F486935

General Info

Members Datasets Scaffolds Average Seq Length
964 473 1929 147

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10024739|Ga0111539_100247395
Length 147
Sequence MPSTIRLHRVLKTTPDRLYRAFLDPEAMVKWLPPHGFTGKVHHMDARVGGSYKMSFKNFSTGNGHSFGGEYLELVPNERIVHTDKFDAGLVGTMKVTIQIRKVLVGTELNVTQEGVPDAIPAEACYLGWGESLELLAKLVEPEIADQ

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
126 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
196 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
207 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
208 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
223 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
251 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
252 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
253 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
256 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
257 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
258 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
259 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
260 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
261 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
264 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
265 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
266 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
300 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
383 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
384 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
390 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
391 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
392 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
393 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
394 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
395 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
396 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
406 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
407 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
411 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
412 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
413 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
414 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
415 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
416 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
417 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
418 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
419 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
420 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
421 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
422 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
423 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
424 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
425 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
426 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
427 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
428 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
429 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
430 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
431 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
432 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
433 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
434 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
435 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
436 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
437 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
438 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
439 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
440 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
441 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
442 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
443 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
444 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
445 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
446 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
447 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
448 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
449 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
450 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
451 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
473 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 2.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.77
Nodule 0.41
Rhizoplane 3.22
Rhizosphere 74.17
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10024739 3300009094 Bacteria 7364
2 JGI24739J22299_10222828 3300001989 Bacteria 553
3 JGI25151J46595_10000306 3300003187 Bacteria 53632
4 JGI25165J46597_1010796 3300003214 Bacteria 1321
5 JGI25153J46596_10003655 3300003215 Bacteria 8519
6 JGI25153J46596_10091401 3300003215 Bacteria 735
7 rootH1_10008424 3300003316 Bacteria 1420
8 rootH1_10008424 3300003323 Bacteria 4048
9 rootL2_10075568 3300003322 Bacteria 4457
10 rootH1_10012499 3300003323 Bacteria 7219
11 rootH1_10297523 3300003323 Bacteria 2544
12 JGI25160J50197_1001723 3300003354 Bacteria 10607
13 JGI25161J50226_1004749 3300003374 Bacteria 2785
14 Ga0055526_1001326 3300003771 Bacteria 17720
15 Ga0055526_1031321 3300003771 Bacteria 1528
16 Ga0055524_1000395 3300003775 Bacteria 37422
17 Ga0055524_1017200 3300003775 Bacteria 2559
18 Ga0055524_1020409 3300003775 Bacteria 2232
19 Ga0055528_1000044 3300003790 Bacteria 102325
20 Ga0055528_1000474 3300003790 Bacteria 32088
21 Ga0055528_1002042 3300003790 Bacteria 11291
22 Ga0055528_1010751 3300003790 Bacteria 3695
23 Ga0055540_1000109 3300003792 Bacteria 89131
24 Ga0055540_1041871 3300003792 Bacteria 984
25 Ga0055531_10032240 3300003794 Bacteria 1716
26 Ga0058692_1021833 3300003856 Bacteria 1324
27 Ga0055543_1001847 3300004625 Bacteria 7734
28 Ga0055543_1005224 3300004625 Bacteria 3356
29 Ga0065165_1001971 3300005262 Bacteria 19399
30 Ga0065165_1006220 3300005262 Bacteria 6359
31 Ga0065165_1152885 3300005262 Bacteria 537
32 Ga0065715_10559015 3300005293 Bacteria 735
33 Ga0065707_10123227 3300005295 Bacteria 2070
34 Ga0070658_10049053 3300005327 Bacteria 3420
35 Ga0070658_10230789 3300005327 Bacteria 1567
36 Ga0070658_10266520 3300005327 Bacteria 1456
37 Ga0070683_101093607 3300005329 Bacteria 766
38 Ga0070670_100247295 3300005331 Bacteria 1553
39 Ga0070670_101874559 3300005331 Bacteria 552
40 Ga0070677_10645172 3300005333 Bacteria 591
41 Ga0070666_11254469 3300005335 Bacteria 552
42 Ga0070680_100062019 3300005336 Bacteria 3061
43 Ga0070680_100086233 3300005336 Bacteria 2595
44 Ga0070680_100342211 3300005336 Bacteria 1271
45 Ga0070682_100232809 3300005337 Bacteria 1318
46 Ga0068868_100011174 3300005338 Bacteria 6537
47 Ga0068868_101042872 3300005338 Bacteria 750
48 Ga0070660_100453365 3300005339 Bacteria 1064
49 Ga0070660_100495482 3300005339 Bacteria 1016
50 Ga0070689_101021739 3300005340 Bacteria 736
51 Ga0070691_10018885 3300005341 Bacteria 3178
52 Ga0070692_10024986 3300005345 Bacteria 2941
53 Ga0070692_10295037 3300005345 Bacteria 988
54 Ga0070668_100017791 3300005347 Bacteria 5330
55 Ga0070668_100044744 3300005347 Bacteria 3396
56 Ga0070668_101334460 3300005347 Bacteria 653
57 Ga0070669_100004210 3300005353 Bacteria 10406
58 Ga0070669_100221885 3300005353 Bacteria 1495
59 Ga0070675_100174229 3300005354 Bacteria 1857
60 Ga0070659_100453922 3300005366 Bacteria 1088
61 Ga0070659_100798095 3300005366 Bacteria 821
62 Ga0070667_100512808 3300005367 Bacteria 1100
63 Ga0070709_10790954 3300005434 Bacteria 744
64 Ga0070709_10821428 3300005434 Bacteria 731
65 Ga0070714_100134069 3300005435 Bacteria 2216
66 Ga0070714_101399264 3300005435 Bacteria 683
67 Ga0070713_100471370 3300005436 Bacteria 1182
68 Ga0070713_100866147 3300005436 Bacteria 868
69 Ga0070710_10477657 3300005437 Bacteria 849
70 Ga0070711_100218660 3300005439 Bacteria 1479
71 Ga0070711_100656886 3300005439 Bacteria 880
72 Ga0070711_101110064 3300005439 Bacteria 682
73 Ga0070700_100002123 3300005441 Bacteria 10059
74 Ga0070694_100472001 3300005444 Bacteria 994
75 Ga0070663_100470946 3300005455 Bacteria 1038
76 Ga0070663_100967050 3300005455 Bacteria 739
77 Ga0070663_100992318 3300005455 Bacteria 730
78 Ga0070662_100153924 3300005457 Bacteria 1793
79 Ga0070681_10032753 3300005458 Bacteria 5218
80 Ga0070681_10051730 3300005458 Bacteria 4097
81 Ga0070681_10134027 3300005458 Bacteria 2408
82 Ga0070681_10655035 3300005458 Bacteria 965
83 Ga0068867_100002614 3300005459 Bacteria 12702
84 Ga0070707_100598920 3300005468 Bacteria 1065
85 Ga0070698_100186202 3300005471 Bacteria 2014
86 Ga0070699_100142817 3300005518 Bacteria 2115
87 Ga0070679_100000922 3300005530 Bacteria 25584
88 Ga0070679_100046080 3300005530 Bacteria 4345
89 Ga0070679_100139958 3300005530 Bacteria 2400
90 Ga0070679_100651135 3300005530 Bacteria 996
91 Ga0068853_100001311 3300005539 Bacteria 17870
92 Ga0068853_100287048 3300005539 Bacteria 1518
93 Ga0070672_100934225 3300005543 Bacteria 767
94 Ga0070695_100677987 3300005545 Bacteria 816
95 Ga0070696_100010491 3300005546 Bacteria 6209
96 Ga0070696_100270041 3300005546 Bacteria 1293
97 Ga0070665_100007168 3300005548 Bacteria 11336
98 Ga0070665_100244791 3300005548 Bacteria 1794
