F486944
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 423 | 1928 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300041405|Ga0439438_000033|Ga0439438_000033_41544_42098 |
| Length | 184 |
| Sequence | MCGGLREMWVIVLNSSPVCPTYYRESLSMRRALGVSLFLMLLSLSACALFPHRDPLNITVVGIEPLPSQELEMRFAVKLRLQNPNETAIDYNGVALDLEVNGRTLASGVSDQTGSIPRFSEAVLSVPVSISAFSVLRQTLGLSQTQSLDNLPYVLKGKLAGGLFGTLRFVDRGTLDLPGTAATW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 31 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 32 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 33 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 90 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 91 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 92 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 95 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 96 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 97 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 102 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 103 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 104 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 106 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 107 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 108 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 109 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 110 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 111 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 112 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 113 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 114 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 115 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 116 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 117 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 118 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 119 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 120 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 121 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 122 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 123 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 124 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 125 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 126 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 127 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 128 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 129 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 130 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 230 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 231 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 232 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 233 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 234 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 235 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 236 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 237 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 238 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 239 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 240 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 241 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 242 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 243 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 244 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 245 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 246 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 247 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 248 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 249 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 250 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 251 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 252 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 253 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 254 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 255 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 256 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 257 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 258 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 259 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 260 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 261 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 262 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 263 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 264 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 265 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 266 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 267 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 268 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 269 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 270 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 271 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 272 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 273 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 274 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 275 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 276 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 277 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 278 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 279 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 280 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 281 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 282 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 283 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 284 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 285 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 286 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 287 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 288 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 289 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 290 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 291 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 292 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 293 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 294 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 295 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 296 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 297 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 298 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 299 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 300 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 301 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 302 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 303 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 304 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 305 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 306 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 307 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 308 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 309 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 310 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 311 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 312 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 313 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 314 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 315 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 316 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 317 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 318 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 319 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 320 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 321 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 322 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 323 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 324 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 325 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 326 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 327 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 328 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 329 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 330 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 331 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 332 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 333 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 334 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 335 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 336 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 337 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 338 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 339 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 340 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 341 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 342 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 343 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 344 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 345 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 346 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 347 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 348 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 349 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 350 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 351 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 352 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 353 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 354 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 355 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 356 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 357 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 358 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 359 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 360 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 361 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 362 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 363 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 364 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 365 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 366 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 367 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 368 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 369 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 370 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 371 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 372 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 373 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 374 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 375 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 376 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 377 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 378 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 379 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 380 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 381 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 382 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 383 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 384 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 385 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 386 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 387 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 388 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 389 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 390 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 391 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 392 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 393 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 394 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 395 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 396 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 397 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 398 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 399 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 400 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 401 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 402 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 403 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 404 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 405 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 406 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 407 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 408 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 409 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 410 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 411 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 412 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 413 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 414 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 415 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 416 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 417 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 418 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 419 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 420 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 421 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 422 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 423 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.71 |
