga0070699_100081806 Ga0070699_1000818062 152
178 3300005518 Ga0070699_100091875 Ga0070699_1000918752 152
179 3300005518 Ga0070699_100185087 Ga0070699_1001850872 152
180 3300005518 Ga0070699_100294785 Ga0070699_1002947852 152
181 3300005518 Ga0070699_100319775 Ga0070699_1003197751 152
182 3300005518 Ga0070699_100350177 Ga0070699_1003501771 152
183 3300005518 Ga0070699_100445390 Ga0070699_1004453902 152
184 3300005518 Ga0070699_100489209 Ga0070699_1004892092 152
185 3300005518 Ga0070699_100917110 Ga0070699_1009171102 152
186 3300005530 Ga0070679_100001113 Ga0070679_10000111317 152
187 3300005530 Ga0070679_100034545 Ga0070679_1000345452 152
188 3300005530 Ga0070679_100036717 Ga0070679_1000367172 152
189 3300005530 Ga0070679_100234132 Ga0070679_1002341323 152
190 3300005530 Ga0070679_100309895 Ga0070679_1003098952 152
191 3300005535 Ga0070684_100241528 Ga0070684_1002415282 152
192 3300005536 Ga0070697_100000676 Ga0070697_10000067616 152
193 3300005536 Ga0070697_100002183 Ga0070697_1000021831 152
194 3300005536 Ga0070697_100025430 Ga0070697_1000254303 152
195 3300005536 Ga0070697_100048316 Ga0070697_1000483164 152
196 3300005536 Ga0070697_100182974 Ga0070697_1001829742 152
197 3300005536 Ga0070697_100188915 Ga0070697_1001889153 152
198 3300005536 Ga0070697_100189402 Ga0070697_1001894022 152
199 3300005536 Ga0070697_100225229 Ga0070697_1002252292 152
200 3300005536 Ga0070697_100261986 Ga0070697_1002619862 152
201 3300005536 Ga0070697_100874309 Ga0070697_1008743091 152
202 3300005539 Ga0068853_100008227 Ga0068853_1000082275 152
203 3300005543 Ga0070672_100024688 Ga0070672_1000246883 152
204 3300005543 Ga0070672_100164052 Ga0070672_1001640522 152
205 3300005543 Ga0070672_100448181 Ga0070672_1004481812 152
206 3300005544 Ga0070686_100310061 Ga0070686_1003100612 152
207 3300005545 Ga0070695_100001443 Ga0070695_1000014434 152
208 3300005545 Ga0070695_100005056 Ga0070695_1000050563 152
209 3300005545 Ga0070695_100096571 Ga0070695_1000965712 152
210 3300005545 Ga0070695_100134677 Ga0070695_1001346772 152
211 3300005546 Ga0070696_100001369 Ga0070696_10000136911 152
212 3300005546 Ga0070696_100017182 Ga0070696_1000171825 152
213 3300005546 Ga0070696_100025044 Ga0070696_1000250442 152
214 3300005546 Ga0070696_100085349 Ga0070696_1000853492 152
215 3300005546 Ga0070696_100330285 Ga0070696_1003302851 152
216 3300005546 Ga0070696_101718551 Ga0070696_1017185511 152
217 3300005547 Ga0070693_100000104 Ga0070693_10000010422 152
218 3300005548 Ga0070665_101162564 Ga0070665_1011625642 152
219 3300005549 Ga0070704_100014114 Ga0070704_1000141145 152
220 3300005549 Ga0070704_100033390 Ga0070704_1000333903 152
221 3300005549 Ga0070704_100066200 Ga0070704_1000662002 152
222 3300005549 Ga0070704_100720848 Ga0070704_1007208481 152
223 3300005549 Ga0070704_100952440 Ga0070704_1009524401 152
224 3300005549 Ga0070704_101587799 Ga0070704_1015877991 152
225 3300005563 Ga0068855_100016998 Ga0068855_1000169982 152
226 3300005563 Ga0068855_100518680 Ga0068855_1005186802 152
227 3300005563 Ga0068855_100577014 Ga0068855_1005770142 152
228 3300005563 Ga0068855_100611731 Ga0068855_1006117312 152
229 3300005577 Ga0068857_100094550 Ga0068857_1000945502 152
230 3300005577 Ga0068857_100175503 Ga0068857_1001755033 152
231 3300005577 Ga0068857_100214239 Ga0068857_1002142392 152
232 3300005578 Ga0068854_100004651 Ga0068854_1000046515 152
233 3300005614 Ga0068856_100012614 Ga0068856_1000126145 152
234 3300005614 Ga0068856_100071511 Ga0068856_1000715113 152
235 3300005614 Ga0068856_100298801 Ga0068856_1002988012 152
236 3300005615 Ga0070702_100024931 Ga0070702_1000249314 152
237 3300005615 Ga0070702_101046941 Ga0070702_1010469411 152
238 3300005616 Ga0068852_100389912 Ga0068852_1003899122 152
239 3300005617 Ga0068859_100001562 Ga0068859_1000015625 152
240 3300005617 Ga0068859_100127803 Ga0068859_1001278033 152
241 3300005617 Ga0068859_100268466 Ga0068859_1002684662 152
242 3300005617 Ga0068859_100338727 Ga0068859_1003387272 152
243 3300005617 Ga0068859_100501533 Ga0068859_1005015332 152
244 3300005617 Ga0068859_100641229 Ga0068859_1006412291 152
245 3300005618 Ga0068864_100000991 Ga0068864_10000099110 152
246 3300005618 Ga0068864_100047381 Ga0068864_1000473812 152
247 3300005618 Ga0068864_101256791 Ga0068864_1012567912 152
248 3300005718 Ga0068866_10618098 Ga0068866_106180981 152
249 3300005719 Ga0068861_100018444 Ga0068861_1000184442 152
250 3300005719 Ga0068861_100154005 Ga0068861_1001540052 152
251 3300005719 Ga0068861_100237858 Ga0068861_1002378583 152
252 3300005834 Ga0068851_10198680 Ga0068851_101986802 152
253 3300005840 Ga0068870_10002820 Ga0068870_100028205 152
254 3300005841 Ga0068863_100010104 Ga0068863_1000101046 152
255 3300005841 Ga0068863_100708195 Ga0068863_1007081951 152
256 3300005841 Ga0068863_101154134 Ga0068863_1011541342 152
257 3300005841 Ga0068863_101522666 Ga0068863_1015226662 152
258 3300005841 Ga0068863_101948999 Ga0068863_1019489991 152
259 3300005842 Ga0068858_100033406 Ga0068858_1000334064 152
260 3300005842 Ga0068858_100157079 Ga0068858_1001570791 152
261 3300005843 Ga0068860_100022117 Ga0068860_1000221174 152
262 3300005843 Ga0068860_100336400 Ga0068860_1003364003 152
263 3300005843 Ga0068860_100882234 Ga0068860_1008822341 152
264 3300005844 Ga0068862_100007685 Ga0068862_1000076856 152
265 3300005844 Ga0068862_100013048 Ga0068862_1000130483 152
266 3300005844 Ga0068862_100023027 Ga0068862_1000230275 152
267 3300005844 Ga0068862_100043608 Ga0068862_1000436083 152
268 3300005844 Ga0068862_100098268 Ga0068862_1000982682 152
269 3300005844 Ga0068862_100212790 Ga0068862_1002127902 152
270 3300005844 Ga0068862_100468936 Ga0068862_1004689362 152
271 3300005844 Ga0068862_100591516 Ga0068862_1005915162 152
272 3300005844 Ga0068862_101279850 Ga0068862_1012798502 152
273 3300005983 Ga0081540_1001963 Ga0081540_10019638 152
274 3300005985 Ga0081539_10000590 Ga0081539_1000059011 152
275 3300006058 Ga0075432_10080745 Ga0075432_100807452 152
276 3300006163 Ga0070715_10267494 Ga0070715_102674942 152
277 3300006163 Ga0070715_11017775 Ga0070715_110177751 152
278 3300006173 Ga0070716_100007870 Ga0070716_1000078706 152
279 3300006194 Ga0075427_10021528 Ga0075427_100215282 152
280 3300006237 Ga0097621_101244755 Ga0097621_1012447552 152
281 3300006358 Ga0068871_100762236 Ga0068871_1007622362 152
282 3300006844 Ga0075428_100000730 Ga0075428_10000073037 152
