F486946
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 327 | 962 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_0135129|Ga0451853_0135129_18_392 |
| Length | 124 |
| Sequence | MPAATSHPFRQTDGDVTDERRDPMGMANLQRMAQQMQQEMLRIQGELETTLVDGTAGGGVVSVTVTGKQELVSVTIDPSAVDPDDVEMLQDLVVAAVNDALRSSKELAEQKMAAVTGGLRLPGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 2 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 230 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 231 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 232 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 233 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 234 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 235 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 236 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 237 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 238 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 7.68 |
| Rhizosphere | 90.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10027416 | 3300003203 | Unclassified | 2184 |
| 2 | rootH2_10016961 | 3300003320 | Bacteria | 5664 |
| 3 | rootH2_10041962 | 3300003320 | Bacteria | 1355 |
| 4 | rootH2_10247369 | 3300003320 | Bacteria | 2622 |
| 5 | rootH1_10020450 | 3300003323 | Bacteria | 2542 |
| 6 | Ga0065715_10961770 | 3300005293 | Bacteria | 556 |
| 7 | Ga0070676_10236036 | 3300005328 | Bacteria | 1214 |
| 8 | Ga0070676_10599700 | 3300005328 | Bacteria | 794 |
| 9 | Ga0070683_100644225 | 3300005329 | Bacteria | 1014 |
| 10 | Ga0070690_100148212 | 3300005330 | Bacteria | 1599 |
| 11 | Ga0070690_101358852 | 3300005330 | Bacteria | 571 |
| 12 | Ga0070670_100368652 | 3300005331 | Bacteria | 1264 |
| 13 | Ga0070677_10418474 | 3300005333 | Bacteria | 710 |
| 14 | Ga0068869_100457324 | 3300005334 | Bacteria | 1059 |
| 15 | Ga0068869_101657215 | 3300005334 | Bacteria | 570 |
| 16 | Ga0070680_100763137 | 3300005336 | Bacteria | 833 |
| 17 | Ga0070682_100352490 | 3300005337 | Bacteria | 1098 |
| 18 | Ga0070682_100354112 | 3300005337 | Bacteria | 1095 |
| 19 | Ga0070682_100650347 | 3300005337 | Bacteria | 839 |
| 20 | Ga0070682_101996449 | 3300005337 | Bacteria | 510 |
| 21 | Ga0068868_100152639 | 3300005338 | Bacteria | 1903 |
| 22 | Ga0068868_101052529 | 3300005338 | Bacteria | 747 |
| 23 | Ga0068868_101591236 | 3300005338 | Bacteria | 614 |
| 24 | Ga0070660_100098548 | 3300005339 | Bacteria | 2314 |
| 25 | Ga0070660_100599296 | 3300005339 | Bacteria | 921 |
| 26 | Ga0070689_100022734 | 3300005340 | Bacteria | 4685 |
| 27 | Ga0070689_100125139 | 3300005340 | Bacteria | 2056 |
| 28 | Ga0070689_100357111 | 3300005340 | Bacteria | 1227 |
| 29 | Ga0070691_10134575 | 3300005341 | Bacteria | 1255 |
| 30 | Ga0070661_100199944 | 3300005344 | Bacteria | 1527 |
| 31 | Ga0070661_101229554 | 3300005344 | Bacteria | 627 |
| 32 | Ga0070692_10025730 | 3300005345 | Bacteria | 2904 |
| 33 | Ga0070692_10225742 | 3300005345 | Bacteria | 1109 |
| 34 | Ga0070692_10518170 | 3300005345 | Bacteria | 776 |
| 35 | Ga0070692_10585780 | 3300005345 | Bacteria | 736 |
| 36 | Ga0070692_10933696 | 3300005345 | Bacteria | 602 |
| 37 | Ga0070668_100115147 | 3300005347 | Bacteria | 2143 |
| 38 | Ga0070668_100185384 | 3300005347 | Unclassified | 1702 |
| 39 | Ga0070668_100359692 | 3300005347 | Bacteria | 1234 |
| 40 | Ga0070668_100594938 | 3300005347 | Bacteria | 967 |
| 41 | Ga0070668_100815044 | 3300005347 | Unclassified | 830 |
| 42 | Ga0070669_101303047 | 3300005353 | Bacteria | 629 |
| 43 | Ga0070675_100139086 | 3300005354 | Bacteria | 2074 |
| 44 | Ga0070675_100395775 | 3300005354 | Bacteria | 1232 |
| 45 | Ga0070674_100040553 | 3300005356 | Bacteria | 3150 |
| 46 | Ga0070674_100209921 | 3300005356 | Bacteria | 1508 |
| 47 | Ga0070674_101184564 | 3300005356 | Bacteria | 678 |
| 48 | Ga0070673_100541484 | 3300005364 | Unclassified | 1057 |
| 49 | Ga0070673_101435897 | 3300005364 | Bacteria | 650 |
| 50 | Ga0070688_100704933 | 3300005365 | Bacteria | 782 |
| 51 | Ga0070688_100987390 | 3300005365 | Bacteria | 668 |
| 52 | Ga0070659_100015650 | 3300005366 | Bacteria | 5682 |
| 53 | Ga0070659_100430523 | 3300005366 | Bacteria | 1117 |
| 54 | Ga0070659_101666369 | 3300005366 | Bacteria | 570 |
| 55 | Ga0070659_101692357 | 3300005366 | Bacteria | 566 |
| 56 | Ga0070667_100585371 | 3300005367 | Bacteria | 1027 |
| 57 | Ga0070667_100658974 | 3300005367 | Bacteria | 967 |
| 58 | Ga0070703_10299321 | 3300005406 | Bacteria | 670 |
| 59 | Ga0070701_10049674 | 3300005438 | Bacteria | 2169 |
| 60 | Ga0070701_10304334 | 3300005438 | Bacteria | 981 |
| 61 | Ga0070711_100552070 | 3300005439 | Bacteria | 956 |
| 62 | Ga0070705_100035713 | 3300005440 | Bacteria | 2788 |
| 63 | Ga0070705_100680183 | 3300005440 | Bacteria | 806 |
| 64 | Ga0070700_100052017 | 3300005441 | Bacteria | 2552 |
| 65 | Ga0070700_100054398 | 3300005441 | Bacteria | 2501 |
| 66 | Ga0070700_100059450 | 3300005441 | Bacteria | 2406 |
| 67 | Ga0070700_100306225 | 3300005441 | Bacteria | 1162 |
| 68 | Ga0070700_101044844 | 3300005441 | Bacteria | 674 |
| 69 | Ga0070694_100034060 | 3300005444 | Bacteria | 3356 |
| 70 | Ga0070694_100136520 | 3300005444 | Bacteria | 1778 |
| 71 | Ga0070694_100218069 | 3300005444 | Bacteria | 1430 |
| 72 | Ga0070694_100220578 | 3300005444 | Bacteria | 1422 |
| 73 | Ga0070694_100327892 | 3300005444 | Bacteria | 1180 |
| 74 | Ga0070708_100102469 | 3300005445 | Bacteria | 2623 |
| 75 | Ga0070708_100260834 | 3300005445 | Bacteria | 1629 |
| 76 | Ga0070708_100448181 | 3300005445 | Bacteria | 1218 |
| 77 | Ga0070708_100542486 | 3300005445 | Bacteria | 1097 |
| 78 | Ga0070708_100601551 | 3300005445 | Bacteria | 1037 |
| 79 | Ga0070663_101258504 | 3300005455 | Bacteria | 652 |
| 80 | Ga0070663_101299142 | 3300005455 | Bacteria | 642 |
| 81 | Ga0070663_101819370 | 3300005455 | Bacteria | 546 |
| 82 | Ga0070678_100137826 | 3300005456 | Bacteria | 1948 |
| 83 | Ga0070678_100249957 | 3300005456 | Bacteria | 1486 |
| 84 | Ga0070678_100419704 | 3300005456 | Bacteria | 1166 |
| 85 | Ga0070678_100528970 | 3300005456 | Bacteria | 1044 |
| 86 | Ga0070678_100537665 | 3300005456 | Bacteria | 1036 |
| 87 | Ga0070678_100764945 | 3300005456 | Bacteria | 875 |
| 88 | Ga0070678_101271423 | 3300005456 | Bacteria | 684 |
| 89 | Ga0070662_100174199 | 3300005457 | Bacteria | 1692 |
| 90 | Ga0070662_100621452 | 3300005457 | Bacteria | 910 |
| 91 | Ga0070681_10315714 | 3300005458 | Bacteria | 1472 |
| 92 | Ga0070681_10549404 | 3300005458 | Bacteria | 1069 |
| 93 | Ga0070681_10812784 | 3300005458 | Bacteria | 852 |
| 94 | Ga0070681_11208650 | 3300005458 | Bacteria | 678 |
| 95 | Ga0070681_11208732 | 3300005458 | Bacteria | 678 |
| 96 | Ga0068867_100037830 | 3300005459 | Bacteria | 3509 |
| 97 | Ga0068867_101063418 | 3300005459 | Unclassified | 737 |
| 98 | Ga0068867_101427197 | 3300005459 | Unclassified | 643 |
| 99 | Ga0070685_10026310 | 3300005466 | Bacteria | 3206 |
| 100 | Ga0070685_10699323 | 3300005466 | Bacteria | 739 |
| 101 | Ga0070706_100222584 | 3300005467 | Bacteria | 1761 |
| 102 | Ga0070707_100025207 | 3300005468 | Bacteria | 5640 |
| 103 | Ga0070707_100396221 | 3300005468 | Bacteria | 1341 |
| 104 | Ga0070707_100572488 | 3300005468 | Bacteria | 1092 |
| 105 | Ga0070698_100164248 | 3300005471 | Bacteria | 2163 |
| 106 | Ga0070698_100252012 | 3300005471 | Bacteria | 1698 |
| 107 | Ga0070698_100327200 | 3300005471 | Bacteria | 1463 |
| 108 | Ga0070698_101087309 | 3300005471 | Bacteria | 748 |
| 109 | Ga0070699_100008575 | 3300005518 | Bacteria | 8857 |
| 110 | Ga0070699_101334491 | 3300005518 | Bacteria | 658 |
| 111 | Ga0070679_100400729 | 3300005530 | Bacteria | 1318 |
| 112 | Ga0070679_100404901 | 3300005530 | Bacteria | 1310 |
| 113 | Ga0070679_100719571 | 3300005530 | Bacteria | 941 |
| 114 | Ga0070679_100867230 | 3300005530 | Bacteria | 846 |
| 115 | Ga0070679_101146898 | 3300005530 | Bacteria | 722 |
| 116 | Ga0070684_100186927 | 3300005535 | Bacteria | 1884 |
| 117 | Ga0070684_100575704 | 3300005535 | Bacteria | 1046 |
| 118 | Ga0070697_100093865 | 3300005536 | Bacteria | 2485 |
| 119 | Ga0070697_100097763 | 3300005536 | Bacteria | 2436 |
| 120 | Ga0070697_100397843 | 3300005536 | Bacteria | 1195 |
| 121 | Ga0070697_100440145 | 3300005536 | Bacteria | 1134 |
| 122 | Ga0068853_100388878 | 3300005539 | Bacteria | 1304 |
| 123 | Ga0068853_100497354 | 3300005539 | Bacteria | 1151 |
| 124 | Ga0070672_100734034 | 3300005543 | Unclassified | 866 |
| 125 | Ga0070672_101024435 | 3300005543 | Bacteria | 732 |
| 126 | Ga0070686_100072359 | 3300005544 | Bacteria | 2260 |
| 127 | Ga0070686_100120228 | 3300005544 | Bacteria | 1802 |
| 128 | Ga0070686_100185107 | 3300005544 | Bacteria | 1483 |
| 129 | Ga0070686_100588665 | 3300005544 | Unclassified | 875 |
| 130 | Ga0070686_100610339 | 3300005544 | Bacteria | 861 |
| 131 | Ga0070686_100721487 | 3300005544 | Bacteria | 797 |
| 132 | Ga0070695_100054976 | 3300005545 | Bacteria | 2565 |
| 133 | Ga0070695_100082748 | 3300005545 | Bacteria | 2125 |
| 134 | Ga0070695_100192056 | 3300005545 | Bacteria | 1454 |
| 135 | Ga0070695_100920971 | 3300005545 | Bacteria | 707 |
| 136 | Ga0070695_101124659 | 3300005545 | Bacteria | 644 |
| 137 | Ga0070696_100014238 | 3300005546 | Bacteria | 5336 |
| 138 | Ga0070696_100029799 | 3300005546 | Bacteria | 3733 |
| 139 | Ga0070696_100072070 | 3300005546 | Bacteria | 2432 |
| 140 | Ga0070696_100860435 | 3300005546 | Bacteria | 750 |
| 141 | Ga0070696_101313572 | 3300005546 | Unclassified | 614 |
| 142 | Ga0070696_101353244 | 3300005546 | Bacteria | 606 |
| 143 | Ga0070696_101788678 | 3300005546 | Bacteria | 531 |
| 144 | Ga0070693_100072762 | 3300005547 | Bacteria | 2028 |
| 145 | Ga0070693_100089178 | 3300005547 | Bacteria | 1856 |
| 146 | Ga0070704_100064012 | 3300005549 | Bacteria | 2641 |
| 147 | Ga0070704_101193995 | 3300005549 | Bacteria | 694 |
| 148 | Ga0070704_101501735 | 3300005549 | Bacteria | 620 |
| 149 | Ga0068855_100847382 | 3300005563 | Bacteria | 969 |
| 150 | Ga0070664_100133647 | 3300005564 | Bacteria | 2180 |
| 151 | Ga0070664_100381505 | 3300005564 | Bacteria | 1287 |
| 152 | Ga0070664_100742324 | 3300005564 | Bacteria | 916 |
| 153 | Ga0070664_101393127 | 3300005564 | Bacteria | 663 |
| 154 | Ga0070664_101594443 | 3300005564 | Bacteria | 618 |
| 155 | Ga0068857_100142197 | 3300005577 | Bacteria | 2169 |
| 156 | Ga0068854_100084803 | 3300005578 | Bacteria | 2345 |
| 157 | Ga0068854_100783160 | 3300005578 | Bacteria | 830 |
| 158 | Ga0068854_100934598 | 3300005578 | Bacteria | 764 |
| 159 | Ga0068854_101061831 | 3300005578 | Bacteria | 720 |
| 160 | Ga0068854_101701763 | 3300005578 | Bacteria | 577 |
| 161 | Ga0068856_100200695 | 3300005614 | Bacteria | 2009 |
| 162 | Ga0068856_100666754 | 3300005614 | Bacteria | 1061 |
| 163 | Ga0070702_100035782 | 3300005615 | Bacteria | 2745 |
| 164 | Ga0070702_100156558 | 3300005615 | Bacteria | 1468 |
| 165 | Ga0070702_100464968 | 3300005615 | Bacteria | 921 |
| 166 | Ga0070702_101703033 | 3300005615 | Bacteria | 524 |
| 167 | Ga0068852_100186891 | 3300005616 | Bacteria | 1952 |
| 168 | Ga0068852_101105787 | 3300005616 | Bacteria | 813 |
| 169 | Ga0068859_101579095 | 3300005617 | Bacteria | 724 |
| 170 | Ga0068864_100537254 | 3300005618 | Bacteria | 1129 |
| 171 | Ga0068864_100840386 | 3300005618 | Bacteria | 904 |
| 172 | Ga0068864_101906823 | 3300005618 | Bacteria | 600 |
| 173 | Ga0068864_102141219 | 3300005618 | Bacteria | 566 |
| 174 | Ga0068866_10584039 | 3300005718 | Unclassified | 752 |
| 175 | Ga0068866_10597154 | 3300005718 | Bacteria | 745 |
| 176 | Ga0068866_10865520 | 3300005718 | Bacteria | 633 |
| 177 | Ga0068861_100205052 | 3300005719 | Bacteria | 1657 |
| 178 | Ga0068861_100335407 | 3300005719 | Bacteria | 1322 |
| 179 | Ga0068861_100502843 | 3300005719 | Bacteria | 1096 |
| 180 | Ga0068861_100727372 | 3300005719 | Bacteria | 925 |
| 181 | Ga0068861_100753090 | 3300005719 | Unclassified | 910 |
| 182 | Ga0068861_102402387 | 3300005719 | Bacteria | 530 |
| 183 | Ga0068870_10154553 | 3300005840 | Bacteria | 1354 |
| 184 | Ga0068863_101817861 | 3300005841 | Bacteria | 619 |
| 185 | Ga0068858_100103958 | 3300005842 | Bacteria | 2650 |
| 186 | Ga0068858_100222021 | 3300005842 | Bacteria | 1790 |
| 187 | Ga0068858_100415907 | 3300005842 | Bacteria | 1293 |
| 188 | Ga0068858_101487124 | 3300005842 | Bacteria | 668 |
| 189 | Ga0068858_101652130 | 3300005842 | Bacteria | 632 |
| 190 | Ga0068860_100531355 | 3300005843 | Bacteria | 1177 |
| 191 | Ga0068860_101791862 | 3300005843 | Bacteria | 636 |
| 192 | Ga0068862_100259914 | 3300005844 | Bacteria | 1585 |
| 193 | Ga0068862_101230904 | 3300005844 | Bacteria | 748 |
| 194 | Ga0068862_101247836 | 3300005844 | Bacteria | 743 |
| 195 | Ga0081539_10029426 | 3300005985 | Bacteria | 3431 |
| 196 | Ga0081539_10056210 | 3300005985 | Bacteria | 2185 |
| 197 | Ga0075365_10133768 | 3300006038 | Bacteria | 1717 |
| 198 | Ga0075432_10092489 | 3300006058 | Bacteria | 1109 |
| 199 | Ga0097621_100152764 | 3300006237 | Bacteria | 1980 |
| 200 | Ga0068871_100849554 | 3300006358 | Bacteria | 844 |
| 201 | Ga0075428_100113608 | 3300006844 | Bacteria | 2951 |
| 202 | Ga0075428_100486259 | 3300006844 | Bacteria | 1321 |
| 203 | Ga0075428_100776662 | 3300006844 | Bacteria | 1019 |
| 204 | Ga0075431_100844501 | 3300006847 | Bacteria | 887 |
| 205 | Ga0075433_10369755 | 3300006852 | Bacteria | 1266 |
| 206 | Ga0075433_10505951 | 3300006852 | Bacteria | 1063 |
| 207 | Ga0075433_10560793 | 3300006852 | Unclassified | 1004 |
| 208 | Ga0075434_100187428 | 3300006871 | Bacteria | 2089 |
| 209 | Ga0075434_100338781 | 3300006871 | Bacteria | 1525 |
| 210 | Ga0068865_100078447 | 3300006881 | Bacteria | 2362 |
| 211 | Ga0068865_100213479 | 3300006881 | Bacteria | 1505 |
| 212 | Ga0068865_100433050 | 3300006881 | Bacteria | 1084 |
| 213 | Ga0068865_100592630 | 3300006881 | Bacteria | 936 |
| 214 | Ga0068865_101073885 | 3300006881 | Bacteria | 708 |
| 215 | Ga0075436_101079646 | 3300006914 | Bacteria | 604 |
| 216 | Ga0097620_101579035 | 3300006931 | Bacteria | 724 |
| 217 | Ga0075435_100596311 | 3300007076 | Bacteria | 958 |
| 218 | Ga0075435_100668355 | 3300007076 | Unclassified | 902 |
| 219 | Ga0105240_10044197 | 3300009093 | Bacteria | 5664 |
| 220 | Ga0105240_11143548 | 3300009093 | Bacteria | 827 |
| 221 | Ga0111539_10083116 | 3300009094 | Bacteria | 3766 |
| 222 | Ga0111539_10163105 | 3300009094 | Bacteria | 2607 |
| 223 | Ga0111539_10247245 | 3300009094 | Bacteria | 2076 |
| 224 | Ga0111539_10379491 | 3300009094 | Bacteria | 1646 |
| 225 | Ga0111539_11149912 | 3300009094 | Bacteria | 902 |
| 226 | Ga0111539_11158339 | 3300009094 | Bacteria | 898 |
| 227 | Ga0105245_10061212 | 3300009098 | Bacteria | 3393 |
| 228 | Ga0105245_10259642 | 3300009098 | Bacteria | 1690 |
| 229 | Ga0105245_10265852 | 3300009098 | Bacteria | 1671 |
| 230 | Ga0105245_10390300 | 3300009098 | Bacteria | 1389 |
| 231 | Ga0105245_10390566 | 3300009098 | Bacteria | 1388 |
| 232 | Ga0105245_10412610 | 3300009098 | Bacteria | 1352 |
| 233 | Ga0105245_10487151 | 3300009098 | Bacteria | 1247 |
| 234 | Ga0105245_10707723 | 3300009098 | Bacteria | 1041 |
| 235 | Ga0105245_11560036 | 3300009098 | Bacteria | 712 |
| 236 | Ga0105245_11926018 | 3300009098 | Bacteria | 644 |
| 237 | Ga0105245_12157575 | 3300009098 | Bacteria | 611 |
| 238 | Ga0105247_10323393 | 3300009101 | Unclassified | 1077 |
| 239 | Ga0105247_10488216 | 3300009101 | Bacteria | 895 |
| 240 | Ga0114129_10173746 | 3300009147 | Bacteria | 2935 |
| 241 | Ga0114129_10255828 | 3300009147 | Bacteria | 2349 |
| 242 | Ga0114129_10270353 | 3300009147 | Bacteria | 2274 |
| 243 | Ga0114129_11705941 | 3300009147 | Bacteria | 768 |
| 244 | Ga0105243_10085338 | 3300009148 | Bacteria | 2588 |
| 245 | Ga0105243_10114671 | 3300009148 | Bacteria | 2261 |
| 246 | Ga0105243_10274461 | 3300009148 | Bacteria | 1515 |
| 247 | Ga0105243_10314081 | 3300009148 | Bacteria | 1425 |
| 248 | Ga0105243_10550736 | 3300009148 | Bacteria | 1102 |
| 249 | Ga0105243_11174643 | 3300009148 | Bacteria | 779 |
| 250 | Ga0105241_12067047 | 3300009174 | Bacteria | 562 |
| 251 | Ga0105242_10057420 | 3300009176 | Bacteria | 3187 |
| 252 | Ga0105242_10134891 | 3300009176 | Bacteria | 2135 |
| 253 | Ga0105242_10843851 | 3300009176 | Bacteria | 911 |
| 254 | Ga0105248_10054628 | 3300009177 | Bacteria | 4479 |