| Metatranscriptomes | 0 |
| Isolates | 19.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.19 |
| Nodule | 1.87 |
| Rhizoplane | 7.57 |
| Rhizosphere | 73.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439438_000033 | 3300041405 | Bacteria | 69839 |
| 2 | MRS2a_Contig_14 | 2124908027 | Bacteria | 25214 |
| 3 | MRS1b_contig_7203591 | 2162886011 | Bacteria | 1857 |
| 4 | JGI25163J39215_1000030 | 3300002771 | Bacteria | 65586 |
| 5 | JGI25163J39215_1000145 | 3300002771 | Bacteria | 28053 |
| 6 | JGI25164J39214_1000027 | 3300002772 | Bacteria | 156759 |
| 7 | JGI25164J39214_1000092 | 3300002772 | Bacteria | 90356 |
| 8 | JGI25165J46597_1000084 | 3300003214 | Bacteria | 172199 |
| 9 | JGI25165J46597_1000101 | 3300003214 | Bacteria | 156765 |
| 10 | Ga0055538_1000123 | 3300003751 | Bacteria | 58939 |
| 11 | Ga0055539_1000167 | 3300003752 | Bacteria | 58939 |
| 12 | Ga0055533_1000171 | 3300003756 | Bacteria | 58939 |
| 13 | Ga0055532_1000159 | 3300003758 | Bacteria | 59066 |
| 14 | Ga0055525_1000232 | 3300003759 | Bacteria | 58939 |
| 15 | Ga0055535_1006313 | 3300003761 | Bacteria | 2423 |
| 16 | Ga0055536_1000014 | 3300003781 | Bacteria | 240624 |
| 17 | Ga0055530_10000009 | 3300003791 | Bacteria | 174044 |
| 18 | Ga0055530_10000019 | 3300003791 | Bacteria | 140299 |
| 19 | Ga0055540_1000055 | 3300003792 | Bacteria | 140299 |
| 20 | Ga0055540_1000556 | 3300003792 | Bacteria | 27561 |
| 21 | Ga0055541_1000112 | 3300003841 | Bacteria | 58923 |
| 22 | Ga0065714_10002287 | 3300005288 | Bacteria | 28980 |
| 23 | Ga0065714_10016219 | 3300005288 | Bacteria | 2242 |
| 24 | Ga0065714_10065686 | 3300005288 | Bacteria | 8858 |
| 25 | Ga0065714_10073274 | 3300005288 | Bacteria | 3214 |
| 26 | Ga0065714_10144891 | 3300005288 | Bacteria | 1145 |
| 27 | Ga0065704_10007733 | 3300005289 | Bacteria | 3903 |
| 28 | Ga0065704_10016866 | 3300005289 | Bacteria | 2159 |
| 29 | Ga0065704_10070497 | 3300005289 | Bacteria | 22482 |
| 30 | Ga0065704_10336572 | 3300005289 | Bacteria | 830 |
| 31 | Ga0065712_10002138 | 3300005290 | Bacteria | 5861 |
| 32 | Ga0065715_10280905 | 3300005293 | Bacteria | 1083 |
| 33 | Ga0070670_100000087 | 3300005331 | Bacteria | 88228 |
| 34 | Ga0070670_100001780 | 3300005331 | Bacteria | 17538 |
| 35 | Ga0070661_100013109 | 3300005344 | Bacteria | 5816 |
| 36 | Ga0070669_100000583 | 3300005353 | Bacteria | 27152 |
| 37 | Ga0070669_100317908 | 3300005353 | Bacteria | 1256 |
| 38 | Ga0070662_100051896 | 3300005457 | Bacteria | 2963 |
| 39 | Ga0070662_100247864 | 3300005457 | Bacteria | 1431 |
| 40 | Ga0068853_100016563 | 3300005539 | Bacteria | 6070 |
| 41 | Ga0070665_100387189 | 3300005548 | Bacteria | 1406 |
| 42 | Ga0070664_100000042 | 3300005564 | Bacteria | 77212 |
| 43 | Ga0070664_101270311 | 3300005564 | Bacteria | 695 |
| 44 | Ga0068851_10000268 | 3300005834 | Bacteria | 24414 |
| 45 | Ga0075364_10326030 | 3300006051 | Bacteria | 1046 |
| 46 | Ga0075436_100463649 | 3300006914 | Bacteria | 924 |
| 47 | Ga0079104_1000612 | 3300006946 | Bacteria | 35183 |
| 48 | Ga0079104_1020269 | 3300006946 | Bacteria | 1836 |
| 49 | Ga0099826_10010705 | 3300006948 | Bacteria | 6880 |
| 50 | Ga0105251_10003010 | 3300009011 | Bacteria | 12570 |
| 51 | Ga0105251_10003185 | 3300009011 | Bacteria | 12135 |
| 52 | Ga0105251_10042542 | 3300009011 | Bacteria | 2204 |
| 53 | Ga0105251_10049212 | 3300009011 | Bacteria | 2018 |
| 54 | Ga0105251_10090954 | 3300009011 | Bacteria | 1402 |
| 55 | Ga0105244_10006007 | 3300009036 | Bacteria | 7954 |
| 56 | Ga0105244_10019652 | 3300009036 | Bacteria | 3765 |
| 57 | Ga0105244_10024096 | 3300009036 | Bacteria | 3326 |
| 58 | Ga0105244_10051132 | 3300009036 | Bacteria | 2106 |
| 59 | Ga0105244_10095113 | 3300009036 | Bacteria | 1462 |
| 60 | Ga0105244_10126841 | 3300009036 | Bacteria | 1233 |
| 61 | Ga0105244_10203356 | 3300009036 | Bacteria | 933 |
| 62 | Ga0105244_10338095 | 3300009036 | Bacteria | 694 |
| 63 | Ga0105244_10343142 | 3300009036 | Bacteria | 689 |
| 64 | Ga0105250_10000158 | 3300009092 | Bacteria | 58645 |
| 65 | Ga0105250_10000593 | 3300009092 | Bacteria | 23700 |
| 66 | Ga0105250_10010389 | 3300009092 | Bacteria | 3881 |
| 67 | Ga0105250_10015699 | 3300009092 | Bacteria | 3100 |
| 68 | Ga0105250_10020995 | 3300009092 | Bacteria | 2637 |
| 69 | Ga0105250_10031479 | 3300009092 | Bacteria | 2130 |
| 70 | Ga0105250_10037248 | 3300009092 | Bacteria | 1952 |
| 71 | Ga0105250_10056632 | 3300009092 | Bacteria | 1573 |
| 72 | Ga0105250_10075703 | 3300009092 | Bacteria | 1362 |
| 73 | Ga0105250_10086624 | 3300009092 | Bacteria | 1272 |
| 74 | Ga0105250_10097854 | 3300009092 | Bacteria | 1196 |
| 75 | Ga0105243_10015032 | 3300009148 | Bacteria | 5858 |
| 76 | Ga0105243_10060354 | 3300009148 | Bacteria | 3030 |
| 77 | Ga0105242_10039070 | 3300009176 | Bacteria | 3819 |
| 78 | Ga0105248_10685498 | 3300009177 | Bacteria | 1156 |
| 79 | Ga0105237_10002354 | 3300009545 | Bacteria | 23501 |
| 80 | Ga0105246_10000801 | 3300011119 | Bacteria | 17857 |
| 81 | Ga0105246_10008402 | 3300011119 | Bacteria | 6346 |
| 82 | Ga0157345_1000062 | 3300012498 | Bacteria | 22806 |
| 83 | Ga0157373_10000554 | 3300013100 | Bacteria | 29289 |
| 84 | Ga0157373_10000675 | 3300013100 | Bacteria | 26713 |
| 85 | Ga0157373_10001783 | 3300013100 | Bacteria | 16355 |
| 86 | Ga0157373_10003049 | 3300013100 | Bacteria | 12638 |
| 87 | Ga0157373_10009090 | 3300013100 | Bacteria | 7351 |
| 88 | Ga0157373_10082201 | 3300013100 | Bacteria | 2270 |
| 89 | Ga0157373_10103560 | 3300013100 | Bacteria | 2002 |
| 90 | Ga0157373_10214911 | 3300013100 | Bacteria | 1356 |
| 91 | Ga0157371_10000142 | 3300013102 | Bacteria | 103825 |
| 92 | Ga0157371_10002100 | 3300013102 | Bacteria | 19456 |
| 93 | Ga0157371_10002889 | 3300013102 | Bacteria | 16067 |
| 94 | Ga0157371_10036666 | 3300013102 | Bacteria | 3511 |
| 95 | Ga0157370_10044396 | 3300013104 | Bacteria | 4272 |
| 96 | Ga0157370_10100427 | 3300013104 | Bacteria | 2711 |
| 97 | Ga0157370_10404221 | 3300013104 | Bacteria | 1257 |
| 98 | Ga0157369_10001013 | 3300013105 | Bacteria | 35347 |
| 99 | Ga0157369_10018470 | 3300013105 | Bacteria | 7817 |
| 100 | Ga0157369_10028752 | 3300013105 | Bacteria | 6149 |
| 101 | Ga0157369_11080383 | 3300013105 | Bacteria | 820 |
| 102 | Ga0163162_10005115 | 3300013306 | Bacteria | 12641 |
| 103 | Ga0163162_11106148 | 3300013306 | Bacteria | 898 |
| 104 | Ga0163162_11432100 | 3300013306 | Bacteria | 786 |
| 105 | Ga0163162_11954572 | 3300013306 | Bacteria | 672 |
| 106 | Ga0157372_10113148 | 3300013307 | Bacteria | 3110 |
| 107 | Ga0157375_10162642 | 3300013308 | Bacteria | 2375 |
| 108 | Ga0182008_10000563 | 3300014497 | Bacteria | 27425 |
| 109 | Ga0182008_10002156 | 3300014497 | Bacteria | 12533 |
| 110 | Ga0182008_10002369 | 3300014497 | Bacteria | 11860 |
| 111 | Ga0182008_10003170 | 3300014497 | Bacteria | 10067 |
| 112 | Ga0182008_10027769 | 3300014497 | Bacteria | 2864 |
| 113 | Ga0182008_10051897 | 3300014497 | Bacteria | 2033 |
| 114 | Ga0182008_10092440 | 3300014497 | Bacteria | 1492 |
| 115 | Ga0182008_10132532 | 3300014497 | Bacteria | 1243 |
| 116 | Ga0182006_1000206 | 3300015261 | Bacteria | 59352 |
| 117 | Ga0182006_1001357 | 3300015261 | Bacteria | 14974 |
| 118 | Ga0182006_1001807 | 3300015261 | Bacteria | 12320 |
| 119 | Ga0182006_1006330 | 3300015261 | Bacteria | 5514 |
| 120 | Ga0182006_1010414 | 3300015261 | Bacteria | 4136 |
| 121 | Ga0182007_10001484 | 3300015262 | Bacteria | 12551 |
| 122 | Ga0182007_10004046 | 3300015262 | Bacteria | 6755 |
| 123 | Ga0182005_1011162 | 3300015265 | Bacteria | 2567 |
| 124 | Ga0182005_1014884 | 3300015265 | Bacteria | 2174 |
| 125 | Ga0182005_1040005 | 3300015265 | Bacteria | 1275 |
| 126 | Ga0163161_10000111 | 3300017792 | Bacteria | 77470 |
| 127 | Ga0163161_10032983 | 3300017792 | Bacteria | 3700 |
| 128 | Ga0163161_10051618 | 3300017792 | Bacteria | 2979 |
| 129 | Ga0163161_10191889 | 3300017792 | Bacteria | 1571 |
| 130 | Ga0163161_10678471 | 3300017792 | Bacteria | 856 |
| 131 | Ga0209435_108808 | 3300025206 | Bacteria | 1106 |
| 132 | Ga0209760_100014 | 3300025207 | Bacteria | 177898 |
| 133 | Ga0209760_100030 | 3300025207 | Bacteria | 142765 |
| 134 | Ga0209784_100058 | 3300025224 | Bacteria | 167327 |
| 135 | Ga0209566_100045 | 3300025225 | Bacteria | 258557 |
| 136 | Ga0209674_100096 | 3300025226 | Bacteria | 167418 |
| 137 | Ga0209147_100056 | 3300025229 | Bacteria | 258557 |
| 138 | Ga0209563_100064 | 3300025230 | Bacteria | 258557 |
| 139 | Ga0209563_100288 | 3300025230 | Bacteria | 21084 |
| 140 | Ga0207427_100011 | 3300025231 | Bacteria | 640076 |
| 141 | Ga0207427_100022 | 3300025231 | Bacteria | 469701 |
| 142 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 143 | Ga0209437_100025 | 3300025233 | Bacteria | 561333 |
| 144 | Ga0209258_100243 | 3300025242 | Bacteria | 100317 |
| 145 | Ga0209646_1000207 | 3300025246 | Bacteria | 67740 |
| 146 | Ga0209677_100053 | 3300025253 | Bacteria | 167537 |
| 147 | Ga0209759_1003014 | 3300025256 | Bacteria | 6969 |
| 148 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 149 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 150 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 151 | Ga0209676_1000158 | 3300025292 | Bacteria | 162469 |
| 152 | Ga0209676_1000701 | 3300025292 | Bacteria | 46848 |
| 153 | Ga0209676_1001208 | 3300025292 | Bacteria | 27576 |
| 154 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 155 | Ga0209050_1000013 | 3300025298 | Bacteria | 811408 |
| 156 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 157 | Ga0209051_1000007 | 3300025303 | Bacteria | 811408 |
| 158 | Ga0209257_1004709 | 3300025304 | Bacteria | 10233 |
| 159 | Ga0207656_10000674 | 3300025321 | Bacteria | 11189 |
| 160 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 161 | Ga0207696_1000019 | 3300025711 | Bacteria | 476309 |
| 162 | Ga0207696_1000041 | 3300025711 | Bacteria | 311695 |
| 163 | Ga0207696_1001637 | 3300025711 | Bacteria | 11791 |
| 164 | Ga0207696_1018476 | 3300025711 | Bacteria | 2288 |
| 165 | Ga0207696_1022339 | 3300025711 | Bacteria | 2012 |
| 166 | Ga0207696_1024290 | 3300025711 | Bacteria | 1902 |
| 167 | Ga0207696_1038903 | 3300025711 | Bacteria | 1402 |
| 168 | Ga0207696_1051946 | 3300025711 | Bacteria | 1169 |
| 169 | Ga0207655_1000118 | 3300025728 | Bacteria | 159617 |
| 170 | Ga0207655_1000216 | 3300025728 | Bacteria | 99551 |
| 171 | Ga0207655_1001015 | 3300025728 | Bacteria | 28499 |
| 172 | Ga0207655_1004036 | 3300025728 | Bacteria | 10576 |
| 173 | Ga0207655_1029143 | 3300025728 | Bacteria | 2591 |
| 174 | Ga0207655_1041749 | 3300025728 | Bacteria | 1962 |
| 175 | Ga0207655_1079896 | 3300025728 | Bacteria | 1184 |
| 176 | Ga0207655_1093264 | 3300025728 | Bacteria | 1054 |
| 177 | Ga0207655_1104855 | 3300025728 | Bacteria | 966 |
| 178 | Ga0207713_1000275 | 3300025735 | Bacteria | 61536 |
| 179 | Ga0207713_1000903 | 3300025735 | Bacteria | 26873 |
| 180 | Ga0207713_1001384 | 3300025735 | Bacteria | 19658 |
| 181 | Ga0207713_1002856 | 3300025735 | Bacteria | 12135 |
| 182 | Ga0207713_1011556 | 3300025735 | Bacteria | 4787 |
| 183 | Ga0207713_1016989 | 3300025735 | Bacteria | 3672 |
| 184 | Ga0207713_1022934 | 3300025735 | Bacteria | 2951 |
| 185 | Ga0207713_1041300 | 3300025735 | Bacteria | 1926 |
| 186 | Ga0207671_10000163 | 3300025914 | Bacteria | 103443 |
| 187 | Ga0207649_10000050 | 3300025920 | Bacteria | 109366 |
| 188 | Ga0207681_10001448 | 3300025923 | Bacteria | 15273 |
| 189 | Ga0207681_10130565 | 3300025923 | Bacteria | 1857 |
| 190 | Ga0207650_10000418 | 3300025925 | Bacteria | 37720 |
| 191 | Ga0207650_10000500 | 3300025925 | Bacteria | 32613 |
| 192 | Ga0207706_10073777 | 3300025933 | Bacteria | 3000 |
| 193 | Ga0207686_10022450 | 3300025934 | Bacteria | 3634 |
| 194 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 195 | Ga0207709_10004473 | 3300025935 | Bacteria | 8069 |
| 196 | Ga0207711_10553080 | 3300025941 | Bacteria | 1073 |