99 Ga0070665_100281938 3300005548 Bacteria 1664
100 Ga0070665_100744845 3300005548 Bacteria 993
101 Ga0068855_100000075 3300005563 Bacteria 119094
102 Ga0068855_100087438 3300005563 Bacteria 3602
103 Ga0068854_100118739 3300005578 Bacteria 2004
104 Ga0068854_100352397 3300005578 Bacteria 1205
105 Ga0068856_100262132 3300005614 Bacteria 1744
106 Ga0068856_100359271 3300005614 Bacteria 1475
107 Ga0068856_100361940 3300005614 Bacteria 1469
108 Ga0068856_100980643 3300005614 Bacteria 863
109 Ga0068856_102148820 3300005614 Bacteria 568
110 Ga0070702_100300147 3300005615 Bacteria 1111
111 Ga0068859_100158131 3300005617 Bacteria 2344
112 Ga0068859_102196711 3300005617 Bacteria 609
113 Ga0068861_100004297 3300005719 Bacteria 9557
114 Ga0068861_100008010 3300005719 Bacteria 7268
115 Ga0068861_100136760 3300005719 Bacteria 1995
116 Ga0068870_10101624 3300005840 Bacteria 1626
117 Ga0068858_100175475 3300005842 Bacteria 2022
118 Ga0068858_100436414 3300005842 Bacteria 1261
119 Ga0068860_100471721 3300005843 Bacteria 1250
120 Ga0068860_101629810 3300005843 Bacteria 667
121 Ga0068862_100004600 3300005844 Bacteria 11628
122 Ga0068862_100458571 3300005844 Bacteria 1203
123 Ga0070717_10346285 3300006028 Bacteria 1328
124 Ga0070717_10808287 3300006028 Bacteria 853
125 Ga0075365_10003446 3300006038 Bacteria 8152
126 Ga0075365_10011705 3300006038 Bacteria 5170
127 Ga0075365_10079423 3300006038 Bacteria 2220
128 Ga0075365_10197156 3300006038 Bacteria 1410
129 Ga0075368_10008087 3300006042 Bacteria 3734
130 Ga0075363_100013679 3300006048 Bacteria 3944
131 Ga0075363_100074584 3300006048 Bacteria 1847
132 Ga0075364_10468439 3300006051 Bacteria 861
133 Ga0070716_100468968 3300006173 Bacteria 922
134 Ga0070716_101420912 3300006173 Bacteria 565
135 Ga0070712_100024158 3300006175 Bacteria 4023
136 Ga0070712_100042405 3300006175 Bacteria 3129
137 Ga0070712_100046822 3300006175 Bacteria 2991
138 Ga0075362_10000264 3300006177 Bacteria 14621
139 Ga0075367_10003934 3300006178 Bacteria 7168
140 Ga0075367_10169564 3300006178 Bacteria 1359
141 Ga0075367_10202317 3300006178 Bacteria 1241
142 Ga0075369_10002368 3300006186 Bacteria 6720
143 Ga0075369_10032002 3300006186 Bacteria 2223
144 Ga0075369_10123086 3300006186 Bacteria 1175
145 Ga0075369_10348503 3300006186 Bacteria 695
146 Ga0075366_10066962 3300006195 Bacteria 2137
147 Ga0075366_10109230 3300006195 Bacteria 1663
148 Ga0097621_100167911 3300006237 Bacteria 1890
149 Ga0097621_100647747 3300006237 Bacteria 969
150 Ga0097621_101900432 3300006237 Bacteria 568
151 Ga0068871_100510471 3300006358 Bacteria 1084
152 Ga0068871_100653703 3300006358 Bacteria 960
153 Ga0075428_100000758 3300006844 Bacteria 33544
154 Ga0075428_100528343 3300006844 Bacteria 1262
155 Ga0075431_100000011 3300006847 Bacteria 95501
156 Ga0075431_100360839 3300006847 Bacteria 1459
157 Ga0075434_101519204 3300006871 Bacteria 679
158 Ga0075429_100015054 3300006880 Bacteria 6706
159 Ga0075429_100048835 3300006880 Bacteria 3680
160 Ga0068865_100001819 3300006881 Bacteria 12528
161 Ga0068865_100298214 3300006881 Bacteria 1289
162 Ga0075436_100027717 3300006914 Bacteria 3899
163 Ga0075436_100492992 3300006914 Bacteria 895
164 Ga0075436_100678639 3300006914 Bacteria 762
165 Ga0097620_100158129 3300006931 Bacteria 2344
166 Ga0097620_102196722 3300006931 Bacteria 609
167 Ga0079104_1000032 3300006946 Bacteria 203094
168 Ga0075435_100024337 3300007076 Bacteria 4697
169 Ga0099795_10021964 3300007788 Bacteria 2101
170 Ga0105244_10343806 3300009036 Bacteria 688
171 Ga0105240_10000091 3300009093 Bacteria 182507
172 Ga0105240_10010353 3300009093 Bacteria 13121
173 Ga0105240_10188844 3300009093 Bacteria 2424
174 Ga0105240_10199959 3300009093 Bacteria 2343
175 Ga0105240_11794558 3300009093 Bacteria 639
176 Ga0111539_10158151 3300009094 Bacteria 2651
177 Ga0111539_10169371 3300009094 Bacteria 2552
178 Ga0105245_10653884 3300009098 Bacteria 1081
179 Ga0105245_11882191 3300009098 Bacteria 651
180 Ga0105247_10044031 3300009101 Bacteria 2736
181 Ga0105247_10243114 3300009101 Bacteria 1227
182 Ga0105247_10686414 3300009101 Bacteria 769
183 Ga0114129_11797739 3300009147 Bacteria 745
184 Ga0105243_10002935 3300009148 Bacteria 14105
185 Ga0105241_10289114 3300009174 Bacteria 1403
186 Ga0105241_10406342 3300009174 Bacteria 1195
187 Ga0105241_11842143 3300009174 Bacteria 592
188 Ga0105242_10107594 3300009176 Bacteria 2372
189 Ga0105242_10437288 3300009176 Bacteria 1230
190 Ga0105242_10908591 3300009176 Bacteria 881
191 Ga0105248_10877914 3300009177 Bacteria 1013
192 Ga0105248_13235689 3300009177 Bacteria 518
193 Ga0105237_10616558 3300009545 Bacteria 1092
194 Ga0105237_11723021 3300009545 Bacteria 634
195 Ga0105238_10012336 3300009551 Bacteria 8618
196 Ga0105238_10577769 3300009551 Bacteria 1130
197 Ga0105249_10028823 3300009553 Bacteria 5011
198 Ga0105249_10173209 3300009553 Bacteria 2094
199 Ga0105249_11869175 3300009553 Bacteria 673
200 Ga0105249_12228726 3300009553 Bacteria 621
201 Ga0099796_10000023 3300010159 Bacteria 39177
202 Ga0099796_10009092 3300010159 Bacteria 2675
203 Ga0105239_10036500 3300010375 Bacteria 5397
204 Ga0105239_12119918 3300010375 Bacteria 653
205 Ga0105239_12919272 3300010375 Bacteria 558
206 Ga0105246_10047013 3300011119 Bacteria 2946
207 Ga0105246_10493116 3300011119 Bacteria 1039
208 Ga0157322_1000013 3300012490 Bacteria 3178
209 Ga0157373_10237469 3300013100 Bacteria 1288
210 Ga0157373_10557374 3300013100 Bacteria 831
211 Ga0157370_10008908 3300013104 Bacteria 10779
212 Ga0157369_10239824 3300013105 Bacteria 1894
213 Ga0157369_10838313 3300013105 Bacteria 944
214 Ga0157369_11398171 3300013105 Bacteria 712
215 Ga0157374_10061180 3300013296 Bacteria 3526
216 Ga0157374_10849329 3300013296 Bacteria 930
217 Ga0157374_12275244 3300013296 Bacteria 569
218 Ga0157374_12777030 3300013296 Bacteria 517
219 Ga0157378_11109840 3300013297 Bacteria 828
220 Ga0163162_10631552 3300013306 Bacteria 1195
221 Ga0157372_10447227 3300013307 Bacteria 1506
222 Ga0157372_12828048 3300013307 Bacteria 556
223 Ga0157375_10012541 3300013308 Bacteria 7523
224 Ga0157375_10516605 3300013308 Bacteria 1358
225 Ga0157375_12400191 3300013308 Bacteria 629
226 Ga0163163_10087170 3300014325 Bacteria 3132
227 Ga0163163_10169418 3300014325 Bacteria 2230
228 Ga0163163_11009500 3300014325 Bacteria 895
229 Ga0163163_11455977 3300014325 Bacteria 746
230 Ga0163163_11784912 3300014325 Bacteria 675
231 Ga0157380_10024201 3300014326 Bacteria 4593
232 Ga0157380_10554148 3300014326 Bacteria 1128
233 Ga0182008_10660328 3300014497 Bacteria 593
234 Ga0157377_10096808 3300014745 Bacteria 1751
235 Ga0157379_10160210 3300014968 Bacteria 2031
236 Ga0157376_10931475 3300014969 Bacteria 888
237 Ga0182006_1198479 3300015261 Bacteria 665
238 Ga0163161_10132000 3300017792 Bacteria 1885
239 Ga0163161_10220954 3300017792 Bacteria 1467
240 Ga0163161_10747740 3300017792 Bacteria 818
241 Ga0197907_10043327 3300020069 Bacteria 711
242 Ga0206350_11354611 3300020080 Bacteria 1203
243 Ga0214542_1018037 3300021321 Bacteria 6127
244 Ga0214543_1000005 3300021327 Bacteria 454523
245 Ga0213876_10496708 3300021384 Bacteria 649
246 Ga0213875_10051498 3300021388 Bacteria 1929
247 Ga0224712_10154532 3300022467 Bacteria 1019
248 Ga0207425_1003494 3300025245 Bacteria 5001
249 Ga0209148_1001052 3300025254 Bacteria 17035
250 Ga0209129_1002523 3300025258 Bacteria 8913
251 Ga0209233_1001623 3300025261 Bacteria 8745
252 Ga0209233_1002454 3300025261 Bacteria 6816
253 Ga0209233_1031649 3300025261 Bacteria 1233
254 Ga0209455_1011474 3300025272 Bacteria 2178
255 Ga0209673_1000013 3300025273 Bacteria 571633
256 Ga0209673_1000557 3300025273 Bacteria 59948
257 Ga0209673_1001282 3300025273 Bacteria 25743
258 Ga0209673_1003182 3300025273 Bacteria 9990
259 Ga0209673_1017351 3300025273 Bacteria 2655
260 Ga0209675_1042931 3300025291 Bacteria 977
261 Ga0209676_1015701 3300025292 Bacteria 2774
262 Ga0209025_1000058 3300025294 Bacteria 311398
263 Ga0209564_1000118 3300025295 Bacteria 205431
264 Ga0209564_1000167 3300025295 Bacteria 159653
265 Ga0209564_1044691 3300025295 Bacteria 1147
266 Ga0209758_1000209 3300025297 Bacteria 128038
267 Ga0209758_1000878 3300025297 Bacteria 41328
268 Ga0209758_1014137 3300025297 Bacteria 4275
269 Ga0209758_1033049 3300025297 Bacteria 2086
270 Ga0209758_1048195 3300025297 Bacteria 1517
271 Ga0209758_1050935 3300025297 Bacteria 1447
272 Ga0209050_1019055 3300025298 Bacteria 2630
273 Ga0209256_1000160 3300025299 Bacteria 138781
274 Ga0209256_1001227 3300025299 Bacteria 28538
275 Ga0209256_1004791 3300025299 Bacteria 8223
276 Ga0209256_1021977 3300025299 Bacteria 1944
277 Ga0207426_1000147 3300025302 Bacteria 190586
278 Ga0209051_1000224 3300025303 Bacteria 95355
279 Ga0209051_1000390 3300025303 Bacteria 61886
280 Ga0209051_1022795 3300025303 Bacteria 2625
281 Ga0209257_1003920 3300025304 Bacteria 12097
282 Ga0209257_1011573 3300025304 Bacteria 4225
283 Ga0209257_1139879 3300025304 Bacteria 545
284 Ga0207682_10292586 3300025893 Bacteria 763
285 Ga0207692_10125200 3300025898 Bacteria 1444
286 Ga0207642_10323577 3300025899 Bacteria 901
287 Ga0207710_10091141 3300025900 Bacteria 1427
288 Ga0207685_10000568 3300025905 Bacteria 6419
289 Ga0207699_10143813 3300025906 Bacteria 1570
290 Ga0207699_10224691 3300025906 Bacteria 1283
291 Ga0207699_10559139 3300025906 Bacteria 830