| 255 | Ga0105248_11213140 | 3300009177 | Bacteria | 853 |
| 256 | Ga0105248_11463580 | 3300009177 | Bacteria | 773 |
| 257 | Ga0105248_11898017 | 3300009177 | Bacteria | 676 |
| 258 | Ga0105248_13388968 | 3300009177 | Bacteria | 506 |
| 259 | Ga0105238_10070578 | 3300009551 | Bacteria | 3492 |
| 260 | Ga0105238_10374143 | 3300009551 | Bacteria | 1415 |
| 261 | Ga0105249_10111503 | 3300009553 | Bacteria | 2587 |
| 262 | Ga0105249_10139553 | 3300009553 | Bacteria | 2322 |
| 263 | Ga0105249_10556239 | 3300009553 | Bacteria | 1198 |
| 264 | Ga0105249_11742264 | 3300009553 | Bacteria | 695 |
| 265 | Ga0105239_10183486 | 3300010375 | Bacteria | 2341 |
| 266 | Ga0105239_10225542 | 3300010375 | Bacteria | 2102 |
| 267 | Ga0105239_11033154 | 3300010375 | Bacteria | 945 |
| 268 | Ga0105239_11548821 | 3300010375 | Unclassified | 766 |
| 269 | Ga0105246_10440601 | 3300011119 | Bacteria | 1092 |
| 270 | Ga0105246_10608934 | 3300011119 | Bacteria | 945 |
| 271 | Ga0105246_10998763 | 3300011119 | Bacteria | 757 |
| 272 | Ga0105246_11385517 | 3300011119 | Unclassified | 655 |
| 273 | Ga0105246_11732794 | 3300011119 | Bacteria | 595 |
| 274 | Ga0157342_1050137 | 3300012507 | Unclassified | 585 |
| 275 | Ga0157371_11226651 | 3300013102 | Bacteria | 579 |
| 276 | Ga0157374_10528563 | 3300013296 | Bacteria | 1186 |
| 277 | Ga0157374_10891944 | 3300013296 | Bacteria | 907 |
| 278 | Ga0157374_11313298 | 3300013296 | Bacteria | 745 |
| 279 | Ga0157378_10117009 | 3300013297 | Bacteria | 2452 |
| 280 | Ga0157378_11551325 | 3300013297 | Bacteria | 707 |
| 281 | Ga0157378_11774611 | 3300013297 | Bacteria | 665 |
| 282 | Ga0157378_12077549 | 3300013297 | Unclassified | 619 |
| 283 | Ga0163162_10747468 | 3300013306 | Unclassified | 1097 |
| 284 | Ga0163162_10786677 | 3300013306 | Bacteria | 1069 |
| 285 | Ga0163162_10931184 | 3300013306 | Bacteria | 981 |
| 286 | Ga0163162_10969871 | 3300013306 | Bacteria | 960 |
| 287 | Ga0163162_11214252 | 3300013306 | Bacteria | 856 |
| 288 | Ga0163162_11535614 | 3300013306 | Bacteria | 759 |
| 289 | Ga0157372_11048214 | 3300013307 | Unclassified | 944 |
| 290 | Ga0157375_10182066 | 3300013308 | Bacteria | 2253 |
| 291 | Ga0157375_10447930 | 3300013308 | Bacteria | 1457 |
| 292 | Ga0157375_10781512 | 3300013308 | Bacteria | 1104 |
| 293 | Ga0157375_11120408 | 3300013308 | Bacteria | 922 |
| 294 | Ga0157375_11287547 | 3300013308 | Unclassified | 859 |
| 295 | Ga0163163_10011059 | 3300014325 | Bacteria | 8164 |
| 296 | Ga0163163_10089481 | 3300014325 | Bacteria | 3090 |
| 297 | Ga0163163_10229313 | 3300014325 | Bacteria | 1906 |
| 298 | Ga0163163_10247169 | 3300014325 | Bacteria | 1834 |
| 299 | Ga0163163_10329052 | 3300014325 | Bacteria | 1582 |
| 300 | Ga0163163_11048556 | 3300014325 | Bacteria | 878 |
| 301 | Ga0157380_10038585 | 3300014326 | Bacteria | 3710 |
| 302 | Ga0157380_10110883 | 3300014326 | Bacteria | 2305 |
| 303 | Ga0157380_10491946 | 3300014326 | Bacteria | 1189 |
| 304 | Ga0157380_10953972 | 3300014326 | Bacteria | 888 |
| 305 | Ga0157377_10016618 | 3300014745 | Bacteria | 3789 |
| 306 | Ga0157377_10206994 | 3300014745 | Bacteria | 1249 |
| 307 | Ga0157377_10361175 | 3300014745 | Bacteria | 977 |
| 308 | Ga0157377_10450062 | 3300014745 | Bacteria | 889 |
| 309 | Ga0157377_10700719 | 3300014745 | Bacteria | 735 |
| 310 | Ga0157377_11146848 | 3300014745 | Bacteria | 598 |
| 311 | Ga0157379_10108237 | 3300014968 | Bacteria | 2495 |
| 312 | Ga0157379_10160852 | 3300014968 | Bacteria | 2027 |
| 313 | Ga0157379_10247422 | 3300014968 | Bacteria | 1618 |
| 314 | Ga0157379_11470508 | 3300014968 | Bacteria | 662 |
| 315 | Ga0157379_11711181 | 3300014968 | Bacteria | 616 |
| 316 | Ga0157376_10870384 | 3300014969 | Bacteria | 917 |
| 317 | Ga0157376_10966747 | 3300014969 | Bacteria | 873 |
| 318 | Ga0157376_12715255 | 3300014969 | Bacteria | 535 |
| 319 | Ga0163161_10253589 | 3300017792 | Bacteria | 1372 |
| 320 | Ga0163161_10256644 | 3300017792 | Bacteria | 1364 |
| 321 | Ga0163161_10286463 | 3300017792 | Bacteria | 1294 |
| 322 | Ga0163161_10392266 | 3300017792 | Bacteria | 1112 |
| 323 | Ga0163161_10480261 | 3300017792 | Bacteria | 1009 |
| 324 | Ga0213871_10177200 | 3300021441 | Bacteria | 658 |
| 325 | Ga0207656_10473495 | 3300025321 | Bacteria | 634 |
| 326 | Ga0207653_10229605 | 3300025885 | Bacteria | 707 |
| 327 | Ga0207642_10067918 | 3300025899 | Bacteria | 1685 |
| 328 | Ga0207642_10917455 | 3300025899 | Bacteria | 562 |
| 329 | Ga0207710_10334696 | 3300025900 | Bacteria | 769 |
| 330 | Ga0207688_10030278 | 3300025901 | Bacteria | 2984 |
| 331 | Ga0207688_10163195 | 3300025901 | Bacteria | 1322 |
| 332 | Ga0207688_10340999 | 3300025901 | Bacteria | 922 |
| 333 | Ga0207680_10711008 | 3300025903 | Bacteria | 720 |
| 334 | Ga0207647_10101791 | 3300025904 | Bacteria | 1704 |
| 335 | Ga0207645_10478937 | 3300025907 | Bacteria | 842 |
| 336 | Ga0207643_10016672 | 3300025908 | Bacteria | 4007 |
| 337 | Ga0207643_10160866 | 3300025908 | Bacteria | 1351 |
| 338 | Ga0207643_10593847 | 3300025908 | Bacteria | 712 |
| 339 | Ga0207643_10790053 | 3300025908 | Bacteria | 615 |
| 340 | Ga0207684_10158375 | 3300025910 | Bacteria | 1949 |
| 341 | Ga0207707_10291079 | 3300025912 | Bacteria | 1413 |
| 342 | Ga0207707_11018031 | 3300025912 | Bacteria | 679 |
| 343 | Ga0207707_11387696 | 3300025912 | Bacteria | 561 |
| 344 | Ga0207695_10705285 | 3300025913 | Unclassified | 890 |
| 345 | Ga0207663_11641556 | 3300025916 | Unclassified | 517 |
| 346 | Ga0207660_10853859 | 3300025917 | Bacteria | 743 |
| 347 | Ga0207660_10872714 | 3300025917 | Bacteria | 734 |
| 348 | Ga0207662_10057431 | 3300025918 | Bacteria | 2326 |
| 349 | Ga0207662_10579817 | 3300025918 | Bacteria | 779 |
| 350 | Ga0207657_10065544 | 3300025919 | Bacteria | 3096 |
| 351 | Ga0207657_10317132 | 3300025919 | Bacteria | 1233 |
| 352 | Ga0207649_10650077 | 3300025920 | Bacteria | 815 |
| 353 | Ga0207649_10716733 | 3300025920 | Bacteria | 777 |
| 354 | Ga0207649_11075407 | 3300025920 | Unclassified | 634 |
| 355 | Ga0207652_10107893 | 3300025921 | Bacteria | 2466 |
| 356 | Ga0207652_10586935 | 3300025921 | Bacteria | 1000 |
| 357 | Ga0207652_10616927 | 3300025921 | Bacteria | 972 |
| 358 | Ga0207652_11092722 | 3300025921 | Bacteria | 698 |
| 359 | Ga0207652_11582571 | 3300025921 | Bacteria | 559 |
| 360 | Ga0207646_10146007 | 3300025922 | Bacteria | 2132 |
| 361 | Ga0207646_10827774 | 3300025922 | Bacteria | 823 |
| 362 | Ga0207681_10550006 | 3300025923 | Bacteria | 950 |
| 363 | Ga0207681_10662404 | 3300025923 | Bacteria | 866 |
| 364 | Ga0207650_10408400 | 3300025925 | Bacteria | 1125 |
| 365 | Ga0207650_10942020 | 3300025925 | Bacteria | 734 |
| 366 | Ga0207650_11392763 | 3300025925 | Bacteria | 597 |
| 367 | Ga0207659_10222120 | 3300025926 | Unclassified | 1519 |
| 368 | Ga0207659_10480710 | 3300025926 | Bacteria | 1049 |
| 369 | Ga0207659_10991786 | 3300025926 | Bacteria | 723 |
| 370 | Ga0207687_10180464 | 3300025927 | Bacteria | 1635 |
| 371 | Ga0207687_10453847 | 3300025927 | Bacteria | 1063 |
| 372 | Ga0207687_10475775 | 3300025927 | Bacteria | 1039 |
| 373 | Ga0207687_10601319 | 3300025927 | Bacteria | 927 |
| 374 | Ga0207687_10651948 | 3300025927 | Bacteria | 891 |
| 375 | Ga0207687_10671264 | 3300025927 | Bacteria | 878 |
| 376 | Ga0207687_10943300 | 3300025927 | Bacteria | 739 |
| 377 | Ga0207644_11135708 | 3300025931 | Bacteria | 657 |
| 378 | Ga0207690_10347462 | 3300025932 | Bacteria | 1172 |
| 379 | Ga0207690_10807211 | 3300025932 | Bacteria | 775 |
| 380 | Ga0207690_11284731 | 3300025932 | Bacteria | 612 |
| 381 | Ga0207706_10072044 | 3300025933 | Bacteria | 3040 |
| 382 | Ga0207706_10087943 | 3300025933 | Bacteria | 2732 |
| 383 | Ga0207706_10270340 | 3300025933 | Bacteria | 1483 |
| 384 | Ga0207706_10286659 | 3300025933 | Bacteria | 1436 |
| 385 | Ga0207706_10675569 | 3300025933 | Bacteria | 883 |
| 386 | Ga0207686_10319868 | 3300025934 | Unclassified | 1159 |
| 387 | Ga0207686_10406670 | 3300025934 | Unclassified | 1038 |
| 388 | Ga0207709_10137682 | 3300025935 | Unclassified | 1674 |
| 389 | Ga0207709_10301932 | 3300025935 | Bacteria | 1191 |
| 390 | Ga0207670_10082652 | 3300025936 | Bacteria | 2251 |
| 391 | Ga0207670_10337047 | 3300025936 | Bacteria | 1191 |
| 392 | Ga0207670_10908428 | 3300025936 | Bacteria | 738 |
| 393 | Ga0207669_10042488 | 3300025937 | Bacteria | 2654 |
| 394 | Ga0207669_10410115 | 3300025937 | Bacteria | 1064 |
| 395 | Ga0207704_10219443 | 3300025938 | Unclassified | 1406 |
| 396 | Ga0207704_10275800 | 3300025938 | Bacteria | 1276 |
| 397 | Ga0207665_11125471 | 3300025939 | Bacteria | 626 |
| 398 | Ga0207691_10133269 | 3300025940 | Bacteria | 2193 |
| 399 | Ga0207691_10428486 | 3300025940 | Bacteria | 1127 |
| 400 | Ga0207711_10457175 | 3300025941 | Bacteria | 1189 |
| 401 | Ga0207711_10559730 | 3300025941 | Bacteria | 1066 |
| 402 | Ga0207711_10880302 | 3300025941 | Bacteria | 833 |
| 403 | Ga0207689_10254215 | 3300025942 | Bacteria | 1453 |
| 404 | Ga0207689_10363582 | 3300025942 | Bacteria | 1203 |
| 405 | Ga0207661_11010135 | 3300025944 | Bacteria | 766 |
| 406 | Ga0207661_11159002 | 3300025944 | Bacteria | 711 |
| 407 | Ga0207679_10370591 | 3300025945 | Bacteria | 1253 |
| 408 | Ga0207679_10421090 | 3300025945 | Bacteria | 1179 |
| 409 | Ga0207679_10658102 | 3300025945 | Bacteria | 948 |
| 410 | Ga0207679_10714639 | 3300025945 | Bacteria | 910 |
| 411 | Ga0207667_11181810 | 3300025949 | Bacteria | 745 |
| 412 | Ga0207651_10385267 | 3300025960 | Bacteria | 1189 |
| 413 | Ga0207651_10847430 | 3300025960 | Bacteria | 812 |
| 414 | Ga0207651_11874009 | 3300025960 | Bacteria | 539 |
| 415 | Ga0207712_10005919 | 3300025961 | Bacteria | 7710 |
| 416 | Ga0207712_10372681 | 3300025961 | Bacteria | 1192 |
| 417 | Ga0207712_10770950 | 3300025961 | Bacteria | 844 |
| 418 | Ga0207668_10019059 | 3300025972 | Bacteria | 4329 |
| 419 | Ga0207668_10110474 | 3300025972 | Bacteria | 2062 |
| 420 | Ga0207668_10388264 | 3300025972 | Bacteria | 1177 |
| 421 | Ga0207668_10448158 | 3300025972 | Unclassified | 1101 |
| 422 | Ga0207668_11625516 | 3300025972 | Bacteria | 583 |
| 423 | Ga0207640_10136496 | 3300025981 | Bacteria | 1782 |
| 424 | Ga0207640_10230364 | 3300025981 | Bacteria | 1425 |
| 425 | Ga0207640_10365465 | 3300025981 | Bacteria | 1164 |
| 426 | Ga0207640_10520554 | 3300025981 | Bacteria | 994 |
| 427 | Ga0207640_10709653 | 3300025981 | Bacteria | 863 |
| 428 | Ga0207658_10317816 | 3300025986 | Bacteria | 1347 |
| 429 | Ga0207658_10681225 | 3300025986 | Bacteria | 928 |
| 430 | Ga0207677_10196835 | 3300026023 | Unclassified | 1599 |
| 431 | Ga0207677_10515685 | 3300026023 | Bacteria | 1036 |
| 432 | Ga0207677_10628862 | 3300026023 | Bacteria | 945 |
| 433 | Ga0207677_10803064 | 3300026023 | Bacteria | 842 |
| 434 | Ga0207677_10998501 | 3300026023 | Bacteria | 759 |
| 435 | Ga0207677_11052709 | 3300026023 | Bacteria | 740 |
| 436 | Ga0207677_11811243 | 3300026023 | Bacteria | 567 |
| 437 | Ga0207703_10180006 | 3300026035 | Bacteria | 1865 |
| 438 | Ga0207703_10477429 | 3300026035 | Bacteria | 1168 |
| 439 | Ga0207703_10687286 | 3300026035 | Bacteria | 972 |
| 440 | Ga0207703_10863343 | 3300026035 | Bacteria | 866 |
| 441 | Ga0207639_10990714 | 3300026041 | Bacteria | 787 |
| 442 | Ga0207639_11006988 | 3300026041 | Bacteria | 780 |
| 443 | Ga0207639_11103114 | 3300026041 | Bacteria | 744 |
| 444 | Ga0207678_10051746 | 3300026067 | Bacteria | 3545 |
| 445 | Ga0207678_10190485 | 3300026067 | Bacteria | 1752 |
| 446 | Ga0207678_11395090 | 3300026067 | Bacteria | 619 |
| 447 | Ga0207678_11524405 | 3300026067 | Bacteria | 590 |
| 448 | Ga0207678_11809148 | 3300026067 | Bacteria | 535 |
| 449 | Ga0207708_10027078 | 3300026075 | Bacteria | 4340 |
| 450 | Ga0207708_10046959 | 3300026075 | Bacteria | 3289 |
| 451 | Ga0207708_10058239 | 3300026075 | Bacteria | 2948 |
| 452 | Ga0207708_10077455 | 3300026075 | Bacteria | 2552 |
| 453 | Ga0207708_10104167 | 3300026075 | Bacteria | 2198 |
| 454 | Ga0207708_10267045 | 3300026075 | Bacteria | 1383 |
| 455 | Ga0207708_10696059 | 3300026075 | Bacteria | 868 |
| 456 | Ga0207708_11415064 | 3300026075 | Bacteria | 610 |
| 457 | Ga0207708_11604107 | 3300026075 | Bacteria | 572 |
| 458 | Ga0207702_10092653 | 3300026078 | Bacteria | 2649 |
| 459 | Ga0207702_10423542 | 3300026078 | Bacteria | 1288 |
| 460 | Ga0207641_12292266 | 3300026088 | Unclassified | 540 |
| 461 | Ga0207648_10124183 | 3300026089 | Bacteria | 2270 |
| 462 | Ga0207648_10187344 | 3300026089 | Bacteria | 1833 |
| 463 | Ga0207648_10271978 | 3300026089 | Bacteria | 1514 |
| 464 | Ga0207648_11067686 | 3300026089 | Unclassified | 757 |
| 465 | Ga0207676_10280099 | 3300026095 | Bacteria | 1514 |
| 466 | Ga0207676_10385037 | 3300026095 | Bacteria | 1306 |
| 467 | Ga0207676_10942844 | 3300026095 | Bacteria | 848 |
| 468 | Ga0207676_11257492 | 3300026095 | Bacteria | 734 |
| 469 | Ga0207674_10013614 | 3300026116 | Bacteria | 9010 |
| 470 | Ga0207674_10399929 | 3300026116 | Bacteria | 1327 |
| 471 | Ga0207675_100369599 | 3300026118 | Bacteria | 1408 |
| 472 | Ga0207675_100418325 | 3300026118 | Bacteria | 1323 |
| 473 | Ga0207675_100551977 | 3300026118 | Bacteria | 1151 |
| 474 | Ga0207675_100683476 | 3300026118 | Bacteria | 1034 |
| 475 | Ga0207675_100698522 | 3300026118 | Bacteria | 1023 |
| 476 | Ga0207675_100992121 | 3300026118 | Bacteria | 858 |
| 477 | Ga0207683_10113879 | 3300026121 | Bacteria | 2423 |
| 478 | Ga0207683_10185240 | 3300026121 | Bacteria | 1889 |
| 479 | Ga0207683_10688342 | 3300026121 | Bacteria | 948 |
| 480 | Ga0207683_10837266 | 3300026121 | Bacteria | 854 |
| 481 | Ga0207683_11707821 | 3300026121 | Bacteria | 579 |
| 482 | Ga0207698_11145580 | 3300026142 | Bacteria | 791 |
| 483 | Ga0207698_11464131 | 3300026142 | Bacteria | 698 |
| 484 | Ga0209970_1097799 | 3300027614 | Bacteria | 560 |
| 485 | Ga0209971_1136023 | 3300027682 | Bacteria | 605 |
| 486 | Ga0209974_10139179 | 3300027876 | Bacteria | 870 |
| 487 | Ga0207428_10238070 | 3300027907 | Bacteria | 1361 |
| 488 | Ga0268265_10128199 | 3300028380 | Bacteria | 2104 |
| 489 | Ga0268265_10134270 | 3300028380 | Bacteria | 2062 |
| 490 | Ga0268265_11705333 | 3300028380 | Bacteria | 636 |
| 491 | Ga0268264_10452043 | 3300028381 | Bacteria | 1245 |
| 492 | Ga0268264_11474183 | 3300028381 | Bacteria | 691 |
| 493 | Ga0268264_11935325 | 3300028381 | Bacteria | 599 |
| 494 | Ga0265337_1025186 | 3300028556 | Bacteria | 1812 |
| 495 | Ga0265319_1090269 | 3300028563 | Bacteria | 967 |
| 496 | Ga0265319_1118035 | 3300028563 | Bacteria | 828 |
| 497 | Ga0265334_10017086 | 3300028573 | Bacteria | 3001 |
| 498 | Ga0265334_10066481 | 3300028573 | Unclassified | 1349 |
| 499 | Ga0265334_10233234 | 3300028573 | Bacteria | 635 |
| 500 | Ga0265318_10027403 | 3300028577 | Bacteria | 2239 |
| 501 | Ga0265318_10032808 | 3300028577 | Bacteria | 2007 |
| 502 | Ga0265318_10065308 | 3300028577 | Bacteria | 1353 |
| 503 | Ga0265318_10205186 | 3300028577 | Bacteria | 720 |
| 504 | Ga0265323_10100835 | 3300028653 | Unclassified | 956 |
| 505 | Ga0265323_10158006 | 3300028653 | Bacteria | 724 |
| 506 | Ga0265322_10023037 | 3300028654 | Bacteria | 1781 |
| 507 | Ga0265322_10066830 | 3300028654 | Unclassified | 1019 |
| 508 | Ga0265322_10138898 | 3300028654 | Bacteria | 694 |
| 509 | Ga0265336_10021334 | 3300028666 | Bacteria | 2071 |
| 510 | Ga0265336_10115861 | 3300028666 | Unclassified | 798 |
| 511 | Ga0265338_10063875 | 3300028800 | Bacteria | 3207 |
| 512 | Ga0265338_10210218 | 3300028800 | Bacteria | 1461 |
| 513 | Ga0265338_10832125 | 3300028800 | Bacteria | 631 |
| 514 | Ga0265338_11233506 | 3300028800 | Bacteria | 501 |
| 515 | Ga0265324_10006906 | 3300029957 | Bacteria | 4675 |
| 516 | Ga0265330_10022220 | 3300031235 | Bacteria | 2889 |
| 517 | Ga0265330_10023113 | 3300031235 | Bacteria | 2825 |
| 518 | Ga0265330_10033335 | 3300031235 | Bacteria | 2303 |
| 519 | Ga0265330_10043710 | 3300031235 | Bacteria | 1981 |
| 520 | Ga0265330_10201803 | 3300031235 | Bacteria | 841 |
| 521 | Ga0265330_10299656 | 3300031235 | Bacteria | 678 |
| 522 | Ga0265330_10369136 | 3300031235 | Bacteria | 606 |
| 523 | Ga0265332_10018915 | 3300031238 | Bacteria | 3041 |
| 524 | Ga0265328_10051663 | 3300031239 | Bacteria | 1509 |
| 525 | Ga0265328_10110104 | 3300031239 | Bacteria | 1023 |
| 526 | Ga0265320_10008973 | 3300031240 | Bacteria | 6066 |