283 3300006844 Ga0075428_100008047 Ga0075428_1000080474 152
284 3300006844 Ga0075428_100017939 Ga0075428_1000179399 152
285 3300006844 Ga0075428_100030783 Ga0075428_1000307836 152
286 3300006844 Ga0075428_100063364 Ga0075428_1000633643 152
287 3300006844 Ga0075428_100161255 Ga0075428_1001612552 152
288 3300006844 Ga0075428_100175668 Ga0075428_1001756682 152
289 3300006844 Ga0075428_100188259 Ga0075428_1001882592 152
290 3300006844 Ga0075428_100304698 Ga0075428_1003046984 152
291 3300006844 Ga0075428_100466585 Ga0075428_1004665852 152
292 3300006844 Ga0075428_100842283 Ga0075428_1008422832 152
293 3300006844 Ga0075428_101009790 Ga0075428_1010097902 152
294 3300006846 Ga0075430_100002036 Ga0075430_1000020367 152
295 3300006846 Ga0075430_100006370 Ga0075430_1000063702 152
296 3300006846 Ga0075430_100018856 Ga0075430_1000188567 152
297 3300006846 Ga0075430_100111721 Ga0075430_1001117213 152
298 3300006846 Ga0075430_100176534 Ga0075430_1001765342 152
299 3300006846 Ga0075430_100198464 Ga0075430_1001984642 152
300 3300006846 Ga0075430_100309158 Ga0075430_1003091583 152
301 3300006846 Ga0075430_100350342 Ga0075430_1003503422 152
302 3300006846 Ga0075430_100395150 Ga0075430_1003951502 152
303 3300006846 Ga0075430_100490427 Ga0075430_1004904272 152
304 3300006847 Ga0075431_100007203 Ga0075431_1000072033 152
305 3300006847 Ga0075431_100008661 Ga0075431_1000086616 152
306 3300006847 Ga0075431_100010364 Ga0075431_1000103649 152
307 3300006847 Ga0075431_100019710 Ga0075431_1000197107 152
308 3300006847 Ga0075431_100035297 Ga0075431_1000352974 152
309 3300006847 Ga0075431_100070228 Ga0075431_1000702283 152
310 3300006847 Ga0075431_100089673 Ga0075431_1000896733 152
311 3300006847 Ga0075431_100093074 Ga0075431_1000930746 152
312 3300006847 Ga0075431_100110736 Ga0075431_1001107361 152
313 3300006847 Ga0075431_100219357 Ga0075431_1002193572 152
314 3300006847 Ga0075431_100270914 Ga0075431_1002709142 152
315 3300006847 Ga0075431_100307066 Ga0075431_1003070663 152
316 3300006847 Ga0075431_100471721 Ga0075431_1004717212 152
317 3300006847 Ga0075431_100781618 Ga0075431_1007816182 152
318 3300006852 Ga0075433_10001209 Ga0075433_1000120910 152
319 3300006852 Ga0075433_10002879 Ga0075433_100028795 152
320 3300006852 Ga0075433_10005890 Ga0075433_100058905 152
321 3300006852 Ga0075433_10018092 Ga0075433_100180924 152
322 3300006852 Ga0075433_10022899 Ga0075433_100228994 152
323 3300006852 Ga0075433_10025739 Ga0075433_100257397 152
324 3300006852 Ga0075433_10040876 Ga0075433_100408764 152
325 3300006852 Ga0075433_10080500 Ga0075433_100805003 152
326 3300006852 Ga0075433_10085717 Ga0075433_100857174 152
327 3300006852 Ga0075433_10086269 Ga0075433_100862692 152
328 3300006852 Ga0075433_10088588 Ga0075433_100885884 152
329 3300006852 Ga0075433_10161430 Ga0075433_101614302 152
330 3300006852 Ga0075433_10444063 Ga0075433_104440633 152
331 3300006852 Ga0075433_10536391 Ga0075433_105363911 152
332 3300006871 Ga0075434_100000039 Ga0075434_10000003919 152
333 3300006871 Ga0075434_100004221 Ga0075434_1000042215 152
334 3300006871 Ga0075434_100011543 Ga0075434_1000115435 152
335 3300006871 Ga0075434_100061715 Ga0075434_1000617155 152
336 3300006871 Ga0075434_100071242 Ga0075434_1000712423 152
337 3300006871 Ga0075434_100092860 Ga0075434_1000928602 152
338 3300006871 Ga0075434_100118891 Ga0075434_1001188912 152
339 3300006871 Ga0075434_100120734 Ga0075434_1001207343 152
340 3300006871 Ga0075434_100149544 Ga0075434_1001495442 152
341 3300006871 Ga0075434_100185820 Ga0075434_1001858203 152
342 3300006871 Ga0075434_100235777 Ga0075434_1002357773 152
343 3300006871 Ga0075434_100436959 Ga0075434_1004369591 152
344 3300006871 Ga0075434_100597562 Ga0075434_1005975622 152
345 3300006871 Ga0075434_101756525 Ga0075434_1017565251 152
346 3300006871 Ga0075434_101860463 Ga0075434_1018604632 152
347 3300006880 Ga0075429_100002010 Ga0075429_10000201011 152
348 3300006880 Ga0075429_100010977 Ga0075429_1000109774 152
349 3300006880 Ga0075429_100011741 Ga0075429_1000117416 152
350 3300006880 Ga0075429_100013899 Ga0075429_1000138992 152
351 3300006880 Ga0075429_100014322 Ga0075429_1000143223 152
352 3300006880 Ga0075429_100023491 Ga0075429_1000234915 152
353 3300006880 Ga0075429_100095349 Ga0075429_1000953493 152
354 3300006880 Ga0075429_100102898 Ga0075429_1001028982 152
355 3300006880 Ga0075429_100175753 Ga0075429_1001757532 152
356 3300006880 Ga0075429_100178014 Ga0075429_1001780142 152
357 3300006880 Ga0075429_100183632 Ga0075429_1001836322 152
358 3300006880 Ga0075429_100230963 Ga0075429_1002309632 152
359 3300006880 Ga0075429_100312326 Ga0075429_1003123262 152
360 3300006881 Ga0068865_100078896 Ga0068865_1000788963 152
361 3300006881 Ga0068865_100080105 Ga0068865_1000801052 152
362 3300006914 Ga0075436_100044437 Ga0075436_1000444373 152
363 3300006914 Ga0075436_100084670 Ga0075436_1000846702 152
364 3300006914 Ga0075436_100086429 Ga0075436_1000864292 152
365 3300006914 Ga0075436_100127043 Ga0075436_1001270432 152
366 3300006914 Ga0075436_100466309 Ga0075436_1004663092 152
367 3300006914 Ga0075436_100625026 Ga0075436_1006250262 152
368 3300006931 Ga0097620_100001562 Ga0097620_1000015625 152
369 3300006931 Ga0097620_100127803 Ga0097620_1001278032 152
370 3300006931 Ga0097620_100268459 Ga0097620_1002684592 152
371 3300006931 Ga0097620_100338733 Ga0097620_1003387332 152
372 3300006931 Ga0097620_100501536 Ga0097620_1005015362 152
373 3300006931 Ga0097620_100641246 Ga0097620_1006412461 152
374 3300007076 Ga0075435_100008582 Ga0075435_1000085825 152
375 3300007076 Ga0075435_100017075 Ga0075435_1000170755 152
376 3300007076 Ga0075435_100028763 Ga0075435_1000287633 152
377 3300007076 Ga0075435_100041954 Ga0075435_1000419545 152
378 3300007076 Ga0075435_100065361 Ga0075435_1000653612 152
379 3300007076 Ga0075435_100128630 Ga0075435_1001286302 152
380 3300007076 Ga0075435_100142348 Ga0075435_1001423483 152
381 3300007076 Ga0075435_100222577 Ga0075435_1002225772 152
382 3300007076 Ga0075435_100711065 Ga0075435_1007110652 152
383 3300007076 Ga0075435_100750633 Ga0075435_1007506332 152
384 3300007265 Ga0099794_10003785 Ga0099794_100037853 152
385 3300007265 Ga0099794_10053082 Ga0099794_100530822 152
386 3300007265 Ga0099794_10399742 Ga0099794_103997422 152
387 3300007265 Ga0099794_10455910 Ga0099794_104559102 152