292 Ga0207699_10597874 3300025906 Bacteria 803
293 Ga0207699_10648414 3300025906 Bacteria 771
294 Ga0207645_10097676 3300025907 Bacteria 1893
295 Ga0207643_10014208 3300025908 Bacteria 4323
296 Ga0207643_10789060 3300025908 Bacteria 615
297 Ga0207705_10214385 3300025909 Bacteria 1461
298 Ga0207705_10255876 3300025909 Bacteria 1336
299 Ga0207705_11095549 3300025909 Bacteria 614
300 Ga0207684_11710692 3300025910 Bacteria 507
301 Ga0207707_10008658 3300025912 Bacteria 8828
302 Ga0207707_10112191 3300025912 Bacteria 2384
303 Ga0207707_10332290 3300025912 Bacteria 1311
304 Ga0207695_10000018 3300025913 Bacteria 766611
305 Ga0207695_10035433 3300025913 Bacteria 5411
306 Ga0207695_10057465 3300025913 Bacteria 4041
307 Ga0207695_10372492 3300025913 Bacteria 1314
308 Ga0207671_10645861 3300025914 Bacteria 843
309 Ga0207693_10035708 3300025915 Bacteria 3919
310 Ga0207693_10052369 3300025915 Bacteria 3201
311 Ga0207693_10077545 3300025915 Bacteria 2602
312 Ga0207693_11384281 3300025915 Bacteria 523
313 Ga0207663_10023820 3300025916 Bacteria 3520
314 Ga0207663_10070361 3300025916 Bacteria 2254
315 Ga0207663_10311589 3300025916 Bacteria 1180
316 Ga0207663_10567694 3300025916 Bacteria 888
317 Ga0207663_11263276 3300025916 Bacteria 595
318 Ga0207660_10014320 3300025917 Bacteria 5212
319 Ga0207660_10023952 3300025917 Bacteria 4128
320 Ga0207660_10067664 3300025917 Bacteria 2588
321 Ga0207660_11056956 3300025917 Bacteria 662
322 Ga0207657_10497210 3300025919 Bacteria 955
323 Ga0207652_10020155 3300025921 Bacteria 5491
324 Ga0207652_10180096 3300025921 Bacteria 1899
325 Ga0207652_10545378 3300025921 Bacteria 1042
326 Ga0207652_10965928 3300025921 Bacteria 750
327 Ga0207652_11318447 3300025921 Bacteria 625
328 Ga0207652_11399036 3300025921 Bacteria 603
329 Ga0207681_10001355 3300025923 Bacteria 15822
330 Ga0207694_10000018 3300025924 Bacteria 331281
331 Ga0207694_10492552 3300025924 Bacteria 1026
332 Ga0207650_10210026 3300025925 Bacteria 1563
333 Ga0207650_11740068 3300025925 Bacteria 528
334 Ga0207659_10212423 3300025926 Bacteria 1551
335 Ga0207700_10002145 3300025928 Bacteria 11291
336 Ga0207700_10129656 3300025928 Bacteria 2057
337 Ga0207700_10444787 3300025928 Bacteria 1141
338 Ga0207700_10578946 3300025928 Bacteria 998
339 Ga0207664_10752207 3300025929 Bacteria 876
340 Ga0207690_10082427 3300025932 Bacteria 2250
341 Ga0207690_10982221 3300025932 Bacteria 702
342 Ga0207690_11162559 3300025932 Bacteria 644
343 Ga0207706_10103182 3300025933 Bacteria 2509
344 Ga0207706_11069176 3300025933 Bacteria 675
345 Ga0207709_10032314 3300025935 Bacteria 3064
346 Ga0207669_10561133 3300025937 Bacteria 923
347 Ga0207704_10006461 3300025938 Bacteria 5469
348 Ga0207665_10168701 3300025939 Bacteria 1579
349 Ga0207691_10622287 3300025940 Bacteria 913
350 Ga0207691_10845978 3300025940 Bacteria 767
351 Ga0207661_10610299 3300025944 Bacteria 1002
352 Ga0207679_10953108 3300025945 Bacteria 786
353 Ga0207667_10000052 3300025949 Bacteria 232415
354 Ga0207667_10283258 3300025949 Bacteria 1693
355 Ga0207651_10210141 3300025960 Bacteria 1566
356 Ga0207651_10932721 3300025960 Bacteria 774
357 Ga0207712_10005328 3300025961 Bacteria 8122
358 Ga0207712_10329531 3300025961 Bacteria 1262
359 Ga0207668_10073947 3300025972 Bacteria 2444
360 Ga0207668_10653467 3300025972 Bacteria 920
361 Ga0207668_11170676 3300025972 Bacteria 690
362 Ga0207640_10225517 3300025981 Bacteria 1438
363 Ga0207677_10020570 3300026023 Bacteria 4010
364 Ga0207677_11636273 3300026023 Bacteria 596
365 Ga0207703_10256522 3300026035 Bacteria 1579
366 Ga0207703_10750337 3300026035 Bacteria 930
367 Ga0207639_10002815 3300026041 Bacteria 11672
368 Ga0207639_10240471 3300026041 Bacteria 1574
369 Ga0207639_11493790 3300026041 Bacteria 634
370 Ga0207678_10640514 3300026067 Bacteria 933
371 Ga0207708_10001370 3300026075 Bacteria 18328
372 Ga0207702_10206584 3300026078 Bacteria 1823
373 Ga0207702_10373464 3300026078 Bacteria 1370
374 Ga0207702_10499397 3300026078 Bacteria 1186
375 Ga0207702_11664581 3300026078 Bacteria 631
376 Ga0207648_10006874 3300026089 Bacteria 11280
377 Ga0207648_10282957 3300026089 Bacteria 1483
378 Ga0207674_10634480 3300026116 Bacteria 1032
379 Ga0207675_100002718 3300026118 Bacteria 17433
380 Ga0207675_100030886 3300026118 Bacteria 4989
381 Ga0207683_10452342 3300026121 Bacteria 1184
382 Ga0207683_10602890 3300026121 Bacteria 1016
383 Ga0207683_11412608 3300026121 Bacteria 643
384 Ga0207698_10007839 3300026142 Bacteria 6715
385 Ga0209281_1000053 3300027111 Bacteria 309587
386 Ga0209371_1042730 3300027312 Bacteria 910
387 Ga0209179_1000175 3300027512 Bacteria 6059
388 Ga0209179_1020592 3300027512 Bacteria 1281
389 Ga0209983_1061399 3300027665 Bacteria 831
390 Ga0209813_10024390 3300027866 Bacteria 1729
391 Ga0207428_10001843 3300027907 Bacteria 21667
392 Ga0207428_10014039 3300027907 Bacteria 6976
393 Ga0207428_10600955 3300027907 Bacteria 793
394 Ga0268266_10008848 3300028379 Bacteria 8915
395 Ga0268266_10243564 3300028379 Bacteria 1660
396 Ga0268266_10490532 3300028379 Bacteria 1172
397 Ga0268265_10010433 3300028380 Bacteria 6273
398 Ga0268265_10733699 3300028380 Bacteria 957
399 Ga0268265_10849861 3300028380 Bacteria 893
400 Ga0268264_10338455 3300028381 Bacteria 1428
401 Ga0268264_10911438 3300028381 Bacteria 883
402 Ga0268264_11413296 3300028381 Bacteria 706
403 Ga0307515_10401196 3300028794 Bacteria 997
404 Ga0268256_1037489 3300030500 Bacteria 1110
405 Ga0314311_1036646 3300030733 Bacteria 1471
406 Ga0316182_1084857 3300030745 Bacteria 610
407 Ga0265760_10183749 3300031090 Bacteria 699
408 Ga0307513_10368578 3300031456 Bacteria 1179
409 Ga0307408_100951764 3300031548 Bacteria 789
410 Ga0307508_10000100 3300031616 Bacteria 102032
411 Ga0307508_10464616 3300031616 Bacteria 859
412 Ga0307516_10042183 3300031730 Bacteria 4528
413 Ga0307413_10241183 3300031824 Bacteria 1335
414 Ga0307413_10784013 3300031824 Bacteria 800
415 Ga0307412_10101378 3300031911 Bacteria 2037
416 Ga0307409_102440503 3300031995 Bacteria 552
417 Ga0307411_11085278 3300032005 Bacteria 721
418 Ga0307510_10105997 3300033180 Bacteria 2576
419 Ga0307510_10156071 3300033180 Bacteria 1889
420 Ga0307510_10247111 3300033180 Bacteria 1274
421 Ga0373934_0165852 3300035086 Bacteria 906
422 Ga0373934_0413696 3300035086 Bacteria 564
423 Ga0373944_0342420 3300035089 Bacteria 568
424 Ga0373923_0000829 3300035111 Bacteria 8120
425 Ga0373936_0001166 3300035113 Bacteria 9449
426 Ga0373945_0083201 3300035116 Bacteria 1229
427 Ga0373953_0005121 3300035117 Bacteria 4235
428 Ga0373953_0346511 3300035117 Bacteria 651
429 Ga0373954_0003062 3300035118 Bacteria 7056
430 Ga0373954_0120246 3300035118 Bacteria 1274
431 Ga0373956_0301690 3300035119 Bacteria 763
432 Ga0373957_0446448 3300035120 Bacteria 560
433 Ga0373960_0155655 3300035121 Bacteria 783
434 Ga0373943_0023535 3300035170 Bacteria 2865
435 Ga0373943_0455154 3300035170 Bacteria 744
436 Ga0373943_0878174 3300035170 Bacteria 535
437 Ga0373946_0158396 3300035171 Bacteria 1061
438 Ga0373955_0003572 3300035172 Bacteria 6845
439 Ga0373961_0006801 3300035241 Bacteria 2750
440 Ga0373924_0006186 3300035410 Bacteria 4280
441 Ga0373931_0089440 3300035691 Bacteria 1713
442 Ga0373935_0000117 3300035692 Bacteria 35971
443 Ga0373935_0371543 3300035692 Bacteria 1023
444 Ga0373935_0836620 3300035692 Bacteria 680
445 Ga0373927_0137640 3300035695 Bacteria 1596
446 Ga0373933_0006556 3300035724 Bacteria 6343
447 Ga0373933_0153188 3300035724 Bacteria 1461
448 Ga0373933_0241484 3300035724 Unclassified 1162
449 Ga0373947_0000276 3300035725 Bacteria 29236
450 Ga0373947_0125354 3300035725 Bacteria 1635
451 Ga0373937_0000052 3300036401 Bacteria 104781
452 Ga0373937_0051892 3300036401 Bacteria 3759
453 Ga0373937_0124945 3300036401 Unclassified 2399
454 Ga0373937_0400294 3300036401 Bacteria 1303
455 Ga0373937_0528471 3300036401 Bacteria 1121
456 Ga0373925_0000019 3300037068 Bacteria 170628
457 Ga0373925_0025932 3300037068 Bacteria 4286
458 Ga0373925_0073597 3300037068 Bacteria 2586
459 Ga0373925_0133779 3300037068 Bacteria 1936
460 Ga0373925_1635935 3300037068 Bacteria 526
461 Ga0395899_0255344 3300037312 Bacteria 1201
462 Ga0395899_0442326 3300037312 Bacteria 853
463 Ga0395900_0001586 3300037418 Bacteria 26897
464 Ga0395900_0107986 3300037418 Bacteria 2859
465 Ga0395900_0156437 3300037418 Bacteria 2328
466 Ga0395900_0165806 3300037418 Bacteria 2251
467 Ga0395900_0844115 3300037418 Bacteria 842
468 Ga0395898_0006493 3300037466 Bacteria 12490
469 Ga0395898_0064243 3300037466 Bacteria 3560
470 Ga0395898_0752369 3300037466 Bacteria 916
471 Ga0395905_0013634 3300037471 Bacteria 7787
472 Ga0395905_0192436 3300037471 Bacteria 1913
473 Ga0395905_0590888 3300037471 Bacteria 1012
474 Ga0436364_0556111 3300037853 Bacteria 2067
475 Ga0436364_0991952 3300037853 Bacteria 1359
476 Ga0395901_0078373 3300038443 Bacteria 3450
477 Ga0395901_0102137 3300038443 Bacteria 3009
478 Ga0395901_0253199 3300038443 Bacteria 1834
479 Ga0395901_0266418 3300038443 Bacteria 1783
480 Ga0395901_0388018 3300038443 Bacteria 1436
481 Ga0395901_0418829 3300038443 Bacteria 1374
482 Ga0395901_1066725 3300038443 Bacteria 780
483 Ga0395901_1660917 3300038443 Bacteria 591
484 Ga0436365_0805373 3300039437 Bacteria 856
485 Ga0436365_1116090 3300039437 Bacteria 2651
486 Ga0436360_0413971 3300039438 Bacteria 2191