| 527 | Ga0265320_10153210 | 3300031240 | Bacteria | 1040 |
| 528 | Ga0265320_10166058 | 3300031240 | Bacteria | 993 |
| 529 | Ga0265320_10286496 | 3300031240 | Unclassified | 729 |
| 530 | Ga0265320_10431330 | 3300031240 | Unclassified | 582 |
| 531 | Ga0265325_10024484 | 3300031241 | Bacteria | 3284 |
| 532 | Ga0265325_10065109 | 3300031241 | Bacteria | 1841 |
| 533 | Ga0265325_10079666 | 3300031241 | Bacteria | 1630 |
| 534 | Ga0265325_10082224 | 3300031241 | Bacteria | 1599 |
| 535 | Ga0265325_10155077 | 3300031241 | Bacteria | 1081 |
| 536 | Ga0265329_10001690 | 3300031242 | Bacteria | 10573 |
| 537 | Ga0265329_10040372 | 3300031242 | Bacteria | 1497 |
| 538 | Ga0265329_10049764 | 3300031242 | Bacteria | 1335 |
| 539 | Ga0265340_10002587 | 3300031247 | Bacteria | 10275 |
| 540 | Ga0265340_10006154 | 3300031247 | Bacteria | 6616 |
| 541 | Ga0265340_10010584 | 3300031247 | Bacteria | 4931 |
| 542 | Ga0265340_10014489 | 3300031247 | Bacteria | 4116 |
| 543 | Ga0265340_10023721 | 3300031247 | Bacteria | 3126 |
| 544 | Ga0265340_10117125 | 3300031247 | Bacteria | 1227 |
| 545 | Ga0265339_10028210 | 3300031249 | Bacteria | 3194 |
| 546 | Ga0265339_10090867 | 3300031249 | Bacteria | 1600 |
| 547 | Ga0265339_10138978 | 3300031249 | Bacteria | 1237 |
| 548 | Ga0265339_10173500 | 3300031249 | Bacteria | 1078 |
| 549 | Ga0265339_10198339 | 3300031249 | Bacteria | 991 |
| 550 | Ga0265331_10017780 | 3300031250 | Bacteria | 3701 |
| 551 | Ga0265331_10352040 | 3300031250 | Bacteria | 660 |
| 552 | Ga0265316_10012137 | 3300031344 | Bacteria | 7735 |
| 553 | Ga0265316_10029418 | 3300031344 | Bacteria | 4517 |
| 554 | Ga0265316_10043169 | 3300031344 | Bacteria | 3598 |
| 555 | Ga0265316_10084578 | 3300031344 | Bacteria | 2429 |
| 556 | Ga0265316_10332295 | 3300031344 | Bacteria | 1102 |
| 557 | Ga0265316_10349136 | 3300031344 | Bacteria | 1071 |
| 558 | Ga0307408_100077221 | 3300031548 | Bacteria | 2480 |
| 559 | Ga0265313_10005225 | 3300031595 | Bacteria | 9619 |
| 560 | Ga0265313_10075370 | 3300031595 | Bacteria | 1544 |
| 561 | Ga0265313_10115404 | 3300031595 | Bacteria | 1176 |
| 562 | Ga0265313_10204676 | 3300031595 | Bacteria | 820 |
| 563 | Ga0265313_10261075 | 3300031595 | Unclassified | 704 |
| 564 | Ga0265314_10002544 | 3300031711 | Bacteria | 18542 |
| 565 | Ga0265314_10003068 | 3300031711 | Bacteria | 16468 |
| 566 | Ga0265314_10148599 | 3300031711 | Bacteria | 1440 |
| 567 | Ga0265314_10193558 | 3300031711 | Bacteria | 1208 |
| 568 | Ga0265314_10631335 | 3300031711 | Bacteria | 548 |
| 569 | Ga0265342_10006227 | 3300031712 | Bacteria | 8915 |
| 570 | Ga0265342_10021592 | 3300031712 | Bacteria | 4107 |
| 571 | Ga0265342_10057470 | 3300031712 | Bacteria | 2302 |
| 572 | Ga0265342_10284736 | 3300031712 | Unclassified | 874 |
| 573 | Ga0265342_10576802 | 3300031712 | Bacteria | 569 |
| 574 | Ga0307405_10336232 | 3300031731 | Bacteria | 1159 |
| 575 | Ga0307413_10961791 | 3300031824 | Bacteria | 729 |
| 576 | Ga0307410_10477906 | 3300031852 | Bacteria | 1022 |
| 577 | Ga0307406_11349324 | 3300031901 | Bacteria | 624 |
| 578 | Ga0307406_11672182 | 3300031901 | Bacteria | 564 |
| 579 | Ga0307407_10376319 | 3300031903 | Bacteria | 1013 |
| 580 | Ga0307407_10595052 | 3300031903 | Unclassified | 823 |
| 581 | Ga0307409_100139853 | 3300031995 | Bacteria | 2084 |
| 582 | Ga0307409_100199728 | 3300031995 | Bacteria | 1788 |
| 583 | Ga0307416_100001176 | 3300032002 | Bacteria | 14019 |
| 584 | Ga0307416_100660880 | 3300032002 | Bacteria | 1131 |
| 585 | Ga0307416_101852880 | 3300032002 | Bacteria | 707 |
| 586 | Ga0307416_102954160 | 3300032002 | Bacteria | 569 |
| 587 | Ga0307411_10363239 | 3300032005 | Bacteria | 1185 |
| 588 | Ga0307415_100526118 | 3300032126 | Unclassified | 1039 |
| 589 | Ga0307415_101773278 | 3300032126 | Bacteria | 597 |
| 590 | Ga0373959_0065518 | 3300034820 | Unclassified | 812 |
| 591 | Ga0373959_0101059 | 3300034820 | Bacteria | 686 |
| 592 | Ga0373928_0092712 | 3300035084 | Unclassified | 778 |
| 593 | Ga0373929_0104037 | 3300035085 | Bacteria | 719 |
| 594 | Ga0373932_0244480 | 3300035112 | Bacteria | 653 |
| 595 | Ga0373941_0257761 | 3300035115 | Bacteria | 683 |
| 596 | Ga0373960_0215663 | 3300035121 | Bacteria | 685 |
| 597 | Ga0373955_0214708 | 3300035172 | Unclassified | 1148 |
| 598 | Ga0373942_0096437 | 3300035207 | Unclassified | 898 |
| 599 | Ga0373962_0033326 | 3300035242 | Bacteria | 1421 |
| 600 | Ga0373962_0108938 | 3300035242 | Unclassified | 872 |
| 601 | Ga0373947_0611394 | 3300035725 | Bacteria | 743 |
| 602 | Ga0373925_1113872 | 3300037068 | Bacteria | 649 |
| 603 | Ga0395899_0549168 | 3300037312 | Bacteria | 743 |
| 604 | Ga0395900_0439904 | 3300037418 | Bacteria | 1262 |
| 605 | Ga0395900_0501778 | 3300037418 | Bacteria | 1164 |
| 606 | Ga0395905_0858116 | 3300037471 | Bacteria | 811 |
| 607 | Ga0395901_0017877 | 3300038443 | Bacteria | 7237 |
| 608 | Ga0395901_0280227 | 3300038443 | Bacteria | 1732 |
| 609 | Ga0395901_2021374 | 3300038443 | Bacteria | 522 |
| 610 | Ga0436365_1485382 | 3300039437 | Bacteria | 3020 |
| 611 | Ga0436360_0263685 | 3300039438 | Bacteria | 2649 |
| 612 | Ga0436360_1115059 | 3300039438 | Bacteria | 588 |
| 613 | Ga0436361_1146080 | 3300039447 | Bacteria | 651 |
| 614 | Ga0451787_536941 | 3300041441 | Unclassified | 517 |
| 615 | Ga0451787_675165 | 3300041441 | Bacteria | 736 |
| 616 | Ga0451791_1458017 | 3300041451 | Bacteria | 690 |
| 617 | Ga0451793_1125082 | 3300041452 | Bacteria | 603 |
| 618 | Ga0451795_1460265 | 3300041456 | Bacteria | 533 |
| 619 | Ga0451795_1537678 | 3300041456 | Bacteria | 1443 |
| 620 | Ga0451802_0894001 | 3300041460 | Bacteria | 512 |
| 621 | Ga0451837_1035402 | 3300041494 | Unclassified | 572 |
| 622 | Ga0451845_0263999 | 3300041501 | Bacteria | 780 |
| 623 | Ga0451843_0151156 | 3300041509 | Bacteria | 574 |
| 624 | Ga0451855_1451656 | 3300041511 | Bacteria | 687 |
| 625 | Ga0451853_0129182 | 3300041512 | Bacteria | 506 |
| 626 | Ga0451853_0135129 | 3300041512 | Bacteria | 899 |
| 627 | Ga0451853_0628733 | 3300041512 | Bacteria | 649 |
| 628 | Ga0451853_1064254 | 3300041512 | Bacteria | 1642 |
| 629 | Ga0451853_2873151 | 3300041512 | Bacteria | 1379 |
| 630 | Ga0450914_007210 | 3300042118 | Unclassified | 998 |
| 631 | Ga0439446_0095485 | 3300042156 | Bacteria | 935 |
| 632 | Ga0439435_0254332 | 3300042436 | Bacteria | 592 |
| 633 | Ga0450916_065330 | 3300042530 | Bacteria | 598 |
| 634 | Ga0450916_097568 | 3300042530 | Bacteria | 518 |
| 635 | Ga0453683_0792285 | 3300044673 | Bacteria | 624 |
| 636 | Ga0466964_0452518 | 3300044706 | Unclassified | 681 |
| 637 | Ga0495592_0602507 | 3300046454 | Bacteria | 670 |
| 638 | Ga0495592_0639995 | 3300046454 | Bacteria | 645 |
| 639 | Ga0495592_0740542 | 3300046454 | Bacteria | 588 |
| 640 | Ga0495629_0239440 | 3300046459 | Bacteria | 1250 |
| 641 | Ga0495629_0267819 | 3300046459 | Bacteria | 1174 |
| 642 | Ga0495641_0548427 | 3300046461 | Bacteria | 528 |
| 643 | Ga0495582_0254788 | 3300046473 | Bacteria | 1007 |
| 644 | Ga0495608_0310088 | 3300046511 | Bacteria | 976 |
| 645 | Ga0495628_0285421 | 3300046516 | Bacteria | 1225 |
| 646 | Ga0495628_0607309 | 3300046516 | Unclassified | 781 |
| 647 | Ga0495630_0298151 | 3300046517 | Bacteria | 1232 |
| 648 | Ga0495644_0273886 | 3300046523 | Bacteria | 658 |
| 649 | Ga0495652_0538504 | 3300046529 | Bacteria | 804 |
| 650 | Ga0495665_0550653 | 3300046531 | Bacteria | 579 |
| 651 | Ga0495640_0287391 | 3300046533 | Bacteria | 1023 |
| 652 | Ga0495667_0115528 | 3300046559 | Bacteria | 1734 |
| 653 | Ga0495656_0689355 | 3300046615 | Bacteria | 549 |
| 654 | Ga0495635_0062887 | 3300046663 | Bacteria | 2549 |
| 655 | Ga0495635_0599985 | 3300046663 | Bacteria | 719 |
| 656 | Ga0495657_0330408 | 3300046675 | Bacteria | 905 |
| 657 | Ga0495646_0345956 | 3300046680 | Bacteria | 780 |
| 658 | Ga0495613_0582585 | 3300046689 | Bacteria | 746 |
| 659 | Ga0495624_0900012 | 3300046690 | Bacteria | 521 |
| 660 | Ga0495649_0622869 | 3300046694 | Bacteria | 532 |
| 661 | Ga0495589_0539536 | 3300046794 | Unclassified | 532 |
| 662 | Ga0495600_0197212 | 3300046809 | Bacteria | 1294 |
| 663 | Ga0495674_0168247 | 3300047319 | Bacteria | 1830 |
| 664 | Ga0495674_0443014 | 3300047319 | Bacteria | 1044 |
| 665 | Ga0495676_0398141 | 3300047321 | Bacteria | 914 |
| 666 | Ga0495675_0268724 | 3300047444 | Bacteria | 1020 |
| 667 | Ga0495602_0218185 | 3300048088 | Bacteria | 1442 |
| 668 | Ga0496100_0056711 | 3300048903 | Bacteria | 2564 |
| 669 | Ga0496100_0069716 | 3300048903 | Bacteria | 2342 |
| 670 | Ga0496100_1436052 | 3300048903 | Bacteria | 545 |
| 671 | Ga0496101_0034194 | 3300048904 | Bacteria | 3588 |
| 672 | Ga0496101_0179285 | 3300048904 | Bacteria | 1631 |
| 673 | Ga0496101_0373325 | 3300048904 | Bacteria | 1122 |
| 674 | Ga0496101_1486336 | 3300048904 | Bacteria | 528 |
| 675 | Ga0496102_0032069 | 3300048905 | Bacteria | 4719 |
| 676 | Ga0496102_0043371 | 3300048905 | Bacteria | 4078 |
| 677 | Ga0496102_0409977 | 3300048905 | Bacteria | 1273 |
| 678 | Ga0496102_0468672 | 3300048905 | Bacteria | 1180 |
| 679 | Ga0496102_0501699 | 3300048905 | Bacteria | 1136 |
| 680 | Ga0496102_0732835 | 3300048905 | Bacteria | 911 |
| 681 | Ga0496103_0013350 | 3300048906 | Bacteria | 4868 |
| 682 | Ga0496103_0334638 | 3300048906 | Bacteria | 974 |
| 683 | Ga0496104_0051704 | 3300048907 | Bacteria | 3878 |
| 684 | Ga0496104_0055493 | 3300048907 | Bacteria | 3746 |
| 685 | Ga0496104_0114696 | 3300048907 | Bacteria | 2584 |
| 686 | Ga0496104_0633328 | 3300048907 | Bacteria | 979 |
| 687 | Ga0496105_0024902 | 3300048908 | Bacteria | 4864 |
| 688 | Ga0496105_0042189 | 3300048908 | Bacteria | 3760 |
| 689 | Ga0496105_0087184 | 3300048908 | Bacteria | 2579 |
| 690 | Ga0496105_0935733 | 3300048908 | Bacteria | 651 |
| 691 | Ga0496106_0106710 | 3300048909 | Bacteria | 2177 |
| 692 | Ga0496106_1119348 | 3300048909 | Bacteria | 616 |
| 693 | Ga0496107_0013738 | 3300048910 | Bacteria | 5663 |
| 694 | Ga0496107_0122265 | 3300048910 | Bacteria | 1918 |
| 695 | Ga0496108_0030378 | 3300048911 | Bacteria | 4478 |
| 696 | Ga0496108_0131695 | 3300048911 | Bacteria | 2149 |
| 697 | Ga0496108_0151149 | 3300048911 | Bacteria | 2003 |
| 698 | Ga0496108_0177973 | 3300048911 | Bacteria | 1842 |
| 699 | Ga0496108_0186787 | 3300048911 | Bacteria | 1795 |
| 700 | Ga0496108_0347605 | 3300048911 | Bacteria | 1294 |
| 701 | Ga0496108_0658970 | 3300048911 | Bacteria | 910 |
| 702 | Ga0496108_1020252 | 3300048911 | Bacteria | 706 |
| 703 | Ga0496108_1034371 | 3300048911 | Bacteria | 700 |
| 704 | Ga0496109_0010978 | 3300048912 | Bacteria | 7762 |
| 705 | Ga0496109_0017529 | 3300048912 | Bacteria | 6278 |
| 706 | Ga0496109_0065641 | 3300048912 | Bacteria | 3322 |
| 707 | Ga0496109_0159649 | 3300048912 | Bacteria | 2112 |
| 708 | Ga0496109_0259973 | 3300048912 | Bacteria | 1635 |
| 709 | Ga0496109_0452944 | 3300048912 | Unclassified | 1212 |
| 710 | Ga0496109_0533530 | 3300048912 | Bacteria | 1107 |
| 711 | Ga0496109_1715426 | 3300048912 | Bacteria | 562 |
| 712 | Ga0496110_0082377 | 3300048913 | Bacteria | 2869 |
| 713 | Ga0496110_0271345 | 3300048913 | Bacteria | 1544 |
| 714 | Ga0496110_0578631 | 3300048913 | Bacteria | 1020 |
| 715 | Ga0496110_0698738 | 3300048913 | Bacteria | 916 |
| 716 | Ga0496110_0898695 | 3300048913 | Bacteria | 792 |
| 717 | Ga0496111_0033463 | 3300048914 | Bacteria | 3666 |
| 718 | Ga0496111_0042138 | 3300048914 | Bacteria | 3277 |
| 719 | Ga0496111_0121012 | 3300048914 | Bacteria | 1933 |
| 720 | Ga0496111_0121707 | 3300048914 | Bacteria | 1927 |
| 721 | Ga0496111_0480867 | 3300048914 | Bacteria | 915 |
| 722 | Ga0496111_1241302 | 3300048914 | Bacteria | 527 |
| 723 | Ga0496112_0005684 | 3300048915 | Bacteria | 10832 |
| 724 | Ga0496112_0077810 | 3300048915 | Bacteria | 3280 |
| 725 | Ga0496112_0293295 | 3300048915 | Bacteria | 1572 |
| 726 | Ga0496112_0649386 | 3300048915 | Bacteria | 985 |
| 727 | Ga0496113_0005866 | 3300048916 | Bacteria | 7708 |
| 728 | Ga0496113_0028649 | 3300048916 | Bacteria | 4008 |
| 729 | Ga0496113_0044627 | 3300048916 | Bacteria | 3285 |
| 730 | Ga0496113_0862372 | 3300048916 | Bacteria | 717 |
| 731 | Ga0496114_0059876 | 3300048917 | Bacteria | 3181 |
| 732 | Ga0496114_0267931 | 3300048917 | Bacteria | 1505 |
| 733 | Ga0496114_0435160 | 3300048917 | Bacteria | 1162 |
| 734 | Ga0496114_0666000 | 3300048917 | Bacteria | 914 |
| 735 | Ga0501031_0268022 | 3300049568 | Bacteria | 1109 |
| 736 | Ga0501031_0307862 | 3300049568 | Bacteria | 1026 |
| 737 | Ga0501031_0648614 | 3300049568 | Bacteria | 678 |
| 738 | Ga0501032_0106114 | 3300049569 | Bacteria | 1861 |
| 739 | Ga0501032_0161355 | 3300049569 | Bacteria | 1472 |
| 740 | Ga0501032_0230613 | 3300049569 | Bacteria | 1204 |
| 741 | Ga0501033_0062904 | 3300049570 | Bacteria | 2732 |
| 742 | Ga0501033_0272021 | 3300049570 | Bacteria | 1197 |
| 743 | Ga0501034_0040812 | 3300049571 | Bacteria | 4695 |
| 744 | Ga0501034_0047013 | 3300049571 | Bacteria | 4359 |
| 745 | Ga0501034_0355819 | 3300049571 | Bacteria | 1392 |
| 746 | Ga0501034_0431231 | 3300049571 | Bacteria | 1238 |
| 747 | Ga0501034_0486794 | 3300049571 | Bacteria | 1148 |
| 748 | Ga0501036_0060546 | 3300049572 | Bacteria | 3207 |
| 749 | Ga0501036_0100063 | 3300049572 | Bacteria | 2452 |
| 750 | Ga0501036_0257087 | 3300049572 | Bacteria | 1463 |
| 751 | Ga0501036_0614827 | 3300049572 | Bacteria | 901 |
| 752 | Ga0501036_0648452 | 3300049572 | Bacteria | 874 |
| 753 | Ga0501036_0834258 | 3300049572 | Bacteria | 758 |
| 754 | Ga0501036_1153026 | 3300049572 | Bacteria | 632 |
| 755 | Ga0501036_1166351 | 3300049572 | Bacteria | 628 |
| 756 | Ga0501037_0020704 | 3300049573 | Bacteria | 4857 |
| 757 | Ga0501037_0140868 | 3300049573 | Bacteria | 1726 |
| 758 | Ga0501038_0061833 | 3300049574 | Bacteria | 3202 |
| 759 | Ga0501038_0062771 | 3300049574 | Bacteria | 3173 |
| 760 | Ga0501038_0146108 | 3300049574 | Bacteria | 1931 |
| 761 | Ga0501039_0138032 | 3300049575 | Bacteria | 1915 |
| 762 | Ga0501039_0140834 | 3300049575 | Bacteria | 1895 |
| 763 | Ga0501039_0316464 | 3300049575 | Bacteria | 1227 |
| 764 | Ga0501039_0336837 | 3300049575 | Bacteria | 1185 |
| 765 | Ga0501039_0942507 | 3300049575 | Bacteria | 671 |
| 766 | Ga0501039_1028387 | 3300049575 | Bacteria | 640 |
| 767 | Ga0501039_1251568 | 3300049575 | Bacteria | 573 |
| 768 | Ga0501039_1385548 | 3300049575 | Bacteria | 541 |
| 769 | Ga0501040_0047201 | 3300049576 | Bacteria | 2941 |
| 770 | Ga0501040_0114793 | 3300049576 | Bacteria | 1885 |
| 771 | Ga0501040_0144779 | 3300049576 | Bacteria | 1675 |
| 772 | Ga0501040_0145655 | 3300049576 | Bacteria | 1670 |
| 773 | Ga0501040_0174879 | 3300049576 | Bacteria | 1521 |
| 774 | Ga0501040_0200908 | 3300049576 | Bacteria | 1415 |
| 775 | Ga0501040_0955697 | 3300049576 | Bacteria | 621 |
| 776 | Ga0501040_1354537 | 3300049576 | Bacteria | 516 |
| 777 | Ga0501041_0069522 | 3300049577 | Bacteria | 2160 |
| 778 | Ga0501041_0072115 | 3300049577 | Bacteria | 2121 |
| 779 | Ga0501041_0132209 | 3300049577 | Bacteria | 1554 |
| 780 | Ga0501041_0139093 | 3300049577 | Bacteria | 1514 |
| 781 | Ga0501041_0269611 | 3300049577 | Bacteria | 1071 |
| 782 | Ga0501041_0315809 | 3300049577 | Bacteria | 985 |
| 783 | Ga0501041_1102922 | 3300049577 | Bacteria | 511 |
| 784 | Ga0501042_0113953 | 3300049578 | Bacteria | 1947 |
| 785 | Ga0501042_0268597 | 3300049578 | Bacteria | 1231 |
| 786 | Ga0501042_0310767 | 3300049578 | Bacteria | 1139 |
| 787 | Ga0501042_0497542 | 3300049578 | Bacteria | 885 |
| 788 | Ga0501042_0561783 | 3300049578 | Bacteria | 829 |
| 789 | Ga0501043_0113573 | 3300049579 | Bacteria | 2127 |
| 790 | Ga0501043_0238624 | 3300049579 | Bacteria | 1403 |
| 791 | Ga0501043_0467893 | 3300049579 | Bacteria | 945 |
| 792 | Ga0501046_0059012 | 3300049580 | Bacteria | 3007 |
| 793 | Ga0501046_0150713 | 3300049580 | Bacteria | 1754 |
| 794 | Ga0501046_0359267 | 3300049580 | Bacteria | 1056 |
| 795 | Ga0501046_0891885 | 3300049580 | Bacteria | 621 |
| 796 | Ga0501047_0316576 | 3300049581 | Bacteria | 1401 |
| 797 | Ga0501047_0366805 | 3300049581 | Bacteria | 1275 |
| 798 | Ga0501047_0780030 | 3300049581 | Bacteria | 771 |
| 799 | Ga0501047_0853041 | 3300049581 | Bacteria | 725 |
| 800 | Ga0501048_0000725 | 3300049582 | Bacteria | 24137 |
| 801 | Ga0501048_0052300 | 3300049582 | Bacteria | 2906 |