| 197 | Ga0207679_10000021 | 3300025945 | Bacteria | 221630 |
| 198 | Ga0207679_11342521 | 3300025945 | Bacteria | 656 |
| 199 | Ga0207640_10675409 | 3300025981 | Bacteria | 883 |
| 200 | Ga0207639_10028686 | 3300026041 | Bacteria | 4066 |
| 201 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 202 | Ga0209281_1001370 | 3300027111 | Bacteria | 15006 |
| 203 | Ga0209281_1001819 | 3300027111 | Bacteria | 10624 |
| 204 | Ga0209281_1009142 | 3300027111 | Bacteria | 2346 |
| 205 | Ga0209281_1018951 | 3300027111 | Bacteria | 1367 |
| 206 | Ga0268266_10163685 | 3300028379 | Bacteria | 2014 |
| 207 | Ga0268266_10453912 | 3300028379 | Bacteria | 1219 |
| 208 | Ga0316177_1081644 | 3300030731 | Bacteria | 1386 |
| 209 | Ga0316178_1091477 | 3300030735 | Bacteria | 6245 |
| 210 | Ga0316182_1255784 | 3300030745 | Bacteria | 1148 |
| 211 | Ga0307408_100001439 | 3300031548 | Bacteria | 17701 |
| 212 | Ga0307408_100017237 | 3300031548 | Bacteria | 4832 |
| 213 | Ga0307408_100036082 | 3300031548 | Bacteria | 3473 |
| 214 | Ga0307408_100182404 | 3300031548 | Bacteria | 1684 |
| 215 | Ga0307408_100257472 | 3300031548 | Bacteria | 1442 |
| 216 | Ga0307408_100292169 | 3300031548 | Bacteria | 1361 |
| 217 | Ga0307405_10000123 | 3300031731 | Bacteria | 30657 |
| 218 | Ga0307405_10002024 | 3300031731 | Bacteria | 8786 |
| 219 | Ga0307405_10015828 | 3300031731 | Bacteria | 4095 |
| 220 | Ga0307405_10159343 | 3300031731 | Bacteria | 1596 |
| 221 | Ga0307413_10002782 | 3300031824 | Bacteria | 7210 |
| 222 | Ga0307413_10908153 | 3300031824 | Bacteria | 748 |
| 223 | Ga0307406_10136720 | 3300031901 | Bacteria | 1728 |
| 224 | Ga0307406_10648022 | 3300031901 | Bacteria | 876 |
| 225 | Ga0307407_10142841 | 3300031903 | Bacteria | 1546 |
| 226 | Ga0307412_10001220 | 3300031911 | Bacteria | 14616 |
| 227 | Ga0307412_10001865 | 3300031911 | Bacteria | 11658 |
| 228 | Ga0307412_10031292 | 3300031911 | Bacteria | 3359 |
| 229 | Ga0307409_100028987 | 3300031995 | Bacteria | 3954 |
| 230 | Ga0307416_100674867 | 3300032002 | Bacteria | 1120 |
| 231 | Ga0307411_10003794 | 3300032005 | Bacteria | 7103 |
| 232 | Ga0307411_10112498 | 3300032005 | Bacteria | 1951 |
| 233 | Ga0307510_10002317 | 3300033180 | Bacteria | 21528 |
| 234 | Ga0307510_10389384 | 3300033180 | Bacteria | 838 |
| 235 | Ga0439438_000098 | 3300041405 | Bacteria | 40067 |
| 236 | Ga0439438_000229 | 3300041405 | Bacteria | 25432 |
| 237 | Ga0439438_000512 | 3300041405 | Bacteria | 17576 |
| 238 | Ga0439438_003135 | 3300041405 | Bacteria | 6785 |
| 239 | Ga0439438_028378 | 3300041405 | Bacteria | 1505 |
| 240 | Ga0439447_003078 | 3300041407 | Bacteria | 5953 |
| 241 | Ga0439447_004809 | 3300041407 | Bacteria | 4588 |
| 242 | Ga0439447_010514 | 3300041407 | Bacteria | 2742 |
| 243 | Ga0439447_032343 | 3300041407 | Bacteria | 1307 |
| 244 | Ga0439447_039103 | 3300041407 | Bacteria | 1162 |
| 245 | Ga0439447_040476 | 3300041407 | Bacteria | 1137 |
| 246 | Ga0439447_056022 | 3300041407 | Bacteria | 933 |
| 247 | Ga0439447_059164 | 3300041407 | Bacteria | 903 |
| 248 | Ga0439466_0017099 | 3300041411 | Bacteria | 2614 |
| 249 | Ga0439466_0032202 | 3300041411 | Bacteria | 1789 |
| 250 | Ga0439466_0039815 | 3300041411 | Bacteria | 1574 |
| 251 | Ga0439466_0051797 | 3300041411 | Bacteria | 1343 |
| 252 | Ga0439466_0075031 | 3300041411 | Bacteria | 1072 |
| 253 | Ga0451797_0488993 | 3300041453 | Bacteria | 1093 |
| 254 | Ga0439431_0000305 | 3300041997 | Bacteria | 10128 |
| 255 | Ga0439445_0004598 | 3300042004 | Bacteria | 3126 |
| 256 | Ga0439432_000052 | 3300042006 | Bacteria | 36016 |
| 257 | Ga0439432_000468 | 3300042006 | Bacteria | 15122 |
| 258 | Ga0439432_001010 | 3300042006 | Bacteria | 10629 |
| 259 | Ga0439432_001163 | 3300042006 | Bacteria | 9956 |
| 260 | Ga0439432_001534 | 3300042006 | Bacteria | 8680 |
| 261 | Ga0439432_003028 | 3300042006 | Bacteria | 6257 |
| 262 | Ga0439432_010954 | 3300042006 | Bacteria | 3128 |
| 263 | Ga0439432_021412 | 3300042006 | Bacteria | 2143 |
| 264 | Ga0439432_025256 | 3300042006 | Bacteria | 1949 |
| 265 | Ga0439432_030010 | 3300042006 | Bacteria | 1765 |
| 266 | Ga0439451_003621 | 3300042009 | Bacteria | 3126 |
| 267 | Ga0439451_009523 | 3300042009 | Bacteria | 1966 |
| 268 | Ga0439451_054904 | 3300042009 | Bacteria | 797 |
| 269 | Ga0439451_062145 | 3300042009 | Bacteria | 747 |
| 270 | Ga0439452_000087 | 3300042010 | Bacteria | 79439 |
| 271 | Ga0439452_000292 | 3300042010 | Bacteria | 32220 |
| 272 | Ga0439452_005530 | 3300042010 | Bacteria | 4058 |
| 273 | Ga0439452_005855 | 3300042010 | Bacteria | 3915 |
| 274 | Ga0439452_016681 | 3300042010 | Bacteria | 1990 |
| 275 | Ga0439452_021458 | 3300042010 | Bacteria | 1682 |
| 276 | Ga0439452_047578 | 3300042010 | Bacteria | 991 |
| 277 | Ga0439456_002016 | 3300042013 | Bacteria | 4091 |
| 278 | Ga0439456_003100 | 3300042013 | Bacteria | 3360 |
| 279 | Ga0439456_028069 | 3300042013 | Bacteria | 1200 |
| 280 | Ga0439456_037895 | 3300042013 | Bacteria | 1041 |
| 281 | Ga0439463_005415 | 3300042016 | Bacteria | 3169 |
| 282 | Ga0439463_019904 | 3300042016 | Bacteria | 1672 |
| 283 | Ga0439463_036797 | 3300042016 | Bacteria | 1240 |
| 284 | Ga0439463_051238 | 3300042016 | Bacteria | 1053 |
| 285 | Ga0439463_052699 | 3300042016 | Bacteria | 1038 |
| 286 | Ga0439463_066552 | 3300042016 | Bacteria | 921 |
| 287 | Ga0439463_078657 | 3300042016 | Bacteria | 847 |
| 288 | Ga0450911_000063 | 3300042115 | Bacteria | 43941 |
| 289 | Ga0450911_001410 | 3300042115 | Bacteria | 5552 |
| 290 | Ga0450919_002153 | 3300042121 | Bacteria | 2566 |
| 291 | Ga0450922_000847 | 3300042124 | Bacteria | 3130 |
| 292 | Ga0450922_008879 | 3300042124 | Bacteria | 951 |
| 293 | Ga0450890_000120 | 3300042127 | Bacteria | 12305 |
| 294 | Ga0450903_000497 | 3300042138 | Bacteria | 8252 |
| 295 | Ga0450903_010096 | 3300042138 | Bacteria | 1531 |
| 296 | Ga0450904_006659 | 3300042139 | Bacteria | 1151 |
| 297 | Ga0450905_000793 | 3300042142 | Bacteria | 3898 |
| 298 | Ga0450889_010381 | 3300042144 | Bacteria | 960 |
| 299 | Ga0450906_010958 | 3300042145 | Bacteria | 1703 |
| 300 | Ga0450906_021426 | 3300042145 | Bacteria | 1155 |
| 301 | Ga0450907_000060 | 3300042146 | Bacteria | 43254 |
| 302 | Ga0450907_001916 | 3300042146 | Bacteria | 4223 |
| 303 | Ga0450910_001791 | 3300042147 | Bacteria | 2766 |
| 304 | Ga0450910_005016 | 3300042147 | Bacteria | 1800 |
| 305 | Ga0439446_0009657 | 3300042156 | Bacteria | 2586 |
| 306 | Ga0439446_0039818 | 3300042156 | Bacteria | 1381 |
| 307 | Ga0450909_008687 | 3300042185 | Bacteria | 1478 |
| 308 | Ga0450909_018683 | 3300042185 | Bacteria | 1030 |
| 309 | Ga0439434_0000096 | 3300042435 | Bacteria | 22268 |
| 310 | Ga0439464_0011875 | 3300042439 | Bacteria | 2313 |
| 311 | Ga0439460_0003236 | 3300042461 | Bacteria | 3934 |
| 312 | Ga0439460_0090799 | 3300042461 | Bacteria | 970 |
| 313 | Ga0450918_005147 | 3300042531 | Bacteria | 2356 |
| 314 | Ga0439440_0011979 | 3300042993 | Bacteria | 1837 |
| 315 | Ga0439440_0046837 | 3300042993 | Bacteria | 1069 |
| 316 | Ga0495617_013342 | 3300046452 | Bacteria | 2795 |
| 317 | Ga0495617_015217 | 3300046452 | Bacteria | 2610 |
| 318 | Ga0495617_019859 | 3300046452 | Bacteria | 2270 |
| 319 | Ga0495617_053130 | 3300046452 | Bacteria | 1345 |
| 320 | Ga0495617_058086 | 3300046452 | Bacteria | 1282 |
| 321 | Ga0495617_085310 | 3300046452 | Bacteria | 1033 |
| 322 | Ga0495617_117653 | 3300046452 | Bacteria | 857 |
| 323 | Ga0495627_000009 | 3300046453 | Bacteria | 463964 |
| 324 | Ga0495627_000146 | 3300046453 | Bacteria | 84502 |
| 325 | Ga0495627_000276 | 3300046453 | Bacteria | 51860 |
| 326 | Ga0495627_000930 | 3300046453 | Bacteria | 20194 |
| 327 | Ga0495627_002443 | 3300046453 | Bacteria | 8956 |
| 328 | Ga0495627_008602 | 3300046453 | Bacteria | 3810 |
| 329 | Ga0495627_047813 | 3300046453 | Bacteria | 1296 |
| 330 | Ga0495603_0005333 | 3300046455 | Bacteria | 7668 |
| 331 | Ga0495603_0152786 | 3300046455 | Bacteria | 1340 |
| 332 | Ga0495590_0000344 | 3300046457 | Bacteria | 24038 |
| 333 | Ga0495590_0036061 | 3300046457 | Bacteria | 1725 |
| 334 | Ga0495591_000159 | 3300046458 | Bacteria | 71539 |
| 335 | Ga0495591_000249 | 3300046458 | Bacteria | 52047 |
| 336 | Ga0495591_000547 | 3300046458 | Bacteria | 28827 |
| 337 | Ga0495591_003898 | 3300046458 | Bacteria | 7517 |
| 338 | Ga0495591_004168 | 3300046458 | Bacteria | 7175 |
| 339 | Ga0495591_013832 | 3300046458 | Bacteria | 2931 |
| 340 | Ga0495591_025870 | 3300046458 | Bacteria | 1833 |
| 341 | Ga0495591_025908 | 3300046458 | Bacteria | 1831 |
| 342 | Ga0495591_027343 | 3300046458 | Bacteria | 1760 |
| 343 | Ga0495591_052021 | 3300046458 | Bacteria | 1115 |
| 344 | Ga0495629_0016685 | 3300046459 | Bacteria | 5270 |
| 345 | Ga0495638_0000544 | 3300046460 | Bacteria | 43338 |
| 346 | Ga0495638_0042827 | 3300046460 | Bacteria | 2859 |
| 347 | Ga0495638_0081295 | 3300046460 | Bacteria | 1967 |
| 348 | Ga0495638_0088354 | 3300046460 | Bacteria | 1871 |
| 349 | Ga0495638_0388024 | 3300046460 | Bacteria | 727 |
| 350 | Ga0495653_0013976 | 3300046463 | Bacteria | 6546 |
| 351 | Ga0495653_0081697 | 3300046463 | Bacteria | 2387 |
| 352 | Ga0495653_0172160 | 3300046463 | Bacteria | 1493 |
| 353 | Ga0495653_0221512 | 3300046463 | Bacteria | 1271 |
| 354 | Ga0495650_0001892 | 3300046471 | Bacteria | 18567 |
| 355 | Ga0495650_0003079 | 3300046471 | Bacteria | 12515 |
| 356 | Ga0495650_0009724 | 3300046471 | Bacteria | 5447 |
| 357 | Ga0495650_0011053 | 3300046471 | Bacteria | 4982 |
| 358 | Ga0495650_0055661 | 3300046471 | Bacteria | 1608 |
| 359 | Ga0495650_0060679 | 3300046471 | Bacteria | 1517 |
| 360 | Ga0495582_0063607 | 3300046473 | Bacteria | 2038 |
| 361 | Ga0495605_0000011 | 3300046474 | Bacteria | 314856 |
| 362 | Ga0495605_0000200 | 3300046474 | Bacteria | 73721 |
| 363 | Ga0495605_0000201 | 3300046474 | Bacteria | 73671 |
| 364 | Ga0495605_0004771 | 3300046474 | Bacteria | 7924 |
| 365 | Ga0495605_0005921 | 3300046474 | Bacteria | 7066 |
| 366 | Ga0495605_0008597 | 3300046474 | Bacteria | 5767 |
| 367 | Ga0495605_0010708 | 3300046474 | Bacteria | 5125 |
| 368 | Ga0495605_0014933 | 3300046474 | Bacteria | 4236 |
| 369 | Ga0495605_0077657 | 3300046474 | Bacteria | 1557 |
| 370 | Ga0495605_0168899 | 3300046474 | Bacteria | 967 |
| 371 | Ga0495605_0225362 | 3300046474 | Bacteria | 809 |
| 372 | Ga0495639_0007189 | 3300046475 | Bacteria | 4779 |
| 373 | Ga0495584_0000146 | 3300046491 | Bacteria | 49170 |
| 374 | Ga0495584_0000441 | 3300046491 | Bacteria | 28608 |
| 375 | Ga0495584_0000633 | 3300046491 | Bacteria | 23463 |
| 376 | Ga0495584_0003810 | 3300046491 | Bacteria | 8205 |
| 377 | Ga0495584_0017544 | 3300046491 | Bacteria | 3642 |
| 378 | Ga0495584_0036174 | 3300046491 | Bacteria | 2494 |
| 379 | Ga0495584_0110527 | 3300046491 | Bacteria | 1390 |
| 380 | Ga0495585_0000219 | 3300046492 | Bacteria | 59369 |
| 381 | Ga0495585_0000307 | 3300046492 | Bacteria | 48876 |
| 382 | Ga0495585_0002032 | 3300046492 | Bacteria | 14961 |
| 383 | Ga0495585_0002947 | 3300046492 | Bacteria | 11766 |
| 384 | Ga0495585_0004174 | 3300046492 | Bacteria | 9436 |
| 385 | Ga0495585_0018630 | 3300046492 | Bacteria | 4003 |
| 386 | Ga0495585_0558258 | 3300046492 | Bacteria | 540 |
| 387 | Ga0495594_0002120 | 3300046499 | Bacteria | 10335 |
| 388 | Ga0495594_0043472 | 3300046499 | Bacteria | 2463 |
| 389 | Ga0495594_0056263 | 3300046499 | Bacteria | 2170 |
| 390 | Ga0495596_0015225 | 3300046500 | Bacteria | 3225 |
| 391 | Ga0495596_0064891 | 3300046500 | Bacteria | 1420 |
| 392 | Ga0495596_0068023 | 3300046500 | Bacteria | 1384 |
| 393 | Ga0495607_0000014 | 3300046501 | Bacteria | 186627 |
| 394 | Ga0495607_0000052 | 3300046501 | Bacteria | 118863 |
| 395 | Ga0495607_0000074 | 3300046501 | Bacteria | 99993 |
| 396 | Ga0495607_0004566 | 3300046501 | Bacteria | 10152 |
| 397 | Ga0495607_0019802 | 3300046501 | Bacteria | 4267 |
| 398 | Ga0495607_0028075 | 3300046501 | Bacteria | 3475 |
| 399 | Ga0495607_0032939 | 3300046501 | Bacteria | 3156 |
| 400 | Ga0495607_0072624 | 3300046501 | Bacteria | 1915 |
| 401 | Ga0495607_0114195 | 3300046501 | Bacteria | 1427 |
| 402 | Ga0495607_0124995 | 3300046501 | Bacteria | 1345 |
| 403 | Ga0495583_0000047 | 3300046506 | Bacteria | 217720 |
| 404 | Ga0495583_0000513 | 3300046506 | Bacteria | 55346 |
| 405 | Ga0495583_0003239 | 3300046506 | Bacteria | 12698 |
| 406 | Ga0495583_0003561 | 3300046506 | Bacteria | 11730 |
| 407 | Ga0495583_0003633 | 3300046506 | Bacteria | 11524 |
| 408 | Ga0495583_0069492 | 3300046506 | Bacteria | 1551 |
| 409 | Ga0495583_0353681 | 3300046506 | Bacteria | 579 |
| 410 | Ga0495606_0000741 | 3300046507 | Bacteria | 50451 |
| 411 | Ga0495606_0001204 | 3300046507 | Bacteria | 36360 |
| 412 | Ga0495606_0001593 | 3300046507 | Bacteria | 29610 |
| 413 | Ga0495606_0002795 | 3300046507 | Bacteria | 19463 |
| 414 | Ga0495606_0004583 | 3300046507 | Bacteria | 13710 |