487 Ga0436360_1174616 3300039438 Bacteria 576
488 Ga0436360_1276861 3300039438 Bacteria 1412
489 Ga0436361_0973013 3300039447 Bacteria 1182
490 Ga0436363_0045921 3300039450 Bacteria 1069
491 Ga0436363_0100535 3300039450 Bacteria 4984
492 Ga0436363_0467120 3300039450 Bacteria 983
493 Ga0436363_0842799 3300039450 Bacteria 639
494 Ga0436363_1427156 3300039450 Bacteria 890
495 Ga0436362_0165852 3300039453 Bacteria 1554
496 Ga0436362_0325873 3300039453 Bacteria 780
497 Ga0436362_1047858 3300039453 Bacteria 610
498 Ga0451789_0573928 3300041443 Bacteria 1473
499 Ga0451793_0484893 3300041452 Bacteria 1028
500 Ga0451795_1274319 3300041456 Bacteria 549
501 Ga0451807_0666639 3300041486 Bacteria 938
502 Ga0451833_0995772 3300041491 Bacteria 854
503 Ga0451835_0376890 3300041492 Bacteria 953
504 Ga0451835_0664346 3300041492 Bacteria 1898
505 Ga0451837_0639563 3300041494 Bacteria 1449
506 Ga0451841_0552134 3300041498 Bacteria 1750
507 Ga0451845_0653309 3300041501 Bacteria 629
508 Ga0451849_0094019 3300041505 Bacteria 3283
509 Ga0451851_1046301 3300041507 Bacteria 688
510 Ga0451853_0534119 3300041512 Bacteria 819
511 Ga0451853_2562927 3300041512 Bacteria 616
512 Ga0451853_2605588 3300041512 Bacteria 811
513 Ga0439441_023220 3300042001 Bacteria 1158
514 Ga0439455_0061474 3300042012 Bacteria 997
515 Ga0439464_0067784 3300042439 Bacteria 1052
516 Ga0439460_0070042 3300042461 Bacteria 1085
517 Ga0466969_0182267 3300044656 Bacteria 961
518 Ga0466966_0171971 3300044684 Bacteria 1316
519 Ga0466966_0187022 3300044684 Bacteria 1255
520 Ga0466961_0471088 3300044693 Bacteria 759
521 Ga0466961_0526147 3300044693 Bacteria 713
522 Ga0466964_0342313 3300044706 Bacteria 766
523 Ga0466971_0358877 3300044719 Bacteria 706
524 Ga0466971_0383221 3300044719 Bacteria 684
525 Ga0466970_0304196 3300044765 Bacteria 900
526 Ga0466957_0030929 3300044842 Bacteria 3197
527 Ga0466957_0466634 3300044842 Bacteria 872
528 Ga0466957_0591980 3300044842 Bacteria 776
529 Ga0466959_0143948 3300045049 Bacteria 1683
530 Ga0466959_0485503 3300045049 Bacteria 836
531 Ga0466958_0016636 3300045836 Bacteria 4238
532 Ga0466967_0005344 3300045976 Bacteria 8877
533 Ga0466967_0017289 3300045976 Bacteria 5720
534 Ga0495592_0000005 3300046454 Bacteria 194493
535 Ga0495629_0086189 3300046459 Bacteria 2191
536 Ga0495638_0004099 3300046460 Bacteria 11148
537 Ga0495638_0066012 3300046460 Bacteria 2225
538 Ga0495651_0001128 3300046462 Bacteria 20657
539 Ga0495653_0000017 3300046463 Bacteria 190660
540 Ga0495650_0028954 3300046471 Bacteria 2532
541 Ga0495650_0195446 3300046471 Bacteria 705
542 Ga0495605_0024318 3300046474 Bacteria 3171
543 Ga0495662_0007127 3300046476 Bacteria 5544
544 Ga0495662_0219417 3300046476 Bacteria 937
545 Ga0495664_0000014 3300046477 Bacteria 193962
546 Ga0495584_0076119 3300046491 Bacteria 1688
547 Ga0495594_0204793 3300046499 Bacteria 1125
548 Ga0495596_0049895 3300046500 Bacteria 1640
549 Ga0495607_0055231 3300046501 Bacteria 2285
550 Ga0495583_0126822 3300046506 Bacteria 1070
551 Ga0495583_0231907 3300046506 Bacteria 744
552 Ga0495606_0029617 3300046507 Bacteria 3839
553 Ga0495606_0171032 3300046507 Bacteria 1260
554 Ga0495608_0000034 3300046511 Bacteria 136686
555 Ga0495610_0014074 3300046512 Bacteria 4720
556 Ga0495610_0139663 3300046512 Bacteria 1044
557 Ga0495616_0171750 3300046513 Bacteria 969
558 Ga0495616_0206920 3300046513 Bacteria 860
559 Ga0495618_0000011 3300046514 Bacteria 179208
560 Ga0495620_0022071 3300046515 Bacteria 3075
561 Ga0495628_0000017 3300046516 Bacteria 169983
562 Ga0495628_0178576 3300046516 Bacteria 1607
563 Ga0495630_0208808 3300046517 Bacteria 1490
564 Ga0495631_0175256 3300046518 Bacteria 919
565 Ga0495631_0205595 3300046518 Bacteria 842
566 Ga0495632_0009006 3300046519 Bacteria 6054
567 Ga0495643_0011904 3300046522 Bacteria 5269
568 Ga0495643_0239749 3300046522 Bacteria 851
569 Ga0495648_0033232 3300046524 Bacteria 3372
570 Ga0495648_0042090 3300046524 Bacteria 2877
571 Ga0495652_0000008 3300046529 Bacteria 343637
572 Ga0495652_0252287 3300046529 Bacteria 1307
573 Ga0495652_0701673 3300046529 Bacteria 681
574 Ga0495654_0000092 3300046530 Bacteria 101504
575 Ga0495640_0000024 3300046533 Bacteria 99088
576 Ga0495640_0081154 3300046533 Bacteria 2156
577 Ga0495587_0000039 3300046536 Bacteria 114200
578 Ga0495587_0470776 3300046536 Bacteria 695
579 Ga0495598_0240400 3300046537 Bacteria 667
580 Ga0495597_0064955 3300046542 Bacteria 1584
581 Ga0495645_0000006 3300046543 Bacteria 382503
582 Ga0495645_0839249 3300046543 Bacteria 549
583 Ga0495622_0029524 3300046557 Bacteria 2562
584 Ga0495633_0026796 3300046558 Bacteria 2823
585 Ga0495667_0000026 3300046559 Bacteria 154971
586 Ga0495667_0004467 3300046559 Bacteria 9434
587 Ga0495667_0116865 3300046559 Bacteria 1723
588 Ga0495667_0276485 3300046559 Bacteria 1066
589 Ga0495667_0418482 3300046559 Bacteria 843
590 Ga0495668_0004588 3300046616 Bacteria 9719
591 Ga0495668_0084524 3300046616 Bacteria 1740
592 Ga0495668_0241192 3300046616 Bacteria 990
593 Ga0495634_0000009 3300046642 Bacteria 162893
594 Ga0495634_0261661 3300046642 Bacteria 1055
595 Ga0495611_0402818 3300046648 Bacteria 625
596 Ga0495625_0017851 3300046660 Bacteria 5545
597 Ga0495625_0091102 3300046660 Bacteria 2108
598 Ga0495625_0101057 3300046660 Bacteria 1981
599 Ga0495625_0104532 3300046660 Bacteria 1941
600 Ga0495635_0000014 3300046663 Bacteria 218080
601 Ga0495635_0550569 3300046663 Bacteria 756
602 Ga0495588_0062882 3300046674 Bacteria 1924
603 Ga0495588_0082908 3300046674 Bacteria 1675
604 Ga0495657_0000038 3300046675 Bacteria 117535
605 Ga0495657_0046398 3300046675 Bacteria 2942
606 Ga0495657_0366698 3300046675 Bacteria 851
607 Ga0495599_0000010 3300046678 Bacteria 211658
608 Ga0495599_0358303 3300046678 Bacteria 874
609 Ga0495623_0000074 3300046679 Bacteria 59542
610 Ga0495623_0251773 3300046679 Bacteria 993
611 Ga0495646_0000008 3300046680 Bacteria 214486
612 Ga0495658_0703290 3300046683 Bacteria 647
613 Ga0495669_0098429 3300046684 Bacteria 1357
614 Ga0495670_0130370 3300046691 Bacteria 1310
615 Ga0495671_0327056 3300046692 Bacteria 736
616 Ga0495649_0006352 3300046694 Bacteria 7354
617 Ga0495649_0347147 3300046694 Bacteria 750
618 Ga0495600_0000046 3300046809 Bacteria 71644
619 Ga0495660_0018777 3300046810 Bacteria 3970
620 Ga0495581_0105630 3300047315 Bacteria 1636
621 Ga0495604_0000006 3300047317 Bacteria 420480
622 Ga0495604_0110716 3300047317 Bacteria 2003
623 Ga0495674_0000009 3300047319 Bacteria 310479
624 Ga0495676_0334700 3300047321 Bacteria 1015
625 Ga0495680_0000309 3300047322 Bacteria 54644
626 Ga0495680_0084072 3300047322 Bacteria 2399
627 Ga0495683_0020701 3300047323 Bacteria 3392
628 Ga0495687_018973 3300047443 Bacteria 3386
629 Ga0495675_0000044 3300047444 Bacteria 83527
630 Ga0495681_0130536 3300047470 Bacteria 1070
631 Ga0495684_0000015 3300047471 Bacteria 169596
632 Ga0495684_0616761 3300047471 Bacteria 730
633 Ga0495686_0031954 3300047472 Bacteria 3409
634 Ga0495686_0207264 3300047472 Bacteria 1122
635 Ga0495593_0001931 3300047673 Bacteria 12364
636 Ga0495602_0000006 3300048088 Bacteria 322593
637 Ga0495626_0139270 3300048091 Bacteria 1030
638 Ga0496100_0032903 3300048903 Bacteria 3239
639 Ga0496101_0154452 3300048904 Bacteria 1757
640 Ga0496101_0166052 3300048904 Bacteria 1695
641 Ga0496102_0045526 3300048905 Bacteria 3984
642 Ga0496102_0256158 3300048905 Bacteria 1650
643 Ga0496102_0279088 3300048905 Bacteria 1575
644 Ga0496104_0154327 3300048907 Bacteria 2204
645 Ga0496104_0204255 3300048907 Bacteria 1887
646 Ga0496104_0230168 3300048907 Bacteria 1765
647 Ga0496106_0126310 3300048909 Bacteria 2003
648 Ga0496106_0181290 3300048909 Bacteria 1672
649 Ga0496107_0065780 3300048910 Bacteria 2628
650 Ga0496107_0150418 3300048910 Bacteria 1722
651 Ga0496107_0502286 3300048910 Bacteria 900
652 Ga0496108_0744691 3300048911 Bacteria 848
653 Ga0496109_1505565 3300048912 Bacteria 608
654 Ga0496109_1675964 3300048912 Bacteria 570
655 Ga0496109_1697692 3300048912 Bacteria 565
656 Ga0496111_0488123 3300048914 Bacteria 907
657 Ga0496112_0082873 3300048915 Bacteria 3171
658 Ga0496112_0348976 3300048915 Bacteria 1422
659 Ga0496112_0695731 3300048915 Bacteria 945
660 Ga0496113_0041330 3300048916 Bacteria 3402
661 Ga0496114_0358881 3300048917 Bacteria 1289
662 Ga0496115_0193832 3300048918 Bacteria 1679
663 Ga0496115_0243314 3300048918 Bacteria 1483
664 Ga0496115_0310678 3300048918 Bacteria 1291
665 Ga0496116_0045169 3300048919 Bacteria 2985
666 Ga0496116_0168197 3300048919 Bacteria 1192
667 Ga0496116_0277736 3300048919 Bacteria 814
668 Ga0496117_0097323 3300048920 Bacteria 1875
669 Ga0496117_0118366 3300048920 Bacteria 1633
670 Ga0496118_0055453 3300048921 Bacteria 2991
671 Ga0496118_0071415 3300048921 Bacteria 2499
672 Ga0496118_0081880 3300048921 Bacteria 2264
673 Ga0496119_0058946 3300048922 Bacteria 2310
674 Ga0496119_0098092 3300048922 Bacteria 1650
675 Ga0496121_0085717 3300048924 Bacteria 2478
676 Ga0496121_0101640 3300048924 Bacteria 2216
677 Ga0496121_0191953 3300048924 Bacteria 1463
678 Ga0496121_0245936 3300048924 Bacteria 1243
679 Ga0496121_0258418 3300048924 Bacteria 1204
680 Ga0496121_0510917 3300048924 Bacteria 760
681 Ga0496122_0047059 3300048925 Bacteria 3333
682 Ga0496122_0313454 3300048925 Bacteria 838
683 Ga0496124_0006399 3300048927 Bacteria 12840
684 Ga0496124_0066866 3300048927 Bacteria 2992
685 Ga0496124_0151238 3300048927 Bacteria 1820
686 Ga0496124_0260017 3300048927 Bacteria 1278
687 Ga0496124_0628802 3300048927 Bacteria 693
688 Ga0496125_0368643 3300048928 Bacteria 851
689 Ga0496126_0441710 3300048929 Bacteria 1048
690 Ga0496126_0562981 3300048929 Bacteria 903
691 Ga0496126_0648424 3300048929 Bacteria 826
692 Ga0496126_1308912 3300048929 Bacteria 527
693 Ga0495678_018936 3300049459 Bacteria 3083
694 Ga0495682_0001599 3300049460 Bacteria 11741
695 Ga0501031_0000005 3300049568 Bacteria 183960
696 Ga0501031_0071156 3300049568 Bacteria 2265
697 Ga0501031_0248203 3300049568 Bacteria 1157
698 Ga0501032_0000442 3300049569 Bacteria 34064
699 Ga0501032_0002265 3300049569 Bacteria 15126
700 Ga0501032_0016737 3300049569 Bacteria 5151
701 Ga0501032_0174561 3300049569 Bacteria 1408
702 Ga0501032_0373661 3300049569 Bacteria 917
703 Ga0501032_0633490 3300049569 Bacteria 679
704 Ga0501033_0000578 3300049570 Bacteria 34064
705 Ga0501033_0001698 3300049570 Bacteria 19273
706 Ga0501033_0004152 3300049570 Bacteria 11670
707 Ga0501033_0020661 3300049570 Bacteria 4974
708 Ga0501033_0030146 3300049570 Bacteria 4075
709 Ga0501034_0001277 3300049571 Bacteria 34064
710 Ga0501034_0033968 3300049571 Bacteria 5171
711 Ga0501034_0081735 3300049571 Bacteria 3233
712 Ga0501034_0189593 3300049571 Bacteria 2019
713 Ga0501034_0499255 3300049571 Bacteria 1130
714 Ga0501034_0928168 3300049571 Bacteria 757
715 Ga0501034_1366567 3300049571 Bacteria 584
716 Ga0501036_0000305 3300049572 Bacteria 34066
717 Ga0501036_0019971 3300049572 Bacteria 5624
718 Ga0501036_0060543 3300049572 Bacteria 3207
719 Ga0501036_0077745 3300049572 Bacteria 2808
720 Ga0501036_0088830 3300049572 Bacteria 2611
721 Ga0501036_0367529 3300049572 Bacteria 1201
722 Ga0501036_0852859 3300049572 Bacteria 749
723 Ga0501037_0000441 3300049573 Bacteria 34064
724 Ga0501037_0008100 3300049573 Bacteria 7699
725 Ga0501037_0019848 3300049573 Bacteria 4959
726 Ga0501037_0039290 3300049573 Bacteria 3484
727 Ga0501037_0257559 3300049573 Bacteria 1219
728 Ga0501038_0000511 3300049574 Bacteria 34064
729 Ga0501038_0033922 3300049574 Bacteria 4491
730 Ga0501038_0040102 3300049574 Bacteria 4092
731 Ga0501038_0355687 3300049574 Bacteria 1140
732 Ga0501038_0959995 3300049574 Bacteria 629
733 Ga0501038_1233854 3300049574 Bacteria 542
734 Ga0501039_0000318 3300049575 Bacteria 34064
735 Ga0501039_0102241 3300049575 Bacteria 2236
736 Ga0501039_0145646 3300049575 Bacteria 1861
737 Ga0501039_0223052 3300049575 Bacteria 1482
738 Ga0501040_0007413 3300049576 Bacteria 7100
739 Ga0501042_0042120 3300049578 Bacteria 3249
740 Ga0501042_0357750 3300049578 Bacteria 1056
741 Ga0501042_0825493 3300049578 Bacteria 675
742 Ga0501043_0000446 3300049579 Bacteria 37169
743 Ga0501043_0001518 3300049579 Bacteria 20269
744 Ga0501043_0193762 3300049579 Bacteria 1580
745 Ga0501043_0237103 3300049579 Bacteria 1408
746 Ga0501043_0537700 3300049579 Bacteria 869
747 Ga0501046_0040692 3300049580 Bacteria 3712
748 Ga0501046_0049009 3300049580 Bacteria 3343
749 Ga0501046_0124033 3300049580 Bacteria 1963
750 Ga0501046_0158979 3300049580 Bacteria 1700
751 Ga0501046_0285198 3300049580 Bacteria 1209
752 Ga0501046_0386524 3300049580 Bacteria 1012
753 Ga0501047_0001273 3300049581 Bacteria 24917
754 Ga0501047_0017220 3300049581 Bacteria 6918
755 Ga0501047_0032877 3300049581 Bacteria 5008
756 Ga0501047_0034437 3300049581 Bacteria 4890
757 Ga0501047_0073964 3300049581 Bacteria 3280
758 Ga0501047_0173317 3300049581 Bacteria 2026
759 Ga0501047_0333639 3300049581 Bacteria 1355
760 Ga0501048_0013144 3300049582 Bacteria 6145
761 Ga0501067_0015807 3300049583 Bacteria 4175
762 Ga0501067_0277109 3300049583 Bacteria 934
763 Ga0501067_0311471 3300049583 Bacteria 877
764 Ga0501068_0015336 3300049584 Bacteria 4397
765 Ga0501068_0043495 3300049584 Bacteria 2702
766 Ga0501068_0063235 3300049584 Bacteria 2251
767 Ga0501068_0222458 3300049584 Bacteria 1200
768 Ga0501069_0000028 3300049585 Bacteria 106038
769 Ga0501069_0019616 3300049585 Bacteria 3658
770 Ga0501069_0045179 3300049585 Bacteria 2440
771 Ga0501069_0051005 3300049585 Bacteria 2302
772 Ga0501069_0119509 3300049585 Bacteria 1504
773 Ga0501069_0152585 3300049585 Bacteria 1328
774 Ga0501069_0552770 3300049585 Bacteria 689
775 Ga0501069_0821798 3300049585 Bacteria 564
776 Ga0501070_0000480 3300049586 Bacteria 36323
777 Ga0501070_0003350 3300049586 Bacteria 13904
778 Ga0501070_0005618 3300049586 Bacteria 10692
779 Ga0501070_0020274 3300049586 Bacteria 5576
780 Ga0501070_0021774 3300049586 Bacteria 5371
781 Ga0501070_0035668 3300049586 Bacteria 4154
782 Ga0501070_0054281 3300049586 Bacteria 3323
783 Ga0501070_0062458 3300049586 Bacteria 3086
784 Ga0501071_0012350 3300049587 Bacteria 5791
785 Ga0501071_0034023 3300049587 Bacteria 3624
786 Ga0501071_0078989 3300049587 Bacteria 2405
787 Ga0501072_0231907 3300049588 Bacteria 1470
788 Ga0501072_0472418 3300049588 Bacteria 993
789 Ga0501072_0507644 3300049588 Bacteria 954
790 Ga0501073_0004757 3300049589 Bacteria 10189
791 Ga0501073_0067587 3300049589 Bacteria 2492
792 Ga0501073_0076652 3300049589 Bacteria 2326
793 Ga0501073_0196827 3300049589 Bacteria 1394
794 Ga0501073_0209472 3300049589 Bacteria 1347
795 Ga0501073_1191579 3300049589 Bacteria 523
796 Ga0501074_0001595 3300049590 Bacteria 15382
797 Ga0501074_0024196 3300049590 Bacteria 4413
798 Ga0501074_0095639 3300049590 Bacteria 2127
799 Ga0501074_0784712 3300049590 Bacteria 671
800 Ga0501074_1115811 3300049590 Bacteria 554
801 Ga0501076_0758932 3300049592 Bacteria 800
802 Ga0501077_0093683 3300049593 Bacteria 1904
803 Ga0501079_0427672 3300049741 Bacteria 1039
804 Ga0501079_0690870 3300049741 Bacteria 803
805 Ga0501080_0005343 3300049742 Bacteria 11445
806 Ga0501080_0005473 3300049742 Bacteria 11332
807 Ga0501080_0021113 3300049742 Bacteria 6028
808 Ga0501080_0023261 3300049742 Bacteria 5745
809 Ga0501080_0043178 3300049742 Bacteria 4197
810 Ga0501080_0077963 3300049742 Bacteria 3082
811 Ga0501080_0344840 3300049742 Bacteria 1346
812 Ga0501080_0507761 3300049742 Bacteria 1077
813 Ga0501080_0513050 3300049742 Bacteria 1070
814 Ga0501080_0708382 3300049742 Bacteria 887
815 Ga0501080_0920711 3300049742 Bacteria 761
816 Ga0501081_0127577 3300049743 Bacteria 1816
817 Ga0501083_0003437 3300049744 Bacteria 11060
818 Ga0501083_0040131 3300049744 Bacteria 3178
819 Ga0501083_0332208 3300049744 Bacteria 988
820 Ga0501083_0377359 3300049744 Bacteria 922
821 Ga0501083_0423202 3300049744 Bacteria 867
822 Ga0501083_0460838 3300049744 Bacteria 827
823 Ga0501241_114432 3300049758 Bacteria 593
824 Ga0501035_0000036 3300049822 Bacteria 165008
825 Ga0501035_0000779 3300049822 Bacteria 34064
826 Ga0501035_0003150 3300049822 Bacteria 15847
827 Ga0501035_0052347 3300049822 Bacteria 3653
828 Ga0501035_0053127 3300049822 Bacteria 3625
829 Ga0501035_0092163 3300049822 Bacteria 2666
830 Ga0501035_0204546 3300049822 Bacteria 1691
831 Ga0501035_0310854 3300049822 Bacteria 1326
832 Ga0501035_0317252 3300049822 Bacteria 1310
833 Ga0501044_0000011 3300049823 Bacteria 257385
834 Ga0501044_0000997 3300049823 Bacteria 34064
835 Ga0501044_0046896 3300049823 Bacteria 4471
836 Ga0501044_0085448 3300049823 Bacteria 3188
837 Ga0501044_0085657 3300049823 Bacteria 3184
838 Ga0501044_0126127 3300049823 Bacteria 2557
839 Ga0501044_0132246 3300049823 Bacteria 2488
840 Ga0501044_0172438 3300049823 Bacteria 2134
841 Ga0501044_0753172 3300049823 Bacteria 856
842 Ga0501044_0958267 3300049823 Bacteria 728
843 Ga0501045_0009075 3300049824 Bacteria 6948
844 nmdc:mga03683_217056_c1 3300050489 Bacteria 881
845 nmdc:mga03683_241_c1 3300050489 Bacteria 17051
846 nmdc:mga03n38_22833_c1 3300050490 Bacteria 2537
847 nmdc:mga03n38_31320_c1 3300050490 Bacteria 2243
848 nmdc:mga03n38_572725_c1 3300050490 Bacteria 641
849 nmdc:mga03n38_685615_c1 3300050490 Bacteria 590
850 nmdc:mga03n38_797435_c1 3300050490 Bacteria 550
851 nmdc:mga00v17_69298_c1 3300050491 Bacteria 2183
852 nmdc:mga00v17_717013_c1 3300050491 Bacteria 640
853 nmdc:mga00v17_84611_c1 3300050491 Bacteria 1985
854 nmdc:mga0yw44_14483_c1 3300050492 Bacteria 4190
855 nmdc:mga0yw44_35225_c1 3300050492 Bacteria 2940
856 nmdc:mga0yw44_9086_c1 3300050492 Bacteria 4998
857 nmdc:mga0k408_20513_c1 3300050493 Bacteria 3703
858 nmdc:mga0k408_213180_c1 3300050493 Bacteria 1153
859 nmdc:mga06z11_1098_c1 3300050494 Bacteria 9870
860 nmdc:mga06z11_136607_c1 3300050494 Bacteria 1382
861 nmdc:mga04h51_197397_c1 3300050495 Bacteria 789
862 nmdc:mga07m45_184945_c1 3300050496 Bacteria 1211
863 nmdc:mga07m45_223357_c1 3300050496 Bacteria 1096
864 nmdc:mga05p37_563093_c1 3300050507 Bacteria 1294
865 nmdc:mga05p37_744467_c1 3300050507 Bacteria 1081
866 nmdc:mga09592_93494_c1 3300050508 Bacteria 2571
867 nmdc:mga08y16_107806_c1 3300050511 Bacteria 2900
868 nmdc:mga08y16_257930_c1 3300050511 Bacteria 1801
869 nmdc:mga0rr50_146001_c1 3300050513 Bacteria 1907
870 nmdc:mga0sz30_116984_c1 3300050516 Bacteria 1170
871 nmdc:mga0sz30_137153_c1 3300050516 Bacteria 1080
872 nmdc:mga0sz30_213661_c1 3300050516 Bacteria 857
873 nmdc:mga0sz30_277435_c1 3300050516 Bacteria 747
874 nmdc:mga0sz30_7324_c1 3300050516 Bacteria 1023
875 Ga0495601_0000007 3300053077 Bacteria 365972
876 Ga0495601_0155402 3300053077 Bacteria 1494
877 Ga0495612_0000015 3300053078 Bacteria 167816
878 Ga0495612_0144922 3300053078 Bacteria 1032
879 Ga0495612_0302869 3300053078 Bacteria 717
880 Ga0495655_0048367 3300053083 Bacteria 1116
881 Ga0495595_0000023 3300053084 Bacteria 108096
882 Ga0495595_0019996 3300053084 Bacteria 2910
883 Ga0495619_0000017 3300053085 Bacteria 219276
884 Ga0495619_1069679 3300053085 Bacteria 538
885 Ga0500578_0063996 3300053086 Bacteria 2345
886 Ga0500578_0126586 3300053086 Bacteria 1604
887 Ga0500578_0239587 3300053086 Bacteria 1096
888 Ga0500643_000046 3300053087 Bacteria 150388
889 Ga0500583_0167930 3300053092 Bacteria 1092
890 Ga0500583_0330329 3300053092 Bacteria 742
891 Ga0500651_0013380 3300053093 Bacteria 4999
892 Ga0500651_0227857 3300053093 Bacteria 1091
893 Ga0500651_0445419 3300053093 Bacteria 721
894 Ga0500641_0002960 3300053096 Bacteria 6014
895 Ga0500650_0000023 3300053098 Bacteria 61675
896 Ga0500650_0180823 3300053098 Bacteria 966
897 Ga0500555_010932 3300053103 Bacteria 2606
898 Ga0500556_0001345 3300053104 Bacteria 10857
899 Ga0500556_0074910 3300053104 Bacteria 1270
900 Ga0500569_002373 3300053109 Bacteria 3696
901 Ga0500572_048409 3300053111 Bacteria 1259
902 Ga0500572_272677 3300053111 Bacteria 548
903 Ga0500594_0025437 3300053118 Bacteria 1517
904 Ga0500594_0219846 3300053118 Bacteria 627
905 Ga0500595_001530 3300053119 Bacteria 12274
906 Ga0500607_104705 3300053121 Bacteria 1398
907 Ga0500618_006819 3300053125 Bacteria 3315
908 Ga0500618_025926 3300053125 Bacteria 1402
909 Ga0500642_0001181 3300053130 Bacteria 7478
910 Ga0500652_121842 3300053131 Bacteria 1090
911 Ga0500658_0025643 3300053134 Bacteria 2266
912 Ga0500658_0054038 3300053134 Bacteria 1649
913 Ga0500568_0000066 3300053139 Bacteria 104826
914 Ga0500568_0011009 3300053139 Bacteria 4212
915 Ga0500577_0140293 3300053142 Bacteria 1019
916 Ga0500616_0004258 3300053153 Bacteria 10289
917 Ga0500616_0023969 3300053153 Bacteria 3396
918 Ga0500616_0068346 3300053153 Bacteria 1820
919 Ga0500619_007297 3300053154 Bacteria 2608
920 Ga0500620_011648 3300053155 Bacteria 2367
921 Ga0500622_0038376 3300053156 Bacteria 2498
922 Ga0500624_016821 3300053157 Bacteria 1134
923 Ga0500627_0101385 3300053158 Bacteria 1292
924 Ga0500627_0365788 3300053158 Bacteria 620
925 Ga0500633_0047552 3300053160 Bacteria 1468
926 Ga0500634_0276445 3300053161 Bacteria 680
927 Ga0500636_0123665 3300053177 Bacteria 1449
928 Ga0500645_071444 3300053730 Bacteria 996
929 Ga0500645_077706 3300053730 Bacteria 948
930 Ga0500645_102669 3300053730 Bacteria 806
931 Ga0500552_001260 3300053733 Bacteria 2403
932 Ga0500599_004294 3300053736 Bacteria 1760
933 Ga0501084_1066613 3300054114 Bacteria 679
934 Ga0501084_1096255 3300054114 Bacteria 668
935 Ga0501084_1121898 3300054114 Bacteria 660
936 Ga0500661_003671 3300055283 Bacteria 2884
937 Ga0587073_0022355 3300059492 Bacteria 1227
938 Ga0587073_0103271 3300059492 Bacteria 744
939 Ga0587077_133142 3300059493 Bacteria 633
940 Ga0587080_061269 3300059503 Bacteria 733
941 Ga0587082_060501 3300059504 Bacteria 746
942 Ga0587083_0021817 3300059505 Bacteria 1193
943 Ga0587086_074799 3300059507 Bacteria 588
944 Ga0587091_101103 3300059511 Bacteria 676
945 Ga0587106_002519 3300059605 Bacteria 1811
946 Ga0587099_021626 3300059622 Bacteria 730
947 Ga0587101_061636 3300059623 Bacteria 671
948 Ga0587109_106053 3300059624 Bacteria 651
949 Ga0587117_067301 3300059627 Bacteria 628
950 Ga0587067_016625 3300059640 Bacteria 1211
951 Ga0587072_035518 3300059643 Bacteria 950
952 Ga0587075_043196 3300059644 Bacteria 763
953 Ga0587076_000891 3300059645 Bacteria 2787
954 Ga0587079_146728 3300059647 Bacteria 606
955 Ga0587107_031210 3300059652 Bacteria 812
956 Ga0587114_113132 3300059655 Bacteria 542
957 Ga0587071_078573 3300060344 Bacteria 731
958 Ga0587111_0128964 3300060346 Bacteria 659
959 Ga0501082_0030716 3300060353 Bacteria 4631
960 Ga0501082_0046790 3300060353 Bacteria 3728
961 Ga0501082_0102271 3300060353 Bacteria 2479
962 Ga0501082_0217075 3300060353 Bacteria 1664
963 Ga0501082_0317532 3300060353 Bacteria 1357
964 Ga0501082_0362260 3300060353 Bacteria 1265
965 Ga0466962_0011800 3300061719 Bacteria 4206
966 Ga0111539_10024739
967 JGI24739J22299_10222828
968 JGI25151J46595_10000306
969 JGI25165J46597_1010796
970 JGI25153J46596_10003655
971 JGI25153J46596_10091401
972 rootH1_10008424
973 rootL2_10075568
974 rootH1_10012499
975 rootH1_10297523
976 JGI25160J50197_1001723
977 JGI25161J50226_1004749
978 Ga0055526_1001326
979 Ga0055526_1031321
980 Ga0055524_1000395
981 Ga0055524_1017200
982 Ga0055524_1020409
983 Ga0055528_1000044
984 Ga0055528_1000474
985 Ga0055528_1002042
986 Ga0055528_1010751
987 Ga0055540_1000109
988 Ga0055540_1041871
989 Ga0055531_10032240
990 Ga0058692_1021833
991 Ga0055543_1001847
992 Ga0055543_1005224
993 Ga0065165_1001971
994 Ga0065165_1006220
995 Ga0065165_1152885
996 Ga0065715_10559015
997 Ga0065707_10123227
998 Ga0070658_10049053
999 Ga0070658_10230789
1000 Ga0070658_10266520
1001 Ga0070683_101093607
1002 Ga0070670_100247295
1003 Ga0070670_101874559
1004 Ga0070677_10645172
1005 Ga0070666_11254469
1006 Ga0070680_100062019
1007 Ga0070680_100086233
1008 Ga0070680_100342211
1009 Ga0070682_100232809
1010 Ga0068868_100011174
1011 Ga0068868_101042872
1012 Ga0070660_100453365
1013 Ga0070660_100495482
1014 Ga0070689_101021739
1015 Ga0070691_10018885
1016 Ga0070692_10024986
1017 Ga0070692_10295037
1018 Ga0070668_100017791
1019 Ga0070668_100044744
1020 Ga0070668_101334460
1021 Ga0070669_100004210
1022 Ga0070669_100221885
1023 Ga0070675_100174229
1024 Ga0070659_100453922
1025 Ga0070659_100798095
1026 Ga0070667_100512808
1027 Ga0070709_10790954
1028 Ga0070709_10821428
1029 Ga0070714_100134069
1030 Ga0070714_101399264
1031 Ga0070713_100471370
1032 Ga0070713_100866147
1033 Ga0070710_10477657
1034 Ga0070711_100218660
1035 Ga0070711_100656886
1036 Ga0070711_101110064
1037 Ga0070700_100002123
1038 Ga0070694_100472001
1039 Ga0070663_100470946
1040 Ga0070663_100967050
1041 Ga0070663_100992318
1042 Ga0070662_100153924
1043 Ga0070681_10032753
1044 Ga0070681_10051730
1045 Ga0070681_10134027
1046 Ga0070681_10655035
1047 Ga0068867_100002614
1048 Ga0070707_100598920
1049 Ga0070698_100186202
1050 Ga0070699_100142817
1051 Ga0070679_100000922
1052 Ga0070679_100046080
1053 Ga0070679_100139958
1054 Ga0070679_100651135
1055 Ga0068853_100001311
1056 Ga0068853_100287048
1057 Ga0070672_100934225
1058 Ga0070695_100677987
1059 Ga0070696_100010491
1060 Ga0070696_100270041
1061 Ga0070665_100007168
1062 Ga0070665_100244791
1063 Ga0070665_100281938
1064 Ga0070665_100744845
1065 Ga0068855_100000075
1066 Ga0068855_100087438
1067 Ga0068854_100118739
1068 Ga0068854_100352397
1069 Ga0068856_100262132
1070 Ga0068856_100359271
1071 Ga0068856_100361940
1072 Ga0068856_100980643
1073 Ga0068856_102148820
1074 Ga0070702_100300147
1075 Ga0068859_100158131
1076 Ga0068859_102196711
1077 Ga0068861_100004297
1078 Ga0068861_100008010
1079 Ga0068861_100136760
1080 Ga0068870_10101624
1081 Ga0068858_100175475
1082 Ga0068858_100436414
1083 Ga0068860_100471721
1084 Ga0068860_101629810
1085 Ga0068862_100004600
1086 Ga0068862_100458571
1087 Ga0070717_10346285
1088 Ga0070717_10808287
1089 Ga0075365_10003446
1090 Ga0075365_10011705
1091 Ga0075365_10079423
1092 Ga0075365_10197156
1093 Ga0075368_10008087
1094 Ga0075363_100013679
1095 Ga0075363_100074584
1096 Ga0075364_10468439
1097 Ga0070716_100468968
1098 Ga0070716_101420912
1099 Ga0070712_100024158
1100 Ga0070712_100042405
1101 Ga0070712_100046822
1102 Ga0075362_10000264
1103 Ga0075367_10003934
1104 Ga0075367_10169564
1105 Ga0075367_10202317
1106 Ga0075369_10002368
1107 Ga0075369_10032002
1108 Ga0075369_10123086
1109 Ga0075369_10348503
1110 Ga0075366_10066962
1111 Ga0075366_10109230
1112 Ga0097621_100167911
1113 Ga0097621_100647747
1114 Ga0097621_101900432
1115 Ga0068871_100510471
1116 Ga0068871_100653703
1117 Ga0075428_100000758
1118 Ga0075428_100528343
1119 Ga0075431_100000011
1120 Ga0075431_100360839
1121 Ga0075434_101519204
1122 Ga0075429_100015054
1123 Ga0075429_100048835
1124 Ga0068865_100001819
1125 Ga0068865_100298214
1126 Ga0075436_100027717
1127 Ga0075436_100492992
1128 Ga0075436_100678639
1129 Ga0097620_100158129
1130 Ga0097620_102196722
1131 Ga0079104_1000032
1132 Ga0075435_100024337
1133 Ga0099795_10021964
1134 Ga0105244_10343806
1135 Ga0105240_10000091
1136 Ga0105240_10010353
1137 Ga0105240_10188844
1138 Ga0105240_10199959
1139 Ga0105240_11794558
1140 Ga0111539_10158151
1141 Ga0111539_10169371
1142 Ga0105245_10653884
1143 Ga0105245_11882191
1144 Ga0105247_10044031
1145 Ga0105247_10243114
1146 Ga0105247_10686414
1147 Ga0114129_11797739
1148 Ga0105243_10002935
1149 Ga0105241_10289114
1150 Ga0105241_10406342
1151 Ga0105241_11842143
1152 Ga0105242_10107594
1153 Ga0105242_10437288
1154 Ga0105242_10908591
1155 Ga0105248_10877914
1156 Ga0105248_13235689
1157 Ga0105237_10616558
1158 Ga0105237_11723021
1159 Ga0105238_10012336
1160 Ga0105238_10577769
1161 Ga0105249_10028823
1162 Ga0105249_10173209
1163 Ga0105249_11869175
1164 Ga0105249_12228726
1165 Ga0099796_10000023
1166 Ga0099796_10009092
1167 Ga0105239_10036500
1168 Ga0105239_12119918
1169 Ga0105239_12919272
1170 Ga0105246_10047013
1171 Ga0105246_10493116
1172 Ga0157322_1000013
1173 Ga0157373_10237469
1174 Ga0157373_10557374
1175 Ga0157370_10008908
1176 Ga0157369_10239824
1177 Ga0157369_10838313
1178 Ga0157369_11398171
1179 Ga0157374_10061180
1180 Ga0157374_10849329
1181 Ga0157374_12275244
1182 Ga0157374_12777030
1183 Ga0157378_11109840
1184 Ga0163162_10631552
1185 Ga0157372_10447227
1186 Ga0157372_12828048
1187 Ga0157375_10012541
1188 Ga0157375_10516605
1189 Ga0157375_12400191
1190 Ga0163163_10087170
1191 Ga0163163_10169418
1192 Ga0163163_11009500
1193 Ga0163163_11455977
1194 Ga0163163_11784912
1195 Ga0157380_10024201
1196 Ga0157380_10554148
1197 Ga0182008_10660328
1198 Ga0157377_10096808
1199 Ga0157379_10160210
1200 Ga0157376_10931475
1201 Ga0182006_1198479
1202 Ga0163161_10132000
1203 Ga0163161_10220954
1204 Ga0163161_10747740
1205 Ga0197907_10043327
1206 Ga0206350_11354611
1207 Ga0214542_1018037
1208 Ga0214543_1000005
1209 Ga0213876_10496708
1210 Ga0213875_10051498
1211 Ga0224712_10154532
1212 Ga0207425_1003494
1213 Ga0209148_1001052
1214 Ga0209129_1002523
1215 Ga0209233_1001623
1216 Ga0209233_1002454
1217 Ga0209233_1031649
1218 Ga0209455_1011474
1219 Ga0209673_1000013
1220 Ga0209673_1000557
1221 Ga0209673_1001282
1222 Ga0209673_1003182
1223 Ga0209673_1017351
1224 Ga0209675_1042931
1225 Ga0209676_1015701
1226 Ga0209025_1000058
1227 Ga0209564_1000118
1228 Ga0209564_1000167
1229 Ga0209564_1044691
1230 Ga0209758_1000209
1231 Ga0209758_1000878
1232 Ga0209758_1014137
1233 Ga0209758_1033049
1234 Ga0209758_1048195
1235 Ga0209758_1050935
1236 Ga0209050_1019055
1237 Ga0209256_1000160
1238 Ga0209256_1001227
1239 Ga0209256_1004791
1240 Ga0209256_1021977
1241 Ga0207426_1000147
1242 Ga0209051_1000224
1243 Ga0209051_1000390
1244 Ga0209051_1022795
1245 Ga0209257_1003920
1246 Ga0209257_1011573
1247 Ga0209257_1139879
1248 Ga0207682_10292586
1249 Ga0207692_10125200
1250 Ga0207642_10323577
1251 Ga0207710_10091141
1252 Ga0207685_10000568
1253 Ga0207699_10143813
1254 Ga0207699_10224691
1255 Ga0207699_10559139
1256 Ga0207699_10597874
1257 Ga0207699_10648414
1258 Ga0207645_10097676
1259 Ga0207643_10014208
1260 Ga0207643_10789060
1261 Ga0207705_10214385
1262 Ga0207705_10255876
1263 Ga0207705_11095549
1264 Ga0207684_11710692
1265 Ga0207707_10008658
1266 Ga0207707_10112191
1267 Ga0207707_10332290
1268 Ga0207695_10000018
1269 Ga0207695_10035433
1270 Ga0207695_10057465
1271 Ga0207695_10372492
1272 Ga0207671_10645861
1273 Ga0207693_10035708
1274 Ga0207693_10052369
1275 Ga0207693_10077545
1276 Ga0207693_11384281
1277 Ga0207663_10023820
1278 Ga0207663_10070361
1279 Ga0207663_10311589
1280 Ga0207663_10567694
1281 Ga0207663_11263276
1282 Ga0207660_10014320
1283 Ga0207660_10023952
1284 Ga0207660_10067664
1285 Ga0207660_11056956
1286 Ga0207657_10497210
1287 Ga0207652_10020155
1288 Ga0207652_10180096
1289 Ga0207652_10545378
1290 Ga0207652_10965928
1291 Ga0207652_11318447
1292 Ga0207652_11399036
1293 Ga0207681_10001355
1294 Ga0207694_10000018
1295 Ga0207694_10492552
1296 Ga0207650_10210026
1297 Ga0207650_11740068
1298 Ga0207659_10212423
1299 Ga0207700_10002145
1300 Ga0207700_10129656
1301 Ga0207700_10444787
1302 Ga0207700_10578946
1303 Ga0207664_10752207
1304 Ga0207690_10082427
1305 Ga0207690_10982221
1306 Ga0207690_11162559
1307 Ga0207706_10103182
1308 Ga0207706_11069176
1309 Ga0207709_10032314
1310 Ga0207669_10561133
1311 Ga0207704_10006461
1312 Ga0207665_10168701
1313 Ga0207691_10622287
1314 Ga0207691_10845978
1315 Ga0207661_10610299
1316 Ga0207679_10953108
1317 Ga0207667_10000052
1318 Ga0207667_10283258
1319 Ga0207651_10210141
1320 Ga0207651_10932721
1321 Ga0207712_10005328
1322 Ga0207712_10329531
1323 Ga0207668_10073947
1324 Ga0207668_10653467
1325 Ga0207668_11170676
1326 Ga0207640_10225517
1327 Ga0207677_10020570
1328 Ga0207677_11636273
1329 Ga0207703_10256522
1330 Ga0207703_10750337
1331 Ga0207639_10002815
1332 Ga0207639_10240471
1333 Ga0207639_11493790
1334 Ga0207678_10640514
1335 Ga0207708_10001370
1336 Ga0207702_10206584
1337 Ga0207702_10373464
1338 Ga0207702_10499397
1339 Ga0207702_11664581
1340 Ga0207648_10006874
1341 Ga0207648_10282957
1342 Ga0207674_10634480
1343 Ga0207675_100002718
1344 Ga0207675_100030886
1345 Ga0207683_10452342
1346 Ga0207683_10602890
1347 Ga0207683_11412608
1348 Ga0207698_10007839
1349 Ga0209281_1000053
1350 Ga0209371_1042730
1351 Ga0209179_1000175
1352 Ga0209179_1020592
1353 Ga0209983_1061399
1354 Ga0209813_10024390
1355 Ga0207428_10001843
1356 Ga0207428_10014039
1357 Ga0207428_10600955
1358 Ga0268266_10008848
1359 Ga0268266_10243564
1360 Ga0268266_10490532
1361 Ga0268265_10010433
1362 Ga0268265_10733699
1363 Ga0268265_10849861
1364 Ga0268264_10338455
1365 Ga0268264_10911438
1366 Ga0268264_11413296
1367 Ga0307515_10401196
1368 Ga0268256_1037489
1369 Ga0314311_1036646
1370 Ga0316182_1084857
1371 Ga0265760_10183749
1372 Ga0307513_10368578
1373 Ga0307408_100951764
1374 Ga0307508_10000100
1375 Ga0307508_10464616
1376 Ga0307516_10042183
1377 Ga0307413_10241183
1378 Ga0307413_10784013
1379 Ga0307412_10101378
1380 Ga0307409_102440503
1381 Ga0307411_11085278
1382 Ga0307510_10105997
1383 Ga0307510_10156071
1384 Ga0307510_10247111
1385 Ga0373934_0165852
1386 Ga0373934_0413696
1387 Ga0373944_0342420
1388 Ga0373923_0000829
1389 Ga0373936_0001166
1390 Ga0373945_0083201
1391 Ga0373953_0005121
1392 Ga0373953_0346511
1393 Ga0373954_0003062
1394 Ga0373954_0120246
1395 Ga0373956_0301690
1396 Ga0373957_0446448
1397 Ga0373960_0155655
1398 Ga0373943_0023535
1399 Ga0373943_0455154
1400 Ga0373943_0878174
1401 Ga0373946_0158396
1402 Ga0373955_0003572
1403 Ga0373961_0006801
1404 Ga0373924_0006186
1405 Ga0373931_0089440
1406 Ga0373935_0000117
1407 Ga0373935_0371543
1408 Ga0373935_0836620
1409 Ga0373927_0137640
1410 Ga0373933_0006556
1411 Ga0373933_0153188
1412 Ga0373933_0241484
1413 Ga0373947_0000276
1414 Ga0373947_0125354
1415 Ga0373937_0000052
1416 Ga0373937_0051892
1417 Ga0373937_0124945
1418 Ga0373937_0400294
1419 Ga0373937_0528471
1420 Ga0373925_0000019
1421 Ga0373925_0025932
1422 Ga0373925_0073597
1423 Ga0373925_0133779
1424 Ga0373925_1635935
1425 Ga0395899_0255344
1426 Ga0395899_0442326
1427 Ga0395900_0001586
1428 Ga0395900_0107986
1429 Ga0395900_0156437
1430 Ga0395900_0165806
1431 Ga0395900_0844115
1432 Ga0395898_0006493
1433 Ga0395898_0064243
1434 Ga0395898_0752369
1435 Ga0395905_0013634
1436 Ga0395905_0192436
1437 Ga0395905_0590888
1438 Ga0436364_0556111
1439 Ga0436364_0991952
1440 Ga0395901_0078373
1441 Ga0395901_0102137
1442 Ga0395901_0253199
1443 Ga0395901_0266418
1444 Ga0395901_0388018
1445 Ga0395901_0418829
1446 Ga0395901_1066725
1447 Ga0395901_1660917
1448 Ga0436365_0805373
1449 Ga0436365_1116090
1450 Ga0436360_0413971
1451 Ga0436360_1174616
1452 Ga0436360_1276861
1453 Ga0436361_0973013
1454 Ga0436363_0045921
1455 Ga0436363_0100535
1456 Ga0436363_0467120
1457 Ga0436363_0842799
1458 Ga0436363_1427156
1459 Ga0436362_0165852
1460 Ga0436362_0325873
1461 Ga0436362_1047858
1462 Ga0451789_0573928
1463 Ga0451793_0484893
1464 Ga0451795_1274319
1465 Ga0451807_0666639
1466 Ga0451833_0995772
1467 Ga0451835_0376890
1468 Ga0451835_0664346
1469 Ga0451837_0639563
1470 Ga0451841_0552134
1471 Ga0451845_0653309
1472 Ga0451849_0094019
1473 Ga0451851_1046301
1474 Ga0451853_0534119
1475 Ga0451853_2562927
1476 Ga0451853_2605588
1477 Ga0439441_023220
1478 Ga0439455_0061474
1479 Ga0439464_0067784
1480 Ga0439460_0070042
1481 Ga0466969_0182267
1482 Ga0466966_0171971
1483 Ga0466966_0187022
1484 Ga0466961_0471088
1485 Ga0466961_0526147
1486 Ga0466964_0342313
1487 Ga0466971_0358877
1488 Ga0466971_0383221
1489 Ga0466970_0304196
1490 Ga0466957_0030929
1491 Ga0466957_0466634
1492 Ga0466957_0591980
1493 Ga0466959_0143948
1494 Ga0466959_0485503
1495 Ga0466958_0016636
1496 Ga0466967_0005344
1497 Ga0466967_0017289
1498 Ga0495592_0000005
1499 Ga0495629_0086189
1500 Ga0495638_0004099
1501 Ga0495638_0066012
1502 Ga0495651_0001128
1503 Ga0495653_0000017
1504 Ga0495650_0028954
1505 Ga0495650_0195446
1506 Ga0495605_0024318
1507 Ga0495662_0007127
1508 Ga0495662_0219417
1509 Ga0495664_0000014
1510 Ga0495584_0076119
1511 Ga0495594_0204793
1512 Ga0495596_0049895
1513 Ga0495607_0055231
1514 Ga0495583_0126822
1515 Ga0495583_0231907
1516 Ga0495606_0029617
1517 Ga0495606_0171032
1518 Ga0495608_0000034
1519 Ga0495610_0014074
1520 Ga0495610_0139663
1521 Ga0495616_0171750
1522 Ga0495616_0206920
1523 Ga0495618_0000011
1524 Ga0495620_0022071
1525 Ga0495628_0000017
1526 Ga0495628_0178576
1527 Ga0495630_0208808
1528 Ga0495631_0175256
1529 Ga0495631_0205595
1530 Ga0495632_0009006
1531 Ga0495643_0011904
1532 Ga0495643_0239749
1533 Ga0495648_0033232
1534 Ga0495648_0042090
1535 Ga0495652_0000008
1536 Ga0495652_0252287
1537 Ga0495652_0701673
1538 Ga0495654_0000092
1539 Ga0495640_0000024
1540 Ga0495640_0081154
1541 Ga0495587_0000039
1542 Ga0495587_0470776
1543 Ga0495598_0240400
1544 Ga0495597_0064955
1545 Ga0495645_0000006
1546 Ga0495645_0839249
1547 Ga0495622_0029524
1548 Ga0495633_0026796
1549 Ga0495667_0000026
1550 Ga0495667_0004467
1551 Ga0495667_0116865
1552 Ga0495667_0276485
1553 Ga0495667_0418482
1554 Ga0495668_0004588
1555 Ga0495668_0084524
1556 Ga0495668_0241192
1557 Ga0495634_0000009
1558 Ga0495634_0261661
1559 Ga0495611_0402818
1560 Ga0495625_0017851
1561 Ga0495625_0091102
1562 Ga0495625_0101057
1563 Ga0495625_0104532
1564 Ga0495635_0000014
1565 Ga0495635_0550569
1566 Ga0495588_0062882
1567 Ga0495588_0082908
1568 Ga0495657_0000038
1569 Ga0495657_0046398
1570 Ga0495657_0366698
1571 Ga0495599_0000010
1572 Ga0495599_0358303
1573 Ga0495623_0000074
1574 Ga0495623_0251773
1575 Ga0495646_0000008