| 802 | Ga0501048_0227205 | 3300049582 | Bacteria | 1324 |
| 803 | Ga0501048_0524534 | 3300049582 | Bacteria | 849 |
| 804 | Ga0501048_0566304 | 3300049582 | Bacteria | 815 |
| 805 | Ga0501067_0010872 | 3300049583 | Bacteria | 5038 |
| 806 | Ga0501067_0037432 | 3300049583 | Bacteria | 2695 |
| 807 | Ga0501067_0527570 | 3300049583 | Bacteria | 661 |
| 808 | Ga0501067_0663561 | 3300049583 | Bacteria | 586 |
| 809 | Ga0501068_0154001 | 3300049584 | Bacteria | 1446 |
| 810 | Ga0501068_0156275 | 3300049584 | Bacteria | 1436 |
| 811 | Ga0501068_0283646 | 3300049584 | Bacteria | 1059 |
| 812 | Ga0501068_0898305 | 3300049584 | Bacteria | 583 |
| 813 | Ga0501069_0953147 | 3300049585 | Bacteria | 523 |
| 814 | Ga0501070_0229143 | 3300049586 | Bacteria | 1522 |
| 815 | Ga0501070_0377057 | 3300049586 | Bacteria | 1149 |
| 816 | Ga0501070_0443328 | 3300049586 | Bacteria | 1047 |
| 817 | Ga0501070_0538470 | 3300049586 | Bacteria | 936 |
| 818 | Ga0501070_0756025 | 3300049586 | Unclassified | 766 |
| 819 | Ga0501071_0043355 | 3300049587 | Bacteria | 3225 |
| 820 | Ga0501071_0107484 | 3300049587 | Bacteria | 2060 |
| 821 | Ga0501071_0127701 | 3300049587 | Bacteria | 1888 |
| 822 | Ga0501071_0186980 | 3300049587 | Bacteria | 1553 |
| 823 | Ga0501071_0878668 | 3300049587 | Bacteria | 692 |
| 824 | Ga0501072_0078801 | 3300049588 | Bacteria | 2609 |
| 825 | Ga0501072_0088411 | 3300049588 | Bacteria | 2458 |
| 826 | Ga0501072_0104740 | 3300049588 | Bacteria | 2249 |
| 827 | Ga0501072_0116622 | 3300049588 | Bacteria | 2127 |
| 828 | Ga0501072_0134891 | 3300049588 | Bacteria | 1968 |
| 829 | Ga0501072_0136409 | 3300049588 | Bacteria | 1956 |
| 830 | Ga0501072_1086916 | 3300049588 | Bacteria | 622 |
| 831 | Ga0501073_0174531 | 3300049589 | Bacteria | 1488 |
| 832 | Ga0501073_0194478 | 3300049589 | Unclassified | 1403 |
| 833 | Ga0501073_0307177 | 3300049589 | Bacteria | 1094 |
| 834 | Ga0501073_0365553 | 3300049589 | Bacteria | 996 |
| 835 | Ga0501073_0627446 | 3300049589 | Bacteria | 742 |
| 836 | Ga0501073_0911935 | 3300049589 | Bacteria | 605 |
| 837 | Ga0501073_1164419 | 3300049589 | Bacteria | 529 |
| 838 | Ga0501074_0037653 | 3300049590 | Bacteria | 3505 |
| 839 | Ga0501074_0083694 | 3300049590 | Bacteria | 2287 |
| 840 | Ga0501074_0230080 | 3300049590 | Bacteria | 1320 |
| 841 | Ga0501074_0246753 | 3300049590 | Bacteria | 1270 |
| 842 | Ga0501074_0436423 | 3300049590 | Bacteria | 929 |
| 843 | Ga0501074_0893331 | 3300049590 | Bacteria | 625 |
| 844 | Ga0501075_0025569 | 3300049591 | Bacteria | 4337 |
| 845 | Ga0501075_0070787 | 3300049591 | Bacteria | 2636 |
| 846 | Ga0501075_0134970 | 3300049591 | Bacteria | 1880 |
| 847 | Ga0501075_0156577 | 3300049591 | Bacteria | 1737 |
| 848 | Ga0501075_0329038 | 3300049591 | Bacteria | 1164 |
| 849 | Ga0501075_0541518 | 3300049591 | Bacteria | 888 |
| 850 | Ga0501075_0833725 | 3300049591 | Bacteria | 701 |
| 851 | Ga0501075_0849714 | 3300049591 | Bacteria | 694 |
| 852 | Ga0501076_0048131 | 3300049592 | Bacteria | 3371 |
| 853 | Ga0501076_0052004 | 3300049592 | Bacteria | 3243 |
| 854 | Ga0501076_0088677 | 3300049592 | Bacteria | 2486 |
| 855 | Ga0501076_0122268 | 3300049592 | Bacteria | 2108 |
| 856 | Ga0501076_0769621 | 3300049592 | Bacteria | 794 |
| 857 | Ga0501076_0980099 | 3300049592 | Bacteria | 696 |
| 858 | Ga0501076_1486123 | 3300049592 | Bacteria | 556 |
| 859 | Ga0501076_1536942 | 3300049592 | Bacteria | 546 |
| 860 | Ga0501077_0028422 | 3300049593 | Bacteria | 3553 |
| 861 | Ga0501077_0034293 | 3300049593 | Bacteria | 3230 |
| 862 | Ga0501077_0186922 | 3300049593 | Bacteria | 1316 |
| 863 | Ga0501077_0191161 | 3300049593 | Bacteria | 1300 |
| 864 | Ga0501077_0850130 | 3300049593 | Bacteria | 587 |
| 865 | Ga0501077_0912259 | 3300049593 | Bacteria | 565 |
| 866 | Ga0501079_0090500 | 3300049741 | Bacteria | 2370 |
| 867 | Ga0501079_0097020 | 3300049741 | Bacteria | 2285 |
| 868 | Ga0501079_0106982 | 3300049741 | Bacteria | 2171 |
| 869 | Ga0501079_0233101 | 3300049741 | Bacteria | 1438 |
| 870 | Ga0501079_0337015 | 3300049741 | Bacteria | 1181 |
| 871 | Ga0501079_0476712 | 3300049741 | Bacteria | 980 |
| 872 | Ga0501079_0503470 | 3300049741 | Bacteria | 952 |
| 873 | Ga0501079_0547285 | 3300049741 | Bacteria | 910 |
| 874 | Ga0501080_0069798 | 3300049742 | Bacteria | 3268 |
| 875 | Ga0501080_0146841 | 3300049742 | Bacteria | 2180 |
| 876 | Ga0501080_0165757 | 3300049742 | Bacteria | 2039 |
| 877 | Ga0501080_0387747 | 3300049742 | Bacteria | 1258 |
| 878 | Ga0501080_0416397 | 3300049742 | Bacteria | 1207 |
| 879 | Ga0501080_0535265 | 3300049742 | Bacteria | 1044 |
| 880 | Ga0501080_0905909 | 3300049742 | Bacteria | 768 |
| 881 | Ga0501080_1002026 | 3300049742 | Bacteria | 724 |
| 882 | Ga0501081_0006642 | 3300049743 | Bacteria | 7520 |
| 883 | Ga0501081_0022707 | 3300049743 | Bacteria | 4199 |
| 884 | Ga0501081_0356587 | 3300049743 | Bacteria | 1078 |
| 885 | Ga0501081_0518939 | 3300049743 | Bacteria | 889 |
| 886 | Ga0501081_0716896 | 3300049743 | Bacteria | 751 |
| 887 | Ga0501081_0748224 | 3300049743 | Bacteria | 734 |
| 888 | Ga0501081_1069891 | 3300049743 | Bacteria | 610 |
| 889 | Ga0501083_0000366 | 3300049744 | Bacteria | 28661 |
| 890 | Ga0501083_0023852 | 3300049744 | Bacteria | 4242 |
| 891 | Ga0501083_0057582 | 3300049744 | Bacteria | 2601 |
| 892 | Ga0501083_0332767 | 3300049744 | Bacteria | 988 |
| 893 | Ga0501083_0382418 | 3300049744 | Bacteria | 915 |
| 894 | Ga0501083_0666444 | 3300049744 | Bacteria | 677 |
| 895 | Ga0501083_0868747 | 3300049744 | Bacteria | 587 |
| 896 | Ga0501035_0166001 | 3300049822 | Bacteria | 1909 |
| 897 | Ga0501035_0986216 | 3300049822 | Bacteria | 663 |
| 898 | Ga0501044_0248359 | 3300049823 | Bacteria | 1721 |
| 899 | Ga0501044_0408732 | 3300049823 | Bacteria | 1269 |
| 900 | Ga0501044_0433386 | 3300049823 | Bacteria | 1223 |
| 901 | Ga0501045_0062741 | 3300049824 | Bacteria | 2727 |
| 902 | Ga0501045_0107082 | 3300049824 | Bacteria | 2071 |
| 903 | Ga0501045_0149202 | 3300049824 | Bacteria | 1739 |
| 904 | Ga0501045_0217822 | 3300049824 | Bacteria | 1422 |
| 905 | Ga0501045_0292817 | 3300049824 | Bacteria | 1211 |
| 906 | nmdc:mga0yw44_656657_c1 | 3300050492 | Unclassified | 713 |
| 907 | nmdc:mga05p37_18344_c1 | 3300050507 | Bacteria | 8450 |
| 908 | nmdc:mga05p37_302458_c1 | 3300050507 | Bacteria | 1900 |
| 909 | nmdc:mga05p37_311339_c1 | 3300050507 | Bacteria | 1866 |
| 910 | nmdc:mga05p37_70473_c1 | 3300050507 | Bacteria | 4300 |
| 911 | nmdc:mga08y16_1020227_c1 | 3300050511 | Bacteria | 806 |
| 912 | nmdc:mga08y16_131922_c1 | 3300050511 | Bacteria | 2598 |
| 913 | nmdc:mga08y16_1525983_c1 | 3300050511 | Bacteria | 628 |
| 914 | nmdc:mga08y16_188128_c1 | 3300050511 | Bacteria | 2142 |
| 915 | nmdc:mga08y16_474401_c1 | 3300050511 | Unclassified | 1274 |
| 916 | nmdc:mga0n895_1484744_c1 | 3300050512 | Bacteria | 644 |
| 917 | nmdc:mga0n895_318901_c1 | 3300050512 | Bacteria | 1575 |
| 918 | nmdc:mga0rr50_129171_c1 | 3300050513 | Bacteria | 2021 |
| 919 | nmdc:mga0rr50_220059_c1 | 3300050513 | Unclassified | 1567 |
| 920 | nmdc:mga0a205_162884_c1 | 3300050515 | Bacteria | 2126 |
| 921 | nmdc:mga0a205_202167_c1 | 3300050515 | Bacteria | 1877 |
| 922 | Ga0495601_0016216 | 3300053077 | Bacteria | 4513 |
| 923 | Ga0495601_0571122 | 3300053077 | Bacteria | 727 |
| 924 | Ga0495612_0094471 | 3300053078 | Bacteria | 1269 |
| 925 | Ga0495595_0100982 | 3300053084 | Bacteria | 1392 |
| 926 | Ga0495595_0636284 | 3300053084 | Bacteria | 546 |
| 927 | Ga0495619_0016410 | 3300053085 | Bacteria | 4688 |
| 928 | Ga0495619_0351950 | 3300053085 | Bacteria | 1019 |
| 929 | Ga0501084_0040791 | 3300054114 | Bacteria | 3884 |
| 930 | Ga0501084_0054711 | 3300054114 | Bacteria | 3338 |
| 931 | Ga0501084_0075715 | 3300054114 | Bacteria | 2820 |
| 932 | Ga0501084_0138566 | 3300054114 | Bacteria | 2048 |
| 933 | Ga0501084_0274186 | 3300054114 | Bacteria | 1424 |
| 934 | Ga0501084_0440559 | 3300054114 | Bacteria | 1101 |
| 935 | Ga0501084_0457983 | 3300054114 | Bacteria | 1078 |
| 936 | Ga0501084_0487006 | 3300054114 | Bacteria | 1042 |
| 937 | Ga0501084_0525368 | 3300054114 | Bacteria | 1000 |
| 938 | Ga0501084_0758980 | 3300054114 | Bacteria | 817 |
| 939 | Ga0501084_0901679 | 3300054114 | Bacteria | 743 |
| 940 | Ga0501084_1100541 | 3300054114 | Bacteria | 667 |
| 941 | Ga0501084_1205252 | 3300054114 | Bacteria | 635 |
| 942 | Ga0501084_1744282 | 3300054114 | Bacteria | 520 |
| 943 | Ga0590071_000189 | 3300059421 | Bacteria | 17985 |
| 944 | Ga0590075_018081 | 3300059424 | Bacteria | 1741 |
| 945 | Ga0501082_0036986 | 3300060353 | Bacteria | 4205 |
| 946 | Ga0501082_0050355 | 3300060353 | Bacteria | 3592 |
| 947 | Ga0501082_0194128 | 3300060353 | Bacteria | 1766 |
| 948 | Ga0501082_0244033 | 3300060353 | Bacteria | 1563 |
| 949 | Ga0501082_0519190 | 3300060353 | Bacteria | 1041 |
| 950 | Ga0501082_0534793 | 3300060353 | Bacteria | 1025 |
| 951 | Ga0501082_0662253 | 3300060353 | Bacteria | 914 |
| 952 | Ga0501082_0670203 | 3300060353 | Bacteria | 908 |
| 953 | Ga0501082_1351221 | 3300060353 | Bacteria | 622 |
| 954 | Ga0501082_2023012 | 3300060353 | Bacteria | 502 |
| 955 | Ga0530510_0033333 | 3300061734 | Bacteria | 3709 |
| 956 | Ga0530510_0060525 | 3300061734 | Bacteria | 2740 |
| 957 | Ga0530510_0083461 | 3300061734 | Bacteria | 2326 |
| 958 | Ga0530510_0105394 | 3300061734 | Bacteria | 2063 |
| 959 | Ga0530510_0704487 | 3300061734 | Bacteria | 769 |
| 960 | Ga0530510_0900019 | 3300061734 | Bacteria | 676 |
| 961 | Ga0530510_0959485 | 3300061734 | Bacteria | 654 |
| 962 | Ga0530510_1305268 | 3300061734 | Bacteria | 557 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0017877 | Ga0395901_0017877_682_1005 | 84 |
| 2 | 3300049582 | Ga0501048_0000725 | Ga0501048_0000725_10250_10570 | 88 |
| 3 | 3300041494 | Ga0451837_1035402 | Ga0451837_1035402_12_281 | 89 |
| 4 | 3300005468 | Ga0070707_100025207 | Ga0070707_1000252073 | 92 |
| 5 | iso_pu_bacteria | 2919450847 | 2919454757 | 95 |
| 6 | 3300025939 | Ga0207665_11125471 | Ga0207665_111254711 | 96 |
| 7 | iso_pu_bacteria | 2554235469 | 2556065943 | 97 |
| 8 | 3300003320 | rootH2_10016961 | rootH2_100169617 | 98 |
| 9 | 3300003320 | rootH2_10247369 | rootH2_102473694 | 98 |
| 10 | 3300009093 | Ga0105240_10044197 | Ga0105240_100441972 | 98 |
| 11 | 3300009177 | Ga0105248_10054628 | Ga0105248_100546282 | 98 |
| 12 | 3300013306 | Ga0163162_10931184 | Ga0163162_109311842 | 98 |
| 13 | 3300021441 | Ga0213871_10177200 | Ga0213871_101772002 | 98 |
| 14 | 3300025913 | Ga0207695_10705285 | Ga0207695_107052852 | 98 |
| 15 | 3300025941 | Ga0207711_10880302 | Ga0207711_108803022 | 98 |
| 16 | 3300039438 | Ga0436360_0263685 | Ga0436360_0263685_1299_1625 | 98 |
| 17 | 3300039438 | Ga0436360_1115059 | Ga0436360_1115059_92_418 | 98 |
| 18 | 3300039447 | Ga0436361_1146080 | Ga0436361_1146080_232_561 | 98 |
| 19 | 3300046516 | Ga0495628_0607309 | Ga0495628_0607309_278_604 | 98 |
| 20 | 3300005345 | Ga0070692_10518170 | Ga0070692_105181702 | 99 |
| 21 | 3300005366 | Ga0070659_100430523 | Ga0070659_1004305232 | 99 |
| 22 | 3300005444 | Ga0070694_100327892 | Ga0070694_1003278922 | 99 |
| 23 | 3300005458 | Ga0070681_10549404 | Ga0070681_105494042 | 99 |
| 24 | 3300005459 | Ga0068867_101427197 | Ga0068867_1014271971 | 99 |
| 25 | 3300005530 | Ga0070679_101146898 | Ga0070679_1011468982 | 99 |
| 26 | 3300005539 | Ga0068853_100497354 | Ga0068853_1004973542 | 99 |
| 27 | 3300005545 | Ga0070695_100192056 | Ga0070695_1001920562 | 99 |
| 28 | 3300005578 | Ga0068854_100934598 | Ga0068854_1009345982 | 99 |
| 29 | 3300005842 | Ga0068858_101487124 | Ga0068858_1014871242 | 99 |
| 30 | 3300009094 | Ga0111539_10379491 | Ga0111539_103794912 | 99 |
| 31 | 3300013306 | Ga0163162_11214252 | Ga0163162_112142522 | 99 |
| 32 | 3300025901 | Ga0207688_10340999 | Ga0207688_103409992 | 99 |
| 33 | 3300025921 | Ga0207652_11582571 | Ga0207652_115825712 | 99 |
| 34 | 3300025932 | Ga0207690_10347462 | Ga0207690_103474622 | 99 |
| 35 | 3300025933 | Ga0207706_10286659 | Ga0207706_102866593 | 99 |
| 36 | 3300026023 | Ga0207677_10803064 | Ga0207677_108030641 | 99 |
| 37 | 3300026035 | Ga0207703_10477429 | Ga0207703_104774292 | 99 |
| 38 | 3300026041 | Ga0207639_11006988 | Ga0207639_110069882 | 99 |
| 39 | 3300026075 | Ga0207708_10027078 | Ga0207708_100270783 | 99 |
| 40 | 3300026078 | Ga0207702_10423542 | Ga0207702_104235422 | 99 |
| 41 | 3300026089 | Ga0207648_10271978 | Ga0207648_102719782 | 99 |
| 42 | 3300028381 | Ga0268264_10452043 | Ga0268264_104520432 | 99 |
| 43 | 3300031901 | Ga0307406_11349324 | Ga0307406_113493241 | 99 |
| 44 | 3300031901 | Ga0307406_11672182 | Ga0307406_116721822 | 99 |
| 45 | 3300037068 | Ga0373925_1113872 | Ga0373925_1113872_52_375 | 99 |
| 46 | 3300048911 | Ga0496108_0658970 | Ga0496108_0658970_130_453 | 99 |
| 47 | 3300048914 | Ga0496111_0480867 | Ga0496111_0480867_186_509 | 99 |
| 48 | 3300050511 | nmdc:mga08y16_1525983_c1 | nmdc:mga08y16_1525983_c1_280_600 | 99 |
| 49 | 3300026075 | Ga0207708_11604107 | Ga0207708_116041072 | 100 |
| 50 | 3300042156 | Ga0439446_0095485 | Ga0439446_0095485_462_764 | 100 |
| 51 | 3300003203 | JGI25406J46586_10027416 | JGI25406J46586_100274162 | 101 |
| 52 | 3300003320 | rootH2_10041962 | rootH2_100419622 | 101 |
| 53 | 3300003323 | rootH1_10020450 | rootH1_100204502 | 101 |
| 54 | 3300005293 | Ga0065715_10961770 | Ga0065715_109617701 | 101 |
| 55 | 3300005328 | Ga0070676_10236036 | Ga0070676_102360362 | 101 |
| 56 | 3300005328 | Ga0070676_10599700 | Ga0070676_105997002 | 101 |
| 57 | 3300005329 | Ga0070683_100644225 | Ga0070683_1006442252 | 101 |
| 58 | 3300005330 | Ga0070690_100148212 | Ga0070690_1001482122 | 101 |
| 59 | 3300005330 | Ga0070690_101358852 | Ga0070690_1013588521 | 101 |
| 60 | 3300005331 | Ga0070670_100368652 | Ga0070670_1003686522 | 101 |
| 61 | 3300005333 | Ga0070677_10418474 | Ga0070677_104184741 | 101 |
| 62 | 3300005334 | Ga0068869_100457324 | Ga0068869_1004573241 | 101 |
| 63 | 3300005334 | Ga0068869_101657215 | Ga0068869_1016572151 | 101 |
| 64 | 3300005336 | Ga0070680_100763137 | Ga0070680_1007631372 | 101 |
| 65 | 3300005337 | Ga0070682_100352490 | Ga0070682_1003524902 | 101 |
| 66 | 3300005337 | Ga0070682_100354112 | Ga0070682_1003541122 | 101 |
| 67 | 3300005337 | Ga0070682_100650347 | Ga0070682_1006503471 | 101 |
| 68 | 3300005337 | Ga0070682_101996449 | Ga0070682_1019964491 | 101 |
| 69 | 3300005338 | Ga0068868_100152639 | Ga0068868_1001526392 | 101 |
| 70 | 3300005338 | Ga0068868_101052529 | Ga0068868_1010525292 | 101 |
| 71 | 3300005338 | Ga0068868_101591236 | Ga0068868_1015912362 | 101 |
| 72 | 3300005339 | Ga0070660_100098548 | Ga0070660_1000985481 | 101 |
| 73 | 3300005339 | Ga0070660_100599296 | Ga0070660_1005992962 | 101 |
| 74 | 3300005340 | Ga0070689_100022734 | Ga0070689_1000227344 | 101 |
| 75 | 3300005340 | Ga0070689_100125139 | Ga0070689_1001251392 | 101 |
| 76 | 3300005340 | Ga0070689_100357111 | Ga0070689_1003571112 | 101 |
| 77 | 3300005341 | Ga0070691_10134575 | Ga0070691_101345752 | 101 |
| 78 | 3300005344 | Ga0070661_100199944 | Ga0070661_1001999443 | 101 |
| 79 | 3300005344 | Ga0070661_101229554 | Ga0070661_1012295542 | 101 |
| 80 | 3300005345 | Ga0070692_10025730 | Ga0070692_100257301 | 101 |
| 81 | 3300005345 | Ga0070692_10225742 | Ga0070692_102257422 | 101 |
| 82 | 3300005345 | Ga0070692_10585780 | Ga0070692_105857801 | 101 |
| 83 | 3300005345 | Ga0070692_10933696 | Ga0070692_109336961 | 101 |
| 84 | 3300005347 | Ga0070668_100115147 | Ga0070668_1001151472 | 101 |
| 85 | 3300005347 | Ga0070668_100185384 | Ga0070668_1001853842 | 101 |
| 86 | 3300005347 | Ga0070668_100359692 | Ga0070668_1003596922 | 101 |
| 87 | 3300005347 | Ga0070668_100594938 | Ga0070668_1005949382 | 101 |
| 88 | 3300005347 | Ga0070668_100815044 | Ga0070668_1008150442 | 101 |
| 89 | 3300005353 | Ga0070669_101303047 | Ga0070669_1013030471 | 101 |
| 90 | 3300005354 | Ga0070675_100139086 | Ga0070675_1001390864 | 101 |
| 91 | 3300005354 | Ga0070675_100395775 | Ga0070675_1003957752 | 101 |
| 92 | 3300005356 | Ga0070674_100040553 | Ga0070674_1000405533 | 101 |
| 93 | 3300005356 | Ga0070674_100209921 | Ga0070674_1002099211 | 101 |
| 94 | 3300005356 | Ga0070674_101184564 | Ga0070674_1011845642 | 101 |
| 95 | 3300005364 | Ga0070673_100541484 | Ga0070673_1005414842 | 101 |
| 96 | 3300005364 | Ga0070673_101435897 | Ga0070673_1014358971 | 101 |