| 415 | Ga0495606_0059184 | 3300046507 | Bacteria | 2458 |
| 416 | Ga0495606_0066152 | 3300046507 | Bacteria | 2293 |
| 417 | Ga0495606_0069025 | 3300046507 | Bacteria | 2234 |
| 418 | Ga0495610_0000498 | 3300046512 | Bacteria | 40182 |
| 419 | Ga0495610_0001076 | 3300046512 | Bacteria | 25017 |
| 420 | Ga0495610_0001677 | 3300046512 | Bacteria | 19471 |
| 421 | Ga0495610_0002781 | 3300046512 | Bacteria | 14326 |
| 422 | Ga0495610_0004366 | 3300046512 | Bacteria | 10484 |
| 423 | Ga0495610_0008011 | 3300046512 | Bacteria | 6921 |
| 424 | Ga0495610_0025029 | 3300046512 | Bacteria | 3213 |
| 425 | Ga0495610_0025440 | 3300046512 | Bacteria | 3176 |
| 426 | Ga0495610_0066081 | 3300046512 | Bacteria | 1704 |
| 427 | Ga0495610_0097467 | 3300046512 | Bacteria | 1322 |
| 428 | Ga0495610_0249672 | 3300046512 | Bacteria | 703 |
| 429 | Ga0495616_0000130 | 3300046513 | Bacteria | 65741 |
| 430 | Ga0495616_0000693 | 3300046513 | Bacteria | 24925 |
| 431 | Ga0495616_0001642 | 3300046513 | Bacteria | 15338 |
| 432 | Ga0495616_0018073 | 3300046513 | Bacteria | 3879 |
| 433 | Ga0495616_0133719 | 3300046513 | Bacteria | 1134 |
| 434 | Ga0495620_0000035 | 3300046515 | Bacteria | 115562 |
| 435 | Ga0495620_0000081 | 3300046515 | Bacteria | 80343 |
| 436 | Ga0495620_0000194 | 3300046515 | Bacteria | 46643 |
| 437 | Ga0495620_0000870 | 3300046515 | Bacteria | 18658 |
| 438 | Ga0495620_0006725 | 3300046515 | Bacteria | 6292 |
| 439 | Ga0495620_0015179 | 3300046515 | Bacteria | 3895 |
| 440 | Ga0495620_0043795 | 3300046515 | Bacteria | 1948 |
| 441 | Ga0495620_0072454 | 3300046515 | Bacteria | 1406 |
| 442 | Ga0495628_0033116 | 3300046516 | Bacteria | 4167 |
| 443 | Ga0495630_0004302 | 3300046517 | Bacteria | 9988 |
| 444 | Ga0495630_0015241 | 3300046517 | Bacteria | 5608 |
| 445 | Ga0495630_0076627 | 3300046517 | Bacteria | 2520 |
| 446 | Ga0495630_0204095 | 3300046517 | Bacteria | 1508 |
| 447 | Ga0495631_0000014 | 3300046518 | Bacteria | 109076 |
| 448 | Ga0495631_0000134 | 3300046518 | Bacteria | 50093 |
| 449 | Ga0495631_0000200 | 3300046518 | Bacteria | 40944 |
| 450 | Ga0495631_0003434 | 3300046518 | Bacteria | 8675 |
| 451 | Ga0495631_0032461 | 3300046518 | Bacteria | 2355 |
| 452 | Ga0495631_0065510 | 3300046518 | Bacteria | 1572 |
| 453 | Ga0495631_0087675 | 3300046518 | Bacteria | 1340 |
| 454 | Ga0495631_0092405 | 3300046518 | Bacteria | 1302 |
| 455 | Ga0495631_0107893 | 3300046518 | Bacteria | 1197 |
| 456 | Ga0495632_0000108 | 3300046519 | Bacteria | 85312 |
| 457 | Ga0495632_0000150 | 3300046519 | Bacteria | 72066 |
| 458 | Ga0495632_0001602 | 3300046519 | Bacteria | 18635 |
| 459 | Ga0495632_0002786 | 3300046519 | Bacteria | 12963 |
| 460 | Ga0495632_0010897 | 3300046519 | Bacteria | 5343 |
| 461 | Ga0495632_0020675 | 3300046519 | Bacteria | 3558 |
| 462 | Ga0495632_0022221 | 3300046519 | Bacteria | 3402 |
| 463 | Ga0495632_0026724 | 3300046519 | Bacteria | 3033 |
| 464 | Ga0495632_0066809 | 3300046519 | Bacteria | 1734 |
| 465 | Ga0495632_0092277 | 3300046519 | Bacteria | 1434 |
| 466 | Ga0495637_0000060 | 3300046520 | Bacteria | 96132 |
| 467 | Ga0495637_0003371 | 3300046520 | Bacteria | 8485 |
| 468 | Ga0495637_0005458 | 3300046520 | Bacteria | 6475 |
| 469 | Ga0495637_0007615 | 3300046520 | Bacteria | 5358 |
| 470 | Ga0495637_0016435 | 3300046520 | Bacteria | 3458 |
| 471 | Ga0495637_0036122 | 3300046520 | Bacteria | 2154 |
| 472 | Ga0495637_0039923 | 3300046520 | Bacteria | 2022 |
| 473 | Ga0495637_0047730 | 3300046520 | Bacteria | 1806 |
| 474 | Ga0495637_0061548 | 3300046520 | Bacteria | 1538 |
| 475 | Ga0495637_0085977 | 3300046520 | Bacteria | 1247 |
| 476 | Ga0495643_0000558 | 3300046522 | Bacteria | 46114 |
| 477 | Ga0495643_0002392 | 3300046522 | Bacteria | 14975 |
| 478 | Ga0495643_0002850 | 3300046522 | Bacteria | 13148 |
| 479 | Ga0495643_0021085 | 3300046522 | Bacteria | 3744 |
| 480 | Ga0495643_0040530 | 3300046522 | Bacteria | 2544 |
| 481 | Ga0495643_0088599 | 3300046522 | Bacteria | 1599 |
| 482 | Ga0495643_0143348 | 3300046522 | Bacteria | 1189 |
| 483 | Ga0495643_0303628 | 3300046522 | Bacteria | 726 |
| 484 | Ga0495644_0023999 | 3300046523 | Bacteria | 2320 |
| 485 | Ga0495644_0038108 | 3300046523 | Bacteria | 1813 |
| 486 | Ga0495644_0211191 | 3300046523 | Bacteria | 749 |
| 487 | Ga0495648_0000042 | 3300046524 | Bacteria | 179918 |
| 488 | Ga0495648_0000237 | 3300046524 | Bacteria | 63132 |
| 489 | Ga0495648_0000342 | 3300046524 | Bacteria | 51508 |
| 490 | Ga0495648_0000548 | 3300046524 | Bacteria | 40373 |
| 491 | Ga0495648_0000890 | 3300046524 | Bacteria | 31411 |
| 492 | Ga0495648_0001245 | 3300046524 | Bacteria | 25450 |
| 493 | Ga0495648_0024098 | 3300046524 | Bacteria | 4154 |
| 494 | Ga0495648_0039834 | 3300046524 | Bacteria | 2985 |
| 495 | Ga0495648_0043278 | 3300046524 | Bacteria | 2825 |
| 496 | Ga0495648_0058713 | 3300046524 | Bacteria | 2299 |
| 497 | Ga0495648_0224506 | 3300046524 | Bacteria | 924 |
| 498 | Ga0495666_0001376 | 3300046526 | Bacteria | 11787 |
| 499 | Ga0495666_0047496 | 3300046526 | Bacteria | 2067 |
| 500 | Ga0495666_0047538 | 3300046526 | Bacteria | 2066 |
| 501 | Ga0495666_0202788 | 3300046526 | Bacteria | 911 |
| 502 | Ga0495666_0224567 | 3300046526 | Bacteria | 859 |
| 503 | Ga0495642_0000163 | 3300046528 | Bacteria | 38739 |
| 504 | Ga0495654_0000209 | 3300046530 | Bacteria | 55466 |
| 505 | Ga0495654_0000703 | 3300046530 | Bacteria | 26259 |
| 506 | Ga0495654_0001036 | 3300046530 | Bacteria | 20339 |
| 507 | Ga0495654_0004602 | 3300046530 | Bacteria | 8146 |
| 508 | Ga0495654_0029922 | 3300046530 | Bacteria | 2774 |
| 509 | Ga0495654_0061955 | 3300046530 | Bacteria | 1794 |
| 510 | Ga0495654_0069034 | 3300046530 | Bacteria | 1678 |
| 511 | Ga0495654_0074402 | 3300046530 | Bacteria | 1604 |
| 512 | Ga0495654_0145319 | 3300046530 | Bacteria | 1053 |
| 513 | Ga0495586_0062043 | 3300046535 | Bacteria | 2034 |
| 514 | Ga0495587_0001361 | 3300046536 | Bacteria | 16211 |
| 515 | Ga0495587_0013686 | 3300046536 | Bacteria | 5095 |
| 516 | Ga0495587_0290237 | 3300046536 | Bacteria | 916 |
| 517 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 518 | Ga0495609_0000256 | 3300046538 | Bacteria | 50491 |
| 519 | Ga0495609_0001222 | 3300046538 | Bacteria | 17710 |
| 520 | Ga0495609_0002453 | 3300046538 | Bacteria | 11402 |
| 521 | Ga0495609_0013640 | 3300046538 | Bacteria | 3834 |
| 522 | Ga0495609_0014549 | 3300046538 | Bacteria | 3696 |
| 523 | Ga0495609_0032915 | 3300046538 | Bacteria | 2353 |
| 524 | Ga0495597_0000002 | 3300046542 | Bacteria | 420382 |
| 525 | Ga0495597_0000166 | 3300046542 | Bacteria | 58474 |
| 526 | Ga0495597_0002678 | 3300046542 | Bacteria | 11021 |
| 527 | Ga0495597_0019105 | 3300046542 | Bacteria | 3209 |
| 528 | Ga0495597_0085879 | 3300046542 | Bacteria | 1340 |
| 529 | Ga0495622_0000350 | 3300046557 | Bacteria | 32833 |
| 530 | Ga0495622_0000611 | 3300046557 | Bacteria | 20724 |
| 531 | Ga0495622_0014948 | 3300046557 | Bacteria | 3609 |
| 532 | Ga0495622_0076136 | 3300046557 | Bacteria | 1546 |
| 533 | Ga0495622_0291304 | 3300046557 | Bacteria | 712 |
| 534 | Ga0495633_0000071 | 3300046558 | Bacteria | 132537 |
| 535 | Ga0495633_0000883 | 3300046558 | Bacteria | 25827 |
| 536 | Ga0495633_0002077 | 3300046558 | Bacteria | 14408 |
| 537 | Ga0495633_0030234 | 3300046558 | Bacteria | 2632 |
| 538 | Ga0495633_0335845 | 3300046558 | Bacteria | 685 |
| 539 | Ga0495656_0112584 | 3300046615 | Bacteria | 1275 |
| 540 | Ga0495656_0431202 | 3300046615 | Bacteria | 693 |
| 541 | Ga0495668_0003415 | 3300046616 | Bacteria | 11930 |
| 542 | Ga0495668_0251086 | 3300046616 | Bacteria | 968 |
| 543 | Ga0495668_0297628 | 3300046616 | Bacteria | 884 |
| 544 | Ga0495634_0000290 | 3300046642 | Bacteria | 48107 |
| 545 | Ga0495634_0060062 | 3300046642 | Bacteria | 2531 |
| 546 | Ga0495611_0000012 | 3300046648 | Bacteria | 131579 |
| 547 | Ga0495611_0001211 | 3300046648 | Bacteria | 13347 |
| 548 | Ga0495611_0005912 | 3300046648 | Bacteria | 5218 |
| 549 | Ga0495611_0094491 | 3300046648 | Bacteria | 1383 |
| 550 | Ga0495611_0144008 | 3300046648 | Bacteria | 1112 |
| 551 | Ga0495625_0002425 | 3300046660 | Bacteria | 20189 |
| 552 | Ga0495625_0003572 | 3300046660 | Bacteria | 15336 |
| 553 | Ga0495625_0200331 | 3300046660 | Bacteria | 1318 |
| 554 | Ga0495635_0000107 | 3300046663 | Bacteria | 49233 |
| 555 | Ga0495635_0000231 | 3300046663 | Bacteria | 35570 |
| 556 | Ga0495659_0010440 | 3300046664 | Bacteria | 2979 |
| 557 | Ga0495659_0067815 | 3300046664 | Bacteria | 1331 |
| 558 | Ga0495661_0000005 | 3300046665 | Bacteria | 433622 |
| 559 | Ga0495661_0000464 | 3300046665 | Bacteria | 42993 |
| 560 | Ga0495661_0000704 | 3300046665 | Bacteria | 33128 |
| 561 | Ga0495661_0031945 | 3300046665 | Bacteria | 3332 |
| 562 | Ga0495661_0034237 | 3300046665 | Bacteria | 3197 |
| 563 | Ga0495661_0066398 | 3300046665 | Bacteria | 2123 |
| 564 | Ga0495661_0155309 | 3300046665 | Bacteria | 1232 |
| 565 | Ga0495661_0192659 | 3300046665 | Bacteria | 1072 |
| 566 | Ga0495661_0200630 | 3300046665 | Bacteria | 1045 |
| 567 | Ga0495661_0317914 | 3300046665 | Bacteria | 774 |
| 568 | Ga0495588_0023272 | 3300046674 | Bacteria | 3066 |
| 569 | Ga0495588_0056012 | 3300046674 | Bacteria | 2035 |
| 570 | Ga0495588_0265890 | 3300046674 | Bacteria | 904 |
| 571 | Ga0495623_0019562 | 3300046679 | Bacteria | 4375 |
| 572 | Ga0495646_0000723 | 3300046680 | Bacteria | 18297 |
| 573 | Ga0495646_0009476 | 3300046680 | Bacteria | 6179 |
| 574 | Ga0495646_0100873 | 3300046680 | Bacteria | 1655 |
| 575 | Ga0495613_0007766 | 3300046689 | Bacteria | 7984 |
| 576 | Ga0495613_0144652 | 3300046689 | Bacteria | 1697 |
| 577 | Ga0495670_0000450 | 3300046691 | Bacteria | 19643 |
| 578 | Ga0495670_0000746 | 3300046691 | Bacteria | 15580 |
| 579 | Ga0495670_0013787 | 3300046691 | Bacteria | 3975 |
| 580 | Ga0495670_0015937 | 3300046691 | Bacteria | 3693 |
| 581 | Ga0495670_0126301 | 3300046691 | Bacteria | 1331 |
| 582 | Ga0495670_0151383 | 3300046691 | Bacteria | 1216 |
| 583 | Ga0495670_0258855 | 3300046691 | Bacteria | 928 |
| 584 | Ga0495671_0000090 | 3300046692 | Bacteria | 85706 |
| 585 | Ga0495671_0007887 | 3300046692 | Bacteria | 6020 |
| 586 | Ga0495671_0011324 | 3300046692 | Bacteria | 4915 |
| 587 | Ga0495671_0031385 | 3300046692 | Bacteria | 2716 |
| 588 | Ga0495671_0035856 | 3300046692 | Bacteria | 2516 |
| 589 | Ga0495671_0057728 | 3300046692 | Bacteria | 1920 |
| 590 | Ga0495671_0088833 | 3300046692 | Bacteria | 1513 |
| 591 | Ga0495649_0000225 | 3300046694 | Bacteria | 49445 |
| 592 | Ga0495649_0009143 | 3300046694 | Bacteria | 5907 |
| 593 | Ga0495649_0029045 | 3300046694 | Bacteria | 3063 |
| 594 | Ga0495649_0048867 | 3300046694 | Bacteria | 2298 |
| 595 | Ga0495649_0055042 | 3300046694 | Bacteria | 2150 |
| 596 | Ga0495649_0068935 | 3300046694 | Bacteria | 1897 |
| 597 | Ga0495589_0000303 | 3300046794 | Bacteria | 39290 |
| 598 | Ga0495589_0001362 | 3300046794 | Bacteria | 14260 |
| 599 | Ga0495589_0002909 | 3300046794 | Bacteria | 9457 |
| 600 | Ga0495589_0018397 | 3300046794 | Bacteria | 3582 |
| 601 | Ga0495589_0053715 | 3300046794 | Bacteria | 1987 |
| 602 | Ga0495589_0177393 | 3300046794 | Bacteria | 1011 |
| 603 | Ga0495600_0004566 | 3300046809 | Bacteria | 8301 |
| 604 | Ga0495600_0098561 | 3300046809 | Bacteria | 1905 |
| 605 | Ga0495660_0001527 | 3300046810 | Bacteria | 15627 |
| 606 | Ga0495660_0003299 | 3300046810 | Bacteria | 10017 |
| 607 | Ga0495660_0005460 | 3300046810 | Bacteria | 7614 |
| 608 | Ga0495660_0017758 | 3300046810 | Bacteria | 4092 |
| 609 | Ga0495660_0019279 | 3300046810 | Bacteria | 3916 |
| 610 | Ga0495660_0046093 | 3300046810 | Bacteria | 2391 |
| 611 | Ga0495660_0050511 | 3300046810 | Bacteria | 2265 |
| 612 | Ga0495660_0103745 | 3300046810 | Bacteria | 1460 |
| 613 | Ga0495581_0011750 | 3300047315 | Bacteria | 5070 |
| 614 | Ga0495604_0001636 | 3300047317 | Bacteria | 18400 |
| 615 | Ga0495604_0009287 | 3300047317 | Bacteria | 7785 |
| 616 | Ga0495604_0027529 | 3300047317 | Bacteria | 4520 |
| 617 | Ga0495604_0153249 | 3300047317 | Bacteria | 1635 |
| 618 | Ga0495636_0105294 | 3300047318 | Bacteria | 1237 |
| 619 | Ga0495674_0010629 | 3300047319 | Bacteria | 8707 |
| 620 | Ga0495672_0000606 | 3300047320 | Bacteria | 40287 |
| 621 | Ga0495672_0004521 | 3300047320 | Bacteria | 11348 |
| 622 | Ga0495672_0004688 | 3300047320 | Bacteria | 11067 |
| 623 | Ga0495672_0018388 | 3300047320 | Bacteria | 4641 |
| 624 | Ga0495672_0026556 | 3300047320 | Bacteria | 3693 |
| 625 | Ga0495672_0113811 | 3300047320 | Bacteria | 1448 |
| 626 | Ga0495672_0223608 | 3300047320 | Bacteria | 928 |
| 627 | Ga0495676_0000297 | 3300047321 | Bacteria | 40253 |
| 628 | Ga0495680_0016211 | 3300047322 | Bacteria | 6407 |
| 629 | Ga0495680_0028985 | 3300047322 | Bacteria | 4536 |
| 630 | Ga0495680_0050222 | 3300047322 | Bacteria | 3262 |
| 631 | Ga0495680_0140466 | 3300047322 | Bacteria | 1767 |