1576 Ga0495658_0703290
1577 Ga0495669_0098429
1578 Ga0495670_0130370
1579 Ga0495671_0327056
1580 Ga0495649_0006352
1581 Ga0495649_0347147
1582 Ga0495600_0000046
1583 Ga0495660_0018777
1584 Ga0495581_0105630
1585 Ga0495604_0000006
1586 Ga0495604_0110716
1587 Ga0495674_0000009
1588 Ga0495676_0334700
1589 Ga0495680_0000309
1590 Ga0495680_0084072
1591 Ga0495683_0020701
1592 Ga0495687_018973
1593 Ga0495675_0000044
1594 Ga0495681_0130536
1595 Ga0495684_0000015
1596 Ga0495684_0616761
1597 Ga0495686_0031954
1598 Ga0495686_0207264
1599 Ga0495593_0001931
1600 Ga0495602_0000006
1601 Ga0495626_0139270
1602 Ga0496100_0032903
1603 Ga0496101_0154452
1604 Ga0496101_0166052
1605 Ga0496102_0045526
1606 Ga0496102_0256158
1607 Ga0496102_0279088
1608 Ga0496104_0154327
1609 Ga0496104_0204255
1610 Ga0496104_0230168
1611 Ga0496106_0126310
1612 Ga0496106_0181290
1613 Ga0496107_0065780
1614 Ga0496107_0150418
1615 Ga0496107_0502286
1616 Ga0496108_0744691
1617 Ga0496109_1505565
1618 Ga0496109_1675964
1619 Ga0496109_1697692
1620 Ga0496111_0488123
1621 Ga0496112_0082873
1622 Ga0496112_0348976
1623 Ga0496112_0695731
1624 Ga0496113_0041330
1625 Ga0496114_0358881
1626 Ga0496115_0193832
1627 Ga0496115_0243314
1628 Ga0496115_0310678
1629 Ga0496116_0045169
1630 Ga0496116_0168197
1631 Ga0496116_0277736
1632 Ga0496117_0097323
1633 Ga0496117_0118366
1634 Ga0496118_0055453
1635 Ga0496118_0071415
1636 Ga0496118_0081880
1637 Ga0496119_0058946
1638 Ga0496119_0098092
1639 Ga0496121_0085717
1640 Ga0496121_0101640
1641 Ga0496121_0191953
1642 Ga0496121_0245936
1643 Ga0496121_0258418
1644 Ga0496121_0510917
1645 Ga0496122_0047059
1646 Ga0496122_0313454
1647 Ga0496124_0006399
1648 Ga0496124_0066866
1649 Ga0496124_0151238
1650 Ga0496124_0260017
1651 Ga0496124_0628802
1652 Ga0496125_0368643
1653 Ga0496126_0441710
1654 Ga0496126_0562981
1655 Ga0496126_0648424
1656 Ga0496126_1308912
1657 Ga0495678_018936
1658 Ga0495682_0001599
1659 Ga0501031_0000005
1660 Ga0501031_0071156
1661 Ga0501031_0248203
1662 Ga0501032_0000442
1663 Ga0501032_0002265
1664 Ga0501032_0016737
1665 Ga0501032_0174561
1666 Ga0501032_0373661
1667 Ga0501032_0633490
1668 Ga0501033_0000578
1669 Ga0501033_0001698
1670 Ga0501033_0004152
1671 Ga0501033_0020661
1672 Ga0501033_0030146
1673 Ga0501034_0001277
1674 Ga0501034_0033968
1675 Ga0501034_0081735
1676 Ga0501034_0189593
1677 Ga0501034_0499255
1678 Ga0501034_0928168
1679 Ga0501034_1366567
1680 Ga0501036_0000305
1681 Ga0501036_0019971
1682 Ga0501036_0060543
1683 Ga0501036_0077745
1684 Ga0501036_0088830
1685 Ga0501036_0367529
1686 Ga0501036_0852859
1687 Ga0501037_0000441
1688 Ga0501037_0008100
1689 Ga0501037_0019848
1690 Ga0501037_0039290
1691 Ga0501037_0257559
1692 Ga0501038_0000511
1693 Ga0501038_0033922
1694 Ga0501038_0040102
1695 Ga0501038_0355687
1696 Ga0501038_0959995
1697 Ga0501038_1233854
1698 Ga0501039_0000318
1699 Ga0501039_0102241
1700 Ga0501039_0145646
1701 Ga0501039_0223052
1702 Ga0501040_0007413
1703 Ga0501042_0042120
1704 Ga0501042_0357750
1705 Ga0501042_0825493
1706 Ga0501043_0000446
1707 Ga0501043_0001518
1708 Ga0501043_0193762
1709 Ga0501043_0237103
1710 Ga0501043_0537700
1711 Ga0501046_0040692
1712 Ga0501046_0049009
1713 Ga0501046_0124033
1714 Ga0501046_0158979
1715 Ga0501046_0285198
1716 Ga0501046_0386524
1717 Ga0501047_0001273
1718 Ga0501047_0017220
1719 Ga0501047_0032877
1720 Ga0501047_0034437
1721 Ga0501047_0073964
1722 Ga0501047_0173317
1723 Ga0501047_0333639
1724 Ga0501048_0013144
1725 Ga0501067_0015807
1726 Ga0501067_0277109
1727 Ga0501067_0311471
1728 Ga0501068_0015336
1729 Ga0501068_0043495
1730 Ga0501068_0063235
1731 Ga0501068_0222458
1732 Ga0501069_0000028
1733 Ga0501069_0019616
1734 Ga0501069_0045179
1735 Ga0501069_0051005
1736 Ga0501069_0119509
1737 Ga0501069_0152585
1738 Ga0501069_0552770
1739 Ga0501069_0821798
1740 Ga0501070_0000480
1741 Ga0501070_0003350
1742 Ga0501070_0005618
1743 Ga0501070_0020274
1744 Ga0501070_0021774
1745 Ga0501070_0035668
1746 Ga0501070_0054281
1747 Ga0501070_0062458
1748 Ga0501071_0012350
1749 Ga0501071_0034023
1750 Ga0501071_0078989
1751 Ga0501072_0231907
1752 Ga0501072_0472418
1753 Ga0501072_0507644
1754 Ga0501073_0004757
1755 Ga0501073_0067587
1756 Ga0501073_0076652
1757 Ga0501073_0196827
1758 Ga0501073_0209472
1759 Ga0501073_1191579
1760 Ga0501074_0001595
1761 Ga0501074_0024196
1762 Ga0501074_0095639
1763 Ga0501074_0784712
1764 Ga0501074_1115811
1765 Ga0501076_0758932
1766 Ga0501077_0093683
1767 Ga0501079_0427672
1768 Ga0501079_0690870
1769 Ga0501080_0005343
1770 Ga0501080_0005473
1771 Ga0501080_0021113
1772 Ga0501080_0023261
1773 Ga0501080_0043178
1774 Ga0501080_0077963
1775 Ga0501080_0344840
1776 Ga0501080_0507761
1777 Ga0501080_0513050
1778 Ga0501080_0708382
1779 Ga0501080_0920711
1780 Ga0501081_0127577
1781 Ga0501083_0003437
1782 Ga0501083_0040131
1783 Ga0501083_0332208
1784 Ga0501083_0377359
1785 Ga0501083_0423202
1786 Ga0501083_0460838
1787 Ga0501241_114432
1788 Ga0501035_0000036
1789 Ga0501035_0000779
1790 Ga0501035_0003150
1791 Ga0501035_0052347
1792 Ga0501035_0053127
1793 Ga0501035_0092163
1794 Ga0501035_0204546
1795 Ga0501035_0310854
1796 Ga0501035_0317252
1797 Ga0501044_0000011
1798 Ga0501044_0000997
1799 Ga0501044_0046896
1800 Ga0501044_0085448
1801 Ga0501044_0085657
1802 Ga0501044_0126127
1803 Ga0501044_0132246
1804 Ga0501044_0172438
1805 Ga0501044_0753172
1806 Ga0501044_0958267
1807 Ga0501045_0009075
1808 nmdc:mga03683_217056_c1
1809 nmdc:mga03683_241_c1
1810 nmdc:mga03n38_22833_c1
1811 nmdc:mga03n38_31320_c1
1812 nmdc:mga03n38_572725_c1
1813 nmdc:mga03n38_685615_c1
1814 nmdc:mga03n38_797435_c1
1815 nmdc:mga00v17_69298_c1
1816 nmdc:mga00v17_717013_c1
1817 nmdc:mga00v17_84611_c1
1818 nmdc:mga0yw44_14483_c1
1819 nmdc:mga0yw44_35225_c1
1820 nmdc:mga0yw44_9086_c1
1821 nmdc:mga0k408_20513_c1
1822 nmdc:mga0k408_213180_c1
1823 nmdc:mga06z11_1098_c1
1824 nmdc:mga06z11_136607_c1
1825 nmdc:mga04h51_197397_c1
1826 nmdc:mga07m45_184945_c1
1827 nmdc:mga07m45_223357_c1
1828 nmdc:mga05p37_563093_c1
1829 nmdc:mga05p37_744467_c1
1830 nmdc:mga09592_93494_c1
1831 nmdc:mga08y16_107806_c1
1832 nmdc:mga08y16_257930_c1
1833 nmdc:mga0rr50_146001_c1
1834 nmdc:mga0sz30_116984_c1
1835 nmdc:mga0sz30_137153_c1
1836 nmdc:mga0sz30_213661_c1
1837 nmdc:mga0sz30_277435_c1
1838 nmdc:mga0sz30_7324_c1
1839 Ga0495601_0000007
1840 Ga0495601_0155402
1841 Ga0495612_0000015
1842 Ga0495612_0144922
1843 Ga0495612_0302869
1844 Ga0495655_0048367
1845 Ga0495595_0000023
1846 Ga0495595_0019996
1847 Ga0495619_0000017
1848 Ga0495619_1069679
1849 Ga0500578_0063996
1850 Ga0500578_0126586
1851 Ga0500578_0239587
1852 Ga0500643_000046
1853 Ga0500583_0167930
1854 Ga0500583_0330329
1855 Ga0500651_0013380
1856 Ga0500651_0227857
1857 Ga0500651_0445419
1858 Ga0500641_0002960
1859 Ga0500650_0000023
1860 Ga0500650_0180823
1861 Ga0500555_010932
1862 Ga0500556_0001345
1863 Ga0500556_0074910
1864 Ga0500569_002373
1865 Ga0500572_048409
1866 Ga0500572_272677
1867 Ga0500594_0025437
1868 Ga0500594_0219846
1869 Ga0500595_001530
1870 Ga0500607_104705
1871 Ga0500618_006819
1872 Ga0500618_025926
1873 Ga0500642_0001181
1874 Ga0500652_121842
1875 Ga0500658_0025643
1876 Ga0500658_0054038
1877 Ga0500568_0000066
1878 Ga0500568_0011009
1879 Ga0500577_0140293
1880 Ga0500616_0004258
1881 Ga0500616_0023969
1882 Ga0500616_0068346
1883 Ga0500619_007297
1884 Ga0500620_011648
1885 Ga0500622_0038376
1886 Ga0500624_016821
1887 Ga0500627_0101385
1888 Ga0500627_0365788
1889 Ga0500633_0047552
1890 Ga0500634_0276445
1891 Ga0500636_0123665
1892 Ga0500645_071444
1893 Ga0500645_077706
1894 Ga0500645_102669
1895 Ga0500552_001260
1896 Ga0500599_004294
1897 Ga0501084_1066613
1898 Ga0501084_1096255
1899 Ga0501084_1121898
1900 Ga0500661_003671
1901 Ga0587073_0022355
1902 Ga0587073_0103271
1903 Ga0587077_133142
1904 Ga0587080_061269
1905 Ga0587082_060501
1906 Ga0587083_0021817
1907 Ga0587086_074799
1908 Ga0587091_101103
1909 Ga0587106_002519
1910 Ga0587099_021626
1911 Ga0587101_061636
1912 Ga0587109_106053
1913 Ga0587117_067301
1914 Ga0587067_016625
1915 Ga0587072_035518
1916 Ga0587075_043196
1917 Ga0587076_000891
1918 Ga0587079_146728
1919 Ga0587107_031210
1920 Ga0587114_113132
1921 Ga0587071_078573
1922 Ga0587111_0128964
1923 Ga0501082_0030716
1924 Ga0501082_0046790
1925 Ga0501082_0102271
1926 Ga0501082_0217075
1927 Ga0501082_0317532
1928 Ga0501082_0362260
1929 Ga0466962_0011800

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

12

141

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9979 2 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9928 2 144
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9907 2 144
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9897 1 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9858 2 144
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9978 2 144 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9905 2 144 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8984 4 140 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8509 1 139 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8434 3 139 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A530H529-F1-model_v4 Toxin 1.003 1 136
AF-A0A529M9F3-F1-model_v4 Toxin 1.003 1 118
AF-A0A023XIA1-F1-model_v4 deleted 1.002 1 147
AF-A0A7X8SZC2-F1-model_v4 SRPBCC family protein 1.002 1 147
AF-A0A3S1ZYZ0-F1-model_v4 deleted 1.002 1 147

Map