| 97 | 3300005365 | Ga0070688_100704933 | Ga0070688_1007049332 | 101 |
| 98 | 3300005365 | Ga0070688_100987390 | Ga0070688_1009873901 | 101 |
| 99 | 3300005366 | Ga0070659_100015650 | Ga0070659_1000156501 | 101 |
| 100 | 3300005366 | Ga0070659_101666369 | Ga0070659_1016663691 | 101 |
| 101 | 3300005366 | Ga0070659_101692357 | Ga0070659_1016923571 | 101 |
| 102 | 3300005367 | Ga0070667_100585371 | Ga0070667_1005853712 | 101 |
| 103 | 3300005367 | Ga0070667_100658974 | Ga0070667_1006589742 | 101 |
| 104 | 3300005406 | Ga0070703_10299321 | Ga0070703_102993211 | 101 |
| 105 | 3300005438 | Ga0070701_10049674 | Ga0070701_100496742 | 101 |
| 106 | 3300005438 | Ga0070701_10304334 | Ga0070701_103043342 | 101 |
| 107 | 3300005439 | Ga0070711_100552070 | Ga0070711_1005520702 | 101 |
| 108 | 3300005440 | Ga0070705_100035713 | Ga0070705_1000357132 | 101 |
| 109 | 3300005440 | Ga0070705_100680183 | Ga0070705_1006801832 | 101 |
| 110 | 3300005441 | Ga0070700_100052017 | Ga0070700_1000520174 | 101 |
| 111 | 3300005441 | Ga0070700_100054398 | Ga0070700_1000543982 | 101 |
| 112 | 3300005441 | Ga0070700_100059450 | Ga0070700_1000594503 | 101 |
| 113 | 3300005441 | Ga0070700_100306225 | Ga0070700_1003062252 | 101 |
| 114 | 3300005441 | Ga0070700_101044844 | Ga0070700_1010448442 | 101 |
| 115 | 3300005444 | Ga0070694_100034060 | Ga0070694_1000340602 | 101 |
| 116 | 3300005444 | Ga0070694_100136520 | Ga0070694_1001365204 | 101 |
| 117 | 3300005444 | Ga0070694_100218069 | Ga0070694_1002180692 | 101 |
| 118 | 3300005444 | Ga0070694_100220578 | Ga0070694_1002205782 | 101 |
| 119 | 3300005445 | Ga0070708_100102469 | Ga0070708_1001024692 | 101 |
| 120 | 3300005445 | Ga0070708_100260834 | Ga0070708_1002608342 | 101 |
| 121 | 3300005445 | Ga0070708_100448181 | Ga0070708_1004481811 | 101 |
| 122 | 3300005445 | Ga0070708_100542486 | Ga0070708_1005424862 | 101 |
| 123 | 3300005445 | Ga0070708_100601551 | Ga0070708_1006015512 | 101 |
| 124 | 3300005455 | Ga0070663_101258504 | Ga0070663_1012585042 | 101 |
| 125 | 3300005455 | Ga0070663_101299142 | Ga0070663_1012991422 | 101 |
| 126 | 3300005455 | Ga0070663_101819370 | Ga0070663_1018193702 | 101 |
| 127 | 3300005456 | Ga0070678_100137826 | Ga0070678_1001378262 | 101 |
| 128 | 3300005456 | Ga0070678_100249957 | Ga0070678_1002499573 | 101 |
| 129 | 3300005456 | Ga0070678_100419704 | Ga0070678_1004197042 | 101 |
| 130 | 3300005456 | Ga0070678_100528970 | Ga0070678_1005289702 | 101 |
| 131 | 3300005456 | Ga0070678_100537665 | Ga0070678_1005376652 | 101 |
| 132 | 3300005456 | Ga0070678_100764945 | Ga0070678_1007649452 | 101 |
| 133 | 3300005456 | Ga0070678_101271423 | Ga0070678_1012714232 | 101 |
| 134 | 3300005457 | Ga0070662_100174199 | Ga0070662_1001741992 | 101 |
| 135 | 3300005457 | Ga0070662_100621452 | Ga0070662_1006214522 | 101 |
| 136 | 3300005458 | Ga0070681_10315714 | Ga0070681_103157142 | 101 |
| 137 | 3300005458 | Ga0070681_10812784 | Ga0070681_108127842 | 101 |
| 138 | 3300005458 | Ga0070681_11208650 | Ga0070681_112086501 | 101 |
| 139 | 3300005458 | Ga0070681_11208732 | Ga0070681_112087322 | 101 |
| 140 | 3300005459 | Ga0068867_100037830 | Ga0068867_1000378304 | 101 |
| 141 | 3300005459 | Ga0068867_101063418 | Ga0068867_1010634182 | 101 |
| 142 | 3300005466 | Ga0070685_10026310 | Ga0070685_100263102 | 101 |
| 143 | 3300005466 | Ga0070685_10699323 | Ga0070685_106993232 | 101 |
| 144 | 3300005467 | Ga0070706_100222584 | Ga0070706_1002225842 | 101 |
| 145 | 3300005468 | Ga0070707_100396221 | Ga0070707_1003962212 | 101 |
| 146 | 3300005468 | Ga0070707_100572488 | Ga0070707_1005724882 | 101 |
| 147 | 3300005471 | Ga0070698_100164248 | Ga0070698_1001642482 | 101 |
| 148 | 3300005471 | Ga0070698_100252012 | Ga0070698_1002520122 | 101 |
| 149 | 3300005471 | Ga0070698_100327200 | Ga0070698_1003272001 | 101 |
| 150 | 3300005471 | Ga0070698_101087309 | Ga0070698_1010873092 | 101 |
| 151 | 3300005518 | Ga0070699_100008575 | Ga0070699_1000085759 | 101 |
| 152 | 3300005518 | Ga0070699_101334491 | Ga0070699_1013344911 | 101 |
| 153 | 3300005530 | Ga0070679_100400729 | Ga0070679_1004007292 | 101 |
| 154 | 3300005530 | Ga0070679_100404901 | Ga0070679_1004049012 | 101 |
| 155 | 3300005530 | Ga0070679_100719571 | Ga0070679_1007195712 | 101 |
| 156 | 3300005530 | Ga0070679_100867230 | Ga0070679_1008672302 | 101 |
| 157 | 3300005535 | Ga0070684_100186927 | Ga0070684_1001869273 | 101 |
| 158 | 3300005535 | Ga0070684_100575704 | Ga0070684_1005757041 | 101 |
| 159 | 3300005536 | Ga0070697_100093865 | Ga0070697_1000938654 | 101 |
| 160 | 3300005536 | Ga0070697_100097763 | Ga0070697_1000977632 | 101 |
| 161 | 3300005536 | Ga0070697_100397843 | Ga0070697_1003978432 | 101 |
| 162 | 3300005536 | Ga0070697_100440145 | Ga0070697_1004401452 | 101 |
| 163 | 3300005539 | Ga0068853_100388878 | Ga0068853_1003888782 | 101 |
| 164 | 3300005543 | Ga0070672_100734034 | Ga0070672_1007340342 | 101 |
| 165 | 3300005543 | Ga0070672_101024435 | Ga0070672_1010244352 | 101 |
| 166 | 3300005544 | Ga0070686_100072359 | Ga0070686_1000723592 | 101 |
| 167 | 3300005544 | Ga0070686_100120228 | Ga0070686_1001202283 | 101 |
| 168 | 3300005544 | Ga0070686_100185107 | Ga0070686_1001851072 | 101 |
| 169 | 3300005544 | Ga0070686_100588665 | Ga0070686_1005886652 | 101 |
| 170 | 3300005544 | Ga0070686_100610339 | Ga0070686_1006103392 | 101 |
| 171 | 3300005544 | Ga0070686_100721487 | Ga0070686_1007214871 | 101 |
| 172 | 3300005545 | Ga0070695_100054976 | Ga0070695_1000549762 | 101 |
| 173 | 3300005545 | Ga0070695_100082748 | Ga0070695_1000827483 | 101 |
| 174 | 3300005545 | Ga0070695_100920971 | Ga0070695_1009209712 | 101 |
| 175 | 3300005545 | Ga0070695_101124659 | Ga0070695_1011246591 | 101 |
| 176 | 3300005546 | Ga0070696_100014238 | Ga0070696_1000142386 | 101 |
| 177 | 3300005546 | Ga0070696_100029799 | Ga0070696_1000297992 | 101 |
| 178 | 3300005546 | Ga0070696_100072070 | Ga0070696_1000720704 | 101 |
| 179 | 3300005546 | Ga0070696_100860435 | Ga0070696_1008604352 | 101 |
| 180 | 3300005546 | Ga0070696_101313572 | Ga0070696_1013135721 | 101 |
| 181 | 3300005546 | Ga0070696_101353244 | Ga0070696_1013532442 | 101 |
| 182 | 3300005546 | Ga0070696_101788678 | Ga0070696_1017886781 | 101 |
| 183 | 3300005547 | Ga0070693_100072762 | Ga0070693_1000727624 | 101 |
| 184 | 3300005547 | Ga0070693_100089178 | Ga0070693_1000891782 | 101 |
| 185 | 3300005549 | Ga0070704_100064012 | Ga0070704_1000640122 | 101 |
| 186 | 3300005549 | Ga0070704_101193995 | Ga0070704_1011939952 | 101 |
| 187 | 3300005549 | Ga0070704_101501735 | Ga0070704_1015017352 | 101 |
| 188 | 3300005563 | Ga0068855_100847382 | Ga0068855_1008473822 | 101 |
| 189 | 3300005564 | Ga0070664_100133647 | Ga0070664_1001336474 | 101 |
| 190 | 3300005564 | Ga0070664_100381505 | Ga0070664_1003815052 | 101 |
| 191 | 3300005564 | Ga0070664_100742324 | Ga0070664_1007423242 | 101 |
| 192 | 3300005564 | Ga0070664_101393127 | Ga0070664_1013931272 | 101 |
| 193 | 3300005564 | Ga0070664_101594443 | Ga0070664_1015944431 | 101 |
| 194 | 3300005577 | Ga0068857_100142197 | Ga0068857_1001421973 | 101 |
| 195 | 3300005578 | Ga0068854_100084803 | Ga0068854_1000848032 | 101 |
| 196 | 3300005578 | Ga0068854_100783160 | Ga0068854_1007831602 | 101 |
| 197 | 3300005578 | Ga0068854_101061831 | Ga0068854_1010618312 | 101 |
| 198 | 3300005578 | Ga0068854_101701763 | Ga0068854_1017017632 | 101 |
| 199 | 3300005614 | Ga0068856_100200695 | Ga0068856_1002006952 | 101 |
| 200 | 3300005614 | Ga0068856_100666754 | Ga0068856_1006667542 | 101 |
| 201 | 3300005615 | Ga0070702_100035782 | Ga0070702_1000357822 | 101 |
| 202 | 3300005615 | Ga0070702_100156558 | Ga0070702_1001565583 | 101 |
| 203 | 3300005615 | Ga0070702_100464968 | Ga0070702_1004649682 | 101 |
| 204 | 3300005615 | Ga0070702_101703033 | Ga0070702_1017030331 | 101 |
| 205 | 3300005616 | Ga0068852_100186891 | Ga0068852_1001868912 | 101 |
| 206 | 3300005616 | Ga0068852_101105787 | Ga0068852_1011057872 | 101 |
| 207 | 3300005617 | Ga0068859_101579095 | Ga0068859_1015790952 | 101 |
| 208 | 3300005618 | Ga0068864_100537254 | Ga0068864_1005372542 | 101 |
| 209 | 3300005618 | Ga0068864_100840386 | Ga0068864_1008403862 | 101 |
| 210 | 3300005618 | Ga0068864_101906823 | Ga0068864_1019068232 | 101 |
| 211 | 3300005618 | Ga0068864_102141219 | Ga0068864_1021412192 | 101 |
| 212 | 3300005718 | Ga0068866_10584039 | Ga0068866_105840392 | 101 |
| 213 | 3300005718 | Ga0068866_10597154 | Ga0068866_105971541 | 101 |
| 214 | 3300005718 | Ga0068866_10865520 | Ga0068866_108655201 | 101 |
| 215 | 3300005719 | Ga0068861_100205052 | Ga0068861_1002050521 | 101 |
| 216 | 3300005719 | Ga0068861_100335407 | Ga0068861_1003354072 | 101 |
| 217 | 3300005719 | Ga0068861_100502843 | Ga0068861_1005028432 | 101 |
| 218 | 3300005719 | Ga0068861_100727372 | Ga0068861_1007273722 | 101 |
| 219 | 3300005719 | Ga0068861_100753090 | Ga0068861_1007530902 | 101 |
| 220 | 3300005719 | Ga0068861_102402387 | Ga0068861_1024023872 | 101 |
| 221 | 3300005840 | Ga0068870_10154553 | Ga0068870_101545531 | 101 |
| 222 | 3300005841 | Ga0068863_101817861 | Ga0068863_1018178611 | 101 |
| 223 | 3300005842 | Ga0068858_100103958 | Ga0068858_1001039582 | 101 |
| 224 | 3300005842 | Ga0068858_100222021 | Ga0068858_1002220211 | 101 |
| 225 | 3300005842 | Ga0068858_100415907 | Ga0068858_1004159072 | 101 |
| 226 | 3300005842 | Ga0068858_101652130 | Ga0068858_1016521301 | 101 |
| 227 | 3300005843 | Ga0068860_100531355 | Ga0068860_1005313551 | 101 |
| 228 | 3300005843 | Ga0068860_101791862 | Ga0068860_1017918621 | 101 |
| 229 | 3300005844 | Ga0068862_100259914 | Ga0068862_1002599142 | 101 |
| 230 | 3300005844 | Ga0068862_101230904 | Ga0068862_1012309042 | 101 |
| 231 | 3300005844 | Ga0068862_101247836 | Ga0068862_1012478361 | 101 |
| 232 | 3300005985 | Ga0081539_10029426 | Ga0081539_100294262 | 101 |
| 233 | 3300005985 | Ga0081539_10056210 | Ga0081539_100562102 | 101 |
| 234 | 3300006038 | Ga0075365_10133768 | Ga0075365_101337683 | 101 |
| 235 | 3300006058 | Ga0075432_10092489 | Ga0075432_100924892 | 101 |
| 236 | 3300006237 | Ga0097621_100152764 | Ga0097621_1001527644 | 101 |
| 237 | 3300006358 | Ga0068871_100849554 | Ga0068871_1008495542 | 101 |
| 238 | 3300006844 | Ga0075428_100113608 | Ga0075428_1001136083 | 101 |
| 239 | 3300006844 | Ga0075428_100486259 | Ga0075428_1004862592 | 101 |
| 240 | 3300006844 | Ga0075428_100776662 | Ga0075428_1007766622 | 101 |
| 241 | 3300006847 | Ga0075431_100844501 | Ga0075431_1008445012 | 101 |
| 242 | 3300006852 | Ga0075433_10369755 | Ga0075433_103697552 | 101 |
| 243 | 3300006852 | Ga0075433_10505951 | Ga0075433_105059512 | 101 |
| 244 | 3300006852 | Ga0075433_10560793 | Ga0075433_105607932 | 101 |
| 245 | 3300006871 | Ga0075434_100187428 | Ga0075434_1001874282 | 101 |
| 246 | 3300006871 | Ga0075434_100338781 | Ga0075434_1003387812 | 101 |
| 247 | 3300006881 | Ga0068865_100078447 | Ga0068865_1000784472 | 101 |
| 248 | 3300006881 | Ga0068865_100213479 | Ga0068865_1002134793 | 101 |
| 249 | 3300006881 | Ga0068865_100433050 | Ga0068865_1004330502 | 101 |
| 250 | 3300006881 | Ga0068865_100592630 | Ga0068865_1005926302 | 101 |
| 251 | 3300006881 | Ga0068865_101073885 | Ga0068865_1010738852 | 101 |
| 252 | 3300006914 | Ga0075436_101079646 | Ga0075436_1010796462 | 101 |
| 253 | 3300006931 | Ga0097620_101579035 | Ga0097620_1015790352 | 101 |
| 254 | 3300007076 | Ga0075435_100596311 | Ga0075435_1005963112 | 101 |
| 255 | 3300007076 | Ga0075435_100668355 | Ga0075435_1006683552 | 101 |
| 256 | 3300009093 | Ga0105240_11143548 | Ga0105240_111435481 | 101 |
| 257 | 3300009094 | Ga0111539_10083116 | Ga0111539_100831162 | 101 |
| 258 | 3300009094 | Ga0111539_10163105 | Ga0111539_101631053 | 101 |
| 259 | 3300009094 | Ga0111539_10247245 | Ga0111539_102472452 | 101 |
| 260 | 3300009094 | Ga0111539_11149912 | Ga0111539_111499122 | 101 |
| 261 | 3300009094 | Ga0111539_11158339 | Ga0111539_111583392 | 101 |
| 262 | 3300009098 | Ga0105245_10061212 | Ga0105245_100612122 | 101 |
| 263 | 3300009098 | Ga0105245_10259642 | Ga0105245_102596422 | 101 |
| 264 | 3300009098 | Ga0105245_10265852 | Ga0105245_102658522 | 101 |
| 265 | 3300009098 | Ga0105245_10390300 | Ga0105245_103903003 | 101 |
| 266 | 3300009098 | Ga0105245_10390566 | Ga0105245_103905662 | 101 |
| 267 | 3300009098 | Ga0105245_10412610 | Ga0105245_104126102 | 101 |
| 268 | 3300009098 | Ga0105245_10487151 | Ga0105245_104871512 | 101 |
| 269 | 3300009098 | Ga0105245_10707723 | Ga0105245_107077232 | 101 |
| 270 | 3300009098 | Ga0105245_11560036 | Ga0105245_115600362 | 101 |
| 271 | 3300009098 | Ga0105245_11926018 | Ga0105245_119260181 | 101 |
| 272 | 3300009098 | Ga0105245_12157575 | Ga0105245_121575751 | 101 |
| 273 | 3300009101 | Ga0105247_10323393 | Ga0105247_103233932 | 101 |
| 274 | 3300009101 | Ga0105247_10488216 | Ga0105247_104882162 | 101 |
| 275 | 3300009147 | Ga0114129_10173746 | Ga0114129_101737462 | 101 |
| 276 | 3300009147 | Ga0114129_10255828 | Ga0114129_102558282 | 101 |
| 277 | 3300009147 | Ga0114129_10270353 | Ga0114129_102703534 | 101 |
| 278 | 3300009147 | Ga0114129_11705941 | Ga0114129_117059412 | 101 |
| 279 | 3300009148 | Ga0105243_10085338 | Ga0105243_100853382 | 101 |
| 280 | 3300009148 | Ga0105243_10114671 | Ga0105243_101146712 | 101 |
| 281 | 3300009148 | Ga0105243_10274461 | Ga0105243_102744612 | 101 |
| 282 | 3300009148 | Ga0105243_10314081 | Ga0105243_103140812 | 101 |
| 283 | 3300009148 | Ga0105243_10550736 | Ga0105243_105507362 | 101 |
| 284 | 3300009148 | Ga0105243_11174643 | Ga0105243_111746432 | 101 |
| 285 | 3300009174 | Ga0105241_12067047 | Ga0105241_120670471 | 101 |
| 286 | 3300009176 | Ga0105242_10057420 | Ga0105242_100574203 | 101 |
| 287 | 3300009176 | Ga0105242_10134891 | Ga0105242_101348914 | 101 |
| 288 | 3300009176 | Ga0105242_10843851 | Ga0105242_108438512 | 101 |
| 289 | 3300009177 | Ga0105248_11213140 | Ga0105248_112131401 | 101 |
| 290 | 3300009177 | Ga0105248_11463580 | Ga0105248_114635801 | 101 |
| 291 | 3300009177 | Ga0105248_11898017 | Ga0105248_118980172 | 101 |
| 292 | 3300009177 | Ga0105248_13388968 | Ga0105248_133889681 | 101 |
| 293 | 3300009551 | Ga0105238_10070578 | Ga0105238_100705784 | 101 |
| 294 | 3300009551 | Ga0105238_10374143 | Ga0105238_103741433 | 101 |
| 295 | 3300009553 | Ga0105249_10111503 | Ga0105249_101115034 | 101 |
| 296 | 3300009553 | Ga0105249_10139553 | Ga0105249_101395532 | 101 |
| 297 | 3300009553 | Ga0105249_10556239 | Ga0105249_105562391 | 101 |
| 298 | 3300009553 | Ga0105249_11742264 | Ga0105249_117422641 | 101 |
| 299 | 3300010375 | Ga0105239_10183486 | Ga0105239_101834864 | 101 |
| 300 | 3300010375 | Ga0105239_10225542 | Ga0105239_102255423 | 101 |
| 301 | 3300010375 | Ga0105239_11033154 | Ga0105239_110331542 | 101 |
| 302 | 3300010375 | Ga0105239_11548821 | Ga0105239_115488211 | 101 |
| 303 | 3300011119 | Ga0105246_10440601 | Ga0105246_104406012 | 101 |
| 304 | 3300011119 | Ga0105246_10608934 | Ga0105246_106089342 | 101 |
| 305 | 3300011119 | Ga0105246_10998763 | Ga0105246_109987631 | 101 |
| 306 | 3300011119 | Ga0105246_11385517 | Ga0105246_113855171 | 101 |
| 307 | 3300011119 | Ga0105246_11732794 | Ga0105246_117327942 | 101 |
| 308 | 3300012507 | Ga0157342_1050137 | Ga0157342_10501372 | 101 |
| 309 | 3300013102 | Ga0157371_11226651 | Ga0157371_112266512 | 101 |
| 310 | 3300013296 | Ga0157374_10528563 | Ga0157374_105285631 | 101 |
| 311 | 3300013296 | Ga0157374_10891944 | Ga0157374_108919441 | 101 |
| 312 | 3300013296 | Ga0157374_11313298 | Ga0157374_113132982 | 101 |
| 313 | 3300013297 | Ga0157378_10117009 | Ga0157378_101170092 | 101 |
| 314 | 3300013297 | Ga0157378_11551325 | Ga0157378_115513252 | 101 |
| 315 | 3300013297 | Ga0157378_11774611 | Ga0157378_117746112 | 101 |
| 316 | 3300013297 | Ga0157378_12077549 | Ga0157378_120775491 | 101 |
| 317 | 3300013306 | Ga0163162_10747468 | Ga0163162_107474681 | 101 |
| 318 | 3300013306 | Ga0163162_10786677 | Ga0163162_107866772 | 101 |
| 319 | 3300013306 | Ga0163162_10969871 | Ga0163162_109698711 | 101 |
| 320 | 3300013306 | Ga0163162_11535614 | Ga0163162_115356142 | 101 |
| 321 | 3300013307 | Ga0157372_11048214 | Ga0157372_110482141 | 101 |
| 322 | 3300013308 | Ga0157375_10182066 | Ga0157375_101820662 | 101 |
| 323 | 3300013308 | Ga0157375_10447930 | Ga0157375_104479304 | 101 |
| 324 | 3300013308 | Ga0157375_10781512 | Ga0157375_107815122 | 101 |