| 632 | Ga0495683_0000026 | 3300047323 | Bacteria | 154645 |
| 633 | Ga0495683_0000057 | 3300047323 | Bacteria | 118509 |
| 634 | Ga0495683_0008432 | 3300047323 | Bacteria | 5512 |
| 635 | Ga0495683_0064640 | 3300047323 | Bacteria | 1806 |
| 636 | Ga0495683_0065775 | 3300047323 | Bacteria | 1787 |
| 637 | Ga0495683_0096327 | 3300047323 | Bacteria | 1428 |
| 638 | Ga0495683_0153704 | 3300047323 | Bacteria | 1069 |
| 639 | Ga0495687_003368 | 3300047443 | Bacteria | 11664 |
| 640 | Ga0495675_0023674 | 3300047444 | Bacteria | 3913 |
| 641 | Ga0495675_0419742 | 3300047444 | Bacteria | 777 |
| 642 | Ga0495677_0046095 | 3300047445 | Bacteria | 1600 |
| 643 | Ga0495679_000853 | 3300047446 | Bacteria | 19300 |
| 644 | Ga0495679_003461 | 3300047446 | Bacteria | 7572 |
| 645 | Ga0495679_027634 | 3300047446 | Bacteria | 1868 |
| 646 | Ga0495679_031432 | 3300047446 | Bacteria | 1712 |
| 647 | Ga0495679_049238 | 3300047446 | Bacteria | 1271 |
| 648 | Ga0495685_015547 | 3300047447 | Bacteria | 2597 |
| 649 | Ga0495673_0000234 | 3300047469 | Bacteria | 80453 |
| 650 | Ga0495673_0000386 | 3300047469 | Bacteria | 51987 |
| 651 | Ga0495673_0000672 | 3300047469 | Bacteria | 33703 |
| 652 | Ga0495673_0000717 | 3300047469 | Bacteria | 32108 |
| 653 | Ga0495673_0000891 | 3300047469 | Bacteria | 27479 |
| 654 | Ga0495673_0001932 | 3300047469 | Bacteria | 15389 |
| 655 | Ga0495673_0004407 | 3300047469 | Bacteria | 8817 |
| 656 | Ga0495673_0004826 | 3300047469 | Bacteria | 8338 |
| 657 | Ga0495673_0018815 | 3300047469 | Bacteria | 3475 |
| 658 | Ga0495673_0028504 | 3300047469 | Bacteria | 2643 |
| 659 | Ga0495673_0108722 | 3300047469 | Bacteria | 1111 |
| 660 | Ga0495681_0000227 | 3300047470 | Bacteria | 47091 |
| 661 | Ga0495681_0000793 | 3300047470 | Bacteria | 24313 |
| 662 | Ga0495681_0001124 | 3300047470 | Bacteria | 20308 |
| 663 | Ga0495681_0003850 | 3300047470 | Bacteria | 10376 |
| 664 | Ga0495681_0011988 | 3300047470 | Bacteria | 5119 |
| 665 | Ga0495681_0018258 | 3300047470 | Bacteria | 3867 |
| 666 | Ga0495681_0121184 | 3300047470 | Bacteria | 1122 |
| 667 | Ga0495684_0162582 | 3300047471 | Bacteria | 1664 |
| 668 | Ga0495686_0001144 | 3300047472 | Bacteria | 31199 |
| 669 | Ga0495686_0093749 | 3300047472 | Bacteria | 1820 |
| 670 | Ga0495686_0308458 | 3300047472 | Bacteria | 871 |
| 671 | Ga0495593_0053788 | 3300047673 | Bacteria | 2123 |
| 672 | Ga0495593_0065136 | 3300047673 | Bacteria | 1900 |
| 673 | Ga0495593_0131079 | 3300047673 | Bacteria | 1272 |
| 674 | Ga0495593_0228030 | 3300047673 | Bacteria | 934 |
| 675 | Ga0495602_0450654 | 3300048088 | Bacteria | 908 |
| 676 | Ga0495626_0000474 | 3300048091 | Bacteria | 40750 |
| 677 | Ga0495626_0000513 | 3300048091 | Bacteria | 38809 |
| 678 | Ga0495626_0001437 | 3300048091 | Bacteria | 18937 |
| 679 | Ga0495626_0011252 | 3300048091 | Bacteria | 4739 |
| 680 | Ga0495626_0052178 | 3300048091 | Bacteria | 1885 |
| 681 | Ga0495626_0076865 | 3300048091 | Bacteria | 1489 |
| 682 | Ga0495626_0134020 | 3300048091 | Bacteria | 1055 |
| 683 | Ga0496100_0289926 | 3300048903 | Bacteria | 1223 |
| 684 | Ga0496102_0000394 | 3300048905 | Bacteria | 50983 |
| 685 | Ga0496103_0000807 | 3300048906 | Bacteria | 23036 |
| 686 | Ga0496104_0864421 | 3300048907 | Bacteria | 810 |
| 687 | Ga0496106_0279195 | 3300048909 | Bacteria | 1338 |
| 688 | Ga0496110_0719601 | 3300048913 | Bacteria | 900 |
| 689 | Ga0496110_1774736 | 3300048913 | Bacteria | 527 |
| 690 | Ga0496114_0008590 | 3300048917 | Bacteria | 8096 |
| 691 | Ga0496114_0872186 | 3300048917 | Bacteria | 781 |
| 692 | Ga0496115_0018838 | 3300048918 | Bacteria | 5307 |
| 693 | Ga0496116_0000010 | 3300048919 | Bacteria | 665608 |
| 694 | Ga0496116_0000785 | 3300048919 | Bacteria | 40397 |
| 695 | Ga0496116_0000884 | 3300048919 | Bacteria | 37446 |
| 696 | Ga0496116_0397930 | 3300048919 | Bacteria | 611 |
| 697 | Ga0496117_0001266 | 3300048920 | Bacteria | 37531 |
| 698 | Ga0496117_0001271 | 3300048920 | Bacteria | 37415 |
| 699 | Ga0496117_0023279 | 3300048920 | Bacteria | 4942 |
| 700 | Ga0496117_0029925 | 3300048920 | Bacteria | 4188 |
| 701 | Ga0496117_0052359 | 3300048920 | Bacteria | 2875 |
| 702 | Ga0496117_0089258 | 3300048920 | Bacteria | 1991 |
| 703 | Ga0496117_0160001 | 3300048920 | Bacteria | 1320 |
| 704 | Ga0496117_0312712 | 3300048920 | Bacteria | 826 |
| 705 | Ga0496118_0006225 | 3300048921 | Bacteria | 13200 |
| 706 | Ga0496118_0020830 | 3300048921 | Bacteria | 5801 |
| 707 | Ga0496118_0021433 | 3300048921 | Bacteria | 5686 |
| 708 | Ga0496118_0022568 | 3300048921 | Bacteria | 5495 |
| 709 | Ga0496118_0026115 | 3300048921 | Bacteria | 4984 |
| 710 | Ga0496118_0058376 | 3300048921 | Bacteria | 2884 |
| 711 | Ga0496119_0111552 | 3300048922 | Bacteria | 1517 |
| 712 | Ga0496119_0112582 | 3300048922 | Bacteria | 1508 |
| 713 | Ga0496120_0004093 | 3300048923 | Bacteria | 12596 |
| 714 | Ga0496120_0069360 | 3300048923 | Bacteria | 1941 |
| 715 | Ga0496121_0000149 | 3300048924 | Bacteria | 153667 |
| 716 | Ga0496121_0003221 | 3300048924 | Bacteria | 23483 |
| 717 | Ga0496121_0034186 | 3300048924 | Bacteria | 4580 |
| 718 | Ga0496121_0076437 | 3300048924 | Bacteria | 2669 |
| 719 | Ga0496121_0082334 | 3300048924 | Bacteria | 2544 |
| 720 | Ga0496121_0145232 | 3300048924 | Bacteria | 1754 |
| 721 | Ga0496121_0169712 | 3300048924 | Bacteria | 1586 |
| 722 | Ga0496122_0003744 | 3300048925 | Bacteria | 19620 |
| 723 | Ga0496122_0018300 | 3300048925 | Bacteria | 6484 |
| 724 | Ga0496122_0032081 | 3300048925 | Bacteria | 4351 |
| 725 | Ga0496122_0090507 | 3300048925 | Bacteria | 2087 |
| 726 | Ga0496122_0178796 | 3300048925 | Bacteria | 1268 |
| 727 | Ga0496122_0187193 | 3300048925 | Bacteria | 1226 |
| 728 | Ga0496123_0002210 | 3300048926 | Bacteria | 24744 |
| 729 | Ga0496123_0007787 | 3300048926 | Bacteria | 9975 |
| 730 | Ga0496123_0038812 | 3300048926 | Bacteria | 3341 |
| 731 | Ga0496123_0059981 | 3300048926 | Bacteria | 2455 |
| 732 | Ga0496123_0101758 | 3300048926 | Bacteria | 1669 |
| 733 | Ga0496123_0151816 | 3300048926 | Bacteria | 1248 |
| 734 | Ga0496124_0017540 | 3300048927 | Bacteria | 6742 |
| 735 | Ga0496124_0052203 | 3300048927 | Bacteria | 3474 |
| 736 | Ga0496124_0084353 | 3300048927 | Bacteria | 2605 |
| 737 | Ga0496124_0086668 | 3300048927 | Bacteria | 2562 |
| 738 | Ga0496124_0139993 | 3300048927 | Bacteria | 1910 |
| 739 | Ga0496124_0316510 | 3300048927 | Bacteria | 1119 |
| 740 | Ga0496124_0347953 | 3300048927 | Bacteria | 1049 |
| 741 | Ga0496124_0471265 | 3300048927 | Bacteria | 850 |
| 742 | Ga0496125_0000658 | 3300048928 | Bacteria | 57602 |
| 743 | Ga0496125_0002795 | 3300048928 | Bacteria | 22065 |
| 744 | Ga0496125_0010383 | 3300048928 | Bacteria | 9419 |
| 745 | Ga0496125_0069780 | 3300048928 | Bacteria | 2754 |
| 746 | Ga0496125_0121813 | 3300048928 | Bacteria | 1858 |
| 747 | Ga0496125_0134477 | 3300048928 | Bacteria | 1732 |
| 748 | Ga0496125_0163258 | 3300048928 | Bacteria | 1509 |
| 749 | Ga0496125_0253760 | 3300048928 | Bacteria | 1107 |
| 750 | Ga0496125_0458220 | 3300048928 | Bacteria | 728 |
| 751 | Ga0496126_0051134 | 3300048929 | Bacteria | 3763 |
| 752 | Ga0496126_0188550 | 3300048929 | Bacteria | 1748 |
| 753 | Ga0496126_0260452 | 3300048929 | Bacteria | 1442 |
| 754 | Ga0495678_000068 | 3300049459 | Bacteria | 132090 |
| 755 | Ga0495678_000247 | 3300049459 | Bacteria | 60600 |
| 756 | Ga0495678_000941 | 3300049459 | Bacteria | 25280 |
| 757 | Ga0495678_000943 | 3300049459 | Bacteria | 25210 |
| 758 | Ga0495678_002439 | 3300049459 | Bacteria | 12640 |
| 759 | Ga0495678_005508 | 3300049459 | Bacteria | 6974 |
| 760 | Ga0495678_015692 | 3300049459 | Bacteria | 3479 |
| 761 | Ga0495678_035720 | 3300049459 | Bacteria | 2034 |
| 762 | Ga0495678_050533 | 3300049459 | Bacteria | 1610 |
| 763 | Ga0495678_082851 | 3300049459 | Bacteria | 1147 |
| 764 | Ga0495678_187627 | 3300049459 | Bacteria | 644 |
| 765 | Ga0495682_0000977 | 3300049460 | Bacteria | 17173 |
| 766 | Ga0495682_0009944 | 3300049460 | Bacteria | 3699 |
| 767 | Ga0495682_0020493 | 3300049460 | Bacteria | 2482 |
| 768 | Ga0495682_0078898 | 3300049460 | Bacteria | 1184 |
| 769 | Ga0501034_0000200 | 3300049571 | Bacteria | 113556 |
| 770 | Ga0501222_017456 | 3300049662 | Bacteria | 951 |
| 771 | Ga0501269_023921 | 3300049766 | Bacteria | 767 |
| 772 | Ga0501226_002565 | 3300049853 | Bacteria | 2208 |
| 773 | nmdc:mga03683_401461_c1 | 3300050489 | Bacteria | 654 |
| 774 | Ga0500572_000410 | 3300053111 | Bacteria | 15064 |
| 775 | Ga0500618_030511 | 3300053125 | Bacteria | 1268 |
| 776 | Ga0500659_0007869 | 3300053135 | Bacteria | 5885 |
| 777 | Ga0500573_0007933 | 3300053140 | Bacteria | 5826 |
| 778 | Ga0500634_0000206 | 3300053161 | Bacteria | 19052 |
| 779 | 2511253880 | 2511231004 | Bacteria | 6669789 |
| 780 | 2511266986 | 2511231006 | Bacteria | 6794709 |
| 781 | 2511271661 | 2511231007 | Bacteria | 6306603 |
| 782 | 2511291616 | 2511231010 | Bacteria | 6373152 |
| 783 | 2511296649 | 2511231011 | Bacteria | 6149768 |
| 784 | 2511326983 | 2511231016 | Bacteria | 6704427 |
| 785 | 2511361670 | 2511231022 | Bacteria | 6719296 |
| 786 | 2511372550 | 2511231023 | Bacteria | 6808468 |
| 787 | 2511415126 | 2511231031 | Bacteria | 6558529 |
| 788 | 2511824653 | 2511231156 | Bacteria | 6845832 |
| 789 | 2512323760 | 2512047018 | Bacteria | 6663241 |
| 790 | 2583791982 | 2582580891 | Bacteria | 6800976 |
| 791 | 2597857987 | 2597489887 | Bacteria | 6666321 |
| 792 | 2597863691 | 2597489888 | Bacteria | 6179543 |
| 793 | 2597870062 | 2597489889 | Bacteria | 6297495 |
| 794 | 2599352833 | 2599185160 | Bacteria | 6844013 |
| 795 | 2599359178 | 2599185161 | Bacteria | 6960462 |
| 796 | 2599365301 | 2599185162 | Bacteria | 6957254 |
| 797 | 2599371872 | 2599185163 | Bacteria | 6995158 |
| 798 | 2599377941 | 2599185164 | Bacteria | 6841688 |
| 799 | 2599384682 | 2599185165 | Bacteria | 6843250 |
| 800 | 2599390730 | 2599185166 | Bacteria | 6959206 |
| 801 | 2599401864 | 2599185167 | Bacteria | 6353609 |
| 802 | 2599402915 | 2599185168 | Bacteria | 6997636 |
| 803 | 2599453944 | 2599185179 | Bacteria | 6611171 |
| 804 | 2599459667 | 2599185181 | Bacteria | 6844519 |
| 805 | 2599465994 | 2599185182 | Bacteria | 6883168 |
| 806 | 2599485018 | 2599185185 | Bacteria | 6652270 |
| 807 | 2599488688 | 2599185186 | Bacteria | 6831633 |
| 808 | 2599500548 | 2599185188 | Bacteria | 6164180 |
| 809 | 2599509157 | 2599185189 | Bacteria | 5862825 |
| 810 | 2599515519 | 2599185190 | Bacteria | 6285678 |
| 811 | 2599521376 | 2599185191 | Bacteria | 6297582 |
| 812 | 2599612870 | 2599185212 | Bacteria | 6765997 |
| 813 | 2599773669 | 2599185248 | Bacteria | 6696816 |
| 814 | 2599802649 | 2599185257 | Bacteria | 6492581 |
| 815 | 2599881145 | 2599185288 | Bacteria | 6666191 |
| 816 | 2599889193 | 2599185289 | Bacteria | 6778765 |
| 817 | 2599894898 | 2599185290 | Bacteria | 6289611 |
| 818 | 2599901247 | 2599185291 | Bacteria | 6775623 |
| 819 | 2599932231 | 2599185300 | Bacteria | 6062622 |
| 820 | 2599943540 | 2599185302 | Bacteria | 5954930 |
| 821 | 2599949570 | 2599185303 | Bacteria | 6512725 |
| 822 | 2599954651 | 2599185304 | Bacteria | 5951361 |
| 823 | 2599962251 | 2599185305 | Bacteria | 6748700 |
| 824 | 2599969368 | 2599185306 | Bacteria | 6637356 |
| 825 | 2599979371 | 2599185308 | Bacteria | 6621546 |
| 826 | 2599985206 | 2599185309 | Bacteria | 5969593 |
| 827 | 2599988543 | 2599185310 | Bacteria | 6014457 |
| 828 | 2599993382 | 2599185311 | Bacteria | 6354990 |
| 829 | 2600002931 | 2599185312 | Bacteria | 5912071 |
| 830 | 2600008252 | 2599185313 | Bacteria | 6658188 |
| 831 | 2600014546 | 2599185314 | Bacteria | 6621749 |
| 832 | 2600016140 | 2599185315 | Bacteria | 6771107 |
| 833 | 2600021964 | 2599185316 | Bacteria | 6320029 |
| 834 | 2600028522 | 2599185317 | Bacteria | 6435722 |
| 835 | 2600037564 | 2599185318 | Bacteria | 6961590 |
| 836 | 2600042839 | 2599185319 | Bacteria | 6637840 |
| 837 | 2600049803 | 2599185320 | Bacteria | 5963263 |
| 838 | 2600051346 | 2599185321 | Bacteria | 6764560 |
| 839 | 2600060049 | 2599185322 | Bacteria | 6763055 |
| 840 | 2600063270 | 2599185323 | Bacteria | 6688755 |
| 841 | 2600070588 | 2599185324 | Bacteria | 6590677 |
| 842 | 2600075238 | 2599185325 | Bacteria | 6324919 |
| 843 | 2600212272 | 2599185356 | Bacteria | 6843884 |
| 844 | 2600357689 | 2600254930 | Bacteria | 6431253 |
| 845 | 2600366553 | 2600254931 | Bacteria | 6734225 |
| 846 | 2601690447 | 2600255296 | Bacteria | 5784754 |
| 847 | 2601772440 | 2600255313 | Bacteria | 6842543 |
| 848 | 2601799597 | 2600255318 | Bacteria | 6383414 |
| 849 | 2606078169 | 2603880185 | Bacteria | 6379190 |
| 850 | 2606130277 | 2603880199 | Bacteria | 6377649 |
| 851 | 2621299360 | 2619619299 | Bacteria | 6649820 |
| 852 | 2624480625 | 2623620443 | Bacteria | 6427864 |
| 853 | 2624492475 | 2623620446 | Bacteria | 6500345 |
| 854 | 2643869779 | 2643221571 | Bacteria | 6228673 |
| 855 | 2644283730 | 2643221650 | Bacteria | 7029547 |
| 856 | 2644621019 | 2643221713 | Bacteria | 6554480 |
| 857 | 2652548530 | 2651869719 | Bacteria | 6047974 |
| 858 | 2671094561 | 2667528170 | Bacteria | 6786960 |
| 859 | 2671095590 | 2667528171 | Bacteria | 6900659 |
| 860 | 2671126312 | 2667528176 | Bacteria | 6724917 |
| 861 | 2671769731 | 2671180172 | Bacteria | 6495783 |
| 862 | 2678263634 | 2675903515 | Bacteria | 6580491 |
| 863 | 2715756583 | 2713897149 | Bacteria | 6506249 |
| 864 | 2718634240 | 2718217725 | Bacteria | 5758958 |
| 865 | 2723249023 | 2721755607 | Bacteria | 5841722 |
| 866 | 2738675007 | 2738541265 | Bacteria | 6594665 |
| 867 | 2738753506 | 2738541282 | Bacteria | 6593925 |
| 868 | 2738810435 | 2738541294 | Bacteria | 6925949 |
| 869 | 2738862418 | 2738541303 | Bacteria | 6591772 |
| 870 | 2738897795 | 2738541309 | Bacteria | 6926455 |
| 871 | 2739311946 | 2738543025 | Bacteria | 6600348 |
| 872 | 2743737452 | 2740892503 | Bacteria | 6855563 |
| 873 | 2745009965 | 2744054620 | Bacteria | 6551379 |
| 874 | 2774120413 | 2773857670 | Bacteria | 6407454 |
| 875 | 2774133645 | 2773857673 | Bacteria | 6513460 |
| 876 | 2784264600 | 2784132063 | Bacteria | 6262788 |
| 877 | 2784312886 | 2784132072 | Bacteria | 6596533 |
| 878 | 2794597372 | 2791355520 | Bacteria | 5948615 |
| 879 | 2808853771 | 2808606361 | Bacteria | 6136259 |
| 880 | 2808922155 | 2808606376 | Bacteria | 6248667 |
| 881 | 2808929651 | 2808606377 | Bacteria | 6646337 |
| 882 | 2808933606 | 2808606378 | Bacteria | 6177535 |
| 883 | 2808944862 | 2808606380 | Bacteria | 6248705 |
| 884 | 2808951770 | 2808606381 | Bacteria | 6646461 |
| 885 | 2808962080 | 2808606383 | Bacteria | 6138645 |
| 886 | 2808978441 | 2808606385 | Bacteria | 6711065 |
| 887 | 2808994032 | 2808606388 | Bacteria | 6706662 |
| 888 | 2808997163 | 2808606389 | Bacteria | 6138126 |
| 889 | 2809214948 | 2808606445 | Bacteria | 6057339 |
| 890 | 2817490722 | 2816332298 | Bacteria | 6852809 |
| 891 | 2819658737 | 2818991456 | Bacteria | 6123676 |
| 892 | 2819700931 | 2818991464 | Bacteria | 6907494 |
| 893 | 2825651441 | 2825651385 | Bacteria | 6715909 |
| 894 | 2826581440 | 2826581358 | Bacteria | 5963467 |
| 895 | 2834030105 | 2834028612 | Bacteria | 6354979 |
| 896 | 2842820155 | 2842815866 | Bacteria | 5947510 |
| 897 | 2842831591 | 2842826826 | Bacteria | 5974129 |
| 898 | 2842834591 | 2842832357 | Bacteria | 5959113 |
| 899 | 2842840156 | 2842837860 | Bacteria | 6066181 |
| 900 | 2842848806 | 2842843487 | Bacteria | 6004777 |
| 901 | 2842851329 | 2842849001 | Bacteria | 5924277 |
| 902 | 2842859065 | 2842854478 | Bacteria | 6143501 |
| 903 | 2844670753 | 2844665904 | Bacteria | 6817974 |
| 904 | 2852617532 | 2852612431 | Bacteria | 6885235 |
| 905 | 2852661983 | 2852657418 | Bacteria | 6472974 |
| 906 | 2852672349 | 2852667396 | Bacteria | 6885555 |
| 907 | 2860344753 | 2860339153 | Bacteria | 6846989 |
| 908 | 2860870056 | 2860867994 | Bacteria | 5645326 |
| 909 | 2878032499 | 2878029506 | Bacteria | 6418441 |
| 910 | 2880233350 | 2880230671 | Bacteria | 6140320 |
| 911 | 2904523981 | 2904518522 | Bacteria | 6068986 |
| 912 | 2908449328 | 2908446538 | Bacteria | 6829095 |
| 913 | 2912965632 | 2912963787 | Bacteria | 5646108 |
| 914 | 2913039529 | 2913036834 | Bacteria | 6704877 |
| 915 | 2917073956 | 2917070673 | Bacteria | 6868303 |
| 916 | 2919065123 | 2919063839 | Bacteria | 6302690 |
| 917 | 2919386965 | 2919385768 | Bacteria | 5897293 |
| 918 | 2919487609 | 2919481497 | Bacteria | 6907839 |
| 919 | 2919698642 | 2919697872 | Bacteria | 6553725 |
| 920 | 2923156493 | 2923153595 | Bacteria | 6870622 |
| 921 | 2923588838 | 2923586266 | Bacteria | 6565975 |
| 922 | 2929147547 | 2929144301 | Bacteria | 6622272 |
| 923 | 2929192201 | 2929189879 | Bacteria | 5930554 |
| 924 | 2931369406 | 2931369376 | Bacteria | 6847892 |
| 925 | 2931394247 | 2931390751 | Bacteria | 6273349 |
| 926 | 2931402272 | 2931396565 | Bacteria | 7251677 |
| 927 | 2935355977 | 2935353572 | Unclassified | 6955622 |
| 928 | 2939653905 | 2939651529 | Bacteria | 5895393 |
| 929 | 2945933775 | 2945928738 | Bacteria | 6053221 |
| 930 | 2945964091 | 2945961074 | Bacteria | 7342064 |
| 931 | 2946031187 | 2946027586 | Bacteria | 6049274 |
| 932 | 2947237536 | 2947233263 | Bacteria | 6439278 |
| 933 | 2969307371 | 2969304461 | Bacteria | 6601805 |
| 934 | 2974290974 | 2974289157 | Bacteria | 6080362 |
| 935 | 2984289567 | 2984286254 | Bacteria | 6702062 |
| 936 | 2988729225 | 2988728565 | Bacteria | 6124362 |
| 937 | 2998142845 | 2998139840 | Bacteria | 6073514 |
| 938 | 3007395872 | 3007395558 | Bacteria | 6755444 |
| 939 | 3007624020 | 3007619802 | Bacteria | 6411688 |
| 940 | 3007803588 | 3007803356 | Bacteria | 5931491 |
| 941 | 3007856867 | 3007855910 | Bacteria | 5637581 |
| 942 | 3007862136 | 3007861166 | Bacteria | 6045338 |
| 943 | 3007868995 | 3007866637 | Bacteria | 5899198 |
| 944 | 637320497 | 637000220 | Bacteria | 7074893 |
| 945 | 8015690689 | 8015687852 | Bacteria | 6613826 |
| 946 | 8019774375 | 8019769354 | Bacteria | 6924660 |
| 947 | 8019778890 | 8019775933 | Bacteria | 6858656 |
| 948 | 8029997947 | 8029995093 | Bacteria | 5990776 |
| 949 | 8052496377 | 8052494512 | Bacteria | 5765634 |
| 950 | 8054287105 | 8054285046 | Bacteria | 6919322 |
| 951 | 8054348189 | 8054347763 | Bacteria | 5901107 |
| 952 | 8054505902 | 8054503363 | Bacteria | 6101651 |
| 953 | 8055773824 | 8055770955 | Bacteria | 6827675 |
| 954 | 8055820548 | 8055817908 | Bacteria | 6609162 |
| 955 | 8055883645 | 8055878733 | Bacteria | 5907058 |
| 956 | 8056134998 | 8056131705 | Bacteria | 6107031 |
| 957 | 8056145810 | 8056143049 | Bacteria | 6307666 |
| 958 | 8056154526 | 8056148874 | Bacteria | 6479865 |
| 959 | 8056157804 | 8056155041 | Bacteria | 6486948 |
| 960 | 8056166385 | 8056161164 | Bacteria | 6106669 |
| 961 | 8056168354 | 8056166840 | Bacteria | 5820959 |
| 962 | 8056174101 | 8056172158 | Bacteria | 6133900 |
| 963 | 8056574578 | 8056569372 | Bacteria | 5997322 |
| 964 | 8057800645 | 8057798959 | Bacteria | 6713499 |
| 965 | Ga0439438_000033 | |||
| 966 | MRS2a_Contig_14 | |||
| 967 | MRS1b_contig_7203591 | |||
| 968 | JGI25163J39215_1000030 | |||
| 969 | JGI25163J39215_1000145 | |||
| 970 | JGI25164J39214_1000027 | |||
| 971 | JGI25164J39214_1000092 | |||
| 972 | JGI25165J46597_1000084 | |||
| 973 | JGI25165J46597_1000101 | |||
| 974 | Ga0055538_1000123 | |||
| 975 | Ga0055539_1000167 | |||
| 976 | Ga0055533_1000171 | |||
| 977 | Ga0055532_1000159 | |||
| 978 | Ga0055525_1000232 | |||
| 979 | Ga0055535_1006313 | |||
| 980 | Ga0055536_1000014 | |||
| 981 | Ga0055530_10000009 | |||
| 982 | Ga0055530_10000019 | |||
| 983 | Ga0055540_1000055 | |||
| 984 | Ga0055540_1000556 | |||
| 985 | Ga0055541_1000112 | |||
| 986 | Ga0065714_10002287 | |||
| 987 | Ga0065714_10016219 | |||
| 988 | Ga0065714_10065686 | |||
| 989 | Ga0065714_10073274 | |||
| 990 | Ga0065714_10144891 | |||
| 991 | Ga0065704_10007733 | |||
| 992 | Ga0065704_10016866 | |||
| 993 | Ga0065704_10070497 | |||
| 994 | Ga0065704_10336572 | |||
| 995 | Ga0065712_10002138 | |||
| 996 | Ga0065715_10280905 | |||
| 997 | Ga0070670_100000087 | |||
| 998 | Ga0070670_100001780 | |||
| 999 | Ga0070661_100013109 | |||
| 1000 | Ga0070669_100000583 | |||
| 1001 | Ga0070669_100317908 | |||
| 1002 | Ga0070662_100051896 | |||
| 1003 | Ga0070662_100247864 | |||
| 1004 | Ga0068853_100016563 | |||
| 1005 | Ga0070665_100387189 | |||
| 1006 | Ga0070664_100000042 | |||
| 1007 | Ga0070664_101270311 | |||
| 1008 | Ga0068851_10000268 | |||
| 1009 | Ga0075364_10326030 | |||
| 1010 | Ga0075436_100463649 | |||
| 1011 | Ga0079104_1000612 | |||
| 1012 | Ga0079104_1020269 | |||
| 1013 | Ga0099826_10010705 | |||
| 1014 | Ga0105251_10003010 | |||
| 1015 | Ga0105251_10003185 | |||
| 1016 | Ga0105251_10042542 | |||
| 1017 | Ga0105251_10049212 | |||
| 1018 | Ga0105251_10090954 | |||
| 1019 | Ga0105244_10006007 | |||
| 1020 | Ga0105244_10019652 | |||
| 1021 | Ga0105244_10024096 | |||
| 1022 | Ga0105244_10051132 | |||
| 1023 | Ga0105244_10095113 | |||
| 1024 | Ga0105244_10126841 | |||
| 1025 | Ga0105244_10203356 | |||
| 1026 | Ga0105244_10338095 | |||
| 1027 | Ga0105244_10343142 | |||
| 1028 | Ga0105250_10000158 | |||
| 1029 | Ga0105250_10000593 | |||
| 1030 | Ga0105250_10010389 | |||
| 1031 | Ga0105250_10015699 | |||
| 1032 | Ga0105250_10020995 | |||
| 1033 | Ga0105250_10031479 | |||
| 1034 | Ga0105250_10037248 | |||
| 1035 | Ga0105250_10056632 | |||
| 1036 | Ga0105250_10075703 | |||
| 1037 | Ga0105250_10086624 | |||
| 1038 | Ga0105250_10097854 | |||
| 1039 | Ga0105243_10015032 | |||
| 1040 | Ga0105243_10060354 | |||
| 1041 | Ga0105242_10039070 | |||
| 1042 | Ga0105248_10685498 | |||
| 1043 | Ga0105237_10002354 | |||
| 1044 | Ga0105246_10000801 | |||
| 1045 | Ga0105246_10008402 | |||
| 1046 | Ga0157345_1000062 | |||
| 1047 | Ga0157373_10000554 | |||
| 1048 | Ga0157373_10000675 | |||
| 1049 | Ga0157373_10001783 | |||
| 1050 | Ga0157373_10003049 | |||
| 1051 | Ga0157373_10009090 | |||
| 1052 | Ga0157373_10082201 | |||
| 1053 | Ga0157373_10103560 | |||
| 1054 | Ga0157373_10214911 | |||
| 1055 | Ga0157371_10000142 | |||
| 1056 | Ga0157371_10002100 | |||
| 1057 | Ga0157371_10002889 | |||
| 1058 | Ga0157371_10036666 | |||
| 1059 | Ga0157370_10044396 | |||
| 1060 | Ga0157370_10100427 | |||
| 1061 | Ga0157370_10404221 | |||
| 1062 | Ga0157369_10001013 | |||
| 1063 | Ga0157369_10018470 | |||
| 1064 | Ga0157369_10028752 | |||
| 1065 | Ga0157369_11080383 | |||
| 1066 | Ga0163162_10005115 | |||
| 1067 | Ga0163162_11106148 | |||
| 1068 | Ga0163162_11432100 | |||
| 1069 | Ga0163162_11954572 | |||
| 1070 | Ga0157372_10113148 | |||
| 1071 | Ga0157375_10162642 | |||
| 1072 | Ga0182008_10000563 | |||
| 1073 | Ga0182008_10002156 | |||
| 1074 | Ga0182008_10002369 | |||
| 1075 | Ga0182008_10003170 | |||
| 1076 | Ga0182008_10027769 | |||
| 1077 | Ga0182008_10051897 | |||
| 1078 | Ga0182008_10092440 | |||
| 1079 | Ga0182008_10132532 | |||
| 1080 | Ga0182006_1000206 | |||
| 1081 | Ga0182006_1001357 | |||
| 1082 | Ga0182006_1001807 | |||
| 1083 | Ga0182006_1006330 | |||
| 1084 | Ga0182006_1010414 | |||
| 1085 | Ga0182007_10001484 | |||
| 1086 | Ga0182007_10004046 | |||
| 1087 | Ga0182005_1011162 | |||
| 1088 | Ga0182005_1014884 | |||
| 1089 | Ga0182005_1040005 | |||
| 1090 | Ga0163161_10000111 | |||
| 1091 | Ga0163161_10032983 | |||
| 1092 | Ga0163161_10051618 | |||
| 1093 | Ga0163161_10191889 | |||
| 1094 | Ga0163161_10678471 | |||
| 1095 | Ga0209435_108808 | |||
| 1096 | Ga0209760_100014 | |||
| 1097 | Ga0209760_100030 | |||
| 1098 | Ga0209784_100058 | |||
| 1099 | Ga0209566_100045 | |||
| 1100 | Ga0209674_100096 | |||
| 1101 | Ga0209147_100056 | |||
| 1102 | Ga0209563_100064 | |||
| 1103 | Ga0209563_100288 | |||
| 1104 | Ga0207427_100011 | |||
| 1105 | Ga0207427_100022 | |||
| 1106 | Ga0209437_100002 | |||
| 1107 | Ga0209437_100025 | |||
| 1108 | Ga0209258_100243 | |||
| 1109 | Ga0209646_1000207 | |||
| 1110 | Ga0209677_100053 | |||
| 1111 | Ga0209759_1003014 | |||
| 1112 | Ga0209233_1000004 | |||
| 1113 | Ga0209233_1000012 | |||
| 1114 | Ga0209676_1000003 | |||
| 1115 | Ga0209676_1000158 | |||
| 1116 | Ga0209676_1000701 | |||
| 1117 | Ga0209676_1001208 | |||
| 1118 | Ga0209050_1000004 | |||
| 1119 | Ga0209050_1000013 | |||
| 1120 | Ga0209051_1000006 | |||
| 1121 | Ga0209051_1000007 | |||
| 1122 | Ga0209257_1004709 | |||
| 1123 | Ga0207656_10000674 | |||
| 1124 | Ga0207696_1000002 | |||
| 1125 | Ga0207696_1000019 | |||
| 1126 | Ga0207696_1000041 | |||
| 1127 | Ga0207696_1001637 | |||
| 1128 | Ga0207696_1018476 | |||
| 1129 | Ga0207696_1022339 | |||
| 1130 | Ga0207696_1024290 | |||
| 1131 | Ga0207696_1038903 | |||
| 1132 | Ga0207696_1051946 | |||
| 1133 | Ga0207655_1000118 | |||
| 1134 | Ga0207655_1000216 | |||
| 1135 | Ga0207655_1001015 | |||
| 1136 | Ga0207655_1004036 | |||
| 1137 | Ga0207655_1029143 | |||
| 1138 | Ga0207655_1041749 | |||
| 1139 | Ga0207655_1079896 | |||
| 1140 | Ga0207655_1093264 | |||
| 1141 | Ga0207655_1104855 | |||
| 1142 | Ga0207713_1000275 | |||
| 1143 | Ga0207713_1000903 | |||
| 1144 | Ga0207713_1001384 | |||
| 1145 | Ga0207713_1002856 | |||
| 1146 | Ga0207713_1011556 | |||
| 1147 | Ga0207713_1016989 | |||
| 1148 | Ga0207713_1022934 | |||
| 1149 | Ga0207713_1041300 | |||
| 1150 | Ga0207671_10000163 | |||
| 1151 | Ga0207649_10000050 | |||
| 1152 | Ga0207681_10001448 | |||
| 1153 | Ga0207681_10130565 | |||
| 1154 | Ga0207650_10000418 | |||
| 1155 | Ga0207650_10000500 | |||
| 1156 | Ga0207706_10073777 | |||
| 1157 | Ga0207686_10022450 | |||
| 1158 | Ga0207709_10000004 | |||
| 1159 | Ga0207709_10004473 | |||
| 1160 | Ga0207711_10553080 | |||
| 1161 | Ga0207679_10000021 | |||
| 1162 | Ga0207679_11342521 | |||
| 1163 | Ga0207640_10675409 | |||
| 1164 | Ga0207639_10028686 | |||
| 1165 | Ga0209281_1000009 | |||
| 1166 | Ga0209281_1001370 | |||
| 1167 | Ga0209281_1001819 | |||
| 1168 | Ga0209281_1009142 | |||
| 1169 | Ga0209281_1018951 | |||
| 1170 | Ga0268266_10163685 | |||
| 1171 | Ga0268266_10453912 | |||
| 1172 | Ga0316177_1081644 | |||
| 1173 | Ga0316178_1091477 | |||
| 1174 | Ga0316182_1255784 | |||
| 1175 | Ga0307408_100001439 | |||
| 1176 | Ga0307408_100017237 | |||
| 1177 | Ga0307408_100036082 | |||
| 1178 | Ga0307408_100182404 | |||
| 1179 | Ga0307408_100257472 | |||
| 1180 | Ga0307408_100292169 | |||
| 1181 | Ga0307405_10000123 | |||
| 1182 | Ga0307405_10002024 | |||
| 1183 | Ga0307405_10015828 | |||
| 1184 | Ga0307405_10159343 | |||
| 1185 | Ga0307413_10002782 | |||
| 1186 | Ga0307413_10908153 | |||
| 1187 | Ga0307406_10136720 | |||
| 1188 | Ga0307406_10648022 | |||
| 1189 | Ga0307407_10142841 | |||
| 1190 | Ga0307412_10001220 | |||
| 1191 | Ga0307412_10001865 | |||
| 1192 | Ga0307412_10031292 | |||
| 1193 | Ga0307409_100028987 | |||
| 1194 | Ga0307416_100674867 | |||
| 1195 | Ga0307411_10003794 | |||
| 1196 | Ga0307411_10112498 | |||
| 1197 | Ga0307510_10002317 | |||
| 1198 | Ga0307510_10389384 | |||
| 1199 | Ga0439438_000098 | |||
| 1200 | Ga0439438_000229 | |||
| 1201 | Ga0439438_000512 | |||
| 1202 | Ga0439438_003135 | |||
| 1203 | Ga0439438_028378 | |||
| 1204 | Ga0439447_003078 | |||
| 1205 | Ga0439447_004809 | |||
| 1206 | Ga0439447_010514 | |||
| 1207 | Ga0439447_032343 | |||
| 1208 | Ga0439447_039103 | |||
| 1209 | Ga0439447_040476 | |||
| 1210 | Ga0439447_056022 | |||
| 1211 | Ga0439447_059164 | |||
| 1212 | Ga0439466_0017099 | |||
| 1213 | Ga0439466_0032202 | |||
| 1214 | Ga0439466_0039815 | |||
| 1215 | Ga0439466_0051797 | |||
| 1216 | Ga0439466_0075031 | |||
| 1217 | Ga0451797_0488993 | |||
| 1218 | Ga0439431_0000305 | |||
| 1219 | Ga0439445_0004598 | |||
| 1220 | Ga0439432_000052 | |||
| 1221 | Ga0439432_000468 | |||
| 1222 | Ga0439432_001010 | |||
| 1223 | Ga0439432_001163 | |||
| 1224 | Ga0439432_001534 | |||
| 1225 | Ga0439432_003028 | |||
| 1226 | Ga0439432_010954 | |||
| 1227 | Ga0439432_021412 | |||
| 1228 | Ga0439432_025256 | |||
| 1229 | Ga0439432_030010 | |||
| 1230 | Ga0439451_003621 | |||
| 1231 | Ga0439451_009523 | |||
| 1232 | Ga0439451_054904 | |||
| 1233 | Ga0439451_062145 | |||
| 1234 | Ga0439452_000087 | |||
| 1235 | Ga0439452_000292 | |||
| 1236 | Ga0439452_005530 | |||
| 1237 | Ga0439452_005855 | |||
| 1238 | Ga0439452_016681 | |||
| 1239 | Ga0439452_021458 | |||
| 1240 | Ga0439452_047578 | |||
| 1241 | Ga0439456_002016 | |||
| 1242 | Ga0439456_003100 | |||
| 1243 | Ga0439456_028069 | |||
| 1244 | Ga0439456_037895 | |||
| 1245 | Ga0439463_005415 | |||
| 1246 | Ga0439463_019904 | |||
| 1247 | Ga0439463_036797 | |||
| 1248 | Ga0439463_051238 | |||
| 1249 | Ga0439463_052699 | |||
| 1250 | Ga0439463_066552 | |||
| 1251 | Ga0439463_078657 | |||
| 1252 | Ga0450911_000063 | |||
| 1253 | Ga0450911_001410 | |||
| 1254 | Ga0450919_002153 | |||
| 1255 | Ga0450922_000847 | |||
| 1256 | Ga0450922_008879 | |||
| 1257 | Ga0450890_000120 | |||
| 1258 | Ga0450903_000497 | |||
| 1259 | Ga0450903_010096 | |||
| 1260 | Ga0450904_006659 | |||
| 1261 | Ga0450905_000793 | |||
| 1262 | Ga0450889_010381 | |||
| 1263 | Ga0450906_010958 | |||
| 1264 | Ga0450906_021426 | |||
| 1265 | Ga0450907_000060 | |||
| 1266 | Ga0450907_001916 | |||
| 1267 | Ga0450910_001791 | |||
| 1268 | Ga0450910_005016 | |||
| 1269 | Ga0439446_0009657 | |||
| 1270 | Ga0439446_0039818 | |||
| 1271 | Ga0450909_008687 | |||
| 1272 | Ga0450909_018683 | |||
| 1273 | Ga0439434_0000096 | |||
| 1274 | Ga0439464_0011875 | |||
| 1275 | Ga0439460_0003236 | |||
| 1276 | Ga0439460_0090799 | |||
| 1277 | Ga0450918_005147 | |||
| 1278 | Ga0439440_0011979 | |||
| 1279 | Ga0439440_0046837 | |||
| 1280 | Ga0495617_013342 | |||
| 1281 | Ga0495617_015217 | |||
| 1282 | Ga0495617_019859 | |||
| 1283 | Ga0495617_053130 | |||
| 1284 | Ga0495617_058086 | |||
| 1285 | Ga0495617_085310 | |||
| 1286 | Ga0495617_117653 | |||
| 1287 | Ga0495627_000009 | |||
| 1288 | Ga0495627_000146 | |||
| 1289 | Ga0495627_000276 | |||
| 1290 | Ga0495627_000930 | |||
| 1291 | Ga0495627_002443 | |||
| 1292 | Ga0495627_008602 | |||
| 1293 | Ga0495627_047813 | |||
| 1294 | Ga0495603_0005333 | |||
| 1295 | Ga0495603_0152786 | |||
| 1296 | Ga0495590_0000344 | |||
| 1297 | Ga0495590_0036061 | |||
| 1298 | Ga0495591_000159 | |||
| 1299 | Ga0495591_000249 | |||
| 1300 | Ga0495591_000547 | |||
| 1301 | Ga0495591_003898 | |||
| 1302 | Ga0495591_004168 | |||
| 1303 | Ga0495591_013832 | |||
| 1304 | Ga0495591_025870 | |||
| 1305 | Ga0495591_025908 | |||
| 1306 | Ga0495591_027343 | |||
| 1307 | Ga0495591_052021 | |||
| 1308 | Ga0495629_0016685 | |||
| 1309 | Ga0495638_0000544 | |||
| 1310 | Ga0495638_0042827 | |||
| 1311 | Ga0495638_0081295 | |||
| 1312 | Ga0495638_0088354 | |||
| 1313 | Ga0495638_0388024 | |||
| 1314 | Ga0495653_0013976 | |||
| 1315 | Ga0495653_0081697 | |||
| 1316 | Ga0495653_0172160 | |||
| 1317 | Ga0495653_0221512 | |||
| 1318 | Ga0495650_0001892 | |||
| 1319 | Ga0495650_0003079 | |||
| 1320 | Ga0495650_0009724 | |||
| 1321 | Ga0495650_0011053 | |||
| 1322 | Ga0495650_0055661 | |||
| 1323 | Ga0495650_0060679 | |||
| 1324 | Ga0495582_0063607 | |||
| 1325 | Ga0495605_0000011 | |||
| 1326 | Ga0495605_0000200 | |||
| 1327 | Ga0495605_0000201 | |||
| 1328 | Ga0495605_0004771 | |||
| 1329 | Ga0495605_0005921 | |||
| 1330 | Ga0495605_0008597 | |||
| 1331 | Ga0495605_0010708 | |||
| 1332 | Ga0495605_0014933 | |||
| 1333 | Ga0495605_0077657 | |||
| 1334 | Ga0495605_0168899 | |||
| 1335 | Ga0495605_0225362 | |||
| 1336 | Ga0495639_0007189 | |||
| 1337 | Ga0495584_0000146 | |||
| 1338 | Ga0495584_0000441 | |||
| 1339 | Ga0495584_0000633 | |||
| 1340 | Ga0495584_0003810 | |||
| 1341 | Ga0495584_0017544 | |||
| 1342 | Ga0495584_0036174 | |||
| 1343 | Ga0495584_0110527 | |||
| 1344 | Ga0495585_0000219 | |||
| 1345 | Ga0495585_0000307 | |||
| 1346 | Ga0495585_0002032 | |||
| 1347 | Ga0495585_0002947 | |||
| 1348 | Ga0495585_0004174 | |||
| 1349 | Ga0495585_0018630 | |||
| 1350 | Ga0495585_0558258 | |||
| 1351 | Ga0495594_0002120 | |||
| 1352 | Ga0495594_0043472 | |||
| 1353 | Ga0495594_0056263 | |||
| 1354 | Ga0495596_0015225 | |||
| 1355 | Ga0495596_0064891 | |||
| 1356 | Ga0495596_0068023 | |||
| 1357 | Ga0495607_0000014 | |||
| 1358 | Ga0495607_0000052 | |||
| 1359 | Ga0495607_0000074 | |||
| 1360 | Ga0495607_0004566 | |||
| 1361 | Ga0495607_0019802 | |||
| 1362 | Ga0495607_0028075 | |||
| 1363 | Ga0495607_0032939 | |||
| 1364 | Ga0495607_0072624 | |||
| 1365 | Ga0495607_0114195 | |||
| 1366 | Ga0495607_0124995 | |||
| 1367 | Ga0495583_0000047 | |||
| 1368 | Ga0495583_0000513 | |||
| 1369 | Ga0495583_0003239 | |||
| 1370 | Ga0495583_0003561 | |||
| 1371 | Ga0495583_0003633 | |||
| 1372 | Ga0495583_0069492 | |||
| 1373 | Ga0495583_0353681 | |||
| 1374 | Ga0495606_0000741 | |||
| 1375 | Ga0495606_0001204 | |||
| 1376 | Ga0495606_0001593 | |||
| 1377 | Ga0495606_0002795 | |||
| 1378 | Ga0495606_0004583 | |||
| 1379 | Ga0495606_0059184 | |||
| 1380 | Ga0495606_0066152 | |||
| 1381 | Ga0495606_0069025 | |||
| 1382 | Ga0495610_0000498 | |||
| 1383 | Ga0495610_0001076 | |||
| 1384 | Ga0495610_0001677 | |||
| 1385 | Ga0495610_0002781 | |||
| 1386 | Ga0495610_0004366 | |||
| 1387 | Ga0495610_0008011 | |||
| 1388 | Ga0495610_0025029 | |||
| 1389 | Ga0495610_0025440 | |||
| 1390 | Ga0495610_0066081 | |||
| 1391 | Ga0495610_0097467 | |||
| 1392 | Ga0495610_0249672 | |||
| 1393 | Ga0495616_0000130 | |||
| 1394 | Ga0495616_0000693 | |||
| 1395 | Ga0495616_0001642 | |||
| 1396 | Ga0495616_0018073 | |||
| 1397 | Ga0495616_0133719 | |||
| 1398 | Ga0495620_0000035 | |||
| 1399 | Ga0495620_0000081 | |||
| 1400 | Ga0495620_0000194 | |||
| 1401 | Ga0495620_0000870 | |||
| 1402 | Ga0495620_0006725 | |||
| 1403 | Ga0495620_0015179 | |||
| 1404 | Ga0495620_0043795 | |||
| 1405 | Ga0495620_0072454 | |||
| 1406 | Ga0495628_0033116 | |||
| 1407 | Ga0495630_0004302 | |||
| 1408 | Ga0495630_0015241 | |||
| 1409 | Ga0495630_0076627 | |||
| 1410 | Ga0495630_0204095 | |||
| 1411 | Ga0495631_0000014 | |||
| 1412 | Ga0495631_0000134 | |||
| 1413 | Ga0495631_0000200 | |||
| 1414 | Ga0495631_0003434 | |||
| 1415 | Ga0495631_0032461 | |||
| 1416 | Ga0495631_0065510 | |||
| 1417 | Ga0495631_0087675 | |||
| 1418 | Ga0495631_0092405 | |||
| 1419 | Ga0495631_0107893 | |||
| 1420 | Ga0495632_0000108 | |||
| 1421 | Ga0495632_0000150 | |||
| 1422 | Ga0495632_0001602 | |||
| 1423 | Ga0495632_0002786 | |||
| 1424 | Ga0495632_0010897 | |||
| 1425 | Ga0495632_0020675 | |||
| 1426 | Ga0495632_0022221 | |||
| 1427 | Ga0495632_0026724 | |||
| 1428 | Ga0495632_0066809 | |||
| 1429 | Ga0495632_0092277 | |||
| 1430 | Ga0495637_0000060 | |||
| 1431 | Ga0495637_0003371 | |||
| 1432 | Ga0495637_0005458 | |||
| 1433 | Ga0495637_0007615 | |||
| 1434 | Ga0495637_0016435 | |||
| 1435 | Ga0495637_0036122 | |||
| 1436 | Ga0495637_0039923 | |||
| 1437 | Ga0495637_0047730 | |||
| 1438 | Ga0495637_0061548 | |||
| 1439 | Ga0495637_0085977 | |||
| 1440 | Ga0495643_0000558 | |||
| 1441 | Ga0495643_0002392 | |||
| 1442 | Ga0495643_0002850 | |||
| 1443 | Ga0495643_0021085 | |||
| 1444 | Ga0495643_0040530 | |||
| 1445 | Ga0495643_0088599 | |||
| 1446 | Ga0495643_0143348 | |||
| 1447 | Ga0495643_0303628 | |||
| 1448 | Ga0495644_0023999 | |||
| 1449 | Ga0495644_0038108 | |||
| 1450 | Ga0495644_0211191 | |||
| 1451 | Ga0495648_0000042 | |||
| 1452 | Ga0495648_0000237 | |||
| 1453 | Ga0495648_0000342 | |||
| 1454 | Ga0495648_0000548 | |||
| 1455 | Ga0495648_0000890 | |||
| 1456 | Ga0495648_0001245 | |||
| 1457 | Ga0495648_0024098 | |||
| 1458 | Ga0495648_0039834 | |||
| 1459 | Ga0495648_0043278 | |||
| 1460 | Ga0495648_0058713 | |||
| 1461 | Ga0495648_0224506 | |||
| 1462 | Ga0495666_0001376 | |||
| 1463 | Ga0495666_0047496 | |||
| 1464 | Ga0495666_0047538 | |||
| 1465 | Ga0495666_0202788 | |||
| 1466 | Ga0495666_0224567 | |||
| 1467 | Ga0495642_0000163 | |||
| 1468 | Ga0495654_0000209 | |||
| 1469 | Ga0495654_0000703 | |||
| 1470 | Ga0495654_0001036 | |||
| 1471 | Ga0495654_0004602 | |||
| 1472 | Ga0495654_0029922 | |||
| 1473 | Ga0495654_0061955 | |||
| 1474 | Ga0495654_0069034 | |||
| 1475 | Ga0495654_0074402 | |||
| 1476 | Ga0495654_0145319 | |||
| 1477 | Ga0495586_0062043 | |||
| 1478 | Ga0495587_0001361 | |||
| 1479 | Ga0495587_0013686 | |||
| 1480 | Ga0495587_0290237 | |||
| 1481 | Ga0495609_0000004 | |||
| 1482 | Ga0495609_0000256 | |||
| 1483 | Ga0495609_0001222 | |||
| 1484 | Ga0495609_0002453 | |||
| 1485 | Ga0495609_0013640 | |||
| 1486 | Ga0495609_0014549 | |||
| 1487 | Ga0495609_0032915 | |||
| 1488 | Ga0495597_0000002 | |||
| 1489 | Ga0495597_0000166 | |||
| 1490 | Ga0495597_0002678 | |||
| 1491 | Ga0495597_0019105 | |||
| 1492 | Ga0495597_0085879 | |||
| 1493 | Ga0495622_0000350 | |||
| 1494 | Ga0495622_0000611 | |||
| 1495 | Ga0495622_0014948 | |||
| 1496 | Ga0495622_0076136 | |||
| 1497 | Ga0495622_0291304 | |||
| 1498 | Ga0495633_0000071 | |||
| 1499 | Ga0495633_0000883 | |||
| 1500 | Ga0495633_0002077 | |||
| 1501 | Ga0495633_0030234 | |||
| 1502 | Ga0495633_0335845 | |||
| 1503 | Ga0495656_0112584 | |||
| 1504 | Ga0495656_0431202 | |||
| 1505 | Ga0495668_0003415 | |||
| 1506 | Ga0495668_0251086 | |||
| 1507 | Ga0495668_0297628 | |||
| 1508 | Ga0495634_0000290 | |||
| 1509 | Ga0495634_0060062 | |||
| 1510 | Ga0495611_0000012 | |||
| 1511 | Ga0495611_0001211 | |||
| 1512 | Ga0495611_0005912 | |||
| 1513 | Ga0495611_0094491 | |||
| 1514 | Ga0495611_0144008 | |||
| 1515 | Ga0495625_0002425 | |||
| 1516 | Ga0495625_0003572 | |||
| 1517 | Ga0495625_0200331 | |||
| 1518 | Ga0495635_0000107 | |||
| 1519 | Ga0495635_0000231 | |||
| 1520 | Ga0495659_0010440 | |||
| 1521 | Ga0495659_0067815 | |||
| 1522 | Ga0495661_0000005 | |||
| 1523 | Ga0495661_0000464 | |||
| 1524 | Ga0495661_0000704 | |||
| 1525 | Ga0495661_0031945 | |||
| 1526 | Ga0495661_0034237 | |||
| 1527 | Ga0495661_0066398 | |||
| 1528 | Ga0495661_0155309 | |||
| 1529 | Ga0495661_0192659 | |||
| 1530 | Ga0495661_0200630 | |||
| 1531 | Ga0495661_0317914 | |||
| 1532 | Ga0495588_0023272 | |||
| 1533 | Ga0495588_0056012 | |||
| 1534 | Ga0495588_0265890 | |||
| 1535 | Ga0495623_0019562 | |||
| 1536 | Ga0495646_0000723 | |||
| 1537 | Ga0495646_0009476 | |||
| 1538 | Ga0495646_0100873 | |||
| 1539 | Ga0495613_0007766 | |||
| 1540 | Ga0495613_0144652 | |||
| 1541 | Ga0495670_0000450 | |||
| 1542 | Ga0495670_0000746 | |||
| 1543 | Ga0495670_0013787 | |||
| 1544 | Ga0495670_0015937 | |||
| 1545 | Ga0495670_0126301 | |||
| 1546 | Ga0495670_0151383 | |||
| 1547 | Ga0495670_0258855 | |||
| 1548 | Ga0495671_0000090 | |||
| 1549 | Ga0495671_0007887 | |||
| 1550 | Ga0495671_0011324 | |||
| 1551 | Ga0495671_0031385 | |||
| 1552 | Ga0495671_0035856 | |||
| 1553 | Ga0495671_0057728 | |||
| 1554 | Ga0495671_0088833 | |||
| 1555 | Ga0495649_0000225 | |||
| 1556 | Ga0495649_0009143 | |||
| 1557 | Ga0495649_0029045 | |||
| 1558 | Ga0495649_0048867 | |||
| 1559 | Ga0495649_0055042 | |||
| 1560 | Ga0495649_0068935 | |||
| 1561 | Ga0495589_0000303 | |||
| 1562 | Ga0495589_0001362 | |||
| 1563 | Ga0495589_0002909 | |||
| 1564 | Ga0495589_0018397 | |||
| 1565 | Ga0495589_0053715 | |||
| 1566 | Ga0495589_0177393 | |||
| 1567 | Ga0495600_0004566 | |||
| 1568 | Ga0495600_0098561 | |||
| 1569 | Ga0495660_0001527 | |||
| 1570 | Ga0495660_0003299 | |||
| 1571 | Ga0495660_0005460 | |||
| 1572 | Ga0495660_0017758 | |||
| 1573 | Ga0495660_0019279 | |||
| 1574 | Ga0495660_0046093 | |||
| 1575 | Ga0495660_0050511 | |||
| 1576 | Ga0495660_0103745 | |||
| 1577 | Ga0495581_0011750 | |||
| 1578 | Ga0495604_0001636 | |||
| 1579 | Ga0495604_0009287 | |||
| 1580 | Ga0495604_0027529 | |||
| 1581 | Ga0495604_0153249 | |||
| 1582 | Ga0495636_0105294 | |||
| 1583 | Ga0495674_0010629 | |||
| 1584 | Ga0495672_0000606 | |||
| 1585 | Ga0495672_0004521 | |||
| 1586 | Ga0495672_0004688 | |||
| 1587 | Ga0495672_0018388 | |||
| 1588 | Ga0495672_0026556 | |||
| 1589 | Ga0495672_0113811 | |||
| 1590 | Ga0495672_0223608 | |||
| 1591 | Ga0495676_0000297 | |||
| 1592 | Ga0495680_0016211 | |||
| 1593 | Ga0495680_0028985 | |||
| 1594 | Ga0495680_0050222 | |||
| 1595 | Ga0495680_0140466 | |||
| 1596 | Ga0495683_0000026 | |||
| 1597 | Ga0495683_0000057 | |||
| 1598 | Ga0495683_0008432 | |||
| 1599 | Ga0495683_0064640 | |||
| 1600 | Ga0495683_0065775 | |||
| 1601 | Ga0495683_0096327 | |||
| 1602 | Ga0495683_0153704 | |||
| 1603 | Ga0495687_003368 | |||
| 1604 | Ga0495675_0023674 | |||
| 1605 | Ga0495675_0419742 | |||
| 1606 | Ga0495677_0046095 | |||
| 1607 | Ga0495679_000853 | |||
| 1608 | Ga0495679_003461 | |||
| 1609 | Ga0495679_027634 | |||
| 1610 | Ga0495679_031432 | |||
| 1611 | Ga0495679_049238 | |||
| 1612 | Ga0495685_015547 | |||
| 1613 | Ga0495673_0000234 | |||
| 1614 | Ga0495673_0000386 | |||
| 1615 | Ga0495673_0000672 | |||
| 1616 | Ga0495673_0000717 | |||
| 1617 | Ga0495673_0000891 | |||
| 1618 | Ga0495673_0001932 | |||
| 1619 | Ga0495673_0004407 | |||
| 1620 | Ga0495673_0004826 | |||
| 1621 | Ga0495673_0018815 | |||
| 1622 | Ga0495673_0028504 | |||
| 1623 | Ga0495673_0108722 | |||
| 1624 | Ga0495681_0000227 | |||
| 1625 | Ga0495681_0000793 | |||
| 1626 | Ga0495681_0001124 | |||
| 1627 | Ga0495681_0003850 | |||
| 1628 | Ga0495681_0011988 | |||
| 1629 | Ga0495681_0018258 | |||
| 1630 | Ga0495681_0121184 | |||
| 1631 | Ga0495684_0162582 | |||
| 1632 | Ga0495686_0001144 | |||
| 1633 | Ga0495686_0093749 | |||
| 1634 | Ga0495686_0308458 | |||
| 1635 | Ga0495593_0053788 | |||
| 1636 | Ga0495593_0065136 | |||
| 1637 | Ga0495593_0131079 | |||
| 1638 | Ga0495593_0228030 | |||
| 1639 | Ga0495602_0450654 | |||
| 1640 | Ga0495626_0000474 | |||
| 1641 | Ga0495626_0000513 | |||
| 1642 | Ga0495626_0001437 | |||
| 1643 | Ga0495626_0011252 | |||
| 1644 | Ga0495626_0052178 | |||
| 1645 | Ga0495626_0076865 | |||
| 1646 | Ga0495626_0134020 | |||
| 1647 | Ga0496100_0289926 | |||
| 1648 | Ga0496102_0000394 | |||
| 1649 | Ga0496103_0000807 | |||
| 1650 | Ga0496104_0864421 | |||
| 1651 | Ga0496106_0279195 | |||
| 1652 | Ga0496110_0719601 | |||
| 1653 | Ga0496110_1774736 | |||
| 1654 | Ga0496114_0008590 | |||
| 1655 | Ga0496114_0872186 | |||
| 1656 | Ga0496115_0018838 | |||
| 1657 | Ga0496116_0000010 | |||
| 1658 | Ga0496116_0000785 | |||
| 1659 | Ga0496116_0000884 | |||
| 1660 | Ga0496116_0397930 | |||
| 1661 | Ga0496117_0001266 | |||
| 1662 | Ga0496117_0001271 | |||
| 1663 | Ga0496117_0023279 | |||
| 1664 | Ga0496117_0029925 | |||
| 1665 | Ga0496117_0052359 | |||
| 1666 | Ga0496117_0089258 | |||
| 1667 | Ga0496117_0160001 | |||
| 1668 | Ga0496117_0312712 | |||
| 1669 | Ga0496118_0006225 | |||
| 1670 | Ga0496118_0020830 | |||
| 1671 | Ga0496118_0021433 | |||
| 1672 | Ga0496118_0022568 | |||
| 1673 | Ga0496118_0026115 | |||
| 1674 | Ga0496118_0058376 | |||
| 1675 | Ga0496119_0111552 | |||
| 1676 | Ga0496119_0112582 | |||
| 1677 | Ga0496120_0004093 | |||
| 1678 | Ga0496120_0069360 | |||
| 1679 | Ga0496121_0000149 | |||
| 1680 | Ga0496121_0003221 | |||
| 1681 | Ga0496121_0034186 | |||
| 1682 | Ga0496121_0076437 | |||
| 1683 | Ga0496121_0082334 | |||
| 1684 | Ga0496121_0145232 | |||
| 1685 | Ga0496121_0169712 | |||
| 1686 | Ga0496122_0003744 | |||
| 1687 | Ga0496122_0018300 | |||
| 1688 | Ga0496122_0032081 | |||
| 1689 | Ga0496122_0090507 | |||
| 1690 | Ga0496122_0178796 | |||
| 1691 | Ga0496122_0187193 | |||
| 1692 | Ga0496123_0002210 | |||
| 1693 | Ga0496123_0007787 | |||
| 1694 | Ga0496123_0038812 | |||
| 1695 | Ga0496123_0059981 | |||
| 1696 | Ga0496123_0101758 | |||
| 1697 | Ga0496123_0151816 | |||
| 1698 | Ga0496124_0017540 | |||
| 1699 | Ga0496124_0052203 | |||
| 1700 | Ga0496124_0084353 | |||
| 1701 | Ga0496124_0086668 | |||
| 1702 | Ga0496124_0139993 | |||
| 1703 | Ga0496124_0316510 | |||
| 1704 | Ga0496124_0347953 | |||
| 1705 | Ga0496124_0471265 | |||
| 1706 | Ga0496125_0000658 | |||
| 1707 | Ga0496125_0002795 | |||
| 1708 | Ga0496125_0010383 | |||
| 1709 | Ga0496125_0069780 | |||
| 1710 | Ga0496125_0121813 | |||
| 1711 | Ga0496125_0134477 | |||
| 1712 | Ga0496125_0163258 | |||
| 1713 | Ga0496125_0253760 | |||
| 1714 | Ga0496125_0458220 | |||
| 1715 | Ga0496126_0051134 | |||
| 1716 | Ga0496126_0188550 | |||
| 1717 | Ga0496126_0260452 | |||
| 1718 | Ga0495678_000068 | |||
| 1719 | Ga0495678_000247 | |||
| 1720 | Ga0495678_000941 | |||
| 1721 | Ga0495678_000943 | |||
| 1722 | Ga0495678_002439 | |||
| 1723 | Ga0495678_005508 | |||
| 1724 | Ga0495678_015692 | |||
| 1725 | Ga0495678_035720 | |||
| 1726 | Ga0495678_050533 | |||
| 1727 | Ga0495678_082851 | |||
| 1728 | Ga0495678_187627 | |||
| 1729 | Ga0495682_0000977 | |||
| 1730 | Ga0495682_0009944 | |||
| 1731 | Ga0495682_0020493 | |||
| 1732 | Ga0495682_0078898 | |||
| 1733 | Ga0501034_0000200 | |||
| 1734 | Ga0501222_017456 | |||
| 1735 | Ga0501269_023921 | |||
| 1736 | Ga0501226_002565 | |||
| 1737 | nmdc:mga03683_401461_c1 | |||
| 1738 | Ga0500572_000410 | |||
| 1739 | Ga0500618_030511 | |||
| 1740 | Ga0500659_0007869 | |||
| 1741 | Ga0500573_0007933 | |||
| 1742 | Ga0500634_0000206 | |||
| 1743 | 2511253880 | |||
| 1744 | 2511266986 | |||
| 1745 | 2511271661 | |||
| 1746 | 2511291616 | |||
| 1747 | 2511296649 | |||
| 1748 | 2511326983 | |||
| 1749 | 2511361670 | |||
| 1750 | 2511372550 | |||
| 1751 | 2511415126 | |||
| 1752 | 2511824653 | |||
| 1753 | 2512323760 | |||
| 1754 | 2583791982 | |||
| 1755 | 2597857987 | |||
| 1756 | 2597863691 | |||
| 1757 | 2597870062 | |||
| 1758 | 2599352833 | |||
| 1759 | 2599359178 | |||
| 1760 | 2599365301 | |||
| 1761 | 2599371872 | |||
| 1762 | 2599377941 | |||
| 1763 | 2599384682 | |||
| 1764 | 2599390730 | |||
| 1765 | 2599401864 | |||
| 1766 | 2599402915 | |||
| 1767 | 2599453944 | |||
| 1768 | 2599459667 | |||
| 1769 | 2599465994 | |||
| 1770 | 2599485018 | |||
| 1771 | 2599488688 | |||
| 1772 | 2599500548 | |||
| 1773 | 2599509157 | |||
| 1774 | 2599515519 | |||
| 1775 | 2599521376 | |||
| 1776 | 2599612870 | |||
| 1777 | 2599773669 | |||
| 1778 | 2599802649 | |||
| 1779 | 2599881145 | |||
| 1780 | 2599889193 | |||
| 1781 | 2599894898 | |||
| 1782 | 2599901247 | |||
| 1783 | 2599932231 | |||
| 1784 | 2599943540 | |||
| 1785 | 2599949570 | |||
| 1786 | 2599954651 | |||
| 1787 | 2599962251 | |||
| 1788 | 2599969368 | |||
| 1789 | 2599979371 | |||
| 1790 | 2599985206 | |||
| 1791 | 2599988543 | |||
| 1792 | 2599993382 | |||
| 1793 | 2600002931 | |||
| 1794 | 2600008252 | |||
| 1795 | 2600014546 | |||
| 1796 | 2600016140 | |||
| 1797 | 2600021964 | |||
| 1798 | 2600028522 | |||
| 1799 | 2600037564 | |||
| 1800 | 2600042839 | |||
| 1801 | 2600049803 | |||
| 1802 | 2600051346 | |||
| 1803 | 2600060049 | |||
| 1804 | 2600063270 | |||
| 1805 | 2600070588 | |||
| 1806 | 2600075238 | |||
| 1807 | 2600212272 | |||
| 1808 | 2600357689 | |||
| 1809 | 2600366553 | |||
| 1810 | 2601690447 | |||
| 1811 | 2601772440 | |||
| 1812 | 2601799597 | |||
| 1813 | 2606078169 | |||
| 1814 | 2606130277 | |||
| 1815 | 2621299360 | |||
| 1816 | 2624480625 | |||
| 1817 | 2624492475 | |||
| 1818 | 2643869779 | |||
| 1819 | 2644283730 | |||
| 1820 | 2644621019 | |||
| 1821 | 2652548530 | |||
| 1822 | 2671094561 | |||
| 1823 | 2671095590 | |||
| 1824 | 2671126312 | |||
| 1825 | 2671769731 | |||
| 1826 | 2678263634 | |||
| 1827 | 2715756583 | |||
| 1828 | 2718634240 | |||
| 1829 | 2723249023 | |||
| 1830 | 2738675007 | |||
| 1831 | 2738753506 | |||
| 1832 | 2738810435 | |||
| 1833 | 2738862418 | |||
| 1834 | 2738897795 | |||
| 1835 | 2739311946 | |||
| 1836 | 2743737452 | |||
| 1837 | 2745009965 | |||
| 1838 | 2774120413 | |||
| 1839 | 2774133645 | |||
| 1840 | 2784264600 | |||
| 1841 | 2784312886 | |||
| 1842 | 2794597372 | |||
| 1843 | 2808853771 | |||
| 1844 | 2808922155 | |||
| 1845 | 2808929651 | |||
| 1846 | 2808933606 | |||
| 1847 | 2808944862 | |||
| 1848 | 2808951770 | |||
| 1849 | 2808962080 | |||
| 1850 | 2808978441 | |||
| 1851 | 2808994032 | |||
| 1852 | 2808997163 | |||
| 1853 | 2809214948 | |||
| 1854 | 2817490722 | |||
| 1855 | 2819658737 | |||
| 1856 | 2819700931 | |||
| 1857 | 2825651441 | |||
| 1858 | 2826581440 | |||
| 1859 | 2834030105 | |||
| 1860 | 2842820155 | |||
| 1861 | 2842831591 | |||
| 1862 | 2842834591 | |||
| 1863 | 2842840156 | |||
| 1864 | 2842848806 | |||
| 1865 | 2842851329 | |||
| 1866 | 2842859065 | |||
| 1867 | 2844670753 | |||
| 1868 | 2852617532 | |||
| 1869 | 2852661983 | |||
| 1870 | 2852672349 | |||
| 1871 | 2860344753 | |||
| 1872 | 2860870056 | |||
| 1873 | 2878032499 | |||
| 1874 | 2880233350 | |||
| 1875 | 2904523981 | |||
| 1876 | 2908449328 | |||
| 1877 | 2912965632 | |||
| 1878 | 2913039529 | |||
| 1879 | 2917073956 | |||
| 1880 | 2919065123 | |||
| 1881 | 2919386965 | |||
| 1882 | 2919487609 | |||
| 1883 | 2919698642 | |||
| 1884 | 2923156493 | |||
| 1885 | 2923588838 | |||
| 1886 | 2929147547 | |||
| 1887 | 2929192201 | |||
| 1888 | 2931369406 | |||
| 1889 | 2931394247 | |||
| 1890 | 2931402272 | |||
| 1891 | 2935355977 | |||
| 1892 | 2939653905 | |||
| 1893 | 2945933775 | |||
| 1894 | 2945964091 | |||
| 1895 | 2946031187 | |||
| 1896 | 2947237536 | |||
| 1897 | 2969307371 | |||
| 1898 | 2974290974 | |||
| 1899 | 2984289567 | |||
| 1900 | 2988729225 | |||
| 1901 | 2998142845 | |||
| 1902 | 3007395872 | |||
| 1903 | 3007624020 | |||
| 1904 | 3007803588 | |||
| 1905 | 3007856867 | |||
| 1906 | 3007862136 | |||
| 1907 | 3007868995 | |||
| 1908 | 637320497 | |||
| 1909 | 8015690689 | |||
| 1910 | 8019774375 | |||
| 1911 | 8019778890 | |||
| 1912 | 8029997947 | |||
| 1913 | 8052496377 | |||
| 1914 | 8054287105 | |||
| 1915 | 8054348189 | |||
| 1916 | 8054505902 | |||
| 1917 | 8055773824 | |||
| 1918 | 8055820548 | |||
| 1919 | 8055883645 | |||
| 1920 | 8056134998 | |||
| 1921 | 8056145810 | |||
| 1922 | 8056154526 | |||
| 1923 | 8056157804 | |||
| 1924 | 8056166385 | |||
| 1925 | 8056168354 | |||
| 1926 | 8056174101 | |||
| 1927 | 8056574578 | |||
| 1928 | 8057800645 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xo8-assembly1.cif.gz_A | solution structure of at1g01470 from arabidopsis thaliana | 0.7053 | 23 | 151 |
| 2vmf-assembly1.cif.gz_A | structural and biochemical evidence for a boat-like transition state in beta-mannosidases | 0.6819 | 25 | 149 |
| 2vqu-assembly1.cif.gz_A | structural and biochemical evidence for a boat-like transition state in beta-mannosidases | 0.6806 | 25 | 149 |
| 2vl4-assembly1.cif.gz_A | structural and biochemical evidence for a boat-like transition state in beta-mannosidases | 0.6799 | 25 | 149 |
| 2vot-assembly1.cif.gz_A | structural and biochemical evidence for a boat-like transition state in beta-mannosidases | 0.6799 | 25 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58353_283_400_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7987 | 40 | 150 | 2.60.40.1820 |
| af_A0A0R0IUI6_98_233_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7689 | 24 | 147 | 2.60.40.1820 |
| af_B6UH99_17_152_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7685 | 24 | 151 | 2.60.40.1820 |
| af_Q58353_283_400_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7262 | 40 | 150 | 2.60.40.1820 |
| af_B6UH99_17_152_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7252 | 24 | 151 | 2.60.40.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L8CTA9-F1-model_v4 | Late embryogenesis abundant protein LEA-2 subgroup domain-containing protein | 0.9153 | 1 | 99 |
|
| AF-A0A3L8CTA9-F1-model_v4 | Late embryogenesis abundant protein LEA-2 subgroup domain-containing protein | 0.8983 | 1 | 99 |
|
| AF-A0A2N7YKZ7-F1-model_v4 | Water stress and hypersensitive response domain-containing protein | 0.8955 | 1 | 155 |
GO:0009269
|
| AF-A0A2N7YKZ7-F1-model_v4 | Water stress and hypersensitive response domain-containing protein | 0.89 | 1 | 155 |
GO:0009269
|
| AF-A0A3B8P0P8-F1-model_v4 | Water stress and hypersensitive response domain-containing protein | 0.8861 | 2 | 154 |
GO:0009269
|