388 3300009094 Ga0111539_10000715 Ga0111539_100007153 152
389 3300009094 Ga0111539_10000819 Ga0111539_1000081944 152
390 3300009094 Ga0111539_10001430 Ga0111539_1000143021 152
391 3300009094 Ga0111539_10047551 Ga0111539_100475515 152
392 3300009098 Ga0105245_10800644 Ga0105245_108006441 152
393 3300009147 Ga0114129_10000409 Ga0114129_1000040954 152
394 3300009147 Ga0114129_10003438 Ga0114129_1000343817 152
395 3300009147 Ga0114129_10005405 Ga0114129_1000540515 152
396 3300009147 Ga0114129_10008975 Ga0114129_1000897515 152
397 3300009147 Ga0114129_10059492 Ga0114129_100594922 152
398 3300009147 Ga0114129_10077976 Ga0114129_100779764 152
399 3300009147 Ga0114129_10082816 Ga0114129_100828162 152
400 3300009147 Ga0114129_10083036 Ga0114129_100830364 152
401 3300009147 Ga0114129_10097283 Ga0114129_100972835 152
402 3300009147 Ga0114129_10138195 Ga0114129_101381953 152
403 3300009147 Ga0114129_10143481 Ga0114129_101434814 152
404 3300009147 Ga0114129_10199854 Ga0114129_101998542 152
405 3300009147 Ga0114129_10224251 Ga0114129_102242512 152
406 3300009147 Ga0114129_10335894 Ga0114129_103358942 152
407 3300009147 Ga0114129_10542462 Ga0114129_105424622 152
408 3300009147 Ga0114129_10990084 Ga0114129_109900841 152
409 3300009147 Ga0114129_11239651 Ga0114129_112396512 152
410 3300009147 Ga0114129_11562390 Ga0114129_115623902 152
411 3300009148 Ga0105243_10161636 Ga0105243_101616362 152
412 3300009148 Ga0105243_10338732 Ga0105243_103387322 152
413 3300009148 Ga0105243_10613718 Ga0105243_106137182 152
414 3300009174 Ga0105241_10001344 Ga0105241_100013448 152
415 3300009174 Ga0105241_10615983 Ga0105241_106159831 152
416 3300009176 Ga0105242_10021975 Ga0105242_100219757 152
417 3300009176 Ga0105242_10190262 Ga0105242_101902623 152
418 3300009177 Ga0105248_10186725 Ga0105248_101867252 152
419 3300009177 Ga0105248_10189571 Ga0105248_101895713 152
420 3300009177 Ga0105248_11738923 Ga0105248_117389231 152
421 3300009545 Ga0105237_10058839 Ga0105237_100588394 152
422 3300009551 Ga0105238_10389887 Ga0105238_103898872 152
423 3300009553 Ga0105249_10061301 Ga0105249_100613012 152
424 3300009553 Ga0105249_10096471 Ga0105249_100964712 152
425 3300009553 Ga0105249_10099318 Ga0105249_100993182 152
426 3300009553 Ga0105249_10147254 Ga0105249_101472543 152
427 3300009553 Ga0105249_10333816 Ga0105249_103338163 152
428 3300009553 Ga0105249_10575338 Ga0105249_105753381 152
429 3300009553 Ga0105249_11114596 Ga0105249_111145961 152
430 3300009553 Ga0105249_11652903 Ga0105249_116529032 152
431 3300011119 Ga0105246_10012663 Ga0105246_100126636 152
432 3300013100 Ga0157373_10000101 Ga0157373_1000010151 152
433 3300013102 Ga0157371_10437079 Ga0157371_104370792 152
434 3300013104 Ga0157370_10275494 Ga0157370_102754942 152
435 3300013105 Ga0157369_10012134 Ga0157369_1001213410 152
436 3300013296 Ga0157374_10446432 Ga0157374_104464322 152
437 3300013296 Ga0157374_11080543 Ga0157374_110805432 152
438 3300013297 Ga0157378_12506964 Ga0157378_125069641 152
439 3300013306 Ga0163162_10489108 Ga0163162_104891083 152
440 3300013306 Ga0163162_10884082 Ga0163162_108840822 152
441 3300013307 Ga0157372_10000703 Ga0157372_1000070320 152
442 3300013307 Ga0157372_11118195 Ga0157372_111181952 152
443 3300013308 Ga0157375_10048022 Ga0157375_100480224 152
444 3300013308 Ga0157375_10524051 Ga0157375_105240512 152
445 3300013308 Ga0157375_10711959 Ga0157375_107119592 152
446 3300013308 Ga0157375_12641858 Ga0157375_126418581 152
447 3300014325 Ga0163163_10152202 Ga0163163_101522024 152
448 3300014325 Ga0163163_10159045 Ga0163163_101590453 152
449 3300014325 Ga0163163_10736290 Ga0163163_107362902 152
450 3300014326 Ga0157380_10056424 Ga0157380_100564244 152
451 3300014326 Ga0157380_10162064 Ga0157380_101620643 152
452 3300014326 Ga0157380_10496505 Ga0157380_104965051 152
453 3300014497 Ga0182008_10397785 Ga0182008_103977851 152
454 3300014745 Ga0157377_10303813 Ga0157377_103038132 152
455 3300014968 Ga0157379_10166896 Ga0157379_101668963 152
456 3300014968 Ga0157379_10902559 Ga0157379_109025592 152
457 3300017792 Ga0163161_10224342 Ga0163161_102243423 152
458 3300020070 Ga0206356_11442960 Ga0206356_114429601 152
459 3300020081 Ga0206354_10938711 Ga0206354_109387112 152
460 3300025321 Ga0207656_10067904 Ga0207656_100679042 152
461 3300025885 Ga0207653_10019640 Ga0207653_100196403 152
462 3300025885 Ga0207653_10071663 Ga0207653_100716632 152
463 3300025885 Ga0207653_10229018 Ga0207653_102290182 152
464 3300025898 Ga0207692_10397937 Ga0207692_103979372 152
465 3300025899 Ga0207642_10292696 Ga0207642_102926962 152
466 3300025899 Ga0207642_10805140 Ga0207642_108051401 152
467 3300025903 Ga0207680_10158576 Ga0207680_101585762 152
468 3300025904 Ga0207647_10049061 Ga0207647_100490613 152
469 3300025907 Ga0207645_10000852 Ga0207645_1000085224 152
470 3300025907 Ga0207645_10013648 Ga0207645_100136485 152
471 3300025908 Ga0207643_10000150 Ga0207643_100001506 152
472 3300025910 Ga0207684_10000996 Ga0207684_1000099623 152
473 3300025910 Ga0207684_10001569 Ga0207684_1000156922 152
474 3300025910 Ga0207684_10002411 Ga0207684_100024118 152
475 3300025910 Ga0207684_10008157 Ga0207684_100081572 152
476 3300025910 Ga0207684_10028553 Ga0207684_100285534 152
477 3300025910 Ga0207684_10052166 Ga0207684_100521663 152
478 3300025910 Ga0207684_10182336 Ga0207684_101823363 152
479 3300025910 Ga0207684_10239761 Ga0207684_102397612 152
480 3300025910 Ga0207684_10284387 Ga0207684_102843872 152
481 3300025910 Ga0207684_10313165 Ga0207684_103131652 152
482 3300025910 Ga0207684_10387267 Ga0207684_103872672 152
483 3300025910 Ga0207684_10462277 Ga0207684_104622772 152
484 3300025910 Ga0207684_10506424 Ga0207684_105064241 152
485 3300025910 Ga0207684_10521690 Ga0207684_105216902 152
486 3300025911 Ga0207654_10029377 Ga0207654_100293774 152
487 3300025911 Ga0207654_10119642 Ga0207654_101196422 152
488 3300025912 Ga0207707_10000076 Ga0207707_1000007617 152
489 3300025912 Ga0207707_10031856 Ga0207707_100318563 152
490 3300025912 Ga0207707_10102064 Ga0207707_101020641 152
491 3300025912 Ga0207707_10140157 Ga0207707_101401573 152
492 3300025912 Ga0207707_10336183 Ga0207707_103361832 152
493 3300025916 Ga0207663_10698262 Ga0207663_106982622 152
494 3300025917 Ga0207660_10000022 Ga0207660_1000002261 152
495 3300025917 Ga0207660_10048361 Ga0207660_100483612 152
496 3300025918 Ga0207662_10023135 Ga0207662_100231354 152
497 3300025919 Ga0207657_10000005 Ga0207657_10000005120 152
498 3300025920 Ga0207649_10003591 Ga0207649_100035914 152
499 3300025921 Ga0207652_10000060 Ga0207652_1000006096 152
500 3300025921 Ga0207652_10023677 Ga0207652_100236775 152
501 3300025921 Ga0207652_10069077 Ga0207652_100690772 152
502 3300025921 Ga0207652_10078641 Ga0207652_100786412 152
503 3300025921 Ga0207652_10349596 Ga0207652_103495962 152
504 3300025922 Ga0207646_10001766 Ga0207646_100017665 152
505 3300025922 Ga0207646_10006356 Ga0207646_1000635611 152
506 3300025922 Ga0207646_10008955 Ga0207646_100089556 152
507 3300025922 Ga0207646_10016669 Ga0207646_100166696 152
508 3300025922 Ga0207646_10114641 Ga0207646_101146412 152
509 3300025922 Ga0207646_10141204 Ga0207646_101412043 152
510 3300025922 Ga0207646_10159756 Ga0207646_101597562 152
511 3300025922 Ga0207646_10424425 Ga0207646_104244252 152
512 3300025922 Ga0207646_10487366 Ga0207646_104873662 152
513 3300025922 Ga0207646_10601260 Ga0207646_106012602 152
514 3300025922 Ga0207646_11349769 Ga0207646_113497691 152
515 3300025923 Ga0207681_10007091 Ga0207681_100070916 152
516 3300025923 Ga0207681_10211310 Ga0207681_102113103 152
517 3300025923 Ga0207681_10459040 Ga0207681_104590402 152
518 3300025923 Ga0207681_10605141 Ga0207681_106051412 152
519 3300025923 Ga0207681_10681995 Ga0207681_106819952 152
520 3300025924 Ga0207694_11095009 Ga0207694_110950091 152
521 3300025924 Ga0207694_11661090 Ga0207694_116610901 152
522 3300025925 Ga0207650_10072410 Ga0207650_100724102 152
523 3300025926 Ga0207659_10248049 Ga0207659_102480493 152
524 3300025926 Ga0207659_10916707 Ga0207659_109167071 152
525 3300025931 Ga0207644_10458373 Ga0207644_104583732 152
526 3300025932 Ga0207690_10006358 Ga0207690_100063586 152
527 3300025933 Ga0207706_10027460 Ga0207706_100274604 152
528 3300025933 Ga0207706_10063115 Ga0207706_100631152 152
529 3300025935 Ga0207709_10017341 Ga0207709_100173413 152
530 3300025935 Ga0207709_10380646 Ga0207709_103806462 152
531 3300025935 Ga0207709_10697026 Ga0207709_106970262 152
532 3300025935 Ga0207709_10725893 Ga0207709_107258931 152
533 3300025936 Ga0207670_10008129 Ga0207670_100081296 152
534 3300025938 Ga0207704_10233523 Ga0207704_102335232 152
535 3300025938 Ga0207704_10308151 Ga0207704_103081512 152
536 3300025938 Ga0207704_10502297 Ga0207704_105022972 152
537 3300025939 Ga0207665_10005354 Ga0207665_100053544 152
538 3300025940 Ga0207691_10037324 Ga0207691_100373243 152
539 3300025940 Ga0207691_10216845 Ga0207691_102168452 152
540 3300025941 Ga0207711_10279211 Ga0207711_102792112 152
541 3300025941 Ga0207711_11332540 Ga0207711_113325401 152
542 3300025942 Ga0207689_10000050 Ga0207689_1000005059 152
543 3300025942 Ga0207689_10004262 Ga0207689_100042625 152
544 3300025942 Ga0207689_10198354 Ga0207689_101983542 152
545 3300025944 Ga0207661_10109543 Ga0207661_101095433 152
546 3300025944 Ga0207661_10436733 Ga0207661_104367332 152
547 3300025944 Ga0207661_10651228 Ga0207661_106512282 152
548 3300025945 Ga0207679_10002376 Ga0207679_100023767 152
549 3300025949 Ga0207667_10000587 Ga0207667_1000058733 152
550 3300025949 Ga0207667_10343624 Ga0207667_103436242 152
551 3300025960 Ga0207651_10011721 Ga0207651_100117213 152
552 3300025961 Ga0207712_10050600 Ga0207712_100506002 152
553 3300025961 Ga0207712_10306567 Ga0207712_103065673 152
554 3300025961 Ga0207712_10670257 Ga0207712_106702571 152
555 3300025961 Ga0207712_10768261 Ga0207712_107682611 152
556 3300025961 Ga0207712_11199756 Ga0207712_111997562 152
557 3300025972 Ga0207668_10401152 Ga0207668_104011522 152
558 3300025972 Ga0207668_10630763 Ga0207668_106307632 152
559 3300025981 Ga0207640_10049758 Ga0207640_100497582 152
560 3300025981 Ga0207640_10211929 Ga0207640_102119291 152
561 3300025981 Ga0207640_11060467 Ga0207640_110604672 152
562 3300026023 Ga0207677_10436860 Ga0207677_104368602 152
563 3300026023 Ga0207677_10836824 Ga0207677_108368242 152
564 3300026035 Ga0207703_10060648 Ga0207703_100606483 152
565 3300026041 Ga0207639_10049105 Ga0207639_100491054 152
566 3300026041 Ga0207639_11404783 Ga0207639_114047831 152
567 3300026067 Ga0207678_10001742 Ga0207678_100017427 152
568 3300026067 Ga0207678_10318709 Ga0207678_103187092 152
569 3300026075 Ga0207708_10124948 Ga0207708_101249483 152
570 3300026078 Ga0207702_10098091 Ga0207702_100980914 152
571 3300026078 Ga0207702_10691902 Ga0207702_106919022 152
572 3300026078 Ga0207702_10928924 Ga0207702_109289242 152
573 3300026088 Ga0207641_10022956 Ga0207641_100229564 152
574 3300026088 Ga0207641_10335830 Ga0207641_103358302 152
575 3300026088 Ga0207641_10520199 Ga0207641_105201992 152
576 3300026088 Ga0207641_11021133 Ga0207641_110211331 152
577 3300026089 Ga0207648_10005797 Ga0207648_1000579711 152
578 3300026089 Ga0207648_10038731 Ga0207648_100387312 152
579 3300026089 Ga0207648_10131629 Ga0207648_101316293 152
580 3300026089 Ga0207648_10146922 Ga0207648_101469222 152
581 3300026095 Ga0207676_10061331 Ga0207676_100613314 152
582 3300026095 Ga0207676_10197607 Ga0207676_101976071 152
583 3300026095 Ga0207676_11038288 Ga0207676_110382882 152
584 3300026116 Ga0207674_10000075 Ga0207674_1000007553 152
585 3300026116 Ga0207674_10036958 Ga0207674_100369585 152
586 3300026116 Ga0207674_10067327 Ga0207674_100673273 152
587 3300026116 Ga0207674_10084664 Ga0207674_100846644 152
588 3300026118 Ga0207675_100012152 Ga0207675_1000121525 152
589 3300026118 Ga0207675_100229606 Ga0207675_1002296062 152
590 3300027462 Ga0210000_1009137 Ga0210000_10091372 152
591 3300027665 Ga0209983_1022072 Ga0209983_10220722 152
592 3300027671 Ga0209588_1002125 Ga0209588_10021255 152
593 3300027671 Ga0209588_1077971 Ga0209588_10779712 152
594 3300027717 Ga0209998_10141696 Ga0209998_101416962 152
595 3300027876 Ga0209974_10046506 Ga0209974_100465063 152
596 3300027907 Ga0207428_10000009 Ga0207428_10000009259 152
597 3300027907 Ga0207428_10000631 Ga0207428_1000063141 152
598 3300027907 Ga0207428_10109497 Ga0207428_101094972 152
599 3300027907 Ga0207428_10560977 Ga0207428_105609771 152
600 3300028379 Ga0268266_10873953 Ga0268266_108739532 152
601 3300028380 Ga0268265_10007375 Ga0268265_100073754 152
602 3300028380 Ga0268265_10067642 Ga0268265_100676424 152
603 3300028380 Ga0268265_10090858 Ga0268265_100908583 152
604 3300028380 Ga0268265_10177003 Ga0268265_101770031 152
605 3300028380 Ga0268265_10467559 Ga0268265_104675592 152
606 3300028380 Ga0268265_10945312 Ga0268265_109453122 152
607 3300028381 Ga0268264_10020679 Ga0268264_100206792 152
608 3300028381 Ga0268264_10030980 Ga0268264_100309803 152
609 3300028381 Ga0268264_10092992 Ga0268264_100929924 152
610 3300028381 Ga0268264_10260110 Ga0268264_102601102 152
611 3300028381 Ga0268264_10657248 Ga0268264_106572482 152
612 3300028381 Ga0268264_10710385 Ga0268264_107103852 152
613 3300028381 Ga0268264_11928651 Ga0268264_119286511 152
614 3300031241 Ga0265325_10005355 Ga0265325_100053552 152
615 3300031548 Ga0307408_100044097 Ga0307408_1000440975 152
616 3300031548 Ga0307408_100222053 Ga0307408_1002220532 152
617 3300031731 Ga0307405_10111668 Ga0307405_101116683 152
618 3300031731 Ga0307405_10273264 Ga0307405_102732642 152
619 3300031852 Ga0307410_11763437 Ga0307410_117634371 152
620 3300031901 Ga0307406_10078084 Ga0307406_100780842 152
621 3300032002 Ga0307416_100521610 Ga0307416_1005216102 152
622 3300032002 Ga0307416_102064962 Ga0307416_1020649621 152
623 3300032005 Ga0307411_10491308 Ga0307411_104913082 152
624 3300032005 Ga0307411_10961862 Ga0307411_109618622 152
625 3300032126 Ga0307415_100263008 Ga0307415_1002630082 152
626 3300032126 Ga0307415_101943541 Ga0307415_1019435411 152
627 3300034816 Ga0373930_0045200 Ga0373930_0045200_40_498 152
628 3300034817 Ga0373948_0022860 Ga0373948_0022860_481_939 152
629 3300034819 Ga0373958_0038403 Ga0373958_0038403_94_552 152
630 3300034820 Ga0373959_0011123 Ga0373959_0011123_709_1167 152
631 3300035086 Ga0373934_0263500 Ga0373934_0263500_127_585 152
632 3300035088 Ga0373940_0002057 Ga0373940_0002057_2822_3280 152
633 3300035088 Ga0373940_0022837 Ga0373940_0022837_1036_1494 152
634 3300035090 Ga0373949_0001137 Ga0373949_0001137_2993_3451 152
635 3300035090 Ga0373949_0154028 Ga0373949_0154028_147_605 152
636 3300035091 Ga0373951_0021372 Ga0373951_0021372_73_531 152
637 3300035092 Ga0373952_0051068 Ga0373952_0051068_280_738 152
638 3300035092 Ga0373952_0066762 Ga0373952_0066762_61_519 152
639 3300035112 Ga0373932_0114584 Ga0373932_0114584_382_840 152
640 3300035114 Ga0373939_0390273 Ga0373939_0390273_51_512 152
641 3300035115 Ga0373941_0124486 Ga0373941_0124486_432_890 152
642 3300035121 Ga0373960_0032851 Ga0373960_0032851_659_1117 152
643 3300035170 Ga0373943_0011173 Ga0373943_0011173_1073_1537 152
644 3300035207 Ga0373942_0057071 Ga0373942_0057071_554_1012 152
645 3300035207 Ga0373942_0080498 Ga0373942_0080498_88_546 152
646 3300035241 Ga0373961_0003927 Ga0373961_0003927_204_662 152
647 3300035241 Ga0373961_0076866 Ga0373961_0076866_383_841 152
648 3300035242 Ga0373962_0006756 Ga0373962_0006756_1971_2429 152
649 3300035242 Ga0373962_0011889 Ga0373962_0011889_1049_1507 152
650 3300035691 Ga0373931_0005358 Ga0373931_0005358_3740_4198 152
651 3300035691 Ga0373931_0009773 Ga0373931_0009773_2559_3017 152
652 3300035691 Ga0373931_0104028 Ga0373931_0104028_17_475 152
653 3300035691 Ga0373931_0315703 Ga0373931_0315703_42_503 152
654 3300035724 Ga0373933_0329719 Ga0373933_0329719_205_663 152
655 3300037312 Ga0395899_0005710 Ga0395899_0005710_4308_4766 152
656 3300037418 Ga0395900_0005301 Ga0395900_0005301_7431_7889 152
657 3300037466 Ga0395898_0007244 Ga0395898_0007244_5532_5990 152
658 3300037466 Ga0395898_1322176 Ga0395898_1322176_167_631 152
659 3300038443 Ga0395901_0137841 Ga0395901_0137841_1663_2121 152
660 3300038443 Ga0395901_0718524 Ga0395901_0718524_459_923 152
661 3300038443 Ga0395901_0915858 Ga0395901_0915858_223_681 152
662 3300039447 Ga0436361_0067535 Ga0436361_0067535_213_671 152
663 3300039450 Ga0436363_0822832 Ga0436363_0822832_35_496 152
664 3300039450 Ga0436363_1398976 Ga0436363_1398976_89_550 152
665 3300042005 Ga0439448_0020856 Ga0439448_0020856_769_1227 152
666 3300042012 Ga0439455_0025065 Ga0439455_0025065_140_598 152
667 3300042012 Ga0439455_0049398 Ga0439455_0049398_235_693 152
668 3300042144 Ga0450889_013854 Ga0450889_013854_217_675 152
669 3300042157 Ga0439458_0008415 Ga0439458_0008415_38_496 152
670 3300042438 Ga0439459_0024084 Ga0439459_0024084_321_779 152
671 3300042438 Ga0439459_0046145 Ga0439459_0046145_304_762 152
672 3300042461 Ga0439460_0077985 Ga0439460_0077985_519_977 152
673 3300042876 Ga0451577_0003313 Ga0451577_0003313_16916_17392 152
674 3300042876 Ga0451577_0054622 Ga0451577_0054622_1036_1494 152
675 3300042876 Ga0451577_0100573 Ga0451577_0100573_53_511 152
676 3300042876 Ga0451577_0182142 Ga0451577_0182142_678_1136 152
677 3300042876 Ga0451577_0510865 Ga0451577_0510865_103_561 152
678 3300044658 Ga0466972_0207976 Ga0466972_0207976_339_890 152
679 3300044673 Ga0453683_0008769 Ga0453683_0008769_5216_5674 152
680 3300044673 Ga0453683_0107187 Ga0453683_0107187_638_1114 152
681 3300044673 Ga0453683_0137695 Ga0453683_0137695_306_767 152
682 3300044693 Ga0466961_0608984 Ga0466961_0608984_34_498 152
683 3300044712 Ga0453684_0023688 Ga0453684_0023688_7890_8348 152
684 3300044712 Ga0453684_0030957 Ga0453684_0030957_3088_3546 152
685 3300044712 Ga0453684_0082959 Ga0453684_0082959_1600_2076 152
686 3300045051 Ga0451576_0006637 Ga0451576_0006637_12329_12805 152
687 3300045051 Ga0451576_0022946 Ga0451576_0022946_2313_2771 152
688 3300045051 Ga0451576_0024715 Ga0451576_0024715_2479_2937 152
689 3300045051 Ga0451576_0029219 Ga0451576_0029219_2689_3147 152
690 3300045051 Ga0451576_0051221 Ga0451576_0051221_2315_2773 152
691 3300045051 Ga0451576_0678385 Ga0451576_0678385_13_471 152
692 3300045976 Ga0466967_0536850 Ga0466967_0536850_440_898 152
693 3300045976 Ga0466967_1580040 Ga0466967_1580040_88_546 152
694 3300045976 Ga0466967_2054182 Ga0466967_2054182_43_507 152
695 3300046455 Ga0495603_0538655 Ga0495603_0538655_78_542 152
696 3300046462 Ga0495651_0537884 Ga0495651_0537884_13_474 152
697 3300046472 Ga0495580_0001861 Ga0495580_0001861_15628_16086 152
698 3300046472 Ga0495580_0472434 Ga0495580_0472434_58_516 152
699 3300046491 Ga0495584_0669906 Ga0495584_0669906_51_509 152
700 3300046491 Ga0495584_0674244 Ga0495584_0674244_30_488 152
701 3300046499 Ga0495594_0091689 Ga0495594_0091689_794_1258 152
702 3300046501 Ga0495607_0335206 Ga0495607_0335206_153_611 152
703 3300046516 Ga0495628_0289371 Ga0495628_0289371_133_594 152
704 3300046528 Ga0495642_0098964 Ga0495642_0098964_280_744 152
705 3300046528 Ga0495642_0528914 Ga0495642_0528914_22_480 152
706 3300046529 Ga0495652_0554207 Ga0495652_0554207_36_497 152
707 3300046615 Ga0495656_0350537 Ga0495656_0350537_113_577 152
708 3300046678 Ga0495599_0178882 Ga0495599_0178882_773_1234 152
709 3300046679 Ga0495623_0102012 Ga0495623_0102012_1180_1641 152
710 3300046680 Ga0495646_0522226 Ga0495646_0522226_44_505 152
711 3300046684 Ga0495669_0099714 Ga0495669_0099714_631_1095 152
712 3300046684 Ga0495669_0637634 Ga0495669_0637634_21_479 152
713 3300046689 Ga0495613_0474799 Ga0495613_0474799_56_520 152
714 3300047318 Ga0495636_0592228 Ga0495636_0592228_46_504 152
715 3300047319 Ga0495674_1209400 Ga0495674_1209400_21_482 152
716 3300048088 Ga0495602_0056861 Ga0495602_0056861_862_1323 152
717 3300048088 Ga0495602_0190760 Ga0495602_0190760_187_648 152
718 3300048905 Ga0496102_0030748 Ga0496102_0030748_3029_3487 152
719 3300048905 Ga0496102_0100319 Ga0496102_0100319_1656_2114 152
720 3300048907 Ga0496104_0307557 Ga0496104_0307557_657_1115 152
721 3300048909 Ga0496106_0066708 Ga0496106_0066708_889_1347 152
722 3300048909 Ga0496106_0165429 Ga0496106_0165429_593_1051 152
723 3300048910 Ga0496107_0155165 Ga0496107_0155165_433_891 152
724 3300048912 Ga0496109_0350859 Ga0496109_0350859_73_531 152
725 3300048913 Ga0496110_0166215 Ga0496110_0166215_593_1051 152
726 3300048914 Ga0496111_0188069 Ga0496111_0188069_351_809 152
727 3300048915 Ga0496112_0037103 Ga0496112_0037103_2673_3131 152
728 3300048915 Ga0496112_0812371 Ga0496112_0812371_214_675 152
729 3300048916 Ga0496113_0344742 Ga0496113_0344742_347_805 152
730 3300049570 Ga0501033_0060859 Ga0501033_0060859_82_540 152
731 3300049571 Ga0501034_0430056 Ga0501034_0430056_388_873 152
732 3300049572 Ga0501036_0497695 Ga0501036_0497695_256_714 152
733 3300049572 Ga0501036_0949161 Ga0501036_0949161_118_576 152
734 3300049572 Ga0501036_1038556 Ga0501036_1038556_132_635 152
735 3300049573 Ga0501037_0167325 Ga0501037_0167325_838_1296 152
736 3300049573 Ga0501037_0970061 Ga0501037_0970061_36_539 152
737 3300049574 Ga0501038_0394070 Ga0501038_0394070_188_646 152
738 3300049575 Ga0501039_0073727 Ga0501039_0073727_727_1185 152
739 3300049576 Ga0501040_0005074 Ga0501040_0005074_7803_8261 152
740 3300049576 Ga0501040_0050315 Ga0501040_0050315_335_793 152
741 3300049576 Ga0501040_0169625 Ga0501040_0169625_1020_1478 152
742 3300049576 Ga0501040_1098407 Ga0501040_1098407_91_549 152
743 3300049577 Ga0501041_0059321 Ga0501041_0059321_1695_2153 152
744 3300049577 Ga0501041_0200888 Ga0501041_0200888_215_673 152
745 3300049577 Ga0501041_0318678 Ga0501041_0318678_311_814 152
746 3300049577 Ga0501041_0712555 Ga0501041_0712555_138_596 152
747 3300049578 Ga0501042_0135706 Ga0501042_0135706_426_884 152
748 3300049578 Ga0501042_0531805 Ga0501042_0531805_274_732 152
749 3300049578 Ga0501042_1023688 Ga0501042_1023688_121_579 152
750 3300049579 Ga0501043_0361466 Ga0501043_0361466_444_902 152
751 3300049579 Ga0501043_0738110 Ga0501043_0738110_180_638 152
752 3300049579 Ga0501043_0814236 Ga0501043_0814236_106_570 152
753 3300049579 Ga0501043_0940766 Ga0501043_0940766_141_599 152
754 3300049580 Ga0501046_0090245 Ga0501046_0090245_805_1263 152
755 3300049580 Ga0501046_0486811 Ga0501046_0486811_68_529 152
756 3300049582 Ga0501048_0078831 Ga0501048_0078831_132_590 152
757 3300049582 Ga0501048_0556054 Ga0501048_0556054_147_605 152
758 3300049583 Ga0501067_0018104 Ga0501067_0018104_3358_3816 152
759 3300049583 Ga0501067_0065519 Ga0501067_0065519_1462_1920 152
760 3300049584 Ga0501068_0029632 Ga0501068_0029632_53_511 152
761 3300049584 Ga0501068_0077246 Ga0501068_0077246_968_1426 152
762 3300049584 Ga0501068_0195644 Ga0501068_0195644_94_552 152
763 3300049584 Ga0501068_0442146 Ga0501068_0442146_208_666 152
764 3300049585 Ga0501069_0030340 Ga0501069_0030340_1817_2275 152
765 3300049585 Ga0501069_0129532 Ga0501069_0129532_18_476 152
766 3300049585 Ga0501069_0475263 Ga0501069_0475263_231_689 152
767 3300049587 Ga0501071_0074452 Ga0501071_0074452_1800_2258 152
768 3300049587 Ga0501071_0128859 Ga0501071_0128859_989_1447 152
769 3300049587 Ga0501071_0302888 Ga0501071_0302888_498_959 152
770 3300049588 Ga0501072_0136345 Ga0501072_0136345_479_943 152
771 3300049588 Ga0501072_0181917 Ga0501072_0181917_530_1018 152
772 3300049588 Ga0501072_0206515 Ga0501072_0206515_193_651 152
773 3300049588 Ga0501072_0935520 Ga0501072_0935520_35_499 152
774 3300049588 Ga0501072_1383178 Ga0501072_1383178_22_480 152
775 3300049590 Ga0501074_0219130 Ga0501074_0219130_829_1287 152
776 3300049590 Ga0501074_0381183 Ga0501074_0381183_206_664 152
777 3300049590 Ga0501074_0439368 Ga0501074_0439368_97_555 152
778 3300049590 Ga0501074_0921760 Ga0501074_0921760_124_582 152
779 3300049591 Ga0501075_0039504 Ga0501075_0039504_521_979 152
780 3300049591 Ga0501075_0050064 Ga0501075_0050064_1035_1499 152
781 3300049591 Ga0501075_0103517 Ga0501075_0103517_1305_1763 152
782 3300049591 Ga0501075_0108776 Ga0501075_0108776_1348_1806 152
783 3300049591 Ga0501075_0143600 Ga0501075_0143600_45_503 152
784 3300049591 Ga0501075_0178358 Ga0501075_0178358_861_1319 152
785 3300049591 Ga0501075_0181089 Ga0501075_0181089_830_1369 152
786 3300049591 Ga0501075_0324184 Ga0501075_0324184_104_562 152
787 3300049591 Ga0501075_0427783 Ga0501075_0427783_132_590 152
788 3300049591 Ga0501075_0595065 Ga0501075_0595065_233_700 152
789 3300049591 Ga0501075_0630076 Ga0501075_0630076_210_689 152
790 3300049592 Ga0501076_0016029 Ga0501076_0016029_4912_5370 152
791 3300049592 Ga0501076_0019510 Ga0501076_0019510_2958_3422 152
792 3300049592 Ga0501076_0178291 Ga0501076_0178291_388_846 152
793 3300049592 Ga0501076_0986157 Ga0501076_0986157_92_553 152
794 3300049593 Ga0501077_0020298 Ga0501077_0020298_3169_3627 152
795 3300049593 Ga0501077_0023045 Ga0501077_0023045_419_877 152
796 3300049593 Ga0501077_0057806 Ga0501077_0057806_727_1185 152
797 3300049593 Ga0501077_0526450 Ga0501077_0526450_132_590 152
798 3300049593 Ga0501077_0585850 Ga0501077_0585850_27_485 152
799 3300049593 Ga0501077_0800068 Ga0501077_0800068_12_470 152
800 3300049669 Ga0501235_180068 Ga0501235_180068_22_486 152
801 3300049670 Ga0501236_032159 Ga0501236_032159_173_631 152
802 3300049741 Ga0501079_0002847 Ga0501079_0002847_11046_11504 152
803 3300049741 Ga0501079_0035747 Ga0501079_0035747_2530_2988 152
804 3300049741 Ga0501079_0083660 Ga0501079_0083660_277_735 152
805 3300049741 Ga0501079_0186289 Ga0501079_0186289_1151_1609 152
806 3300049741 Ga0501079_0256263 Ga0501079_0256263_276_740 152
807 3300049741 Ga0501079_0344740 Ga0501079_0344740_274_813 152
808 3300049741 Ga0501079_0404663 Ga0501079_0404663_351_809 152
809 3300049741 Ga0501079_1232217 Ga0501079_1232217_105_563 152
810 3300049742 Ga0501080_0074798 Ga0501080_0074798_2164_2622 152
811 3300049742 Ga0501080_0364878 Ga0501080_0364878_173_637 152
812 3300049742 Ga0501080_0660533 Ga0501080_0660533_335_793 152
813 3300049742 Ga0501080_0957166 Ga0501080_0957166_211_669 152
814 3300049743 Ga0501081_0003659 Ga0501081_0003659_7058_7516 152
815 3300049743 Ga0501081_0054040 Ga0501081_0054040_1395_1853 152
816 3300049743 Ga0501081_0056281 Ga0501081_0056281_863_1321 152
817 3300049743 Ga0501081_0094403 Ga0501081_0094403_1493_1951 152
818 3300049743 Ga0501081_0173265 Ga0501081_0173265_605_1069 152
819 3300049743 Ga0501081_0296014 Ga0501081_0296014_552_1010 152
820 3300049743 Ga0501081_0644455 Ga0501081_0644455_260_721 152
821 3300049743 Ga0501081_1271718 Ga0501081_1271718_58_516 152
822 3300049743 Ga0501081_1351810 Ga0501081_1351810_13_477 152
823 3300049744 Ga0501083_0506763 Ga0501083_0506763_116_574 152
824 3300049822 Ga0501035_0503081 Ga0501035_0503081_325_783 152
825 3300049824 Ga0501045_0075038 Ga0501045_0075038_1745_2203 152
826 3300049824 Ga0501045_0182607 Ga0501045_0182607_484_942 152
827 3300049824 Ga0501045_0279710 Ga0501045_0279710_674_1213 152
828 3300049824 Ga0501045_0408178 Ga0501045_0408178_213_671 152
829 3300049824 Ga0501045_0536946 Ga0501045_0536946_387_851 152
830 3300049824 Ga0501045_0762198 Ga0501045_0762198_127_597 152
831 3300049824 Ga0501045_1002928 Ga0501045_1002928_128_586 152
832 3300050507 nmdc:mga05p37_100067_c1 nmdc:mga05p37_100067_c1_282_740 152
833 3300050507 nmdc:mga05p37_109212_c1 nmdc:mga05p37_109212_c1_2791_3249 152
834 3300050507 nmdc:mga05p37_110969_c2 nmdc:mga05p37_110969_c2_1512_1973 152
835 3300050507 nmdc:mga05p37_11843_c1 nmdc:mga05p37_11843_c1_6765_7223 152
836 3300050507 nmdc:mga05p37_168904_c1 nmdc:mga05p37_168904_c1_1964_2422 152
837 3300050507 nmdc:mga05p37_17944_c1 nmdc:mga05p37_17944_c1_5976_6434 152
838 3300050507 nmdc:mga05p37_219498_c1 nmdc:mga05p37_219498_c1_487_951 152
839 3300050507 nmdc:mga05p37_251625_c1 nmdc:mga05p37_251625_c1_1371_1835 152
840 3300050507 nmdc:mga05p37_358580_c1 nmdc:mga05p37_358580_c1_698_1156 152
841 3300050507 nmdc:mga05p37_3637_c1 nmdc:mga05p37_3637_c1_14937_15395 152
842 3300050507 nmdc:mga05p37_43265_c1 nmdc:mga05p37_43265_c1_301_789 152
843 3300050507 nmdc:mga05p37_434265_c1 nmdc:mga05p37_434265_c1_130_588 152
844 3300050507 nmdc:mga05p37_449532_c1 nmdc:mga05p37_449532_c1_157_615 152
845 3300050507 nmdc:mga05p37_56510_c1 nmdc:mga05p37_56510_c1_1674_2132 152
846 3300050507 nmdc:mga05p37_634435_c1 nmdc:mga05p37_634435_c1_547_1005 152
847 3300050507 nmdc:mga05p37_72141_c1 nmdc:mga05p37_72141_c1_771_1229 152
848 3300050507 nmdc:mga05p37_8064_c1 nmdc:mga05p37_8064_c1_8241_8699 152
849 3300050507 nmdc:mga05p37_8089_c1 nmdc:mga05p37_8089_c1_8437_8895 152
850 3300050508 nmdc:mga09592_108170_c1 nmdc:mga09592_108170_c1_1170_1628 152
851 3300050508 nmdc:mga09592_1470980_c1 nmdc:mga09592_1470980_c1_81_539 152
852 3300050508 nmdc:mga09592_153742_c1 nmdc:mga09592_153742_c1_219_686 152
853 3300050508 nmdc:mga09592_254165_c1 nmdc:mga09592_254165_c1_432_890 152
854 3300050508 nmdc:mga09592_26657_c1 nmdc:mga09592_26657_c1_478_936 152
855 3300050508 nmdc:mga09592_302111_c1 nmdc:mga09592_302111_c1_158_616 152
856 3300050508 nmdc:mga09592_313007_c1 nmdc:mga09592_313007_c1_521_988 152
857 3300050508 nmdc:mga09592_333651_c1 nmdc:mga09592_333651_c1_734_1192 152
858 3300050508 nmdc:mga09592_417946_c1 nmdc:mga09592_417946_c1_38_496 152
859 3300050508 nmdc:mga09592_4377_c1 nmdc:mga09592_4377_c1_6906_7364 152
860 3300050508 nmdc:mga09592_7564_c1 nmdc:mga09592_7564_c1_88_546 152
861 3300050508 nmdc:mga09592_780320_c1 nmdc:mga09592_780320_c1_260_724 152
862 3300050508 nmdc:mga09592_818_c1 nmdc:mga09592_818_c1_8146_8604 152
863 3300050508 nmdc:mga09592_82381_c1 nmdc:mga09592_82381_c1_626_1084 152
864 3300050508 nmdc:mga09592_95033_c1 nmdc:mga09592_95033_c1_405_863 152
865 3300050509 nmdc:mga0qj67_18174_c1 nmdc:mga0qj67_18174_c1_883_1341 152
866 3300050509 nmdc:mga0qj67_247092_c1 nmdc:mga0qj67_247092_c1_942_1400 152
867 3300050509 nmdc:mga0qj67_316281_c1 nmdc:mga0qj67_316281_c1_251_718 152
868 3300050509 nmdc:mga0qj67_392533_c1 nmdc:mga0qj67_392533_c1_262_729 152
869 3300050509 nmdc:mga0qj67_39748_c1 nmdc:mga0qj67_39748_c1_334_792 152
870 3300050509 nmdc:mga0qj67_638740_c1 nmdc:mga0qj67_638740_c1_208_666 152
871 3300050509 nmdc:mga0qj67_67554_c1 nmdc:mga0qj67_67554_c1_499_975 152
872 3300050509 nmdc:mga0qj67_68714_c1 nmdc:mga0qj67_68714_c1_935_1393 152
873 3300050509 nmdc:mga0qj67_730_c1 nmdc:mga0qj67_730_c1_6067_6525 152
874 3300050509 nmdc:mga0qj67_93875_c1 nmdc:mga0qj67_93875_c1_915_1373 152
875 3300050509 nmdc:mga0qj67_9771_c1 nmdc:mga0qj67_9771_c1_6636_7094 152
876 3300050510 nmdc:mga06r32_1170494_c1 nmdc:mga06r32_1170494_c1_189_647 152
877 3300050510 nmdc:mga06r32_117512_c1 nmdc:mga06r32_117512_c1_2118_2576 152
878 3300050510 nmdc:mga06r32_128690_c1 nmdc:mga06r32_128690_c1_537_995 152
879 3300050510 nmdc:mga06r32_12991_c1 nmdc:mga06r32_12991_c1_4190_4648 152
880 3300050510 nmdc:mga06r32_14279_c1 nmdc:mga06r32_14279_c1_510_968 152
881 3300050510 nmdc:mga06r32_2111_c1 nmdc:mga06r32_2111_c1_15973_16449 152
882 3300050510 nmdc:mga06r32_237426_c1 nmdc:mga06r32_237426_c1_842_1300 152
883 3300050510 nmdc:mga06r32_326076_c1 nmdc:mga06r32_326076_c1_142_600 152
884 3300050510 nmdc:mga06r32_399277_c1 nmdc:mga06r32_399277_c1_390_848 152
885 3300050510 nmdc:mga06r32_41550_c1 nmdc:mga06r32_41550_c1_1453_1911 152
886 3300050510 nmdc:mga06r32_454447_c1 nmdc:mga06r32_454447_c1_82_540 152
887 3300050510 nmdc:mga06r32_4632_c1 nmdc:mga06r32_4632_c1_6053_6511 152
888 3300050510 nmdc:mga06r32_484863_c1 nmdc:mga06r32_484863_c1_219_683 152
889 3300050510 nmdc:mga06r32_786815_c1 nmdc:mga06r32_786815_c1_408_896 152
890 3300050510 nmdc:mga06r32_828564_c1 nmdc:mga06r32_828564_c1_98_556 152
891 3300050511 nmdc:mga08y16_1317_c1 nmdc:mga08y16_1317_c1_22981_23457 152
892 3300050511 nmdc:mga08y16_162187_c1 nmdc:mga08y16_162187_c1_1351_1815 152
893 3300050511 nmdc:mga08y16_171_c1 nmdc:mga08y16_171_c1_19082_19540 152
894 3300050511 nmdc:mga08y16_1739795_c1 nmdc:mga08y16_1739795_c1_65_523 152
895 3300050511 nmdc:mga08y16_428483_c1 nmdc:mga08y16_428483_c1_744_1202 152
896 3300050511 nmdc:mga08y16_7918_c1 nmdc:mga08y16_7918_c1_4053_4511 152
897 3300050512 nmdc:mga0n895_10084_c1 nmdc:mga0n895_10084_c1_2463_2921 152
898 3300050512 nmdc:mga0n895_152601_c1 nmdc:mga0n895_152601_c1_1239_1697 152
899 3300050512 nmdc:mga0n895_17404_c1 nmdc:mga0n895_17404_c1_2168_2641 152
900 3300050512 nmdc:mga0n895_19948_c1 nmdc:mga0n895_19948_c1_1887_2345 152
901 3300050512 nmdc:mga0n895_334791_c1 nmdc:mga0n895_334791_c1_141_599 152
902 3300050512 nmdc:mga0n895_43883_c2 nmdc:mga0n895_43883_c2_1945_2403 152
903 3300050512 nmdc:mga0n895_4527_c1 nmdc:mga0n895_4527_c1_7815_8273 152
904 3300050512 nmdc:mga0n895_47458_c1 nmdc:mga0n895_47458_c1_2115_2573 152
905 3300050512 nmdc:mga0n895_51094_c1 nmdc:mga0n895_51094_c1_1206_1664 152
906 3300050512 nmdc:mga0n895_544513_c1 nmdc:mga0n895_544513_c1_19_477 152
907 3300050512 nmdc:mga0n895_709893_c1 nmdc:mga0n895_709893_c1_20_478 152
908 3300050512 nmdc:mga0n895_861910_c1 nmdc:mga0n895_861910_c1_385_846 152
909 3300050513 nmdc:mga0rr50_1027680_c1 nmdc:mga0rr50_1027680_c1_114_587 152
910 3300050513 nmdc:mga0rr50_1280_c1 nmdc:mga0rr50_1280_c1_8007_8465 152
911 3300050513 nmdc:mga0rr50_139984_c1 nmdc:mga0rr50_139984_c1_652_1110 152
912 3300050513 nmdc:mga0rr50_1590746_c1 nmdc:mga0rr50_1590746_c1_30_488 152
913 3300050513 nmdc:mga0rr50_1684107_c1 nmdc:mga0rr50_1684107_c1_58_516 152
914 3300050513 nmdc:mga0rr50_26347_c1 nmdc:mga0rr50_26347_c1_2392_2850 152
915 3300050513 nmdc:mga0rr50_32838_c1 nmdc:mga0rr50_32838_c1_488_946 152
916 3300050513 nmdc:mga0rr50_5599_c1 nmdc:mga0rr50_5599_c1_6387_6845 152
917 3300050513 nmdc:mga0rr50_91452_c1 nmdc:mga0rr50_91452_c1_785_1243 152
918 3300050514 nmdc:mga08x19_45966_c1 nmdc:mga08x19_45966_c1_20_478 152
919 3300050514 nmdc:mga08x19_5649_c1 nmdc:mga08x19_5649_c1_266_724 152
920 3300050514 nmdc:mga08x19_601847_c1 nmdc:mga08x19_601847_c1_264_722 152
921 3300050514 nmdc:mga08x19_76845_c1 nmdc:mga08x19_76845_c1_439_897 152
922 3300050514 nmdc:mga08x19_9252_c1 nmdc:mga08x19_9252_c1_317_805 152
923 3300050515 nmdc:mga0a205_111571_c1 nmdc:mga0a205_111571_c1_1006_1464 152
924 3300050515 nmdc:mga0a205_120630_c1 nmdc:mga0a205_120630_c1_447_905 152
925 3300050515 nmdc:mga0a205_144582_c1 nmdc:mga0a205_144582_c1_1526_1984 152
926 3300050515 nmdc:mga0a205_178729_c1 nmdc:mga0a205_178729_c1_1219_1677 152
927 3300050515 nmdc:mga0a205_189823_c1 nmdc:mga0a205_189823_c1_648_1106 152
928 3300050515 nmdc:mga0a205_19596_c1 nmdc:mga0a205_19596_c1_2868_3326 152
929 3300050515 nmdc:mga0a205_24698_c1 nmdc:mga0a205_24698_c1_3640_4128 152
930 3300050515 nmdc:mga0a205_4101_c1 nmdc:mga0a205_4101_c1_11244_11702 152
931 3300050515 nmdc:mga0a205_480572_c1 nmdc:mga0a205_480572_c1_56_514 152
932 3300050515 nmdc:mga0a205_49683_c1 nmdc:mga0a205_49683_c1_994_1452 152
933 3300050515 nmdc:mga0a205_502462_c1 nmdc:mga0a205_502462_c1_534_992 152
934 3300050515 nmdc:mga0a205_64423_c1 nmdc:mga0a205_64423_c1_1263_1736 152
935 3300050515 nmdc:mga0a205_72713_c1 nmdc:mga0a205_72713_c1_2337_2795 152
936 3300050515 nmdc:mga0a205_7301_c1 nmdc:mga0a205_7301_c1_4604_5080 152
937 3300050515 nmdc:mga0a205_796_c1 nmdc:mga0a205_796_c1_10100_10558 152
938 3300050515 nmdc:mga0a205_9201_c1 nmdc:mga0a205_9201_c1_3993_4469 152
939 3300053085 Ga0495619_0430549 Ga0495619_0430549_35_499 152
940 3300054114 Ga0501084_0007316 Ga0501084_0007316_3984_4442 152
941 3300054114 Ga0501084_0019852 Ga0501084_0019852_1041_1499 152
942 3300054114 Ga0501084_0039408 Ga0501084_0039408_3334_3792 152
943 3300054114 Ga0501084_0111022 Ga0501084_0111022_940_1398 152
944 3300054114 Ga0501084_0117599 Ga0501084_0117599_518_1006 152
945 3300054114 Ga0501084_0139932 Ga0501084_0139932_161_619 152
946 3300054114 Ga0501084_0522945 Ga0501084_0522945_460_918 152
947 3300054114 Ga0501084_0843721 Ga0501084_0843721_95_553 152
948 3300059424 Ga0590075_016660 Ga0590075_016660_733_1191 152
949 3300059424 Ga0590075_024665 Ga0590075_024665_12_473 152
950 3300060353 Ga0501082_0070725 Ga0501082_0070725_1357_1815 152
951 3300060353 Ga0501082_0083559 Ga0501082_0083559_830_1318 152
952 3300060353 Ga0501082_0090616 Ga0501082_0090616_485_943 152
953 3300060353 Ga0501082_0168589 Ga0501082_0168589_613_1071 152
954 3300060353 Ga0501082_0222579 Ga0501082_0222579_814_1272 152
955 3300060353 Ga0501082_0483426 Ga0501082_0483426_199_663 152
956 3300060353 Ga0501082_0536677 Ga0501082_0536677_538_996 152
957 3300060353 Ga0501082_0566207 Ga0501082_0566207_402_860 152
958 3300060353 Ga0501082_1090843 Ga0501082_1090843_81_557 152
959 3300061734 Ga0530510_0029602 Ga0530510_0029602_676_1146 152
960 3300061734 Ga0530510_0064878 Ga0530510_0064878_885_1343 152
961 3300061734 Ga0530510_0091456 Ga0530510_0091456_1629_2087 152
962 3300061734 Ga0530510_0312353 Ga0530510_0312353_482_946 152
963 3300061734 Ga0530510_0529217 Ga0530510_0529217_252_710 152
964 3300061734 Ga0530510_0572390 Ga0530510_0572390_316_774 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

4

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7984 1 150
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7891 1 150
7pds-assembly1.cif.gz_D the structure of prirep1 with dsdna 0.5298 118 150
5imq-assembly1.cif.gz_S structure of ribosome bound to cofactor at 3.8 angstrom resolution 0.4929 27 113
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4926 3 90
ID Description Score Start End Superfamily
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9341 4 94 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9212 4 94 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9041 1 94 1.10.1510.10
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.8987 5 94 1.10.1510.10
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.8956 4 94 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A7V2IAW8-F1-model_v4 GatB/YqeY domain-containing protein 0.964 2 152 GO:0016884
AF-A0A7S1UDL8-F1-model_v4 Asn/Gln amidotransferase domain-containing protein 0.955 1 150 GO:0016884
AF-A0A7V2IAW8-F1-model_v4 GatB/YqeY domain-containing protein 0.9517 2 152 GO:0016884
AF-A0A7V4G0Y2-F1-model_v4 GatB/YqeY domain-containing protein 0.9469 1 151 GO:0016884
AF-A0A7T9G411-F1-model_v4 deleted 0.9469 3 151

Feature Viewer

pLDDT pTM Quality
91.39 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map