| 325 | 3300013308 | Ga0157375_11120408 | Ga0157375_111204082 | 101 |
| 326 | 3300013308 | Ga0157375_11287547 | Ga0157375_112875471 | 101 |
| 327 | 3300014325 | Ga0163163_10011059 | Ga0163163_100110599 | 101 |
| 328 | 3300014325 | Ga0163163_10089481 | Ga0163163_100894812 | 101 |
| 329 | 3300014325 | Ga0163163_10229313 | Ga0163163_102293132 | 101 |
| 330 | 3300014325 | Ga0163163_10247169 | Ga0163163_102471693 | 101 |
| 331 | 3300014325 | Ga0163163_10329052 | Ga0163163_103290523 | 101 |
| 332 | 3300014325 | Ga0163163_11048556 | Ga0163163_110485562 | 101 |
| 333 | 3300014326 | Ga0157380_10038585 | Ga0157380_100385854 | 101 |
| 334 | 3300014326 | Ga0157380_10110883 | Ga0157380_101108832 | 101 |
| 335 | 3300014326 | Ga0157380_10491946 | Ga0157380_104919462 | 101 |
| 336 | 3300014326 | Ga0157380_10953972 | Ga0157380_109539722 | 101 |
| 337 | 3300014745 | Ga0157377_10016618 | Ga0157377_100166183 | 101 |
| 338 | 3300014745 | Ga0157377_10206994 | Ga0157377_102069942 | 101 |
| 339 | 3300014745 | Ga0157377_10361175 | Ga0157377_103611752 | 101 |
| 340 | 3300014745 | Ga0157377_10450062 | Ga0157377_104500622 | 101 |
| 341 | 3300014745 | Ga0157377_10700719 | Ga0157377_107007192 | 101 |
| 342 | 3300014745 | Ga0157377_11146848 | Ga0157377_111468481 | 101 |
| 343 | 3300014968 | Ga0157379_10108237 | Ga0157379_101082373 | 101 |
| 344 | 3300014968 | Ga0157379_10160852 | Ga0157379_101608522 | 101 |
| 345 | 3300014968 | Ga0157379_10247422 | Ga0157379_102474223 | 101 |
| 346 | 3300014968 | Ga0157379_11470508 | Ga0157379_114705082 | 101 |
| 347 | 3300014968 | Ga0157379_11711181 | Ga0157379_117111812 | 101 |
| 348 | 3300014969 | Ga0157376_10870384 | Ga0157376_108703842 | 101 |
| 349 | 3300014969 | Ga0157376_10966747 | Ga0157376_109667472 | 101 |
| 350 | 3300014969 | Ga0157376_12715255 | Ga0157376_127152551 | 101 |
| 351 | 3300017792 | Ga0163161_10253589 | Ga0163161_102535892 | 101 |
| 352 | 3300017792 | Ga0163161_10256644 | Ga0163161_102566442 | 101 |
| 353 | 3300017792 | Ga0163161_10286463 | Ga0163161_102864633 | 101 |
| 354 | 3300017792 | Ga0163161_10392266 | Ga0163161_103922662 | 101 |
| 355 | 3300017792 | Ga0163161_10480261 | Ga0163161_104802612 | 101 |
| 356 | 3300025321 | Ga0207656_10473495 | Ga0207656_104734951 | 101 |
| 357 | 3300025885 | Ga0207653_10229605 | Ga0207653_102296052 | 101 |
| 358 | 3300025899 | Ga0207642_10067918 | Ga0207642_100679182 | 101 |
| 359 | 3300025899 | Ga0207642_10917455 | Ga0207642_109174551 | 101 |
| 360 | 3300025900 | Ga0207710_10334696 | Ga0207710_103346962 | 101 |
| 361 | 3300025901 | Ga0207688_10030278 | Ga0207688_100302782 | 101 |
| 362 | 3300025901 | Ga0207688_10163195 | Ga0207688_101631952 | 101 |
| 363 | 3300025903 | Ga0207680_10711008 | Ga0207680_107110082 | 101 |
| 364 | 3300025904 | Ga0207647_10101791 | Ga0207647_101017913 | 101 |
| 365 | 3300025907 | Ga0207645_10478937 | Ga0207645_104789372 | 101 |
| 366 | 3300025908 | Ga0207643_10016672 | Ga0207643_100166722 | 101 |
| 367 | 3300025908 | Ga0207643_10160866 | Ga0207643_101608662 | 101 |
| 368 | 3300025908 | Ga0207643_10593847 | Ga0207643_105938471 | 101 |
| 369 | 3300025908 | Ga0207643_10790053 | Ga0207643_107900531 | 101 |
| 370 | 3300025910 | Ga0207684_10158375 | Ga0207684_101583752 | 101 |
| 371 | 3300025912 | Ga0207707_10291079 | Ga0207707_102910792 | 101 |
| 372 | 3300025912 | Ga0207707_11018031 | Ga0207707_110180312 | 101 |
| 373 | 3300025912 | Ga0207707_11387696 | Ga0207707_113876961 | 101 |
| 374 | 3300025916 | Ga0207663_11641556 | Ga0207663_116415561 | 101 |
| 375 | 3300025917 | Ga0207660_10853859 | Ga0207660_108538592 | 101 |
| 376 | 3300025917 | Ga0207660_10872714 | Ga0207660_108727142 | 101 |
| 377 | 3300025918 | Ga0207662_10057431 | Ga0207662_100574312 | 101 |
| 378 | 3300025918 | Ga0207662_10579817 | Ga0207662_105798172 | 101 |
| 379 | 3300025919 | Ga0207657_10065544 | Ga0207657_100655442 | 101 |
| 380 | 3300025919 | Ga0207657_10317132 | Ga0207657_103171322 | 101 |
| 381 | 3300025920 | Ga0207649_10650077 | Ga0207649_106500772 | 101 |
| 382 | 3300025920 | Ga0207649_10716733 | Ga0207649_107167332 | 101 |
| 383 | 3300025920 | Ga0207649_11075407 | Ga0207649_110754072 | 101 |
| 384 | 3300025921 | Ga0207652_10107893 | Ga0207652_101078932 | 101 |
| 385 | 3300025921 | Ga0207652_10586935 | Ga0207652_105869353 | 101 |
| 386 | 3300025921 | Ga0207652_10616927 | Ga0207652_106169273 | 101 |
| 387 | 3300025921 | Ga0207652_11092722 | Ga0207652_110927221 | 101 |
| 388 | 3300025922 | Ga0207646_10146007 | Ga0207646_101460074 | 101 |
| 389 | 3300025922 | Ga0207646_10827774 | Ga0207646_108277742 | 101 |
| 390 | 3300025923 | Ga0207681_10550006 | Ga0207681_105500062 | 101 |
| 391 | 3300025923 | Ga0207681_10662404 | Ga0207681_106624042 | 101 |
| 392 | 3300025925 | Ga0207650_10408400 | Ga0207650_104084002 | 101 |
| 393 | 3300025925 | Ga0207650_10942020 | Ga0207650_109420202 | 101 |
| 394 | 3300025925 | Ga0207650_11392763 | Ga0207650_113927632 | 101 |
| 395 | 3300025926 | Ga0207659_10222120 | Ga0207659_102221202 | 101 |
| 396 | 3300025926 | Ga0207659_10480710 | Ga0207659_104807102 | 101 |
| 397 | 3300025926 | Ga0207659_10991786 | Ga0207659_109917861 | 101 |
| 398 | 3300025927 | Ga0207687_10180464 | Ga0207687_101804642 | 101 |
| 399 | 3300025927 | Ga0207687_10453847 | Ga0207687_104538472 | 101 |
| 400 | 3300025927 | Ga0207687_10475775 | Ga0207687_104757752 | 101 |
| 401 | 3300025927 | Ga0207687_10601319 | Ga0207687_106013192 | 101 |
| 402 | 3300025927 | Ga0207687_10651948 | Ga0207687_106519481 | 101 |
| 403 | 3300025927 | Ga0207687_10671264 | Ga0207687_106712642 | 101 |
| 404 | 3300025927 | Ga0207687_10943300 | Ga0207687_109433001 | 101 |
| 405 | 3300025931 | Ga0207644_11135708 | Ga0207644_111357081 | 101 |
| 406 | 3300025932 | Ga0207690_10807211 | Ga0207690_108072112 | 101 |
| 407 | 3300025932 | Ga0207690_11284731 | Ga0207690_112847312 | 101 |
| 408 | 3300025933 | Ga0207706_10072044 | Ga0207706_100720444 | 101 |
| 409 | 3300025933 | Ga0207706_10087943 | Ga0207706_100879434 | 101 |
| 410 | 3300025933 | Ga0207706_10270340 | Ga0207706_102703402 | 101 |
| 411 | 3300025933 | Ga0207706_10675569 | Ga0207706_106755691 | 101 |
| 412 | 3300025934 | Ga0207686_10319868 | Ga0207686_103198682 | 101 |
| 413 | 3300025934 | Ga0207686_10406670 | Ga0207686_104066702 | 101 |
| 414 | 3300025935 | Ga0207709_10137682 | Ga0207709_101376822 | 101 |
| 415 | 3300025935 | Ga0207709_10301932 | Ga0207709_103019322 | 101 |
| 416 | 3300025936 | Ga0207670_10082652 | Ga0207670_100826522 | 101 |
| 417 | 3300025936 | Ga0207670_10337047 | Ga0207670_103370471 | 101 |
| 418 | 3300025936 | Ga0207670_10908428 | Ga0207670_109084282 | 101 |
| 419 | 3300025937 | Ga0207669_10042488 | Ga0207669_100424883 | 101 |
| 420 | 3300025937 | Ga0207669_10410115 | Ga0207669_104101153 | 101 |
| 421 | 3300025938 | Ga0207704_10219443 | Ga0207704_102194432 | 101 |
| 422 | 3300025938 | Ga0207704_10275800 | Ga0207704_102758002 | 101 |
| 423 | 3300025940 | Ga0207691_10133269 | Ga0207691_101332692 | 101 |
| 424 | 3300025940 | Ga0207691_10428486 | Ga0207691_104284862 | 101 |
| 425 | 3300025941 | Ga0207711_10457175 | Ga0207711_104571752 | 101 |
| 426 | 3300025941 | Ga0207711_10559730 | Ga0207711_105597302 | 101 |
| 427 | 3300025942 | Ga0207689_10254215 | Ga0207689_102542153 | 101 |
| 428 | 3300025942 | Ga0207689_10363582 | Ga0207689_103635822 | 101 |
| 429 | 3300025944 | Ga0207661_11010135 | Ga0207661_110101352 | 101 |
| 430 | 3300025944 | Ga0207661_11159002 | Ga0207661_111590022 | 101 |
| 431 | 3300025945 | Ga0207679_10370591 | Ga0207679_103705913 | 101 |
| 432 | 3300025945 | Ga0207679_10421090 | Ga0207679_104210902 | 101 |
| 433 | 3300025945 | Ga0207679_10658102 | Ga0207679_106581022 | 101 |
| 434 | 3300025945 | Ga0207679_10714639 | Ga0207679_107146392 | 101 |
| 435 | 3300025949 | Ga0207667_11181810 | Ga0207667_111818102 | 101 |
| 436 | 3300025960 | Ga0207651_10385267 | Ga0207651_103852673 | 101 |
| 437 | 3300025960 | Ga0207651_10847430 | Ga0207651_108474302 | 101 |
| 438 | 3300025960 | Ga0207651_11874009 | Ga0207651_118740092 | 101 |
| 439 | 3300025961 | Ga0207712_10005919 | Ga0207712_100059197 | 101 |
| 440 | 3300025961 | Ga0207712_10372681 | Ga0207712_103726811 | 101 |
| 441 | 3300025961 | Ga0207712_10770950 | Ga0207712_107709502 | 101 |
| 442 | 3300025972 | Ga0207668_10019059 | Ga0207668_100190592 | 101 |
| 443 | 3300025972 | Ga0207668_10110474 | Ga0207668_101104742 | 101 |
| 444 | 3300025972 | Ga0207668_10388264 | Ga0207668_103882642 | 101 |
| 445 | 3300025972 | Ga0207668_10448158 | Ga0207668_104481582 | 101 |
| 446 | 3300025972 | Ga0207668_11625516 | Ga0207668_116255161 | 101 |
| 447 | 3300025981 | Ga0207640_10136496 | Ga0207640_101364962 | 101 |
| 448 | 3300025981 | Ga0207640_10230364 | Ga0207640_102303642 | 101 |
| 449 | 3300025981 | Ga0207640_10365465 | Ga0207640_103654652 | 101 |
| 450 | 3300025981 | Ga0207640_10520554 | Ga0207640_105205542 | 101 |
| 451 | 3300025981 | Ga0207640_10709653 | Ga0207640_107096532 | 101 |
| 452 | 3300025986 | Ga0207658_10317816 | Ga0207658_103178162 | 101 |
| 453 | 3300025986 | Ga0207658_10681225 | Ga0207658_106812252 | 101 |
| 454 | 3300026023 | Ga0207677_10196835 | Ga0207677_101968352 | 101 |
| 455 | 3300026023 | Ga0207677_10515685 | Ga0207677_105156851 | 101 |
| 456 | 3300026023 | Ga0207677_10628862 | Ga0207677_106288622 | 101 |
| 457 | 3300026023 | Ga0207677_10998501 | Ga0207677_109985012 | 101 |
| 458 | 3300026023 | Ga0207677_11052709 | Ga0207677_110527092 | 101 |
| 459 | 3300026023 | Ga0207677_11811243 | Ga0207677_118112432 | 101 |
| 460 | 3300026035 | Ga0207703_10180006 | Ga0207703_101800062 | 101 |
| 461 | 3300026035 | Ga0207703_10687286 | Ga0207703_106872862 | 101 |
| 462 | 3300026035 | Ga0207703_10863343 | Ga0207703_108633432 | 101 |
| 463 | 3300026041 | Ga0207639_10990714 | Ga0207639_109907142 | 101 |
| 464 | 3300026041 | Ga0207639_11103114 | Ga0207639_111031141 | 101 |
| 465 | 3300026067 | Ga0207678_10051746 | Ga0207678_100517462 | 101 |
| 466 | 3300026067 | Ga0207678_10190485 | Ga0207678_101904852 | 101 |
| 467 | 3300026067 | Ga0207678_11395090 | Ga0207678_113950901 | 101 |
| 468 | 3300026067 | Ga0207678_11524405 | Ga0207678_115244051 | 101 |
| 469 | 3300026067 | Ga0207678_11809148 | Ga0207678_118091481 | 101 |
| 470 | 3300026075 | Ga0207708_10046959 | Ga0207708_100469593 | 101 |
| 471 | 3300026075 | Ga0207708_10058239 | Ga0207708_100582392 | 101 |
| 472 | 3300026075 | Ga0207708_10077455 | Ga0207708_100774553 | 101 |
| 473 | 3300026075 | Ga0207708_10104167 | Ga0207708_101041672 | 101 |
| 474 | 3300026075 | Ga0207708_10267045 | Ga0207708_102670452 | 101 |
| 475 | 3300026075 | Ga0207708_10696059 | Ga0207708_106960592 | 101 |
| 476 | 3300026075 | Ga0207708_11415064 | Ga0207708_114150642 | 101 |
| 477 | 3300026078 | Ga0207702_10092653 | Ga0207702_100926532 | 101 |
| 478 | 3300026088 | Ga0207641_12292266 | Ga0207641_122922661 | 101 |
| 479 | 3300026089 | Ga0207648_10124183 | Ga0207648_101241831 | 101 |
| 480 | 3300026089 | Ga0207648_10187344 | Ga0207648_101873441 | 101 |
| 481 | 3300026089 | Ga0207648_11067686 | Ga0207648_110676861 | 101 |
| 482 | 3300026095 | Ga0207676_10280099 | Ga0207676_102800992 | 101 |
| 483 | 3300026095 | Ga0207676_10385037 | Ga0207676_103850373 | 101 |
| 484 | 3300026095 | Ga0207676_10942844 | Ga0207676_109428442 | 101 |
| 485 | 3300026095 | Ga0207676_11257492 | Ga0207676_112574922 | 101 |
| 486 | 3300026116 | Ga0207674_10013614 | Ga0207674_1001361410 | 101 |
| 487 | 3300026116 | Ga0207674_10399929 | Ga0207674_103999292 | 101 |
| 488 | 3300026118 | Ga0207675_100369599 | Ga0207675_1003695992 | 101 |
| 489 | 3300026118 | Ga0207675_100418325 | Ga0207675_1004183252 | 101 |
| 490 | 3300026118 | Ga0207675_100551977 | Ga0207675_1005519771 | 101 |
| 491 | 3300026118 | Ga0207675_100683476 | Ga0207675_1006834762 | 101 |
| 492 | 3300026118 | Ga0207675_100698522 | Ga0207675_1006985222 | 101 |
| 493 | 3300026118 | Ga0207675_100992121 | Ga0207675_1009921211 | 101 |
| 494 | 3300026121 | Ga0207683_10113879 | Ga0207683_101138792 | 101 |
| 495 | 3300026121 | Ga0207683_10185240 | Ga0207683_101852402 | 101 |
| 496 | 3300026121 | Ga0207683_10688342 | Ga0207683_106883421 | 101 |
| 497 | 3300026121 | Ga0207683_10837266 | Ga0207683_108372662 | 101 |
| 498 | 3300026121 | Ga0207683_11707821 | Ga0207683_117078211 | 101 |
| 499 | 3300026142 | Ga0207698_11145580 | Ga0207698_111455802 | 101 |
| 500 | 3300026142 | Ga0207698_11464131 | Ga0207698_114641312 | 101 |
| 501 | 3300027614 | Ga0209970_1097799 | Ga0209970_10977992 | 101 |
| 502 | 3300027682 | Ga0209971_1136023 | Ga0209971_11360232 | 101 |
| 503 | 3300027876 | Ga0209974_10139179 | Ga0209974_101391792 | 101 |
| 504 | 3300027907 | Ga0207428_10238070 | Ga0207428_102380701 | 101 |
| 505 | 3300028380 | Ga0268265_10128199 | Ga0268265_101281994 | 101 |
| 506 | 3300028380 | Ga0268265_10134270 | Ga0268265_101342704 | 101 |
| 507 | 3300028380 | Ga0268265_11705333 | Ga0268265_117053331 | 101 |
| 508 | 3300028381 | Ga0268264_11474183 | Ga0268264_114741831 | 101 |
| 509 | 3300028381 | Ga0268264_11935325 | Ga0268264_119353252 | 101 |
| 510 | 3300028556 | Ga0265337_1025186 | Ga0265337_10251864 | 101 |
| 511 | 3300028563 | Ga0265319_1090269 | Ga0265319_10902692 | 101 |
| 512 | 3300028563 | Ga0265319_1118035 | Ga0265319_11180352 | 101 |
| 513 | 3300028573 | Ga0265334_10017086 | Ga0265334_100170864 | 101 |
| 514 | 3300028573 | Ga0265334_10066481 | Ga0265334_100664812 | 101 |
| 515 | 3300028573 | Ga0265334_10233234 | Ga0265334_102332342 | 101 |
| 516 | 3300028577 | Ga0265318_10027403 | Ga0265318_100274034 | 101 |
| 517 | 3300028577 | Ga0265318_10032808 | Ga0265318_100328082 | 101 |
| 518 | 3300028577 | Ga0265318_10065308 | Ga0265318_100653082 | 101 |
| 519 | 3300028577 | Ga0265318_10205186 | Ga0265318_102051862 | 101 |
| 520 | 3300028653 | Ga0265323_10100835 | Ga0265323_101008352 | 101 |
| 521 | 3300028653 | Ga0265323_10158006 | Ga0265323_101580062 | 101 |
| 522 | 3300028654 | Ga0265322_10023037 | Ga0265322_100230372 | 101 |
| 523 | 3300028654 | Ga0265322_10066830 | Ga0265322_100668302 | 101 |
| 524 | 3300028654 | Ga0265322_10138898 | Ga0265322_101388982 | 101 |
| 525 | 3300028666 | Ga0265336_10021334 | Ga0265336_100213341 | 101 |
| 526 | 3300028666 | Ga0265336_10115861 | Ga0265336_101158611 | 101 |
| 527 | 3300028800 | Ga0265338_10063875 | Ga0265338_100638754 | 101 |
| 528 | 3300028800 | Ga0265338_10210218 | Ga0265338_102102182 | 101 |
| 529 | 3300028800 | Ga0265338_10832125 | Ga0265338_108321252 | 101 |
| 530 | 3300028800 | Ga0265338_11233506 | Ga0265338_112335061 | 101 |
| 531 | 3300029957 | Ga0265324_10006906 | Ga0265324_100069064 | 101 |
| 532 | 3300031235 | Ga0265330_10022220 | Ga0265330_100222203 | 101 |
| 533 | 3300031235 | Ga0265330_10023113 | Ga0265330_100231132 | 101 |
| 534 | 3300031235 | Ga0265330_10033335 | Ga0265330_100333352 | 101 |
| 535 | 3300031235 | Ga0265330_10043710 | Ga0265330_100437102 | 101 |
| 536 | 3300031235 | Ga0265330_10201803 | Ga0265330_102018032 | 101 |
| 537 | 3300031235 | Ga0265330_10299656 | Ga0265330_102996562 | 101 |
| 538 | 3300031235 | Ga0265330_10369136 | Ga0265330_103691362 | 101 |
| 539 | 3300031238 | Ga0265332_10018915 | Ga0265332_100189152 | 101 |
| 540 | 3300031239 | Ga0265328_10051663 | Ga0265328_100516632 | 101 |
| 541 | 3300031239 | Ga0265328_10110104 | Ga0265328_101101042 | 101 |
| 542 | 3300031240 | Ga0265320_10008973 | Ga0265320_100089733 | 101 |
| 543 | 3300031240 | Ga0265320_10153210 | Ga0265320_101532102 | 101 |
| 544 | 3300031240 | Ga0265320_10166058 | Ga0265320_101660582 | 101 |
| 545 | 3300031240 | Ga0265320_10286496 | Ga0265320_102864962 | 101 |
| 546 | 3300031240 | Ga0265320_10431330 | Ga0265320_104313302 | 101 |
| 547 | 3300031241 | Ga0265325_10024484 | Ga0265325_100244842 | 101 |
| 548 | 3300031241 | Ga0265325_10065109 | Ga0265325_100651092 | 101 |
| 549 | 3300031241 | Ga0265325_10079666 | Ga0265325_100796662 | 101 |
| 550 | 3300031241 | Ga0265325_10082224 | Ga0265325_100822242 | 101 |
| 551 | 3300031241 | Ga0265325_10155077 | Ga0265325_101550772 | 101 |
| 552 | 3300031242 | Ga0265329_10001690 | Ga0265329_1000169013 | 101 |
| 553 | 3300031242 | Ga0265329_10040372 | Ga0265329_100403723 | 101 |
| 554 | 3300031242 | Ga0265329_10049764 | Ga0265329_100497643 | 101 |
| 555 | 3300031247 | Ga0265340_10002587 | Ga0265340_100025876 | 101 |
| 556 | 3300031247 | Ga0265340_10006154 | Ga0265340_100061548 | 101 |
| 557 | 3300031247 | Ga0265340_10010584 | Ga0265340_100105845 | 101 |
| 558 | 3300031247 | Ga0265340_10014489 | Ga0265340_100144892 | 101 |
| 559 | 3300031247 | Ga0265340_10023721 | Ga0265340_100237213 | 101 |
| 560 | 3300031247 | Ga0265340_10117125 | Ga0265340_101171252 | 101 |
| 561 | 3300031249 | Ga0265339_10028210 | Ga0265339_100282102 | 101 |
| 562 | 3300031249 | Ga0265339_10090867 | Ga0265339_100908672 | 101 |
| 563 | 3300031249 | Ga0265339_10138978 | Ga0265339_101389782 | 101 |
| 564 | 3300031249 | Ga0265339_10173500 | Ga0265339_101735002 | 101 |
| 565 | 3300031249 | Ga0265339_10198339 | Ga0265339_101983392 | 101 |
| 566 | 3300031250 | Ga0265331_10017780 | Ga0265331_100177802 | 101 |
| 567 | 3300031250 | Ga0265331_10352040 | Ga0265331_103520402 | 101 |
| 568 | 3300031344 | Ga0265316_10012137 | Ga0265316_100121375 | 101 |
| 569 | 3300031344 | Ga0265316_10029418 | Ga0265316_100294186 | 101 |
| 570 | 3300031344 | Ga0265316_10043169 | Ga0265316_100431691 | 101 |
| 571 | 3300031344 | Ga0265316_10084578 | Ga0265316_100845782 | 101 |
| 572 | 3300031344 | Ga0265316_10332295 | Ga0265316_103322952 | 101 |
| 573 | 3300031344 | Ga0265316_10349136 | Ga0265316_103491362 | 101 |
| 574 | 3300031548 | Ga0307408_100077221 | Ga0307408_1000772214 | 101 |
| 575 | 3300031595 | Ga0265313_10005225 | Ga0265313_100052254 | 101 |
| 576 | 3300031595 | Ga0265313_10075370 | Ga0265313_100753702 | 101 |
| 577 | 3300031595 | Ga0265313_10115404 | Ga0265313_101154042 | 101 |
| 578 | 3300031595 | Ga0265313_10204676 | Ga0265313_102046762 | 101 |
| 579 | 3300031595 | Ga0265313_10261075 | Ga0265313_102610752 | 101 |
| 580 | 3300031711 | Ga0265314_10002544 | Ga0265314_100025444 | 101 |
| 581 | 3300031711 | Ga0265314_10003068 | Ga0265314_100030686 | 101 |
| 582 | 3300031711 | Ga0265314_10148599 | Ga0265314_101485992 | 101 |
| 583 | 3300031711 | Ga0265314_10193558 | Ga0265314_101935582 | 101 |
| 584 | 3300031711 | Ga0265314_10631335 | Ga0265314_106313351 | 101 |
| 585 | 3300031712 | Ga0265342_10006227 | Ga0265342_1000622710 | 101 |
| 586 | 3300031712 | Ga0265342_10021592 | Ga0265342_100215922 | 101 |
| 587 | 3300031712 | Ga0265342_10057470 | Ga0265342_100574704 | 101 |
| 588 | 3300031712 | Ga0265342_10284736 | Ga0265342_102847361 | 101 |
| 589 | 3300031712 | Ga0265342_10576802 | Ga0265342_105768022 | 101 |
| 590 | 3300031731 | Ga0307405_10336232 | Ga0307405_103362322 | 101 |
| 591 | 3300031824 | Ga0307413_10961791 | Ga0307413_109617912 | 101 |
| 592 | 3300031852 | Ga0307410_10477906 | Ga0307410_104779062 | 101 |
| 593 | 3300031903 | Ga0307407_10376319 | Ga0307407_103763192 | 101 |
| 594 | 3300031903 | Ga0307407_10595052 | Ga0307407_105950522 | 101 |
| 595 | 3300031995 | Ga0307409_100139853 | Ga0307409_1001398532 | 101 |
| 596 | 3300031995 | Ga0307409_100199728 | Ga0307409_1001997282 | 101 |
| 597 | 3300032002 | Ga0307416_100001176 | Ga0307416_10000117615 | 101 |
| 598 | 3300032002 | Ga0307416_100660880 | Ga0307416_1006608802 | 101 |
| 599 | 3300032002 | Ga0307416_101852880 | Ga0307416_1018528802 | 101 |
| 600 | 3300032002 | Ga0307416_102954160 | Ga0307416_1029541602 | 101 |
| 601 | 3300032005 | Ga0307411_10363239 | Ga0307411_103632392 | 101 |
| 602 | 3300032126 | Ga0307415_100526118 | Ga0307415_1005261182 | 101 |
| 603 | 3300032126 | Ga0307415_101773278 | Ga0307415_1017732781 | 101 |
| 604 | 3300034820 | Ga0373959_0065518 | Ga0373959_0065518_349_654 | 101 |
| 605 | 3300034820 | Ga0373959_0101059 | Ga0373959_0101059_358_663 | 101 |
| 606 | 3300035084 | Ga0373928_0092712 | Ga0373928_0092712_85_390 | 101 |
| 607 | 3300035085 | Ga0373929_0104037 | Ga0373929_0104037_97_402 | 101 |
| 608 | 3300035112 | Ga0373932_0244480 | Ga0373932_0244480_334_642 | 101 |
| 609 | 3300035115 | Ga0373941_0257761 | Ga0373941_0257761_26_331 | 101 |
| 610 | 3300035121 | Ga0373960_0215663 | Ga0373960_0215663_97_402 | 101 |
| 611 | 3300035172 | Ga0373955_0214708 | Ga0373955_0214708_668_973 | 101 |
| 612 | 3300035207 | Ga0373942_0096437 | Ga0373942_0096437_50_355 | 101 |
| 613 | 3300035242 | Ga0373962_0033326 | Ga0373962_0033326_1071_1376 | 101 |
| 614 | 3300035242 | Ga0373962_0108938 | Ga0373962_0108938_25_330 | 101 |
| 615 | 3300035725 | Ga0373947_0611394 | Ga0373947_0611394_227_532 | 101 |
| 616 | 3300037312 | Ga0395899_0549168 | Ga0395899_0549168_356_661 | 101 |
| 617 | 3300037418 | Ga0395900_0439904 | Ga0395900_0439904_154_459 | 101 |
| 618 | 3300037418 | Ga0395900_0501778 | Ga0395900_0501778_724_1029 | 101 |
| 619 | 3300037471 | Ga0395905_0858116 | Ga0395905_0858116_496_801 | 101 |
| 620 | 3300038443 | Ga0395901_0280227 | Ga0395901_0280227_27_332 | 101 |
| 621 | 3300038443 | Ga0395901_2021374 | Ga0395901_2021374_74_379 | 101 |
| 622 | 3300039437 | Ga0436365_1485382 | Ga0436365_1485382_587_892 | 101 |
| 623 | 3300041441 | Ga0451787_536941 | Ga0451787_536941_109_435 | 101 |
| 624 | 3300041441 | Ga0451787_675165 | Ga0451787_675165_48_353 | 101 |
| 625 | 3300041451 | Ga0451791_1458017 | Ga0451791_1458017_121_426 | 101 |
| 626 | 3300041452 | Ga0451793_1125082 | Ga0451793_1125082_128_436 | 101 |
| 627 | 3300041456 | Ga0451795_1460265 | Ga0451795_1460265_167_475 | 101 |
| 628 | 3300041456 | Ga0451795_1537678 | Ga0451795_1537678_352_678 | 101 |
| 629 | 3300041460 | Ga0451802_0894001 | Ga0451802_0894001_100_405 | 101 |
| 630 | 3300041501 | Ga0451845_0263999 | Ga0451845_0263999_301_609 | 101 |
| 631 | 3300041509 | Ga0451843_0151156 | Ga0451843_0151156_255_560 | 101 |
| 632 | 3300041511 | Ga0451855_1451656 | Ga0451855_1451656_34_339 | 101 |
| 633 | 3300041512 | Ga0451853_0129182 | Ga0451853_0129182_29_334 | 101 |
| 634 | 3300041512 | Ga0451853_0135129 | Ga0451853_0135129_18_392 | 101 |
| 635 | 3300041512 | Ga0451853_0628733 | Ga0451853_0628733_136_441 | 101 |
| 636 | 3300041512 | Ga0451853_1064254 | Ga0451853_1064254_850_1158 | 101 |
| 637 | 3300041512 | Ga0451853_2873151 | Ga0451853_2873151_487_792 | 101 |
| 638 | 3300042118 | Ga0450914_007210 | Ga0450914_007210_369_674 | 101 |
| 639 | 3300042436 | Ga0439435_0254332 | Ga0439435_0254332_12_317 | 101 |
| 640 | 3300042530 | Ga0450916_065330 | Ga0450916_065330_73_378 | 101 |
| 641 | 3300042530 | Ga0450916_097568 | Ga0450916_097568_101_406 | 101 |
| 642 | 3300044673 | Ga0453683_0792285 | Ga0453683_0792285_286_594 | 101 |
| 643 | 3300044706 | Ga0466964_0452518 | Ga0466964_0452518_147_452 | 101 |
| 644 | 3300046454 | Ga0495592_0602507 | Ga0495592_0602507_82_390 | 101 |
| 645 | 3300046454 | Ga0495592_0639995 | Ga0495592_0639995_285_590 | 101 |
| 646 | 3300046454 | Ga0495592_0740542 | Ga0495592_0740542_254_559 | 101 |
| 647 | 3300046459 | Ga0495629_0239440 | Ga0495629_0239440_822_1127 | 101 |
| 648 | 3300046459 | Ga0495629_0267819 | Ga0495629_0267819_675_980 | 101 |
| 649 | 3300046461 | Ga0495641_0548427 | Ga0495641_0548427_23_328 | 101 |
| 650 | 3300046473 | Ga0495582_0254788 | Ga0495582_0254788_414_719 | 101 |
| 651 | 3300046511 | Ga0495608_0310088 | Ga0495608_0310088_455_763 | 101 |
| 652 | 3300046516 | Ga0495628_0285421 | Ga0495628_0285421_655_960 | 101 |
| 653 | 3300046517 | Ga0495630_0298151 | Ga0495630_0298151_713_1021 | 101 |
| 654 | 3300046523 | Ga0495644_0273886 | Ga0495644_0273886_42_347 | 101 |
| 655 | 3300046529 | Ga0495652_0538504 | Ga0495652_0538504_439_744 | 101 |
| 656 | 3300046531 | Ga0495665_0550653 | Ga0495665_0550653_245_550 | 101 |
| 657 | 3300046533 | Ga0495640_0287391 | Ga0495640_0287391_584_889 | 101 |
| 658 | 3300046559 | Ga0495667_0115528 | Ga0495667_0115528_620_925 | 101 |
| 659 | 3300046615 | Ga0495656_0689355 | Ga0495656_0689355_193_498 | 101 |
| 660 | 3300046663 | Ga0495635_0062887 | Ga0495635_0062887_1396_1701 | 101 |
| 661 | 3300046663 | Ga0495635_0599985 | Ga0495635_0599985_221_529 | 101 |
| 662 | 3300046675 | Ga0495657_0330408 | Ga0495657_0330408_364_669 | 101 |
| 663 | 3300046680 | Ga0495646_0345956 | Ga0495646_0345956_116_421 | 101 |
| 664 | 3300046689 | Ga0495613_0582585 | Ga0495613_0582585_67_372 | 101 |
| 665 | 3300046690 | Ga0495624_0900012 | Ga0495624_0900012_122_427 | 101 |
| 666 | 3300046694 | Ga0495649_0622869 | Ga0495649_0622869_207_512 | 101 |
| 667 | 3300046794 | Ga0495589_0539536 | Ga0495589_0539536_145_450 | 101 |
| 668 | 3300046809 | Ga0495600_0197212 | Ga0495600_0197212_255_560 | 101 |
| 669 | 3300047319 | Ga0495674_0168247 | Ga0495674_0168247_594_899 | 101 |
| 670 | 3300047319 | Ga0495674_0443014 | Ga0495674_0443014_56_361 | 101 |
| 671 | 3300047321 | Ga0495676_0398141 | Ga0495676_0398141_38_343 | 101 |
| 672 | 3300047444 | Ga0495675_0268724 | Ga0495675_0268724_511_816 | 101 |
| 673 | 3300048088 | Ga0495602_0218185 | Ga0495602_0218185_107_412 | 101 |
| 674 | 3300048903 | Ga0496100_0056711 | Ga0496100_0056711_1087_1392 | 101 |
| 675 | 3300048903 | Ga0496100_0069716 | Ga0496100_0069716_1487_1792 | 101 |
| 676 | 3300048903 | Ga0496100_1436052 | Ga0496100_1436052_57_362 | 101 |
| 677 | 3300048904 | Ga0496101_0034194 | Ga0496101_0034194_1633_1938 | 101 |
| 678 | 3300048904 | Ga0496101_0179285 | Ga0496101_0179285_473_778 | 101 |
| 679 | 3300048904 | Ga0496101_0373325 | Ga0496101_0373325_478_807 | 101 |
| 680 | 3300048904 | Ga0496101_1486336 | Ga0496101_1486336_194_499 | 101 |
| 681 | 3300048905 | Ga0496102_0032069 | Ga0496102_0032069_2996_3301 | 101 |
| 682 | 3300048905 | Ga0496102_0043371 | Ga0496102_0043371_786_1091 | 101 |
| 683 | 3300048905 | Ga0496102_0409977 | Ga0496102_0409977_642_947 | 101 |
| 684 | 3300048905 | Ga0496102_0468672 | Ga0496102_0468672_812_1117 | 101 |
| 685 | 3300048905 | Ga0496102_0501699 | Ga0496102_0501699_37_342 | 101 |
| 686 | 3300048905 | Ga0496102_0732835 | Ga0496102_0732835_254_559 | 101 |
| 687 | 3300048906 | Ga0496103_0013350 | Ga0496103_0013350_1522_1827 | 101 |
| 688 | 3300048906 | Ga0496103_0334638 | Ga0496103_0334638_512_817 | 101 |
| 689 | 3300048907 | Ga0496104_0051704 | Ga0496104_0051704_908_1213 | 101 |
| 690 | 3300048907 | Ga0496104_0055493 | Ga0496104_0055493_1487_1792 | 101 |
| 691 | 3300048907 | Ga0496104_0114696 | Ga0496104_0114696_1745_2050 | 101 |
| 692 | 3300048907 | Ga0496104_0633328 | Ga0496104_0633328_89_394 | 101 |
| 693 | 3300048908 | Ga0496105_0024902 | Ga0496105_0024902_3626_3931 | 101 |
| 694 | 3300048908 | Ga0496105_0042189 | Ga0496105_0042189_1969_2274 | 101 |
| 695 | 3300048908 | Ga0496105_0087184 | Ga0496105_0087184_583_888 | 101 |
| 696 | 3300048908 | Ga0496105_0935733 | Ga0496105_0935733_80_385 | 101 |
| 697 | 3300048909 | Ga0496106_0106710 | Ga0496106_0106710_833_1138 | 101 |
| 698 | 3300048909 | Ga0496106_1119348 | Ga0496106_1119348_126_431 | 101 |
| 699 | 3300048910 | Ga0496107_0013738 | Ga0496107_0013738_4440_4745 | 101 |
| 700 | 3300048910 | Ga0496107_0122265 | Ga0496107_0122265_839_1144 | 101 |
| 701 | 3300048911 | Ga0496108_0030378 | Ga0496108_0030378_2716_3021 | 101 |
| 702 | 3300048911 | Ga0496108_0131695 | Ga0496108_0131695_1421_1726 | 101 |
| 703 | 3300048911 | Ga0496108_0151149 | Ga0496108_0151149_1466_1771 | 101 |
| 704 | 3300048911 | Ga0496108_0177973 | Ga0496108_0177973_77_382 | 101 |
| 705 | 3300048911 | Ga0496108_0186787 | Ga0496108_0186787_951_1256 | 101 |
| 706 | 3300048911 | Ga0496108_0347605 | Ga0496108_0347605_557_862 | 101 |
| 707 | 3300048911 | Ga0496108_1020252 | Ga0496108_1020252_40_345 | 101 |
| 708 | 3300048911 | Ga0496108_1034371 | Ga0496108_1034371_374_679 | 101 |
| 709 | 3300048912 | Ga0496109_0010978 | Ga0496109_0010978_5967_6272 | 101 |
| 710 | 3300048912 | Ga0496109_0017529 | Ga0496109_0017529_852_1157 | 101 |
| 711 | 3300048912 | Ga0496109_0065641 | Ga0496109_0065641_2875_3180 | 101 |
| 712 | 3300048912 | Ga0496109_0159649 | Ga0496109_0159649_339_644 | 101 |
| 713 | 3300048912 | Ga0496109_0259973 | Ga0496109_0259973_963_1268 | 101 |
| 714 | 3300048912 | Ga0496109_0452944 | Ga0496109_0452944_521_826 | 101 |
| 715 | 3300048912 | Ga0496109_0533530 | Ga0496109_0533530_543_848 | 101 |
| 716 | 3300048912 | Ga0496109_1715426 | Ga0496109_1715426_172_477 | 101 |
| 717 | 3300048913 | Ga0496110_0082377 | Ga0496110_0082377_1459_1764 | 101 |
| 718 | 3300048913 | Ga0496110_0271345 | Ga0496110_0271345_794_1099 | 101 |
| 719 | 3300048913 | Ga0496110_0578631 | Ga0496110_0578631_507_812 | 101 |
| 720 | 3300048913 | Ga0496110_0698738 | Ga0496110_0698738_49_354 | 101 |
| 721 | 3300048913 | Ga0496110_0898695 | Ga0496110_0898695_455_760 | 101 |
| 722 | 3300048914 | Ga0496111_0033463 | Ga0496111_0033463_2102_2407 | 101 |
| 723 | 3300048914 | Ga0496111_0042138 | Ga0496111_0042138_2280_2585 | 101 |
| 724 | 3300048914 | Ga0496111_0121012 | Ga0496111_0121012_700_1005 | 101 |
| 725 | 3300048914 | Ga0496111_0121707 | Ga0496111_0121707_1338_1643 | 101 |
| 726 | 3300048914 | Ga0496111_1241302 | Ga0496111_1241302_159_473 | 101 |
| 727 | 3300048915 | Ga0496112_0005684 | Ga0496112_0005684_1491_1796 | 101 |
| 728 | 3300048915 | Ga0496112_0077810 | Ga0496112_0077810_936_1241 | 101 |
| 729 | 3300048915 | Ga0496112_0293295 | Ga0496112_0293295_886_1191 | 101 |
| 730 | 3300048915 | Ga0496112_0649386 | Ga0496112_0649386_282_587 | 101 |
| 731 | 3300048916 | Ga0496113_0005866 | Ga0496113_0005866_5821_6126 | 101 |
| 732 | 3300048916 | Ga0496113_0028649 | Ga0496113_0028649_2424_2729 | 101 |
| 733 | 3300048916 | Ga0496113_0044627 | Ga0496113_0044627_2148_2453 | 101 |
| 734 | 3300048916 | Ga0496113_0862372 | Ga0496113_0862372_109_414 | 101 |
| 735 | 3300048917 | Ga0496114_0059876 | Ga0496114_0059876_1364_1669 | 101 |
| 736 | 3300048917 | Ga0496114_0267931 | Ga0496114_0267931_236_544 | 101 |
| 737 | 3300048917 | Ga0496114_0435160 | Ga0496114_0435160_777_1082 | 101 |
| 738 | 3300048917 | Ga0496114_0666000 | Ga0496114_0666000_23_328 | 101 |
| 739 | 3300049568 | Ga0501031_0268022 | Ga0501031_0268022_652_957 | 101 |
| 740 | 3300049568 | Ga0501031_0307862 | Ga0501031_0307862_631_936 | 101 |
| 741 | 3300049568 | Ga0501031_0648614 | Ga0501031_0648614_231_536 | 101 |
| 742 | 3300049569 | Ga0501032_0106114 | Ga0501032_0106114_118_423 | 101 |
| 743 | 3300049569 | Ga0501032_0161355 | Ga0501032_0161355_189_494 | 101 |
| 744 | 3300049569 | Ga0501032_0230613 | Ga0501032_0230613_720_1070 | 101 |
| 745 | 3300049570 | Ga0501033_0062904 | Ga0501033_0062904_2108_2413 | 101 |
| 746 | 3300049570 | Ga0501033_0272021 | Ga0501033_0272021_38_343 | 101 |
| 747 | 3300049571 | Ga0501034_0040812 | Ga0501034_0040812_1034_1363 | 101 |
| 748 | 3300049571 | Ga0501034_0047013 | Ga0501034_0047013_2953_3282 | 101 |
| 749 | 3300049571 | Ga0501034_0355819 | Ga0501034_0355819_613_942 | 101 |
| 750 | 3300049571 | Ga0501034_0431231 | Ga0501034_0431231_323_652 | 101 |
| 751 | 3300049571 | Ga0501034_0486794 | Ga0501034_0486794_123_452 | 101 |
| 752 | 3300049572 | Ga0501036_0060546 | Ga0501036_0060546_894_1199 | 101 |
| 753 | 3300049572 | Ga0501036_0100063 | Ga0501036_0100063_1882_2187 | 101 |
| 754 | 3300049572 | Ga0501036_0257087 | Ga0501036_0257087_495_800 | 101 |
| 755 | 3300049572 | Ga0501036_0614827 | Ga0501036_0614827_461_790 | 101 |
| 756 | 3300049572 | Ga0501036_0648452 | Ga0501036_0648452_109_414 | 101 |
| 757 | 3300049572 | Ga0501036_0834258 | Ga0501036_0834258_387_716 | 101 |
| 758 | 3300049572 | Ga0501036_1153026 | Ga0501036_1153026_250_555 | 101 |
| 759 | 3300049572 | Ga0501036_1166351 | Ga0501036_1166351_182_487 | 101 |
| 760 | 3300049573 | Ga0501037_0020704 | Ga0501037_0020704_929_1234 | 101 |
| 761 | 3300049573 | Ga0501037_0140868 | Ga0501037_0140868_622_951 | 101 |
| 762 | 3300049574 | Ga0501038_0061833 | Ga0501038_0061833_1998_2303 | 101 |
| 763 | 3300049574 | Ga0501038_0062771 | Ga0501038_0062771_857_1162 | 101 |
| 764 | 3300049574 | Ga0501038_0146108 | Ga0501038_0146108_1103_1432 | 101 |
| 765 | 3300049575 | Ga0501039_0138032 | Ga0501039_0138032_1007_1312 | 101 |
| 766 | 3300049575 | Ga0501039_0140834 | Ga0501039_0140834_531_836 | 101 |
| 767 | 3300049575 | Ga0501039_0316464 | Ga0501039_0316464_166_471 | 101 |
| 768 | 3300049575 | Ga0501039_0336837 | Ga0501039_0336837_401_706 | 101 |
| 769 | 3300049575 | Ga0501039_0942507 | Ga0501039_0942507_284_589 | 101 |
| 770 | 3300049575 | Ga0501039_1028387 | Ga0501039_1028387_203_532 | 101 |
| 771 | 3300049575 | Ga0501039_1251568 | Ga0501039_1251568_91_396 | 101 |
| 772 | 3300049575 | Ga0501039_1385548 | Ga0501039_1385548_183_488 | 101 |
| 773 | 3300049576 | Ga0501040_0047201 | Ga0501040_0047201_895_1200 | 101 |
| 774 | 3300049576 | Ga0501040_0114793 | Ga0501040_0114793_1090_1395 | 101 |
| 775 | 3300049576 | Ga0501040_0144779 | Ga0501040_0144779_890_1195 | 101 |
| 776 | 3300049576 | Ga0501040_0145655 | Ga0501040_0145655_50_355 | 101 |
| 777 | 3300049576 | Ga0501040_0174879 | Ga0501040_0174879_911_1261 | 101 |
| 778 | 3300049576 | Ga0501040_0200908 | Ga0501040_0200908_995_1300 | 101 |
| 779 | 3300049576 | Ga0501040_0955697 | Ga0501040_0955697_109_414 | 101 |
| 780 | 3300049576 | Ga0501040_1354537 | Ga0501040_1354537_130_435 | 101 |
| 781 | 3300049577 | Ga0501041_0069522 | Ga0501041_0069522_840_1145 | 101 |
| 782 | 3300049577 | Ga0501041_0072115 | Ga0501041_0072115_378_683 | 101 |
| 783 | 3300049577 | Ga0501041_0132209 | Ga0501041_0132209_1148_1498 | 101 |
| 784 | 3300049577 | Ga0501041_0139093 | Ga0501041_0139093_689_994 | 101 |
| 785 | 3300049577 | Ga0501041_0269611 | Ga0501041_0269611_593_898 | 101 |
| 786 | 3300049577 | Ga0501041_0315809 | Ga0501041_0315809_376_681 | 101 |
| 787 | 3300049577 | Ga0501041_1102922 | Ga0501041_1102922_180_485 | 101 |
| 788 | 3300049578 | Ga0501042_0113953 | Ga0501042_0113953_813_1118 | 101 |
| 789 | 3300049578 | Ga0501042_0268597 | Ga0501042_0268597_631_936 | 101 |
| 790 | 3300049578 | Ga0501042_0310767 | Ga0501042_0310767_632_937 | 101 |
| 791 | 3300049578 | Ga0501042_0497542 | Ga0501042_0497542_327_632 | 101 |
| 792 | 3300049578 | Ga0501042_0561783 | Ga0501042_0561783_191_496 | 101 |
| 793 | 3300049579 | Ga0501043_0113573 | Ga0501043_0113573_292_597 | 101 |
| 794 | 3300049579 | Ga0501043_0238624 | Ga0501043_0238624_296_601 | 101 |
| 795 | 3300049579 | Ga0501043_0467893 | Ga0501043_0467893_544_873 | 101 |
| 796 | 3300049580 | Ga0501046_0059012 | Ga0501046_0059012_1467_1772 | 101 |
| 797 | 3300049580 | Ga0501046_0150713 | Ga0501046_0150713_593_898 | 101 |
| 798 | 3300049580 | Ga0501046_0359267 | Ga0501046_0359267_669_974 | 101 |
| 799 | 3300049580 | Ga0501046_0891885 | Ga0501046_0891885_155_460 | 101 |
| 800 | 3300049581 | Ga0501047_0316576 | Ga0501047_0316576_63_392 | 101 |
| 801 | 3300049581 | Ga0501047_0366805 | Ga0501047_0366805_612_941 | 101 |
| 802 | 3300049581 | Ga0501047_0780030 | Ga0501047_0780030_383_712 | 101 |
| 803 | 3300049581 | Ga0501047_0853041 | Ga0501047_0853041_87_392 | 101 |
| 804 | 3300049582 | Ga0501048_0052300 | Ga0501048_0052300_717_1022 | 101 |
| 805 | 3300049582 | Ga0501048_0227205 | Ga0501048_0227205_728_1033 | 101 |
| 806 | 3300049582 | Ga0501048_0524534 | Ga0501048_0524534_240_545 | 101 |
| 807 | 3300049582 | Ga0501048_0566304 | Ga0501048_0566304_77_382 | 101 |
| 808 | 3300049583 | Ga0501067_0010872 | Ga0501067_0010872_3953_4282 | 101 |
| 809 | 3300049583 | Ga0501067_0037432 | Ga0501067_0037432_1871_2200 | 101 |
| 810 | 3300049583 | Ga0501067_0527570 | Ga0501067_0527570_255_563 | 101 |
| 811 | 3300049583 | Ga0501067_0663561 | Ga0501067_0663561_111_416 | 101 |
| 812 | 3300049584 | Ga0501068_0154001 | Ga0501068_0154001_886_1191 | 101 |
| 813 | 3300049584 | Ga0501068_0156275 | Ga0501068_0156275_479_784 | 101 |
| 814 | 3300049584 | Ga0501068_0283646 | Ga0501068_0283646_638_943 | 101 |
| 815 | 3300049584 | Ga0501068_0898305 | Ga0501068_0898305_254_559 | 101 |
| 816 | 3300049585 | Ga0501069_0953147 | Ga0501069_0953147_142_471 | 101 |
| 817 | 3300049586 | Ga0501070_0229143 | Ga0501070_0229143_1153_1482 | 101 |
| 818 | 3300049586 | Ga0501070_0377057 | Ga0501070_0377057_703_1008 | 101 |
| 819 | 3300049586 | Ga0501070_0443328 | Ga0501070_0443328_10_339 | 101 |
| 820 | 3300049586 | Ga0501070_0538470 | Ga0501070_0538470_145_450 | 101 |
| 821 | 3300049586 | Ga0501070_0756025 | Ga0501070_0756025_128_457 | 101 |
| 822 | 3300049587 | Ga0501071_0043355 | Ga0501071_0043355_2441_2746 | 101 |
| 823 | 3300049587 | Ga0501071_0107484 | Ga0501071_0107484_1729_2034 | 101 |
| 824 | 3300049587 | Ga0501071_0127701 | Ga0501071_0127701_1520_1825 | 101 |
| 825 | 3300049587 | Ga0501071_0186980 | Ga0501071_0186980_533_838 | 101 |
| 826 | 3300049587 | Ga0501071_0878668 | Ga0501071_0878668_104_454 | 101 |
| 827 | 3300049588 | Ga0501072_0078801 | Ga0501072_0078801_1337_1642 | 101 |
| 828 | 3300049588 | Ga0501072_0088411 | Ga0501072_0088411_1546_1851 | 101 |
| 829 | 3300049588 | Ga0501072_0104740 | Ga0501072_0104740_806_1156 | 101 |
| 830 | 3300049588 | Ga0501072_0116622 | Ga0501072_0116622_1278_1583 | 101 |
| 831 | 3300049588 | Ga0501072_0134891 | Ga0501072_0134891_1347_1652 | 101 |
| 832 | 3300049588 | Ga0501072_0136409 | Ga0501072_0136409_120_425 | 101 |
| 833 | 3300049588 | Ga0501072_1086916 | Ga0501072_1086916_289_594 | 101 |
| 834 | 3300049589 | Ga0501073_0174531 | Ga0501073_0174531_194_523 | 101 |
| 835 | 3300049589 | Ga0501073_0194478 | Ga0501073_0194478_791_1120 | 101 |
| 836 | 3300049589 | Ga0501073_0307177 | Ga0501073_0307177_92_397 | 101 |
| 837 | 3300049589 | Ga0501073_0365553 | Ga0501073_0365553_182_511 | 101 |
| 838 | 3300049589 | Ga0501073_0627446 | Ga0501073_0627446_232_537 | 101 |
| 839 | 3300049589 | Ga0501073_0911935 | Ga0501073_0911935_119_448 | 101 |
| 840 | 3300049589 | Ga0501073_1164419 | Ga0501073_1164419_108_437 | 101 |
| 841 | 3300049590 | Ga0501074_0037653 | Ga0501074_0037653_2322_2627 | 101 |
| 842 | 3300049590 | Ga0501074_0083694 | Ga0501074_0083694_605_910 | 101 |
| 843 | 3300049590 | Ga0501074_0230080 | Ga0501074_0230080_913_1218 | 101 |
| 844 | 3300049590 | Ga0501074_0246753 | Ga0501074_0246753_257_562 | 101 |
| 845 | 3300049590 | Ga0501074_0436423 | Ga0501074_0436423_47_397 | 101 |
| 846 | 3300049590 | Ga0501074_0893331 | Ga0501074_0893331_235_540 | 101 |
| 847 | 3300049591 | Ga0501075_0025569 | Ga0501075_0025569_1167_1472 | 101 |
| 848 | 3300049591 | Ga0501075_0070787 | Ga0501075_0070787_420_725 | 101 |
| 849 | 3300049591 | Ga0501075_0134970 | Ga0501075_0134970_1234_1539 | 101 |
| 850 | 3300049591 | Ga0501075_0156577 | Ga0501075_0156577_858_1163 | 101 |
| 851 | 3300049591 | Ga0501075_0329038 | Ga0501075_0329038_199_504 | 101 |
| 852 | 3300049591 | Ga0501075_0541518 | Ga0501075_0541518_269_574 | 101 |
| 853 | 3300049591 | Ga0501075_0833725 | Ga0501075_0833725_67_372 | 101 |
| 854 | 3300049591 | Ga0501075_0849714 | Ga0501075_0849714_65_394 | 101 |
| 855 | 3300049592 | Ga0501076_0048131 | Ga0501076_0048131_1640_1945 | 101 |
| 856 | 3300049592 | Ga0501076_0052004 | Ga0501076_0052004_2099_2404 | 101 |
| 857 | 3300049592 | Ga0501076_0088677 | Ga0501076_0088677_2088_2393 | 101 |
| 858 | 3300049592 | Ga0501076_0122268 | Ga0501076_0122268_847_1152 | 101 |
| 859 | 3300049592 | Ga0501076_0769621 | Ga0501076_0769621_436_741 | 101 |
| 860 | 3300049592 | Ga0501076_0980099 | Ga0501076_0980099_12_317 | 101 |
| 861 | 3300049592 | Ga0501076_1486123 | Ga0501076_1486123_24_329 | 101 |
| 862 | 3300049592 | Ga0501076_1536942 | Ga0501076_1536942_13_318 | 101 |
| 863 | 3300049593 | Ga0501077_0028422 | Ga0501077_0028422_2775_3080 | 101 |
| 864 | 3300049593 | Ga0501077_0034293 | Ga0501077_0034293_1326_1631 | 101 |
| 865 | 3300049593 | Ga0501077_0186922 | Ga0501077_0186922_690_995 | 101 |
| 866 | 3300049593 | Ga0501077_0191161 | Ga0501077_0191161_546_851 | 101 |
| 867 | 3300049593 | Ga0501077_0850130 | Ga0501077_0850130_192_497 | 101 |
| 868 | 3300049593 | Ga0501077_0912259 | Ga0501077_0912259_22_327 | 101 |
| 869 | 3300049741 | Ga0501079_0090500 | Ga0501079_0090500_1546_1851 | 101 |
| 870 | 3300049741 | Ga0501079_0097020 | Ga0501079_0097020_1777_2082 | 101 |
| 871 | 3300049741 | Ga0501079_0106982 | Ga0501079_0106982_937_1242 | 101 |
| 872 | 3300049741 | Ga0501079_0233101 | Ga0501079_0233101_781_1086 | 101 |
| 873 | 3300049741 | Ga0501079_0337015 | Ga0501079_0337015_161_466 | 101 |
| 874 | 3300049741 | Ga0501079_0476712 | Ga0501079_0476712_153_458 | 101 |
| 875 | 3300049741 | Ga0501079_0503470 | Ga0501079_0503470_103_408 | 101 |
| 876 | 3300049741 | Ga0501079_0547285 | Ga0501079_0547285_344_649 | 101 |
| 877 | 3300049742 | Ga0501080_0069798 | Ga0501080_0069798_480_785 | 101 |
| 878 | 3300049742 | Ga0501080_0146841 | Ga0501080_0146841_1120_1449 | 101 |
| 879 | 3300049742 | Ga0501080_0165757 | Ga0501080_0165757_388_693 | 101 |
| 880 | 3300049742 | Ga0501080_0387747 | Ga0501080_0387747_577_882 | 101 |
| 881 | 3300049742 | Ga0501080_0416397 | Ga0501080_0416397_846_1175 | 101 |
| 882 | 3300049742 | Ga0501080_0535265 | Ga0501080_0535265_600_905 | 101 |
| 883 | 3300049742 | Ga0501080_0905909 | Ga0501080_0905909_44_373 | 101 |
| 884 | 3300049742 | Ga0501080_1002026 | Ga0501080_1002026_124_453 | 101 |
| 885 | 3300049743 | Ga0501081_0006642 | Ga0501081_0006642_23_328 | 101 |
| 886 | 3300049743 | Ga0501081_0022707 | Ga0501081_0022707_1426_1731 | 101 |
| 887 | 3300049743 | Ga0501081_0356587 | Ga0501081_0356587_257_562 | 101 |
| 888 | 3300049743 | Ga0501081_0518939 | Ga0501081_0518939_72_377 | 101 |
| 889 | 3300049743 | Ga0501081_0716896 | Ga0501081_0716896_206_511 | 101 |
| 890 | 3300049743 | Ga0501081_0748224 | Ga0501081_0748224_208_513 | 101 |
| 891 | 3300049743 | Ga0501081_1069891 | Ga0501081_1069891_235_540 | 101 |
| 892 | 3300049744 | Ga0501083_0000366 | Ga0501083_0000366_23624_23953 | 101 |
| 893 | 3300049744 | Ga0501083_0023852 | Ga0501083_0023852_1624_1953 | 101 |
| 894 | 3300049744 | Ga0501083_0057582 | Ga0501083_0057582_35_340 | 101 |
| 895 | 3300049744 | Ga0501083_0332767 | Ga0501083_0332767_584_913 | 101 |
| 896 | 3300049744 | Ga0501083_0382418 | Ga0501083_0382418_38_367 | 101 |
| 897 | 3300049744 | Ga0501083_0666444 | Ga0501083_0666444_71_376 | 101 |
| 898 | 3300049744 | Ga0501083_0868747 | Ga0501083_0868747_28_357 | 101 |
| 899 | 3300049822 | Ga0501035_0166001 | Ga0501035_0166001_608_913 | 101 |
| 900 | 3300049822 | Ga0501035_0986216 | Ga0501035_0986216_67_372 | 101 |
| 901 | 3300049823 | Ga0501044_0248359 | Ga0501044_0248359_632_961 | 101 |
| 902 | 3300049823 | Ga0501044_0408732 | Ga0501044_0408732_751_1080 | 101 |
| 903 | 3300049823 | Ga0501044_0433386 | Ga0501044_0433386_862_1191 | 101 |
| 904 | 3300049824 | Ga0501045_0062741 | Ga0501045_0062741_1422_1727 | 101 |
| 905 | 3300049824 | Ga0501045_0107082 | Ga0501045_0107082_140_445 | 101 |
| 906 | 3300049824 | Ga0501045_0149202 | Ga0501045_0149202_894_1199 | 101 |
| 907 | 3300049824 | Ga0501045_0217822 | Ga0501045_0217822_747_1097 | 101 |
| 908 | 3300049824 | Ga0501045_0292817 | Ga0501045_0292817_203_508 | 101 |
| 909 | 3300050492 | nmdc:mga0yw44_656657_c1 | nmdc:mga0yw44_656657_c1_272_577 | 101 |
| 910 | 3300050507 | nmdc:mga05p37_18344_c1 | nmdc:mga05p37_18344_c1_1600_1905 | 101 |
| 911 | 3300050507 | nmdc:mga05p37_302458_c1 | nmdc:mga05p37_302458_c1_1443_1748 | 101 |
| 912 | 3300050507 | nmdc:mga05p37_311339_c1 | nmdc:mga05p37_311339_c1_775_1080 | 101 |
| 913 | 3300050507 | nmdc:mga05p37_70473_c1 | nmdc:mga05p37_70473_c1_2289_2594 | 101 |
| 914 | 3300050511 | nmdc:mga08y16_1020227_c1 | nmdc:mga08y16_1020227_c1_82_387 | 101 |
| 915 | 3300050511 | nmdc:mga08y16_131922_c1 | nmdc:mga08y16_131922_c1_866_1171 | 101 |
| 916 | 3300050511 | nmdc:mga08y16_188128_c1 | nmdc:mga08y16_188128_c1_1042_1356 | 101 |
| 917 | 3300050511 | nmdc:mga08y16_474401_c1 | nmdc:mga08y16_474401_c1_398_703 | 101 |
| 918 | 3300050512 | nmdc:mga0n895_1484744_c1 | nmdc:mga0n895_1484744_c1_210_515 | 101 |
| 919 | 3300050512 | nmdc:mga0n895_318901_c1 | nmdc:mga0n895_318901_c1_789_1094 | 101 |
| 920 | 3300050513 | nmdc:mga0rr50_129171_c1 | nmdc:mga0rr50_129171_c1_321_626 | 101 |
| 921 | 3300050513 | nmdc:mga0rr50_220059_c1 | nmdc:mga0rr50_220059_c1_278_583 | 101 |
| 922 | 3300050515 | nmdc:mga0a205_162884_c1 | nmdc:mga0a205_162884_c1_432_737 | 101 |
| 923 | 3300050515 | nmdc:mga0a205_202167_c1 | nmdc:mga0a205_202167_c1_340_645 | 101 |
| 924 | 3300053077 | Ga0495601_0016216 | Ga0495601_0016216_1864_2169 | 101 |
| 925 | 3300053077 | Ga0495601_0571122 | Ga0495601_0571122_352_660 | 101 |
| 926 | 3300053078 | Ga0495612_0094471 | Ga0495612_0094471_843_1148 | 101 |
| 927 | 3300053084 | Ga0495595_0100982 | Ga0495595_0100982_635_940 | 101 |
| 928 | 3300053084 | Ga0495595_0636284 | Ga0495595_0636284_222_530 | 101 |
| 929 | 3300053085 | Ga0495619_0016410 | Ga0495619_0016410_2793_3098 | 101 |
| 930 | 3300053085 | Ga0495619_0351950 | Ga0495619_0351950_97_402 | 101 |
| 931 | 3300054114 | Ga0501084_0040791 | Ga0501084_0040791_1940_2245 | 101 |
| 932 | 3300054114 | Ga0501084_0054711 | Ga0501084_0054711_857_1162 | 101 |
| 933 | 3300054114 | Ga0501084_0075715 | Ga0501084_0075715_934_1239 | 101 |
| 934 | 3300054114 | Ga0501084_0138566 | Ga0501084_0138566_58_387 | 101 |
| 935 | 3300054114 | Ga0501084_0274186 | Ga0501084_0274186_395_700 | 101 |
| 936 | 3300054114 | Ga0501084_0440559 | Ga0501084_0440559_416_745 | 101 |
| 937 | 3300054114 | Ga0501084_0457983 | Ga0501084_0457983_629_934 | 101 |
| 938 | 3300054114 | Ga0501084_0487006 | Ga0501084_0487006_666_971 | 101 |
| 939 | 3300054114 | Ga0501084_0525368 | Ga0501084_0525368_364_669 | 101 |
| 940 | 3300054114 | Ga0501084_0758980 | Ga0501084_0758980_361_666 | 101 |
| 941 | 3300054114 | Ga0501084_0901679 | Ga0501084_0901679_109_414 | 101 |
| 942 | 3300054114 | Ga0501084_1100541 | Ga0501084_1100541_85_414 | 101 |
| 943 | 3300054114 | Ga0501084_1205252 | Ga0501084_1205252_65_370 | 101 |
| 944 | 3300054114 | Ga0501084_1744282 | Ga0501084_1744282_24_353 | 101 |
| 945 | 3300059421 | Ga0590071_000189 | Ga0590071_000189_13593_13898 | 101 |
| 946 | 3300059424 | Ga0590075_018081 | Ga0590075_018081_908_1213 | 101 |
| 947 | 3300060353 | Ga0501082_0036986 | Ga0501082_0036986_1041_1346 | 101 |
| 948 | 3300060353 | Ga0501082_0050355 | Ga0501082_0050355_910_1215 | 101 |
| 949 | 3300060353 | Ga0501082_0194128 | Ga0501082_0194128_1278_1583 | 101 |
| 950 | 3300060353 | Ga0501082_0244033 | Ga0501082_0244033_911_1216 | 101 |
| 951 | 3300060353 | Ga0501082_0519190 | Ga0501082_0519190_166_471 | 101 |
| 952 | 3300060353 | Ga0501082_0534793 | Ga0501082_0534793_383_712 | 101 |
| 953 | 3300060353 | Ga0501082_0662253 | Ga0501082_0662253_457_762 | 101 |
| 954 | 3300060353 | Ga0501082_0670203 | Ga0501082_0670203_341_670 | 101 |
| 955 | 3300060353 | Ga0501082_1351221 | Ga0501082_1351221_278_607 | 101 |
| 956 | 3300060353 | Ga0501082_2023012 | Ga0501082_2023012_114_419 | 101 |
| 957 | 3300061734 | Ga0530510_0033333 | Ga0530510_0033333_1200_1505 | 101 |
| 958 | 3300061734 | Ga0530510_0060525 | Ga0530510_0060525_810_1115 | 101 |
| 959 | 3300061734 | Ga0530510_0083461 | Ga0530510_0083461_476_781 | 101 |
| 960 | 3300061734 | Ga0530510_0105394 | Ga0530510_0105394_659_964 | 101 |
| 961 | 3300061734 | Ga0530510_0704487 | Ga0530510_0704487_201_506 | 101 |
| 962 | 3300061734 | Ga0530510_0900019 | Ga0530510_0900019_280_609 | 101 |
| 963 | 3300061734 | Ga0530510_0959485 | Ga0530510_0959485_266_571 | 101 |
| 964 | 3300061734 | Ga0530510_1305268 | Ga0530510_1305268_33_362 | 101 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pug-assembly2.cif.gz_C | structure of e. coli ybab | 0.9098 | 13 | 88 |
| 3f42-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein hp0035 from helicobacter pylori | 0.902 | 1 | 91 |
| 1ybx-assembly1.cif.gz_A | conserved hypothetical protein cth-383 from clostridium thermocellum | 0.8932 | 3 | 89 |
| 1pug-assembly2.cif.gz_D | structure of e. coli ybab | 0.8896 | 18 | 88 |
| 3f42-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein hp0035 from helicobacter pylori | 0.8754 | 1 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A2C3_1280_1430_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.9059 | 28 | 55 | 2.130.10.10 |
| 1pugB00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8592 | 17 | 84 | 3.30.1310.10 |
| 5yrxA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8579 | 19 | 84 | 3.30.1310.10 |
| 1ybxA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8409 | 3 | 89 | 3.30.1310.10 |
| af_Q4DVG2_30_117_3.30.1310.10 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.832 | 9 | 93 | 3.30.1310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838Q4L3-F1-model_v4 | Nucleoid-associated protein H0U13_00055 | 0.9707 | 4 | 96 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A7C2ZGL8-F1-model_v4 | Nucleoid-associated protein ENO92_11125 | 0.9623 | 4 | 98 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A1G2ZLL2-F1-model_v4 | Nucleoid-associated protein A2W23_02035 | 0.9621 | 1 | 98 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-Q1DAZ8-F1-model_v4 | Nucleoid-associated protein MXAN_1931 | 0.9602 | 4 | 97 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A7X8J807-F1-model_v4 | Nucleoid-associated protein GX280_04820 | 0.9565 | 3 | 98 |
GO:0003677
GO:0005829 GO:0043590 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar