F486946

General Info

Members Datasets Scaffolds Average Seq Length
964 327 962 102

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0135129|Ga0451853_0135129_18_392
Length 124
Sequence MPAATSHPFRQTDGDVTDERRDPMGMANLQRMAQQMQQEMLRIQGELETTLVDGTAGGGVVSVTVTGKQELVSVTIDPSAVDPDDVEMLQDLVVAAVNDALRSSKELAEQKMAAVTGGLRLPGM

Samples

Sample ID Description Type Environment
1 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
2 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
180 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
225 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
226 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
230 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
231 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
232 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
237 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 7.68
Rhizosphere 90.66
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10027416 3300003203 Unclassified 2184
2 rootH2_10016961 3300003320 Bacteria 5664
3 rootH2_10041962 3300003320 Bacteria 1355
4 rootH2_10247369 3300003320 Bacteria 2622
5 rootH1_10020450 3300003323 Bacteria 2542
6 Ga0065715_10961770 3300005293 Bacteria 556
7 Ga0070676_10236036 3300005328 Bacteria 1214
8 Ga0070676_10599700 3300005328 Bacteria 794
9 Ga0070683_100644225 3300005329 Bacteria 1014
10 Ga0070690_100148212 3300005330 Bacteria 1599
11 Ga0070690_101358852 3300005330 Bacteria 571
12 Ga0070670_100368652 3300005331 Bacteria 1264
13 Ga0070677_10418474 3300005333 Bacteria 710
14 Ga0068869_100457324 3300005334 Bacteria 1059
15 Ga0068869_101657215 3300005334 Bacteria 570
16 Ga0070680_100763137 3300005336 Bacteria 833
17 Ga0070682_100352490 3300005337 Bacteria 1098
18 Ga0070682_100354112 3300005337 Bacteria 1095
19 Ga0070682_100650347 3300005337 Bacteria 839
20 Ga0070682_101996449 3300005337 Bacteria 510
21 Ga0068868_100152639 3300005338 Bacteria 1903
22 Ga0068868_101052529 3300005338 Bacteria 747
23 Ga0068868_101591236 3300005338 Bacteria 614
24 Ga0070660_100098548 3300005339 Bacteria 2314
25 Ga0070660_100599296 3300005339 Bacteria 921
26 Ga0070689_100022734 3300005340 Bacteria 4685
27 Ga0070689_100125139 3300005340 Bacteria 2056
28 Ga0070689_100357111 3300005340 Bacteria 1227
29 Ga0070691_10134575 3300005341 Bacteria 1255
30 Ga0070661_100199944 3300005344 Bacteria 1527
31 Ga0070661_101229554 3300005344 Bacteria 627
32 Ga0070692_10025730 3300005345 Bacteria 2904
33 Ga0070692_10225742 3300005345 Bacteria 1109
34 Ga0070692_10518170 3300005345 Bacteria 776
35 Ga0070692_10585780 3300005345 Bacteria 736
36 Ga0070692_10933696 3300005345 Bacteria 602
37 Ga0070668_100115147 3300005347 Bacteria 2143
38 Ga0070668_100185384 3300005347 Unclassified 1702
39 Ga0070668_100359692 3300005347 Bacteria 1234
40 Ga0070668_100594938 3300005347 Bacteria 967
41 Ga0070668_100815044 3300005347 Unclassified 830
42 Ga0070669_101303047 3300005353 Bacteria 629
43 Ga0070675_100139086 3300005354 Bacteria 2074
44 Ga0070675_100395775 3300005354 Bacteria 1232
45 Ga0070674_100040553 3300005356 Bacteria 3150
46 Ga0070674_100209921 3300005356 Bacteria 1508
47 Ga0070674_101184564 3300005356 Bacteria 678
48 Ga0070673_100541484 3300005364 Unclassified 1057
49 Ga0070673_101435897 3300005364 Bacteria 650
50 Ga0070688_100704933 3300005365 Bacteria 782
51 Ga0070688_100987390 3300005365 Bacteria 668
52 Ga0070659_100015650 3300005366 Bacteria 5682
53 Ga0070659_100430523 3300005366 Bacteria 1117
54 Ga0070659_101666369 3300005366 Bacteria 570
55 Ga0070659_101692357 3300005366 Bacteria 566
56 Ga0070667_100585371 3300005367 Bacteria 1027
57 Ga0070667_100658974 3300005367 Bacteria 967
58 Ga0070703_10299321 3300005406 Bacteria 670
59 Ga0070701_10049674 3300005438 Bacteria 2169
60 Ga0070701_10304334 3300005438 Bacteria 981
61 Ga0070711_100552070 3300005439 Bacteria 956
62 Ga0070705_100035713 3300005440 Bacteria 2788
63 Ga0070705_100680183 3300005440 Bacteria 806
64 Ga0070700_100052017 3300005441 Bacteria 2552
65 Ga0070700_100054398 3300005441 Bacteria 2501
66 Ga0070700_100059450 3300005441 Bacteria 2406
67 Ga0070700_100306225 3300005441 Bacteria 1162
68 Ga0070700_101044844 3300005441 Bacteria 674
69 Ga0070694_100034060 3300005444 Bacteria 3356
70 Ga0070694_100136520 3300005444 Bacteria 1778
71 Ga0070694_100218069 3300005444 Bacteria 1430
72 Ga0070694_100220578 3300005444 Bacteria 1422
73 Ga0070694_100327892 3300005444 Bacteria 1180
74 Ga0070708_100102469 3300005445 Bacteria 2623
75 Ga0070708_100260834 3300005445 Bacteria 1629
76 Ga0070708_100448181 3300005445 Bacteria 1218
77 Ga0070708_100542486 3300005445 Bacteria 1097
78 Ga0070708_100601551 3300005445 Bacteria 1037
79 Ga0070663_101258504 3300005455 Bacteria 652
80 Ga0070663_101299142 3300005455 Bacteria 642
81 Ga0070663_101819370 3300005455 Bacteria 546
82 Ga0070678_100137826 3300005456 Bacteria 1948
83 Ga0070678_100249957 3300005456 Bacteria 1486
84 Ga0070678_100419704 3300005456 Bacteria 1166
85 Ga0070678_100528970 3300005456 Bacteria 1044
86 Ga0070678_100537665 3300005456 Bacteria 1036
87 Ga0070678_100764945 3300005456 Bacteria 875
88 Ga0070678_101271423 3300005456 Bacteria 684
89 Ga0070662_100174199 3300005457 Bacteria 1692
90 Ga0070662_100621452 3300005457 Bacteria 910
91 Ga0070681_10315714 3300005458 Bacteria 1472
92 Ga0070681_10549404 3300005458 Bacteria 1069
93 Ga0070681_10812784 3300005458 Bacteria 852
94 Ga0070681_11208650 3300005458 Bacteria 678
95 Ga0070681_11208732 3300005458 Bacteria 678
96 Ga0068867_100037830 3300005459 Bacteria 3509
97 Ga0068867_101063418 3300005459 Unclassified 737
98 Ga0068867_101427197 3300005459 Unclassified 643
99 Ga0070685_10026310 3300005466 Bacteria 3206
100 Ga0070685_10699323 3300005466 Bacteria 739
101 Ga0070706_100222584 3300005467 Bacteria 1761
102 Ga0070707_100025207 3300005468 Bacteria 5640
103 Ga0070707_100396221 3300005468 Bacteria 1341
104 Ga0070707_100572488 3300005468 Bacteria 1092
105 Ga0070698_100164248 3300005471 Bacteria 2163
106 Ga0070698_100252012 3300005471 Bacteria 1698
107 Ga0070698_100327200 3300005471 Bacteria 1463
108 Ga0070698_101087309 3300005471 Bacteria 748
109 Ga0070699_100008575 3300005518 Bacteria 8857
110 Ga0070699_101334491 3300005518 Bacteria 658
111 Ga0070679_100400729 3300005530 Bacteria 1318
112 Ga0070679_100404901 3300005530 Bacteria 1310
113 Ga0070679_100719571 3300005530 Bacteria 941
114 Ga0070679_100867230 3300005530 Bacteria 846
115 Ga0070679_101146898 3300005530 Bacteria 722
116 Ga0070684_100186927 3300005535 Bacteria 1884
117 Ga0070684_100575704 3300005535 Bacteria 1046
118 Ga0070697_100093865 3300005536 Bacteria 2485
119 Ga0070697_100097763 3300005536 Bacteria 2436
120 Ga0070697_100397843 3300005536 Bacteria 1195
121 Ga0070697_100440145 3300005536 Bacteria 1134
122 Ga0068853_100388878 3300005539 Bacteria 1304
123 Ga0068853_100497354 3300005539 Bacteria 1151
124 Ga0070672_100734034 3300005543 Unclassified 866
125 Ga0070672_101024435 3300005543 Bacteria 732
126 Ga0070686_100072359 3300005544 Bacteria 2260
127 Ga0070686_100120228 3300005544 Bacteria 1802
128 Ga0070686_100185107 3300005544 Bacteria 1483
129 Ga0070686_100588665 3300005544 Unclassified 875
130 Ga0070686_100610339 3300005544 Bacteria 861
131 Ga0070686_100721487 3300005544 Bacteria 797
132 Ga0070695_100054976 3300005545 Bacteria 2565
133 Ga0070695_100082748 3300005545 Bacteria 2125
134 Ga0070695_100192056 3300005545 Bacteria 1454
135 Ga0070695_100920971 3300005545 Bacteria 707
136 Ga0070695_101124659 3300005545 Bacteria 644
137 Ga0070696_100014238 3300005546 Bacteria 5336
138 Ga0070696_100029799 3300005546 Bacteria 3733
139 Ga0070696_100072070 3300005546 Bacteria 2432
140 Ga0070696_100860435 3300005546 Bacteria 750
141 Ga0070696_101313572 3300005546 Unclassified 614
142 Ga0070696_101353244 3300005546 Bacteria 606
143 Ga0070696_101788678 3300005546 Bacteria 531
144 Ga0070693_100072762 3300005547 Bacteria 2028
145 Ga0070693_100089178 3300005547 Bacteria 1856
146 Ga0070704_100064012 3300005549 Bacteria 2641
147 Ga0070704_101193995 3300005549 Bacteria 694
148 Ga0070704_101501735 3300005549 Bacteria 620
149 Ga0068855_100847382 3300005563 Bacteria 969
150 Ga0070664_100133647 3300005564 Bacteria 2180
151 Ga0070664_100381505 3300005564 Bacteria 1287
152 Ga0070664_100742324 3300005564 Bacteria 916
153 Ga0070664_101393127 3300005564 Bacteria 663
154 Ga0070664_101594443 3300005564 Bacteria 618
155 Ga0068857_100142197 3300005577 Bacteria 2169
156 Ga0068854_100084803 3300005578 Bacteria 2345
157 Ga0068854_100783160 3300005578 Bacteria 830
158 Ga0068854_100934598 3300005578 Bacteria 764
159 Ga0068854_101061831 3300005578 Bacteria 720
160 Ga0068854_101701763 3300005578 Bacteria 577
161 Ga0068856_100200695 3300005614 Bacteria 2009
162 Ga0068856_100666754 3300005614 Bacteria 1061
163 Ga0070702_100035782 3300005615 Bacteria 2745
164 Ga0070702_100156558 3300005615 Bacteria 1468
165 Ga0070702_100464968 3300005615 Bacteria 921
166 Ga0070702_101703033 3300005615 Bacteria 524
167 Ga0068852_100186891 3300005616 Bacteria 1952
168 Ga0068852_101105787 3300005616 Bacteria 813
169 Ga0068859_101579095 3300005617 Bacteria 724
170 Ga0068864_100537254 3300005618 Bacteria 1129
171 Ga0068864_100840386 3300005618 Bacteria 904
172 Ga0068864_101906823 3300005618 Bacteria 600
173 Ga0068864_102141219 3300005618 Bacteria 566
174 Ga0068866_10584039 3300005718 Unclassified 752
175 Ga0068866_10597154 3300005718 Bacteria 745
176 Ga0068866_10865520 3300005718 Bacteria 633
177 Ga0068861_100205052 3300005719 Bacteria 1657
178 Ga0068861_100335407 3300005719 Bacteria 1322
179 Ga0068861_100502843 3300005719 Bacteria 1096
180 Ga0068861_100727372 3300005719 Bacteria 925
181 Ga0068861_100753090 3300005719 Unclassified 910
182 Ga0068861_102402387 3300005719 Bacteria 530
183 Ga0068870_10154553 3300005840 Bacteria 1354
184 Ga0068863_101817861 3300005841 Bacteria 619
185 Ga0068858_100103958 3300005842 Bacteria 2650
186 Ga0068858_100222021 3300005842 Bacteria 1790
187 Ga0068858_100415907 3300005842 Bacteria 1293
188 Ga0068858_101487124 3300005842 Bacteria 668
189 Ga0068858_101652130 3300005842 Bacteria 632
190 Ga0068860_100531355 3300005843 Bacteria 1177
191 Ga0068860_101791862 3300005843 Bacteria 636
192 Ga0068862_100259914 3300005844 Bacteria 1585
193 Ga0068862_101230904 3300005844 Bacteria 748
194 Ga0068862_101247836 3300005844 Bacteria 743
195 Ga0081539_10029426 3300005985 Bacteria 3431
196 Ga0081539_10056210 3300005985 Bacteria 2185
197 Ga0075365_10133768 3300006038 Bacteria 1717
198 Ga0075432_10092489 3300006058 Bacteria 1109
199 Ga0097621_100152764 3300006237 Bacteria 1980
200 Ga0068871_100849554 3300006358 Bacteria 844
201 Ga0075428_100113608 3300006844 Bacteria 2951
202 Ga0075428_100486259 3300006844 Bacteria 1321
203 Ga0075428_100776662 3300006844 Bacteria 1019
204 Ga0075431_100844501 3300006847 Bacteria 887
205 Ga0075433_10369755 3300006852 Bacteria 1266
206 Ga0075433_10505951 3300006852 Bacteria 1063
207 Ga0075433_10560793 3300006852 Unclassified 1004
208 Ga0075434_100187428 3300006871 Bacteria 2089
209 Ga0075434_100338781 3300006871 Bacteria 1525
210 Ga0068865_100078447 3300006881 Bacteria 2362
211 Ga0068865_100213479 3300006881 Bacteria 1505
212 Ga0068865_100433050 3300006881 Bacteria 1084
213 Ga0068865_100592630 3300006881 Bacteria 936
214 Ga0068865_101073885 3300006881 Bacteria 708
215 Ga0075436_101079646 3300006914 Bacteria 604
216 Ga0097620_101579035 3300006931 Bacteria 724
217 Ga0075435_100596311 3300007076 Bacteria 958
218 Ga0075435_100668355 3300007076 Unclassified 902
219 Ga0105240_10044197 3300009093 Bacteria 5664
220 Ga0105240_11143548 3300009093 Bacteria 827
221 Ga0111539_10083116 3300009094 Bacteria 3766
222 Ga0111539_10163105 3300009094 Bacteria 2607
223 Ga0111539_10247245 3300009094 Bacteria 2076
224 Ga0111539_10379491 3300009094 Bacteria 1646
225 Ga0111539_11149912 3300009094 Bacteria 902
226 Ga0111539_11158339 3300009094 Bacteria 898
227 Ga0105245_10061212 3300009098 Bacteria 3393
228 Ga0105245_10259642 3300009098 Bacteria 1690
229 Ga0105245_10265852 3300009098 Bacteria 1671
230 Ga0105245_10390300 3300009098 Bacteria 1389
231 Ga0105245_10390566 3300009098 Bacteria 1388
232 Ga0105245_10412610 3300009098 Bacteria 1352
233 Ga0105245_10487151 3300009098 Bacteria 1247
234 Ga0105245_10707723 3300009098 Bacteria 1041
235 Ga0105245_11560036 3300009098 Bacteria 712
236 Ga0105245_11926018 3300009098 Bacteria 644
237 Ga0105245_12157575 3300009098 Bacteria 611
238 Ga0105247_10323393 3300009101 Unclassified 1077
239 Ga0105247_10488216 3300009101 Bacteria 895
240 Ga0114129_10173746 3300009147 Bacteria 2935
241 Ga0114129_10255828 3300009147 Bacteria 2349
242 Ga0114129_10270353 3300009147 Bacteria 2274
243 Ga0114129_11705941 3300009147 Bacteria 768
244 Ga0105243_10085338 3300009148 Bacteria 2588
245 Ga0105243_10114671 3300009148 Bacteria 2261
246 Ga0105243_10274461 3300009148 Bacteria 1515
247 Ga0105243_10314081 3300009148 Bacteria 1425
248 Ga0105243_10550736 3300009148 Bacteria 1102
249 Ga0105243_11174643 3300009148 Bacteria 779
250 Ga0105241_12067047 3300009174 Bacteria 562
251 Ga0105242_10057420 3300009176 Bacteria 3187
252 Ga0105242_10134891 3300009176 Bacteria 2135
253 Ga0105242_10843851 3300009176 Bacteria 911
254 Ga0105248_10054628 3300009177 Bacteria 4479
255 Ga0105248_11213140 3300009177 Bacteria 853
256 Ga0105248_11463580 3300009177 Bacteria 773
257 Ga0105248_11898017 3300009177 Bacteria 676
258 Ga0105248_13388968 3300009177 Bacteria 506
259 Ga0105238_10070578 3300009551 Bacteria 3492
260 Ga0105238_10374143 3300009551 Bacteria 1415
261 Ga0105249_10111503 3300009553 Bacteria 2587
262 Ga0105249_10139553 3300009553 Bacteria 2322
263 Ga0105249_10556239 3300009553 Bacteria 1198
264 Ga0105249_11742264 3300009553 Bacteria 695
265 Ga0105239_10183486 3300010375 Bacteria 2341
266 Ga0105239_10225542 3300010375 Bacteria 2102
267 Ga0105239_11033154 3300010375 Bacteria 945
268 Ga0105239_11548821 3300010375 Unclassified 766
269 Ga0105246_10440601 3300011119 Bacteria 1092
270 Ga0105246_10608934 3300011119 Bacteria 945
271 Ga0105246_10998763 3300011119 Bacteria 757
272 Ga0105246_11385517 3300011119 Unclassified 655
273 Ga0105246_11732794 3300011119 Bacteria 595
274 Ga0157342_1050137 3300012507 Unclassified 585
275 Ga0157371_11226651 3300013102 Bacteria 579
276 Ga0157374_10528563 3300013296 Bacteria 1186
277 Ga0157374_10891944 3300013296 Bacteria 907
278 Ga0157374_11313298 3300013296 Bacteria 745
279 Ga0157378_10117009 3300013297 Bacteria 2452
280 Ga0157378_11551325 3300013297 Bacteria 707
281 Ga0157378_11774611 3300013297 Bacteria 665
282 Ga0157378_12077549 3300013297 Unclassified 619
283 Ga0163162_10747468 3300013306 Unclassified 1097
284 Ga0163162_10786677 3300013306 Bacteria 1069
285 Ga0163162_10931184 3300013306 Bacteria 981
286 Ga0163162_10969871 3300013306 Bacteria 960
287 Ga0163162_11214252 3300013306 Bacteria 856
288 Ga0163162_11535614 3300013306 Bacteria 759
289 Ga0157372_11048214 3300013307 Unclassified 944
290 Ga0157375_10182066 3300013308 Bacteria 2253
291 Ga0157375_10447930 3300013308 Bacteria 1457
292 Ga0157375_10781512 3300013308 Bacteria 1104
293 Ga0157375_11120408 3300013308 Bacteria 922
294 Ga0157375_11287547 3300013308 Unclassified 859
295 Ga0163163_10011059 3300014325 Bacteria 8164
296 Ga0163163_10089481 3300014325 Bacteria 3090
297 Ga0163163_10229313 3300014325 Bacteria 1906
298 Ga0163163_10247169 3300014325 Bacteria 1834
299 Ga0163163_10329052 3300014325 Bacteria 1582
300 Ga0163163_11048556 3300014325 Bacteria 878
301 Ga0157380_10038585 3300014326 Bacteria 3710
302 Ga0157380_10110883 3300014326 Bacteria 2305
303 Ga0157380_10491946 3300014326 Bacteria 1189
304 Ga0157380_10953972 3300014326 Bacteria 888
305 Ga0157377_10016618 3300014745 Bacteria 3789
306 Ga0157377_10206994 3300014745 Bacteria 1249
307 Ga0157377_10361175 3300014745 Bacteria 977
308 Ga0157377_10450062 3300014745 Bacteria 889
309 Ga0157377_10700719 3300014745 Bacteria 735
310 Ga0157377_11146848 3300014745 Bacteria 598
311 Ga0157379_10108237 3300014968 Bacteria 2495
312 Ga0157379_10160852 3300014968 Bacteria 2027
313 Ga0157379_10247422 3300014968 Bacteria 1618
314 Ga0157379_11470508 3300014968 Bacteria 662
315 Ga0157379_11711181 3300014968 Bacteria 616
316 Ga0157376_10870384 3300014969 Bacteria 917
317 Ga0157376_10966747 3300014969 Bacteria 873
318 Ga0157376_12715255 3300014969 Bacteria 535
319 Ga0163161_10253589 3300017792 Bacteria 1372
320 Ga0163161_10256644 3300017792 Bacteria 1364
321 Ga0163161_10286463 3300017792 Bacteria 1294
322 Ga0163161_10392266 3300017792 Bacteria 1112
323 Ga0163161_10480261 3300017792 Bacteria 1009
324 Ga0213871_10177200 3300021441 Bacteria 658
325 Ga0207656_10473495 3300025321 Bacteria 634
326 Ga0207653_10229605 3300025885 Bacteria 707
327 Ga0207642_10067918 3300025899 Bacteria 1685
328 Ga0207642_10917455 3300025899 Bacteria 562
329 Ga0207710_10334696 3300025900 Bacteria 769
330 Ga0207688_10030278 3300025901 Bacteria 2984
331 Ga0207688_10163195 3300025901 Bacteria 1322
332 Ga0207688_10340999 3300025901 Bacteria 922
333 Ga0207680_10711008 3300025903 Bacteria 720
334 Ga0207647_10101791 3300025904 Bacteria 1704
335 Ga0207645_10478937 3300025907 Bacteria 842
336 Ga0207643_10016672 3300025908 Bacteria 4007
337 Ga0207643_10160866 3300025908 Bacteria 1351
338 Ga0207643_10593847 3300025908 Bacteria 712
339 Ga0207643_10790053 3300025908 Bacteria 615
340 Ga0207684_10158375 3300025910 Bacteria 1949
341 Ga0207707_10291079 3300025912 Bacteria 1413
342 Ga0207707_11018031 3300025912 Bacteria 679
343 Ga0207707_11387696 3300025912 Bacteria 561
344 Ga0207695_10705285 3300025913 Unclassified 890
345 Ga0207663_11641556 3300025916 Unclassified 517
346 Ga0207660_10853859 3300025917 Bacteria 743
347 Ga0207660_10872714 3300025917 Bacteria 734
348 Ga0207662_10057431 3300025918 Bacteria 2326
349 Ga0207662_10579817 3300025918 Bacteria 779
350 Ga0207657_10065544 3300025919 Bacteria 3096
351 Ga0207657_10317132 3300025919 Bacteria 1233
352 Ga0207649_10650077 3300025920 Bacteria 815
353 Ga0207649_10716733 3300025920 Bacteria 777
354 Ga0207649_11075407 3300025920 Unclassified 634
355 Ga0207652_10107893 3300025921 Bacteria 2466
356 Ga0207652_10586935 3300025921 Bacteria 1000
357 Ga0207652_10616927 3300025921 Bacteria 972
358 Ga0207652_11092722 3300025921 Bacteria 698
359 Ga0207652_11582571 3300025921 Bacteria 559
360 Ga0207646_10146007 3300025922 Bacteria 2132
361 Ga0207646_10827774 3300025922 Bacteria 823
362 Ga0207681_10550006 3300025923 Bacteria 950
363 Ga0207681_10662404 3300025923 Bacteria 866
364 Ga0207650_10408400 3300025925 Bacteria 1125
365 Ga0207650_10942020 3300025925 Bacteria 734
366 Ga0207650_11392763 3300025925 Bacteria 597
367 Ga0207659_10222120 3300025926 Unclassified 1519
368 Ga0207659_10480710 3300025926 Bacteria 1049
369 Ga0207659_10991786 3300025926 Bacteria 723
370 Ga0207687_10180464 3300025927 Bacteria 1635
371 Ga0207687_10453847 3300025927 Bacteria 1063
372 Ga0207687_10475775 3300025927 Bacteria 1039
373 Ga0207687_10601319 3300025927 Bacteria 927
374 Ga0207687_10651948 3300025927 Bacteria 891
375 Ga0207687_10671264 3300025927 Bacteria 878
376 Ga0207687_10943300 3300025927 Bacteria 739
377 Ga0207644_11135708 3300025931 Bacteria 657
378 Ga0207690_10347462 3300025932 Bacteria 1172
379 Ga0207690_10807211 3300025932 Bacteria 775
380 Ga0207690_11284731 3300025932 Bacteria 612
381 Ga0207706_10072044 3300025933 Bacteria 3040
382 Ga0207706_10087943 3300025933 Bacteria 2732
383 Ga0207706_10270340 3300025933 Bacteria 1483
384 Ga0207706_10286659 3300025933 Bacteria 1436
385 Ga0207706_10675569 3300025933 Bacteria 883
386 Ga0207686_10319868 3300025934 Unclassified 1159
387 Ga0207686_10406670 3300025934 Unclassified 1038
388 Ga0207709_10137682 3300025935 Unclassified 1674
389 Ga0207709_10301932 3300025935 Bacteria 1191
390 Ga0207670_10082652 3300025936 Bacteria 2251
391 Ga0207670_10337047 3300025936 Bacteria 1191
392 Ga0207670_10908428 3300025936 Bacteria 738
393 Ga0207669_10042488 3300025937 Bacteria 2654
394 Ga0207669_10410115 3300025937 Bacteria 1064
395 Ga0207704_10219443 3300025938 Unclassified 1406
396 Ga0207704_10275800 3300025938 Bacteria 1276
397 Ga0207665_11125471 3300025939 Bacteria 626
398 Ga0207691_10133269 3300025940 Bacteria 2193
399 Ga0207691_10428486 3300025940 Bacteria 1127
400 Ga0207711_10457175 3300025941 Bacteria 1189
401 Ga0207711_10559730 3300025941 Bacteria 1066
402 Ga0207711_10880302 3300025941 Bacteria 833
403 Ga0207689_10254215 3300025942 Bacteria 1453
404 Ga0207689_10363582 3300025942 Bacteria 1203
405 Ga0207661_11010135 3300025944 Bacteria 766
406 Ga0207661_11159002 3300025944 Bacteria 711
407 Ga0207679_10370591 3300025945 Bacteria 1253
408 Ga0207679_10421090 3300025945 Bacteria 1179
409 Ga0207679_10658102 3300025945 Bacteria 948
410 Ga0207679_10714639 3300025945 Bacteria 910
411 Ga0207667_11181810 3300025949 Bacteria 745
412 Ga0207651_10385267 3300025960 Bacteria 1189
413 Ga0207651_10847430 3300025960 Bacteria 812
414 Ga0207651_11874009 3300025960 Bacteria 539
415 Ga0207712_10005919 3300025961 Bacteria 7710
416 Ga0207712_10372681 3300025961 Bacteria 1192
417 Ga0207712_10770950 3300025961 Bacteria 844
418 Ga0207668_10019059 3300025972 Bacteria 4329
419 Ga0207668_10110474 3300025972 Bacteria 2062
420 Ga0207668_10388264 3300025972 Bacteria 1177
421 Ga0207668_10448158 3300025972 Unclassified 1101
422 Ga0207668_11625516 3300025972 Bacteria 583
423 Ga0207640_10136496 3300025981 Bacteria 1782
424 Ga0207640_10230364 3300025981 Bacteria 1425
425 Ga0207640_10365465 3300025981 Bacteria 1164
426 Ga0207640_10520554 3300025981 Bacteria 994
427 Ga0207640_10709653 3300025981 Bacteria 863
428 Ga0207658_10317816 3300025986 Bacteria 1347
429 Ga0207658_10681225 3300025986 Bacteria 928
430 Ga0207677_10196835 3300026023 Unclassified 1599
431 Ga0207677_10515685 3300026023 Bacteria 1036
432 Ga0207677_10628862 3300026023 Bacteria 945
433 Ga0207677_10803064 3300026023 Bacteria 842
434 Ga0207677_10998501 3300026023 Bacteria 759
435 Ga0207677_11052709 3300026023 Bacteria 740
436 Ga0207677_11811243 3300026023 Bacteria 567
437 Ga0207703_10180006 3300026035 Bacteria 1865
438 Ga0207703_10477429 3300026035 Bacteria 1168
439 Ga0207703_10687286 3300026035 Bacteria 972
440 Ga0207703_10863343 3300026035 Bacteria 866
441 Ga0207639_10990714 3300026041 Bacteria 787
442 Ga0207639_11006988 3300026041 Bacteria 780
443 Ga0207639_11103114 3300026041 Bacteria 744
444 Ga0207678_10051746 3300026067 Bacteria 3545
445 Ga0207678_10190485 3300026067 Bacteria 1752
446 Ga0207678_11395090 3300026067 Bacteria 619
447 Ga0207678_11524405 3300026067 Bacteria 590
448 Ga0207678_11809148 3300026067 Bacteria 535
449 Ga0207708_10027078 3300026075 Bacteria 4340
450 Ga0207708_10046959 3300026075 Bacteria 3289
451 Ga0207708_10058239 3300026075 Bacteria 2948
452 Ga0207708_10077455 3300026075 Bacteria 2552
453 Ga0207708_10104167 3300026075 Bacteria 2198
454 Ga0207708_10267045 3300026075 Bacteria 1383
455 Ga0207708_10696059 3300026075 Bacteria 868
456 Ga0207708_11415064 3300026075 Bacteria 610
457 Ga0207708_11604107 3300026075 Bacteria 572
458 Ga0207702_10092653 3300026078 Bacteria 2649
459 Ga0207702_10423542 3300026078 Bacteria 1288
460 Ga0207641_12292266 3300026088 Unclassified 540
461 Ga0207648_10124183 3300026089 Bacteria 2270
462 Ga0207648_10187344 3300026089 Bacteria 1833
463 Ga0207648_10271978 3300026089 Bacteria 1514
464 Ga0207648_11067686 3300026089 Unclassified 757
465 Ga0207676_10280099 3300026095 Bacteria 1514
466 Ga0207676_10385037 3300026095 Bacteria 1306
467 Ga0207676_10942844 3300026095 Bacteria 848
468 Ga0207676_11257492 3300026095 Bacteria 734
469 Ga0207674_10013614 3300026116 Bacteria 9010
470 Ga0207674_10399929 3300026116 Bacteria 1327
471 Ga0207675_100369599 3300026118 Bacteria 1408
472 Ga0207675_100418325 3300026118 Bacteria 1323
473 Ga0207675_100551977 3300026118 Bacteria 1151
474 Ga0207675_100683476 3300026118 Bacteria 1034
475 Ga0207675_100698522 3300026118 Bacteria 1023
476 Ga0207675_100992121 3300026118 Bacteria 858
477 Ga0207683_10113879 3300026121 Bacteria 2423
478 Ga0207683_10185240 3300026121 Bacteria 1889
479 Ga0207683_10688342 3300026121 Bacteria 948
480 Ga0207683_10837266 3300026121 Bacteria 854
481 Ga0207683_11707821 3300026121 Bacteria 579
482 Ga0207698_11145580 3300026142 Bacteria 791
483 Ga0207698_11464131 3300026142 Bacteria 698
484 Ga0209970_1097799 3300027614 Bacteria 560
485 Ga0209971_1136023 3300027682 Bacteria 605
486 Ga0209974_10139179 3300027876 Bacteria 870
487 Ga0207428_10238070 3300027907 Bacteria 1361
488 Ga0268265_10128199 3300028380 Bacteria 2104
489 Ga0268265_10134270 3300028380 Bacteria 2062
490 Ga0268265_11705333 3300028380 Bacteria 636
491 Ga0268264_10452043 3300028381 Bacteria 1245
492 Ga0268264_11474183 3300028381 Bacteria 691
493 Ga0268264_11935325 3300028381 Bacteria 599
494 Ga0265337_1025186 3300028556 Bacteria 1812
495 Ga0265319_1090269 3300028563 Bacteria 967
496 Ga0265319_1118035 3300028563 Bacteria 828
497 Ga0265334_10017086 3300028573 Bacteria 3001
498 Ga0265334_10066481 3300028573 Unclassified 1349
499 Ga0265334_10233234 3300028573 Bacteria 635
500 Ga0265318_10027403 3300028577 Bacteria 2239
501 Ga0265318_10032808 3300028577 Bacteria 2007
502 Ga0265318_10065308 3300028577 Bacteria 1353
503 Ga0265318_10205186 3300028577 Bacteria 720
504 Ga0265323_10100835 3300028653 Unclassified 956
505 Ga0265323_10158006 3300028653 Bacteria 724
506 Ga0265322_10023037 3300028654 Bacteria 1781
507 Ga0265322_10066830 3300028654 Unclassified 1019
508 Ga0265322_10138898 3300028654 Bacteria 694
509 Ga0265336_10021334 3300028666 Bacteria 2071
510 Ga0265336_10115861 3300028666 Unclassified 798
511 Ga0265338_10063875 3300028800 Bacteria 3207
512 Ga0265338_10210218 3300028800 Bacteria 1461
513 Ga0265338_10832125 3300028800 Bacteria 631
514 Ga0265338_11233506 3300028800 Bacteria 501
515 Ga0265324_10006906 3300029957 Bacteria 4675
516 Ga0265330_10022220 3300031235 Bacteria 2889
517 Ga0265330_10023113 3300031235 Bacteria 2825
518 Ga0265330_10033335 3300031235 Bacteria 2303
519 Ga0265330_10043710 3300031235 Bacteria 1981
520 Ga0265330_10201803 3300031235 Bacteria 841
521 Ga0265330_10299656 3300031235 Bacteria 678
522 Ga0265330_10369136 3300031235 Bacteria 606
523 Ga0265332_10018915 3300031238 Bacteria 3041
524 Ga0265328_10051663 3300031239 Bacteria 1509
525 Ga0265328_10110104 3300031239 Bacteria 1023
526 Ga0265320_10008973 3300031240 Bacteria 6066
527 Ga0265320_10153210 3300031240 Bacteria 1040
528 Ga0265320_10166058 3300031240 Bacteria 993
529 Ga0265320_10286496 3300031240 Unclassified 729
530 Ga0265320_10431330 3300031240 Unclassified 582
531 Ga0265325_10024484 3300031241 Bacteria 3284
532 Ga0265325_10065109 3300031241 Bacteria 1841
533 Ga0265325_10079666 3300031241 Bacteria 1630
534 Ga0265325_10082224 3300031241 Bacteria 1599
535 Ga0265325_10155077 3300031241 Bacteria 1081
536 Ga0265329_10001690 3300031242 Bacteria 10573
537 Ga0265329_10040372 3300031242 Bacteria 1497
538 Ga0265329_10049764 3300031242 Bacteria 1335
539 Ga0265340_10002587 3300031247 Bacteria 10275
540 Ga0265340_10006154 3300031247 Bacteria 6616
541 Ga0265340_10010584 3300031247 Bacteria 4931
542 Ga0265340_10014489 3300031247 Bacteria 4116
543 Ga0265340_10023721 3300031247 Bacteria 3126
544 Ga0265340_10117125 3300031247 Bacteria 1227
545 Ga0265339_10028210 3300031249 Bacteria 3194
546 Ga0265339_10090867 3300031249 Bacteria 1600
547 Ga0265339_10138978 3300031249 Bacteria 1237
548 Ga0265339_10173500 3300031249 Bacteria 1078
549 Ga0265339_10198339 3300031249 Bacteria 991
550 Ga0265331_10017780 3300031250 Bacteria 3701
551 Ga0265331_10352040 3300031250 Bacteria 660
552 Ga0265316_10012137 3300031344 Bacteria 7735
553 Ga0265316_10029418 3300031344 Bacteria 4517
554 Ga0265316_10043169 3300031344 Bacteria 3598
555 Ga0265316_10084578 3300031344 Bacteria 2429
556 Ga0265316_10332295 3300031344 Bacteria 1102
557 Ga0265316_10349136 3300031344 Bacteria 1071
558 Ga0307408_100077221 3300031548 Bacteria 2480
559 Ga0265313_10005225 3300031595 Bacteria 9619
560 Ga0265313_10075370 3300031595 Bacteria 1544
561 Ga0265313_10115404 3300031595 Bacteria 1176
562 Ga0265313_10204676 3300031595 Bacteria 820
563 Ga0265313_10261075 3300031595 Unclassified 704
564 Ga0265314_10002544 3300031711 Bacteria 18542
565 Ga0265314_10003068 3300031711 Bacteria 16468
566 Ga0265314_10148599 3300031711 Bacteria 1440
567 Ga0265314_10193558 3300031711 Bacteria 1208
568 Ga0265314_10631335 3300031711 Bacteria 548
569 Ga0265342_10006227 3300031712 Bacteria 8915
570 Ga0265342_10021592 3300031712 Bacteria 4107
571 Ga0265342_10057470 3300031712 Bacteria 2302
572 Ga0265342_10284736 3300031712 Unclassified 874
573 Ga0265342_10576802 3300031712 Bacteria 569
574 Ga0307405_10336232 3300031731 Bacteria 1159
575 Ga0307413_10961791 3300031824 Bacteria 729
576 Ga0307410_10477906 3300031852 Bacteria 1022
577 Ga0307406_11349324 3300031901 Bacteria 624
578 Ga0307406_11672182 3300031901 Bacteria 564
579 Ga0307407_10376319 3300031903 Bacteria 1013
580 Ga0307407_10595052 3300031903 Unclassified 823
581 Ga0307409_100139853 3300031995 Bacteria 2084
582 Ga0307409_100199728 3300031995 Bacteria 1788
583 Ga0307416_100001176 3300032002 Bacteria 14019
584 Ga0307416_100660880 3300032002 Bacteria 1131
585 Ga0307416_101852880 3300032002 Bacteria 707
586 Ga0307416_102954160 3300032002 Bacteria 569
587 Ga0307411_10363239 3300032005 Bacteria 1185
588 Ga0307415_100526118 3300032126 Unclassified 1039
589 Ga0307415_101773278 3300032126 Bacteria 597
590 Ga0373959_0065518 3300034820 Unclassified 812
591 Ga0373959_0101059 3300034820 Bacteria 686
592 Ga0373928_0092712 3300035084 Unclassified 778
593 Ga0373929_0104037 3300035085 Bacteria 719
594 Ga0373932_0244480 3300035112 Bacteria 653
595 Ga0373941_0257761 3300035115 Bacteria 683
596 Ga0373960_0215663 3300035121 Bacteria 685
597 Ga0373955_0214708 3300035172 Unclassified 1148
598 Ga0373942_0096437 3300035207 Unclassified 898
599 Ga0373962_0033326 3300035242 Bacteria 1421
600 Ga0373962_0108938 3300035242 Unclassified 872
601 Ga0373947_0611394 3300035725 Bacteria 743
602 Ga0373925_1113872 3300037068 Bacteria 649
603 Ga0395899_0549168 3300037312 Bacteria 743
604 Ga0395900_0439904 3300037418 Bacteria 1262
605 Ga0395900_0501778 3300037418 Bacteria 1164
606 Ga0395905_0858116 3300037471 Bacteria 811
607 Ga0395901_0017877 3300038443 Bacteria 7237
608 Ga0395901_0280227 3300038443 Bacteria 1732
609 Ga0395901_2021374 3300038443 Bacteria 522
610 Ga0436365_1485382 3300039437 Bacteria 3020
611 Ga0436360_0263685 3300039438 Bacteria 2649
612 Ga0436360_1115059 3300039438 Bacteria 588
613 Ga0436361_1146080 3300039447 Bacteria 651
614 Ga0451787_536941 3300041441 Unclassified 517
615 Ga0451787_675165 3300041441 Bacteria 736
616 Ga0451791_1458017 3300041451 Bacteria 690
617 Ga0451793_1125082 3300041452 Bacteria 603
618 Ga0451795_1460265 3300041456 Bacteria 533
619 Ga0451795_1537678 3300041456 Bacteria 1443
620 Ga0451802_0894001 3300041460 Bacteria 512
621 Ga0451837_1035402 3300041494 Unclassified 572
622 Ga0451845_0263999 3300041501 Bacteria 780
623 Ga0451843_0151156 3300041509 Bacteria 574
624 Ga0451855_1451656 3300041511 Bacteria 687
625 Ga0451853_0129182 3300041512 Bacteria 506
626 Ga0451853_0135129 3300041512 Bacteria 899
627 Ga0451853_0628733 3300041512 Bacteria 649
628 Ga0451853_1064254 3300041512 Bacteria 1642
629 Ga0451853_2873151 3300041512 Bacteria 1379
630 Ga0450914_007210 3300042118 Unclassified 998
631 Ga0439446_0095485 3300042156 Bacteria 935
632 Ga0439435_0254332 3300042436 Bacteria 592
633 Ga0450916_065330 3300042530 Bacteria 598
634 Ga0450916_097568 3300042530 Bacteria 518
635 Ga0453683_0792285 3300044673 Bacteria 624
636 Ga0466964_0452518 3300044706 Unclassified 681
637 Ga0495592_0602507 3300046454 Bacteria 670
638 Ga0495592_0639995 3300046454 Bacteria 645
639 Ga0495592_0740542 3300046454 Bacteria 588
640 Ga0495629_0239440 3300046459 Bacteria 1250
641 Ga0495629_0267819 3300046459 Bacteria 1174
642 Ga0495641_0548427 3300046461 Bacteria 528
643 Ga0495582_0254788 3300046473 Bacteria 1007
644 Ga0495608_0310088 3300046511 Bacteria 976
645 Ga0495628_0285421 3300046516 Bacteria 1225
646 Ga0495628_0607309 3300046516 Unclassified 781
647 Ga0495630_0298151 3300046517 Bacteria 1232
648 Ga0495644_0273886 3300046523 Bacteria 658
649 Ga0495652_0538504 3300046529 Bacteria 804
650 Ga0495665_0550653 3300046531 Bacteria 579
651 Ga0495640_0287391 3300046533 Bacteria 1023
652 Ga0495667_0115528 3300046559 Bacteria 1734
653 Ga0495656_0689355 3300046615 Bacteria 549
654 Ga0495635_0062887 3300046663 Bacteria 2549
655 Ga0495635_0599985 3300046663 Bacteria 719
656 Ga0495657_0330408 3300046675 Bacteria 905
657 Ga0495646_0345956 3300046680 Bacteria 780
658 Ga0495613_0582585 3300046689 Bacteria 746
659 Ga0495624_0900012 3300046690 Bacteria 521
660 Ga0495649_0622869 3300046694 Bacteria 532
661 Ga0495589_0539536 3300046794 Unclassified 532
662 Ga0495600_0197212 3300046809 Bacteria 1294
663 Ga0495674_0168247 3300047319 Bacteria 1830
664 Ga0495674_0443014 3300047319 Bacteria 1044
665 Ga0495676_0398141 3300047321 Bacteria 914
666 Ga0495675_0268724 3300047444 Bacteria 1020
667 Ga0495602_0218185 3300048088 Bacteria 1442
668 Ga0496100_0056711 3300048903 Bacteria 2564
669 Ga0496100_0069716 3300048903 Bacteria 2342
670 Ga0496100_1436052 3300048903 Bacteria 545
671 Ga0496101_0034194 3300048904 Bacteria 3588
672 Ga0496101_0179285 3300048904 Bacteria 1631
673 Ga0496101_0373325 3300048904 Bacteria 1122
674 Ga0496101_1486336 3300048904 Bacteria 528
675 Ga0496102_0032069 3300048905 Bacteria 4719
676 Ga0496102_0043371 3300048905 Bacteria 4078
677 Ga0496102_0409977 3300048905 Bacteria 1273
678 Ga0496102_0468672 3300048905 Bacteria 1180
679 Ga0496102_0501699 3300048905 Bacteria 1136
680 Ga0496102_0732835 3300048905 Bacteria 911
681 Ga0496103_0013350 3300048906 Bacteria 4868
682 Ga0496103_0334638 3300048906 Bacteria 974
683 Ga0496104_0051704 3300048907 Bacteria 3878
684 Ga0496104_0055493 3300048907 Bacteria 3746
685 Ga0496104_0114696 3300048907 Bacteria 2584
686 Ga0496104_0633328 3300048907 Bacteria 979
687 Ga0496105_0024902 3300048908 Bacteria 4864
688 Ga0496105_0042189 3300048908 Bacteria 3760
689 Ga0496105_0087184 3300048908 Bacteria 2579
690 Ga0496105_0935733 3300048908 Bacteria 651
691 Ga0496106_0106710 3300048909 Bacteria 2177
692 Ga0496106_1119348 3300048909 Bacteria 616
693 Ga0496107_0013738 3300048910 Bacteria 5663
694 Ga0496107_0122265 3300048910 Bacteria 1918
695 Ga0496108_0030378 3300048911 Bacteria 4478
696 Ga0496108_0131695 3300048911 Bacteria 2149
697 Ga0496108_0151149 3300048911 Bacteria 2003
698 Ga0496108_0177973 3300048911 Bacteria 1842
699 Ga0496108_0186787 3300048911 Bacteria 1795
700 Ga0496108_0347605 3300048911 Bacteria 1294
701 Ga0496108_0658970 3300048911 Bacteria 910
702 Ga0496108_1020252 3300048911 Bacteria 706
703 Ga0496108_1034371 3300048911 Bacteria 700
704 Ga0496109_0010978 3300048912 Bacteria 7762
705 Ga0496109_0017529 3300048912 Bacteria 6278
706 Ga0496109_0065641 3300048912 Bacteria 3322
707 Ga0496109_0159649 3300048912 Bacteria 2112
708 Ga0496109_0259973 3300048912 Bacteria 1635
709 Ga0496109_0452944 3300048912 Unclassified 1212
710 Ga0496109_0533530 3300048912 Bacteria 1107
711 Ga0496109_1715426 3300048912 Bacteria 562
712 Ga0496110_0082377 3300048913 Bacteria 2869
713 Ga0496110_0271345 3300048913 Bacteria 1544
714 Ga0496110_0578631 3300048913 Bacteria 1020
715 Ga0496110_0698738 3300048913 Bacteria 916
716 Ga0496110_0898695 3300048913 Bacteria 792
717 Ga0496111_0033463 3300048914 Bacteria 3666
718 Ga0496111_0042138 3300048914 Bacteria 3277
719 Ga0496111_0121012 3300048914 Bacteria 1933
720 Ga0496111_0121707 3300048914 Bacteria 1927
721 Ga0496111_0480867 3300048914 Bacteria 915
722 Ga0496111_1241302 3300048914 Bacteria 527
723 Ga0496112_0005684 3300048915 Bacteria 10832
724 Ga0496112_0077810 3300048915 Bacteria 3280
725 Ga0496112_0293295 3300048915 Bacteria 1572
726 Ga0496112_0649386 3300048915 Bacteria 985
727 Ga0496113_0005866 3300048916 Bacteria 7708
728 Ga0496113_0028649 3300048916 Bacteria 4008
729 Ga0496113_0044627 3300048916 Bacteria 3285
730 Ga0496113_0862372 3300048916 Bacteria 717
731 Ga0496114_0059876 3300048917 Bacteria 3181
732 Ga0496114_0267931 3300048917 Bacteria 1505
733 Ga0496114_0435160 3300048917 Bacteria 1162
734 Ga0496114_0666000 3300048917 Bacteria 914
735 Ga0501031_0268022 3300049568 Bacteria 1109
736 Ga0501031_0307862 3300049568 Bacteria 1026
737 Ga0501031_0648614 3300049568 Bacteria 678
738 Ga0501032_0106114 3300049569 Bacteria 1861
739 Ga0501032_0161355 3300049569 Bacteria 1472
740 Ga0501032_0230613 3300049569 Bacteria 1204
741 Ga0501033_0062904 3300049570 Bacteria 2732
742 Ga0501033_0272021 3300049570 Bacteria 1197
743 Ga0501034_0040812 3300049571 Bacteria 4695
744 Ga0501034_0047013 3300049571 Bacteria 4359
745 Ga0501034_0355819 3300049571 Bacteria 1392
746 Ga0501034_0431231 3300049571 Bacteria 1238
747 Ga0501034_0486794 3300049571 Bacteria 1148
748 Ga0501036_0060546 3300049572 Bacteria 3207
749 Ga0501036_0100063 3300049572 Bacteria 2452
750 Ga0501036_0257087 3300049572 Bacteria 1463
751 Ga0501036_0614827 3300049572 Bacteria 901
752 Ga0501036_0648452 3300049572 Bacteria 874
753 Ga0501036_0834258 3300049572 Bacteria 758
754 Ga0501036_1153026 3300049572 Bacteria 632
755 Ga0501036_1166351 3300049572 Bacteria 628
756 Ga0501037_0020704 3300049573 Bacteria 4857
757 Ga0501037_0140868 3300049573 Bacteria 1726
758 Ga0501038_0061833 3300049574 Bacteria 3202
759 Ga0501038_0062771 3300049574 Bacteria 3173
760 Ga0501038_0146108 3300049574 Bacteria 1931
761 Ga0501039_0138032 3300049575 Bacteria 1915
762 Ga0501039_0140834 3300049575 Bacteria 1895
763 Ga0501039_0316464 3300049575 Bacteria 1227
764 Ga0501039_0336837 3300049575 Bacteria 1185
765 Ga0501039_0942507 3300049575 Bacteria 671
766 Ga0501039_1028387 3300049575 Bacteria 640
767 Ga0501039_1251568 3300049575 Bacteria 573
768 Ga0501039_1385548 3300049575 Bacteria 541
769 Ga0501040_0047201 3300049576 Bacteria 2941
770 Ga0501040_0114793 3300049576 Bacteria 1885
771 Ga0501040_0144779 3300049576 Bacteria 1675
772 Ga0501040_0145655 3300049576 Bacteria 1670
773 Ga0501040_0174879 3300049576 Bacteria 1521
774 Ga0501040_0200908 3300049576 Bacteria 1415
775 Ga0501040_0955697 3300049576 Bacteria 621
776 Ga0501040_1354537 3300049576 Bacteria 516
777 Ga0501041_0069522 3300049577 Bacteria 2160
778 Ga0501041_0072115 3300049577 Bacteria 2121
779 Ga0501041_0132209 3300049577 Bacteria 1554
780 Ga0501041_0139093 3300049577 Bacteria 1514
781 Ga0501041_0269611 3300049577 Bacteria 1071
782 Ga0501041_0315809 3300049577 Bacteria 985
783 Ga0501041_1102922 3300049577 Bacteria 511
784 Ga0501042_0113953 3300049578 Bacteria 1947
785 Ga0501042_0268597 3300049578 Bacteria 1231
786 Ga0501042_0310767 3300049578 Bacteria 1139
787 Ga0501042_0497542 3300049578 Bacteria 885
788 Ga0501042_0561783 3300049578 Bacteria 829
789 Ga0501043_0113573 3300049579 Bacteria 2127
790 Ga0501043_0238624 3300049579 Bacteria 1403
791 Ga0501043_0467893 3300049579 Bacteria 945
792 Ga0501046_0059012 3300049580 Bacteria 3007
793 Ga0501046_0150713 3300049580 Bacteria 1754
794 Ga0501046_0359267 3300049580 Bacteria 1056
795 Ga0501046_0891885 3300049580 Bacteria 621
796 Ga0501047_0316576 3300049581 Bacteria 1401
797 Ga0501047_0366805 3300049581 Bacteria 1275
798 Ga0501047_0780030 3300049581 Bacteria 771
799 Ga0501047_0853041 3300049581 Bacteria 725
800 Ga0501048_0000725 3300049582 Bacteria 24137
801 Ga0501048_0052300 3300049582 Bacteria 2906
802 Ga0501048_0227205 3300049582 Bacteria 1324
803 Ga0501048_0524534 3300049582 Bacteria 849
804 Ga0501048_0566304 3300049582 Bacteria 815
805 Ga0501067_0010872 3300049583 Bacteria 5038
806 Ga0501067_0037432 3300049583 Bacteria 2695
807 Ga0501067_0527570 3300049583 Bacteria 661
808 Ga0501067_0663561 3300049583 Bacteria 586
809 Ga0501068_0154001 3300049584 Bacteria 1446
810 Ga0501068_0156275 3300049584 Bacteria 1436
811 Ga0501068_0283646 3300049584 Bacteria 1059
812 Ga0501068_0898305 3300049584 Bacteria 583
813 Ga0501069_0953147 3300049585 Bacteria 523
814 Ga0501070_0229143 3300049586 Bacteria 1522
815 Ga0501070_0377057 3300049586 Bacteria 1149
816 Ga0501070_0443328 3300049586 Bacteria 1047
817 Ga0501070_0538470 3300049586 Bacteria 936
818 Ga0501070_0756025 3300049586 Unclassified 766
819 Ga0501071_0043355 3300049587 Bacteria 3225
820 Ga0501071_0107484 3300049587 Bacteria 2060
821 Ga0501071_0127701 3300049587 Bacteria 1888
822 Ga0501071_0186980 3300049587 Bacteria 1553
823 Ga0501071_0878668 3300049587 Bacteria 692
824 Ga0501072_0078801 3300049588 Bacteria 2609
825 Ga0501072_0088411 3300049588 Bacteria 2458
826 Ga0501072_0104740 3300049588 Bacteria 2249
827 Ga0501072_0116622 3300049588 Bacteria 2127
828 Ga0501072_0134891 3300049588 Bacteria 1968
829 Ga0501072_0136409 3300049588 Bacteria 1956
830 Ga0501072_1086916 3300049588 Bacteria 622
831 Ga0501073_0174531 3300049589 Bacteria 1488
832 Ga0501073_0194478 3300049589 Unclassified 1403
833 Ga0501073_0307177 3300049589 Bacteria 1094
834 Ga0501073_0365553 3300049589 Bacteria 996
835 Ga0501073_0627446 3300049589 Bacteria 742
836 Ga0501073_0911935 3300049589 Bacteria 605
837 Ga0501073_1164419 3300049589 Bacteria 529
838 Ga0501074_0037653 3300049590 Bacteria 3505
839 Ga0501074_0083694 3300049590 Bacteria 2287
840 Ga0501074_0230080 3300049590 Bacteria 1320
841 Ga0501074_0246753 3300049590 Bacteria 1270
842 Ga0501074_0436423 3300049590 Bacteria 929
843 Ga0501074_0893331 3300049590 Bacteria 625
844 Ga0501075_0025569 3300049591 Bacteria 4337
845 Ga0501075_0070787 3300049591 Bacteria 2636
846 Ga0501075_0134970 3300049591 Bacteria 1880
847 Ga0501075_0156577 3300049591 Bacteria 1737
848 Ga0501075_0329038 3300049591 Bacteria 1164
849 Ga0501075_0541518 3300049591 Bacteria 888
850 Ga0501075_0833725 3300049591 Bacteria 701
851 Ga0501075_0849714 3300049591 Bacteria 694
852 Ga0501076_0048131 3300049592 Bacteria 3371
853 Ga0501076_0052004 3300049592 Bacteria 3243
854 Ga0501076_0088677 3300049592 Bacteria 2486
855 Ga0501076_0122268 3300049592 Bacteria 2108
856 Ga0501076_0769621 3300049592 Bacteria 794
857 Ga0501076_0980099 3300049592 Bacteria 696
858 Ga0501076_1486123 3300049592 Bacteria 556
859 Ga0501076_1536942 3300049592 Bacteria 546
860 Ga0501077_0028422 3300049593 Bacteria 3553
861 Ga0501077_0034293 3300049593 Bacteria 3230
862 Ga0501077_0186922 3300049593 Bacteria 1316
863 Ga0501077_0191161 3300049593 Bacteria 1300
864 Ga0501077_0850130 3300049593 Bacteria 587
865 Ga0501077_0912259 3300049593 Bacteria 565
866 Ga0501079_0090500 3300049741 Bacteria 2370
867 Ga0501079_0097020 3300049741 Bacteria 2285
868 Ga0501079_0106982 3300049741 Bacteria 2171
869 Ga0501079_0233101 3300049741 Bacteria 1438
870 Ga0501079_0337015 3300049741 Bacteria 1181
871 Ga0501079_0476712 3300049741 Bacteria 980
872 Ga0501079_0503470 3300049741 Bacteria 952
873 Ga0501079_0547285 3300049741 Bacteria 910
874 Ga0501080_0069798 3300049742 Bacteria 3268
875 Ga0501080_0146841 3300049742 Bacteria 2180
876 Ga0501080_0165757 3300049742 Bacteria 2039
877 Ga0501080_0387747 3300049742 Bacteria 1258
878 Ga0501080_0416397 3300049742 Bacteria 1207
879 Ga0501080_0535265 3300049742 Bacteria 1044
880 Ga0501080_0905909 3300049742 Bacteria 768
881 Ga0501080_1002026 3300049742 Bacteria 724
882 Ga0501081_0006642 3300049743 Bacteria 7520
883 Ga0501081_0022707 3300049743 Bacteria 4199
884 Ga0501081_0356587 3300049743 Bacteria 1078
885 Ga0501081_0518939 3300049743 Bacteria 889
886 Ga0501081_0716896 3300049743 Bacteria 751
887 Ga0501081_0748224 3300049743 Bacteria 734
888 Ga0501081_1069891 3300049743 Bacteria 610
889 Ga0501083_0000366 3300049744 Bacteria 28661
890 Ga0501083_0023852 3300049744 Bacteria 4242
891 Ga0501083_0057582 3300049744 Bacteria 2601
892 Ga0501083_0332767 3300049744 Bacteria 988
893 Ga0501083_0382418 3300049744 Bacteria 915
894 Ga0501083_0666444 3300049744 Bacteria 677
895 Ga0501083_0868747 3300049744 Bacteria 587
896 Ga0501035_0166001 3300049822 Bacteria 1909
897 Ga0501035_0986216 3300049822 Bacteria 663
898 Ga0501044_0248359 3300049823 Bacteria 1721
899 Ga0501044_0408732 3300049823 Bacteria 1269
900 Ga0501044_0433386 3300049823 Bacteria 1223
901 Ga0501045_0062741 3300049824 Bacteria 2727
902 Ga0501045_0107082 3300049824 Bacteria 2071
903 Ga0501045_0149202 3300049824 Bacteria 1739
904 Ga0501045_0217822 3300049824 Bacteria 1422
905 Ga0501045_0292817 3300049824 Bacteria 1211
906 nmdc:mga0yw44_656657_c1 3300050492 Unclassified 713
907 nmdc:mga05p37_18344_c1 3300050507 Bacteria 8450
908 nmdc:mga05p37_302458_c1 3300050507 Bacteria 1900
909 nmdc:mga05p37_311339_c1 3300050507 Bacteria 1866
910 nmdc:mga05p37_70473_c1 3300050507 Bacteria 4300
911 nmdc:mga08y16_1020227_c1 3300050511 Bacteria 806
912 nmdc:mga08y16_131922_c1 3300050511 Bacteria 2598
913 nmdc:mga08y16_1525983_c1 3300050511 Bacteria 628
914 nmdc:mga08y16_188128_c1 3300050511 Bacteria 2142
915 nmdc:mga08y16_474401_c1 3300050511 Unclassified 1274
916 nmdc:mga0n895_1484744_c1 3300050512 Bacteria 644
917 nmdc:mga0n895_318901_c1 3300050512 Bacteria 1575
918 nmdc:mga0rr50_129171_c1 3300050513 Bacteria 2021
919 nmdc:mga0rr50_220059_c1 3300050513 Unclassified 1567
920 nmdc:mga0a205_162884_c1 3300050515 Bacteria 2126
921 nmdc:mga0a205_202167_c1 3300050515 Bacteria 1877
922 Ga0495601_0016216 3300053077 Bacteria 4513
923 Ga0495601_0571122 3300053077 Bacteria 727
924 Ga0495612_0094471 3300053078 Bacteria 1269
925 Ga0495595_0100982 3300053084 Bacteria 1392
926 Ga0495595_0636284 3300053084 Bacteria 546
927 Ga0495619_0016410 3300053085 Bacteria 4688
928 Ga0495619_0351950 3300053085 Bacteria 1019
929 Ga0501084_0040791 3300054114 Bacteria 3884
930 Ga0501084_0054711 3300054114 Bacteria 3338
931 Ga0501084_0075715 3300054114 Bacteria 2820
932 Ga0501084_0138566 3300054114 Bacteria 2048
933 Ga0501084_0274186 3300054114 Bacteria 1424
934 Ga0501084_0440559 3300054114 Bacteria 1101
935 Ga0501084_0457983 3300054114 Bacteria 1078
936 Ga0501084_0487006 3300054114 Bacteria 1042
937 Ga0501084_0525368 3300054114 Bacteria 1000
938 Ga0501084_0758980 3300054114 Bacteria 817
939 Ga0501084_0901679 3300054114 Bacteria 743
940 Ga0501084_1100541 3300054114 Bacteria 667
941 Ga0501084_1205252 3300054114 Bacteria 635
942 Ga0501084_1744282 3300054114 Bacteria 520
943 Ga0590071_000189 3300059421 Bacteria 17985
944 Ga0590075_018081 3300059424 Bacteria 1741
945 Ga0501082_0036986 3300060353 Bacteria 4205
946 Ga0501082_0050355 3300060353 Bacteria 3592
947 Ga0501082_0194128 3300060353 Bacteria 1766
948 Ga0501082_0244033 3300060353 Bacteria 1563
949 Ga0501082_0519190 3300060353 Bacteria 1041
950 Ga0501082_0534793 3300060353 Bacteria 1025
951 Ga0501082_0662253 3300060353 Bacteria 914
952 Ga0501082_0670203 3300060353 Bacteria 908
953 Ga0501082_1351221 3300060353 Bacteria 622
954 Ga0501082_2023012 3300060353 Bacteria 502
955 Ga0530510_0033333 3300061734 Bacteria 3709
956 Ga0530510_0060525 3300061734 Bacteria 2740
957 Ga0530510_0083461 3300061734 Bacteria 2326
958 Ga0530510_0105394 3300061734 Bacteria 2063
959 Ga0530510_0704487 3300061734 Bacteria 769
960 Ga0530510_0900019 3300061734 Bacteria 676
961 Ga0530510_0959485 3300061734 Bacteria 654
962 Ga0530510_1305268 3300061734 Bacteria 557

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0017877 Ga0395901_0017877_682_1005 84
2 3300049582 Ga0501048_0000725 Ga0501048_0000725_10250_10570 88
3 3300041494 Ga0451837_1035402 Ga0451837_1035402_12_281 89
4 3300005468 Ga0070707_100025207 Ga0070707_1000252073 92
5 iso_pu_bacteria 2919450847 2919454757 95
6 3300025939 Ga0207665_11125471 Ga0207665_111254711 96
7 iso_pu_bacteria 2554235469 2556065943 97
8 3300003320 rootH2_10016961 rootH2_100169617 98
9 3300003320 rootH2_10247369 rootH2_102473694 98
10 3300009093 Ga0105240_10044197 Ga0105240_100441972 98
11 3300009177 Ga0105248_10054628 Ga0105248_100546282 98
12 3300013306 Ga0163162_10931184 Ga0163162_109311842 98
13 3300021441 Ga0213871_10177200 Ga0213871_101772002 98
14 3300025913 Ga0207695_10705285 Ga0207695_107052852 98
15 3300025941 Ga0207711_10880302 Ga0207711_108803022 98
16 3300039438 Ga0436360_0263685 Ga0436360_0263685_1299_1625 98
17 3300039438 Ga0436360_1115059 Ga0436360_1115059_92_418 98
18 3300039447 Ga0436361_1146080 Ga0436361_1146080_232_561 98
19 3300046516 Ga0495628_0607309 Ga0495628_0607309_278_604 98
20 3300005345 Ga0070692_10518170 Ga0070692_105181702 99
21 3300005366 Ga0070659_100430523 Ga0070659_1004305232 99
22 3300005444 Ga0070694_100327892 Ga0070694_1003278922 99
23 3300005458 Ga0070681_10549404 Ga0070681_105494042 99
24 3300005459 Ga0068867_101427197 Ga0068867_1014271971 99
25 3300005530 Ga0070679_101146898 Ga0070679_1011468982 99
26 3300005539 Ga0068853_100497354 Ga0068853_1004973542 99
27 3300005545 Ga0070695_100192056 Ga0070695_1001920562 99
28 3300005578 Ga0068854_100934598 Ga0068854_1009345982 99
29 3300005842 Ga0068858_101487124 Ga0068858_1014871242 99
30 3300009094 Ga0111539_10379491 Ga0111539_103794912 99
31 3300013306 Ga0163162_11214252 Ga0163162_112142522 99
32 3300025901 Ga0207688_10340999 Ga0207688_103409992 99
33 3300025921 Ga0207652_11582571 Ga0207652_115825712 99
34 3300025932 Ga0207690_10347462 Ga0207690_103474622 99
35 3300025933 Ga0207706_10286659 Ga0207706_102866593 99
36 3300026023 Ga0207677_10803064 Ga0207677_108030641 99
37 3300026035 Ga0207703_10477429 Ga0207703_104774292 99
38 3300026041 Ga0207639_11006988 Ga0207639_110069882 99
39 3300026075 Ga0207708_10027078 Ga0207708_100270783 99
40 3300026078 Ga0207702_10423542 Ga0207702_104235422 99
41 3300026089 Ga0207648_10271978 Ga0207648_102719782 99
42 3300028381 Ga0268264_10452043 Ga0268264_104520432 99
43 3300031901 Ga0307406_11349324 Ga0307406_113493241 99
44 3300031901 Ga0307406_11672182 Ga0307406_116721822 99
45 3300037068 Ga0373925_1113872 Ga0373925_1113872_52_375 99
46 3300048911 Ga0496108_0658970 Ga0496108_0658970_130_453 99
47 3300048914 Ga0496111_0480867 Ga0496111_0480867_186_509 99
48 3300050511 nmdc:mga08y16_1525983_c1 nmdc:mga08y16_1525983_c1_280_600 99
49 3300026075 Ga0207708_11604107 Ga0207708_116041072 100
50 3300042156 Ga0439446_0095485 Ga0439446_0095485_462_764 100
51 3300003203 JGI25406J46586_10027416 JGI25406J46586_100274162 101
52 3300003320 rootH2_10041962 rootH2_100419622 101
53 3300003323 rootH1_10020450 rootH1_100204502 101
54 3300005293 Ga0065715_10961770 Ga0065715_109617701 101
55 3300005328 Ga0070676_10236036 Ga0070676_102360362 101
56 3300005328 Ga0070676_10599700 Ga0070676_105997002 101
57 3300005329 Ga0070683_100644225 Ga0070683_1006442252 101
58 3300005330 Ga0070690_100148212 Ga0070690_1001482122 101
59 3300005330 Ga0070690_101358852 Ga0070690_1013588521 101
60 3300005331 Ga0070670_100368652 Ga0070670_1003686522 101
61 3300005333 Ga0070677_10418474 Ga0070677_104184741 101
62 3300005334 Ga0068869_100457324 Ga0068869_1004573241 101
63 3300005334 Ga0068869_101657215 Ga0068869_1016572151 101
64 3300005336 Ga0070680_100763137 Ga0070680_1007631372 101
65 3300005337 Ga0070682_100352490 Ga0070682_1003524902 101
66 3300005337 Ga0070682_100354112 Ga0070682_1003541122 101
67 3300005337 Ga0070682_100650347 Ga0070682_1006503471 101
68 3300005337 Ga0070682_101996449 Ga0070682_1019964491 101
69 3300005338 Ga0068868_100152639 Ga0068868_1001526392 101
70 3300005338 Ga0068868_101052529 Ga0068868_1010525292 101
71 3300005338 Ga0068868_101591236 Ga0068868_1015912362 101
72 3300005339 Ga0070660_100098548 Ga0070660_1000985481 101
73 3300005339 Ga0070660_100599296 Ga0070660_1005992962 101
74 3300005340 Ga0070689_100022734 Ga0070689_1000227344 101
75 3300005340 Ga0070689_100125139 Ga0070689_1001251392 101
76 3300005340 Ga0070689_100357111 Ga0070689_1003571112 101
77 3300005341 Ga0070691_10134575 Ga0070691_101345752 101
78 3300005344 Ga0070661_100199944 Ga0070661_1001999443 101
79 3300005344 Ga0070661_101229554 Ga0070661_1012295542 101
80 3300005345 Ga0070692_10025730 Ga0070692_100257301 101
81 3300005345 Ga0070692_10225742 Ga0070692_102257422 101
82 3300005345 Ga0070692_10585780 Ga0070692_105857801 101
83 3300005345 Ga0070692_10933696 Ga0070692_109336961 101
84 3300005347 Ga0070668_100115147 Ga0070668_1001151472 101
85 3300005347 Ga0070668_100185384 Ga0070668_1001853842 101
86 3300005347 Ga0070668_100359692 Ga0070668_1003596922 101
87 3300005347 Ga0070668_100594938 Ga0070668_1005949382 101
88 3300005347 Ga0070668_100815044 Ga0070668_1008150442 101
89 3300005353 Ga0070669_101303047 Ga0070669_1013030471 101
90 3300005354 Ga0070675_100139086 Ga0070675_1001390864 101
91 3300005354 Ga0070675_100395775 Ga0070675_1003957752 101
92 3300005356 Ga0070674_100040553 Ga0070674_1000405533 101
93 3300005356 Ga0070674_100209921 Ga0070674_1002099211 101
94 3300005356 Ga0070674_101184564 Ga0070674_1011845642 101
95 3300005364 Ga0070673_100541484 Ga0070673_1005414842 101
96 3300005364 Ga0070673_101435897 Ga0070673_1014358971 101
97 3300005365 Ga0070688_100704933 Ga0070688_1007049332 101
98 3300005365 Ga0070688_100987390 Ga0070688_1009873901 101
99 3300005366 Ga0070659_100015650 Ga0070659_1000156501 101
100 3300005366 Ga0070659_101666369 Ga0070659_1016663691 101
101 3300005366 Ga0070659_101692357 Ga0070659_1016923571 101
102 3300005367 Ga0070667_100585371 Ga0070667_1005853712 101
103 3300005367 Ga0070667_100658974 Ga0070667_1006589742 101
104 3300005406 Ga0070703_10299321 Ga0070703_102993211 101
105 3300005438 Ga0070701_10049674 Ga0070701_100496742 101
106 3300005438 Ga0070701_10304334 Ga0070701_103043342 101
107 3300005439 Ga0070711_100552070 Ga0070711_1005520702 101
108 3300005440 Ga0070705_100035713 Ga0070705_1000357132 101
109 3300005440 Ga0070705_100680183 Ga0070705_1006801832 101
110 3300005441 Ga0070700_100052017 Ga0070700_1000520174 101
111 3300005441 Ga0070700_100054398 Ga0070700_1000543982 101
112 3300005441 Ga0070700_100059450 Ga0070700_1000594503 101
113 3300005441 Ga0070700_100306225 Ga0070700_1003062252 101
114 3300005441 Ga0070700_101044844 Ga0070700_1010448442 101
115 3300005444 Ga0070694_100034060 Ga0070694_1000340602 101
116 3300005444 Ga0070694_100136520 Ga0070694_1001365204 101
117 3300005444 Ga0070694_100218069 Ga0070694_1002180692 101
118 3300005444 Ga0070694_100220578 Ga0070694_1002205782 101
119 3300005445 Ga0070708_100102469 Ga0070708_1001024692 101
120 3300005445 Ga0070708_100260834 Ga0070708_1002608342 101
121 3300005445 Ga0070708_100448181 Ga0070708_1004481811 101
122 3300005445 Ga0070708_100542486 Ga0070708_1005424862 101
123 3300005445 Ga0070708_100601551 Ga0070708_1006015512 101
124 3300005455 Ga0070663_101258504 Ga0070663_1012585042 101
125 3300005455 Ga0070663_101299142 Ga0070663_1012991422 101
126 3300005455 Ga0070663_101819370 Ga0070663_1018193702 101
127 3300005456 Ga0070678_100137826 Ga0070678_1001378262 101
128 3300005456 Ga0070678_100249957 Ga0070678_1002499573 101
129 3300005456 Ga0070678_100419704 Ga0070678_1004197042 101
130 3300005456 Ga0070678_100528970 Ga0070678_1005289702 101
131 3300005456 Ga0070678_100537665 Ga0070678_1005376652 101
132 3300005456 Ga0070678_100764945 Ga0070678_1007649452 101
133 3300005456 Ga0070678_101271423 Ga0070678_1012714232 101
134 3300005457 Ga0070662_100174199 Ga0070662_1001741992 101
135 3300005457 Ga0070662_100621452 Ga0070662_1006214522 101
136 3300005458 Ga0070681_10315714 Ga0070681_103157142 101
137 3300005458 Ga0070681_10812784 Ga0070681_108127842 101
138 3300005458 Ga0070681_11208650 Ga0070681_112086501 101
139 3300005458 Ga0070681_11208732 Ga0070681_112087322 101
140 3300005459 Ga0068867_100037830 Ga0068867_1000378304 101
141 3300005459 Ga0068867_101063418 Ga0068867_1010634182 101
142 3300005466 Ga0070685_10026310 Ga0070685_100263102 101
143 3300005466 Ga0070685_10699323 Ga0070685_106993232 101
144 3300005467 Ga0070706_100222584 Ga0070706_1002225842 101
145 3300005468 Ga0070707_100396221 Ga0070707_1003962212 101
146 3300005468 Ga0070707_100572488 Ga0070707_1005724882 101
147 3300005471 Ga0070698_100164248 Ga0070698_1001642482 101
148 3300005471 Ga0070698_100252012 Ga0070698_1002520122 101
149 3300005471 Ga0070698_100327200 Ga0070698_1003272001 101
150 3300005471 Ga0070698_101087309 Ga0070698_1010873092 101
151 3300005518 Ga0070699_100008575 Ga0070699_1000085759 101
152 3300005518 Ga0070699_101334491 Ga0070699_1013344911 101
153 3300005530 Ga0070679_100400729 Ga0070679_1004007292 101
154 3300005530 Ga0070679_100404901 Ga0070679_1004049012 101
155 3300005530 Ga0070679_100719571 Ga0070679_1007195712 101
156 3300005530 Ga0070679_100867230 Ga0070679_1008672302 101
157 3300005535 Ga0070684_100186927 Ga0070684_1001869273 101
158 3300005535 Ga0070684_100575704 Ga0070684_1005757041 101
159 3300005536 Ga0070697_100093865 Ga0070697_1000938654 101
160 3300005536 Ga0070697_100097763 Ga0070697_1000977632 101
161 3300005536 Ga0070697_100397843 Ga0070697_1003978432 101
162 3300005536 Ga0070697_100440145 Ga0070697_1004401452 101
163 3300005539 Ga0068853_100388878 Ga0068853_1003888782 101
164 3300005543 Ga0070672_100734034 Ga0070672_1007340342 101
165 3300005543 Ga0070672_101024435 Ga0070672_1010244352 101
166 3300005544 Ga0070686_100072359 Ga0070686_1000723592 101
167 3300005544 Ga0070686_100120228 Ga0070686_1001202283 101
168 3300005544 Ga0070686_100185107 Ga0070686_1001851072 101
169 3300005544 Ga0070686_100588665 Ga0070686_1005886652 101
170 3300005544 Ga0070686_100610339 Ga0070686_1006103392 101
171 3300005544 Ga0070686_100721487 Ga0070686_1007214871 101
172 3300005545 Ga0070695_100054976 Ga0070695_1000549762 101
173 3300005545 Ga0070695_100082748 Ga0070695_1000827483 101
174 3300005545 Ga0070695_100920971 Ga0070695_1009209712 101
175 3300005545 Ga0070695_101124659 Ga0070695_1011246591 101
176 3300005546 Ga0070696_100014238 Ga0070696_1000142386 101
177 3300005546 Ga0070696_100029799 Ga0070696_1000297992 101
178 3300005546 Ga0070696_100072070 Ga0070696_1000720704 101
179 3300005546 Ga0070696_100860435 Ga0070696_1008604352 101
180 3300005546 Ga0070696_101313572 Ga0070696_1013135721 101
181 3300005546 Ga0070696_101353244 Ga0070696_1013532442 101
182 3300005546 Ga0070696_101788678 Ga0070696_1017886781 101
183 3300005547 Ga0070693_100072762 Ga0070693_1000727624 101
184 3300005547 Ga0070693_100089178 Ga0070693_1000891782 101
185 3300005549 Ga0070704_100064012 Ga0070704_1000640122 101
186 3300005549 Ga0070704_101193995 Ga0070704_1011939952 101
187 3300005549 Ga0070704_101501735 Ga0070704_1015017352 101
188 3300005563 Ga0068855_100847382 Ga0068855_1008473822 101
189 3300005564 Ga0070664_100133647 Ga0070664_1001336474 101
190 3300005564 Ga0070664_100381505 Ga0070664_1003815052 101
191 3300005564 Ga0070664_100742324 Ga0070664_1007423242 101
192 3300005564 Ga0070664_101393127 Ga0070664_1013931272 101
193 3300005564 Ga0070664_101594443 Ga0070664_1015944431 101
194 3300005577 Ga0068857_100142197 Ga0068857_1001421973 101
195 3300005578 Ga0068854_100084803 Ga0068854_1000848032 101
196 3300005578 Ga0068854_100783160 Ga0068854_1007831602 101
197 3300005578 Ga0068854_101061831 Ga0068854_1010618312 101
198 3300005578 Ga0068854_101701763 Ga0068854_1017017632 101
199 3300005614 Ga0068856_100200695 Ga0068856_1002006952 101
200 3300005614 Ga0068856_100666754 Ga0068856_1006667542 101
201 3300005615 Ga0070702_100035782 Ga0070702_1000357822 101
202 3300005615 Ga0070702_100156558 Ga0070702_1001565583 101
203 3300005615 Ga0070702_100464968 Ga0070702_1004649682 101
204 3300005615 Ga0070702_101703033 Ga0070702_1017030331 101
205 3300005616 Ga0068852_100186891 Ga0068852_1001868912 101
206 3300005616 Ga0068852_101105787 Ga0068852_1011057872 101
207 3300005617 Ga0068859_101579095 Ga0068859_1015790952 101
208 3300005618 Ga0068864_100537254 Ga0068864_1005372542 101
209 3300005618 Ga0068864_100840386 Ga0068864_1008403862 101
210 3300005618 Ga0068864_101906823 Ga0068864_1019068232 101
211 3300005618 Ga0068864_102141219 Ga0068864_1021412192 101
212 3300005718 Ga0068866_10584039 Ga0068866_105840392 101
213 3300005718 Ga0068866_10597154 Ga0068866_105971541 101
214 3300005718 Ga0068866_10865520 Ga0068866_108655201 101
215 3300005719 Ga0068861_100205052 Ga0068861_1002050521 101
216 3300005719 Ga0068861_100335407 Ga0068861_1003354072 101
217 3300005719 Ga0068861_100502843 Ga0068861_1005028432 101
218 3300005719 Ga0068861_100727372 Ga0068861_1007273722 101
219 3300005719 Ga0068861_100753090 Ga0068861_1007530902 101
220 3300005719 Ga0068861_102402387 Ga0068861_1024023872 101
221 3300005840 Ga0068870_10154553 Ga0068870_101545531 101
222 3300005841 Ga0068863_101817861 Ga0068863_1018178611 101
223 3300005842 Ga0068858_100103958 Ga0068858_1001039582 101
224 3300005842 Ga0068858_100222021 Ga0068858_1002220211 101
225 3300005842 Ga0068858_100415907 Ga0068858_1004159072 101
226 3300005842 Ga0068858_101652130 Ga0068858_1016521301 101
227 3300005843 Ga0068860_100531355 Ga0068860_1005313551 101
228 3300005843 Ga0068860_101791862 Ga0068860_1017918621 101
229 3300005844 Ga0068862_100259914 Ga0068862_1002599142 101
230 3300005844 Ga0068862_101230904 Ga0068862_1012309042 101
231 3300005844 Ga0068862_101247836 Ga0068862_1012478361 101
232 3300005985 Ga0081539_10029426 Ga0081539_100294262 101
233 3300005985 Ga0081539_10056210 Ga0081539_100562102 101
234 3300006038 Ga0075365_10133768 Ga0075365_101337683 101
235 3300006058 Ga0075432_10092489 Ga0075432_100924892 101
236 3300006237 Ga0097621_100152764 Ga0097621_1001527644 101
237 3300006358 Ga0068871_100849554 Ga0068871_1008495542 101
238 3300006844 Ga0075428_100113608 Ga0075428_1001136083 101
239 3300006844 Ga0075428_100486259 Ga0075428_1004862592 101
240 3300006844 Ga0075428_100776662 Ga0075428_1007766622 101
241 3300006847 Ga0075431_100844501 Ga0075431_1008445012 101
242 3300006852 Ga0075433_10369755 Ga0075433_103697552 101
243 3300006852 Ga0075433_10505951 Ga0075433_105059512 101
244 3300006852 Ga0075433_10560793 Ga0075433_105607932 101
245 3300006871 Ga0075434_100187428 Ga0075434_1001874282 101
246 3300006871 Ga0075434_100338781 Ga0075434_1003387812 101
247 3300006881 Ga0068865_100078447 Ga0068865_1000784472 101
248 3300006881 Ga0068865_100213479 Ga0068865_1002134793 101
249 3300006881 Ga0068865_100433050 Ga0068865_1004330502 101
250 3300006881 Ga0068865_100592630 Ga0068865_1005926302 101
251 3300006881 Ga0068865_101073885 Ga0068865_1010738852 101
252 3300006914 Ga0075436_101079646 Ga0075436_1010796462 101
253 3300006931 Ga0097620_101579035 Ga0097620_1015790352 101
254 3300007076 Ga0075435_100596311 Ga0075435_1005963112 101
255 3300007076 Ga0075435_100668355 Ga0075435_1006683552 101
256 3300009093 Ga0105240_11143548 Ga0105240_111435481 101
257 3300009094 Ga0111539_10083116 Ga0111539_100831162 101
258 3300009094 Ga0111539_10163105 Ga0111539_101631053 101
259 3300009094 Ga0111539_10247245 Ga0111539_102472452 101
260 3300009094 Ga0111539_11149912 Ga0111539_111499122 101
261 3300009094 Ga0111539_11158339 Ga0111539_111583392 101
262 3300009098 Ga0105245_10061212 Ga0105245_100612122 101
263 3300009098 Ga0105245_10259642 Ga0105245_102596422 101
264 3300009098 Ga0105245_10265852 Ga0105245_102658522 101
265 3300009098 Ga0105245_10390300 Ga0105245_103903003 101
266 3300009098 Ga0105245_10390566 Ga0105245_103905662 101
267 3300009098 Ga0105245_10412610 Ga0105245_104126102 101
268 3300009098 Ga0105245_10487151 Ga0105245_104871512 101
269 3300009098 Ga0105245_10707723 Ga0105245_107077232 101
270 3300009098 Ga0105245_11560036 Ga0105245_115600362 101
271 3300009098 Ga0105245_11926018 Ga0105245_119260181 101
272 3300009098 Ga0105245_12157575 Ga0105245_121575751 101
273 3300009101 Ga0105247_10323393 Ga0105247_103233932 101
274 3300009101 Ga0105247_10488216 Ga0105247_104882162 101
275 3300009147 Ga0114129_10173746 Ga0114129_101737462 101
276 3300009147 Ga0114129_10255828 Ga0114129_102558282 101
277 3300009147 Ga0114129_10270353 Ga0114129_102703534 101
278 3300009147 Ga0114129_11705941 Ga0114129_117059412 101
279 3300009148 Ga0105243_10085338 Ga0105243_100853382 101
280 3300009148 Ga0105243_10114671 Ga0105243_101146712 101
281 3300009148 Ga0105243_10274461 Ga0105243_102744612 101
282 3300009148 Ga0105243_10314081 Ga0105243_103140812 101
283 3300009148 Ga0105243_10550736 Ga0105243_105507362 101
284 3300009148 Ga0105243_11174643 Ga0105243_111746432 101
285 3300009174 Ga0105241_12067047 Ga0105241_120670471 101
286 3300009176 Ga0105242_10057420 Ga0105242_100574203 101
287 3300009176 Ga0105242_10134891 Ga0105242_101348914 101
288 3300009176 Ga0105242_10843851 Ga0105242_108438512 101
289 3300009177 Ga0105248_11213140 Ga0105248_112131401 101
290 3300009177 Ga0105248_11463580 Ga0105248_114635801 101
291 3300009177 Ga0105248_11898017 Ga0105248_118980172 101
292 3300009177 Ga0105248_13388968 Ga0105248_133889681 101
293 3300009551 Ga0105238_10070578 Ga0105238_100705784 101
294 3300009551 Ga0105238_10374143 Ga0105238_103741433 101
295 3300009553 Ga0105249_10111503 Ga0105249_101115034 101
296 3300009553 Ga0105249_10139553 Ga0105249_101395532 101
297 3300009553 Ga0105249_10556239 Ga0105249_105562391 101
298 3300009553 Ga0105249_11742264 Ga0105249_117422641 101
299 3300010375 Ga0105239_10183486 Ga0105239_101834864 101
300 3300010375 Ga0105239_10225542 Ga0105239_102255423 101
301 3300010375 Ga0105239_11033154 Ga0105239_110331542 101
302 3300010375 Ga0105239_11548821 Ga0105239_115488211 101
303 3300011119 Ga0105246_10440601 Ga0105246_104406012 101
304 3300011119 Ga0105246_10608934 Ga0105246_106089342 101
305 3300011119 Ga0105246_10998763 Ga0105246_109987631 101
306 3300011119 Ga0105246_11385517 Ga0105246_113855171 101
307 3300011119 Ga0105246_11732794 Ga0105246_117327942 101
308 3300012507 Ga0157342_1050137 Ga0157342_10501372 101
309 3300013102 Ga0157371_11226651 Ga0157371_112266512 101
310 3300013296 Ga0157374_10528563 Ga0157374_105285631 101
311 3300013296 Ga0157374_10891944 Ga0157374_108919441 101
312 3300013296 Ga0157374_11313298 Ga0157374_113132982 101
313 3300013297 Ga0157378_10117009 Ga0157378_101170092 101
314 3300013297 Ga0157378_11551325 Ga0157378_115513252 101
315 3300013297 Ga0157378_11774611 Ga0157378_117746112 101
316 3300013297 Ga0157378_12077549 Ga0157378_120775491 101
317 3300013306 Ga0163162_10747468 Ga0163162_107474681 101
318 3300013306 Ga0163162_10786677 Ga0163162_107866772 101
319 3300013306 Ga0163162_10969871 Ga0163162_109698711 101
320 3300013306 Ga0163162_11535614 Ga0163162_115356142 101
321 3300013307 Ga0157372_11048214 Ga0157372_110482141 101
322 3300013308 Ga0157375_10182066 Ga0157375_101820662 101
323 3300013308 Ga0157375_10447930 Ga0157375_104479304 101
324 3300013308 Ga0157375_10781512 Ga0157375_107815122 101
325 3300013308 Ga0157375_11120408 Ga0157375_111204082 101
326 3300013308 Ga0157375_11287547 Ga0157375_112875471 101
327 3300014325 Ga0163163_10011059 Ga0163163_100110599 101
328 3300014325 Ga0163163_10089481 Ga0163163_100894812 101
329 3300014325 Ga0163163_10229313 Ga0163163_102293132 101
330 3300014325 Ga0163163_10247169 Ga0163163_102471693 101
331 3300014325 Ga0163163_10329052 Ga0163163_103290523 101
332 3300014325 Ga0163163_11048556 Ga0163163_110485562 101
333 3300014326 Ga0157380_10038585 Ga0157380_100385854 101
334 3300014326 Ga0157380_10110883 Ga0157380_101108832 101
335 3300014326 Ga0157380_10491946 Ga0157380_104919462 101
336 3300014326 Ga0157380_10953972 Ga0157380_109539722 101
337 3300014745 Ga0157377_10016618 Ga0157377_100166183 101
338 3300014745 Ga0157377_10206994 Ga0157377_102069942 101
339 3300014745 Ga0157377_10361175 Ga0157377_103611752 101
340 3300014745 Ga0157377_10450062 Ga0157377_104500622 101
341 3300014745 Ga0157377_10700719 Ga0157377_107007192 101
342 3300014745 Ga0157377_11146848 Ga0157377_111468481 101
343 3300014968 Ga0157379_10108237 Ga0157379_101082373 101
344 3300014968 Ga0157379_10160852 Ga0157379_101608522 101
345 3300014968 Ga0157379_10247422 Ga0157379_102474223 101
346 3300014968 Ga0157379_11470508 Ga0157379_114705082 101
347 3300014968 Ga0157379_11711181 Ga0157379_117111812 101
348 3300014969 Ga0157376_10870384 Ga0157376_108703842 101
349 3300014969 Ga0157376_10966747 Ga0157376_109667472 101
350 3300014969 Ga0157376_12715255 Ga0157376_127152551 101
351 3300017792 Ga0163161_10253589 Ga0163161_102535892 101
352 3300017792 Ga0163161_10256644 Ga0163161_102566442 101
353 3300017792 Ga0163161_10286463 Ga0163161_102864633 101
354 3300017792 Ga0163161_10392266 Ga0163161_103922662 101
355 3300017792 Ga0163161_10480261 Ga0163161_104802612 101
356 3300025321 Ga0207656_10473495 Ga0207656_104734951 101
357 3300025885 Ga0207653_10229605 Ga0207653_102296052 101
358 3300025899 Ga0207642_10067918 Ga0207642_100679182 101
359 3300025899 Ga0207642_10917455 Ga0207642_109174551 101
360 3300025900 Ga0207710_10334696 Ga0207710_103346962 101
361 3300025901 Ga0207688_10030278 Ga0207688_100302782 101
362 3300025901 Ga0207688_10163195 Ga0207688_101631952 101
363 3300025903 Ga0207680_10711008 Ga0207680_107110082 101
364 3300025904 Ga0207647_10101791 Ga0207647_101017913 101
365 3300025907 Ga0207645_10478937 Ga0207645_104789372 101
366 3300025908 Ga0207643_10016672 Ga0207643_100166722 101
367 3300025908 Ga0207643_10160866 Ga0207643_101608662 101
368 3300025908 Ga0207643_10593847 Ga0207643_105938471 101
369 3300025908 Ga0207643_10790053 Ga0207643_107900531 101
370 3300025910 Ga0207684_10158375 Ga0207684_101583752 101
371 3300025912 Ga0207707_10291079 Ga0207707_102910792 101
372 3300025912 Ga0207707_11018031 Ga0207707_110180312 101
373 3300025912 Ga0207707_11387696 Ga0207707_113876961 101
374 3300025916 Ga0207663_11641556 Ga0207663_116415561 101
375 3300025917 Ga0207660_10853859 Ga0207660_108538592 101
376 3300025917 Ga0207660_10872714 Ga0207660_108727142 101
377 3300025918 Ga0207662_10057431 Ga0207662_100574312 101
378 3300025918 Ga0207662_10579817 Ga0207662_105798172 101
379 3300025919 Ga0207657_10065544 Ga0207657_100655442 101
380 3300025919 Ga0207657_10317132 Ga0207657_103171322 101
381 3300025920 Ga0207649_10650077 Ga0207649_106500772 101
382 3300025920 Ga0207649_10716733 Ga0207649_107167332 101
383 3300025920 Ga0207649_11075407 Ga0207649_110754072 101
384 3300025921 Ga0207652_10107893 Ga0207652_101078932 101
385 3300025921 Ga0207652_10586935 Ga0207652_105869353 101
386 3300025921 Ga0207652_10616927 Ga0207652_106169273 101
387 3300025921 Ga0207652_11092722 Ga0207652_110927221 101
388 3300025922 Ga0207646_10146007 Ga0207646_101460074 101
389 3300025922 Ga0207646_10827774 Ga0207646_108277742 101
390 3300025923 Ga0207681_10550006 Ga0207681_105500062 101
391 3300025923 Ga0207681_10662404 Ga0207681_106624042 101
392 3300025925 Ga0207650_10408400 Ga0207650_104084002 101
393 3300025925 Ga0207650_10942020 Ga0207650_109420202 101
394 3300025925 Ga0207650_11392763 Ga0207650_113927632 101
395 3300025926 Ga0207659_10222120 Ga0207659_102221202 101
396 3300025926 Ga0207659_10480710 Ga0207659_104807102 101
397 3300025926 Ga0207659_10991786 Ga0207659_109917861 101
398 3300025927 Ga0207687_10180464 Ga0207687_101804642 101
399 3300025927 Ga0207687_10453847 Ga0207687_104538472 101
400 3300025927 Ga0207687_10475775 Ga0207687_104757752 101
401 3300025927 Ga0207687_10601319 Ga0207687_106013192 101
402 3300025927 Ga0207687_10651948 Ga0207687_106519481 101
403 3300025927 Ga0207687_10671264 Ga0207687_106712642 101
404 3300025927 Ga0207687_10943300 Ga0207687_109433001 101
405 3300025931 Ga0207644_11135708 Ga0207644_111357081 101
406 3300025932 Ga0207690_10807211 Ga0207690_108072112 101
407 3300025932 Ga0207690_11284731 Ga0207690_112847312 101
408 3300025933 Ga0207706_10072044 Ga0207706_100720444 101
409 3300025933 Ga0207706_10087943 Ga0207706_100879434 101
410 3300025933 Ga0207706_10270340 Ga0207706_102703402 101
411 3300025933 Ga0207706_10675569 Ga0207706_106755691 101
412 3300025934 Ga0207686_10319868 Ga0207686_103198682 101
413 3300025934 Ga0207686_10406670 Ga0207686_104066702 101
414 3300025935 Ga0207709_10137682 Ga0207709_101376822 101
415 3300025935 Ga0207709_10301932 Ga0207709_103019322 101
416 3300025936 Ga0207670_10082652 Ga0207670_100826522 101
417 3300025936 Ga0207670_10337047 Ga0207670_103370471 101
418 3300025936 Ga0207670_10908428 Ga0207670_109084282 101
419 3300025937 Ga0207669_10042488 Ga0207669_100424883 101
420 3300025937 Ga0207669_10410115 Ga0207669_104101153 101
421 3300025938 Ga0207704_10219443 Ga0207704_102194432 101
422 3300025938 Ga0207704_10275800 Ga0207704_102758002 101
423 3300025940 Ga0207691_10133269 Ga0207691_101332692 101
424 3300025940 Ga0207691_10428486 Ga0207691_104284862 101
425 3300025941 Ga0207711_10457175 Ga0207711_104571752 101
426 3300025941 Ga0207711_10559730 Ga0207711_105597302 101
427 3300025942 Ga0207689_10254215 Ga0207689_102542153 101
428 3300025942 Ga0207689_10363582 Ga0207689_103635822 101
429 3300025944 Ga0207661_11010135 Ga0207661_110101352 101
430 3300025944 Ga0207661_11159002 Ga0207661_111590022 101
431 3300025945 Ga0207679_10370591 Ga0207679_103705913 101
432 3300025945 Ga0207679_10421090 Ga0207679_104210902 101
433 3300025945 Ga0207679_10658102 Ga0207679_106581022 101
434 3300025945 Ga0207679_10714639 Ga0207679_107146392 101
435 3300025949 Ga0207667_11181810 Ga0207667_111818102 101
436 3300025960 Ga0207651_10385267 Ga0207651_103852673 101
437 3300025960 Ga0207651_10847430 Ga0207651_108474302 101
438 3300025960 Ga0207651_11874009 Ga0207651_118740092 101
439 3300025961 Ga0207712_10005919 Ga0207712_100059197 101
440 3300025961 Ga0207712_10372681 Ga0207712_103726811 101
441 3300025961 Ga0207712_10770950 Ga0207712_107709502 101
442 3300025972 Ga0207668_10019059 Ga0207668_100190592 101
443 3300025972 Ga0207668_10110474 Ga0207668_101104742 101
444 3300025972 Ga0207668_10388264 Ga0207668_103882642 101
445 3300025972 Ga0207668_10448158 Ga0207668_104481582 101
446 3300025972 Ga0207668_11625516 Ga0207668_116255161 101
447 3300025981 Ga0207640_10136496 Ga0207640_101364962 101
448 3300025981 Ga0207640_10230364 Ga0207640_102303642 101
449 3300025981 Ga0207640_10365465 Ga0207640_103654652 101
450 3300025981 Ga0207640_10520554 Ga0207640_105205542 101
451 3300025981 Ga0207640_10709653 Ga0207640_107096532 101
452 3300025986 Ga0207658_10317816 Ga0207658_103178162 101
453 3300025986 Ga0207658_10681225 Ga0207658_106812252 101
454 3300026023 Ga0207677_10196835 Ga0207677_101968352 101
455 3300026023 Ga0207677_10515685 Ga0207677_105156851 101
456 3300026023 Ga0207677_10628862 Ga0207677_106288622 101
457 3300026023 Ga0207677_10998501 Ga0207677_109985012 101
458 3300026023 Ga0207677_11052709 Ga0207677_110527092 101
459 3300026023 Ga0207677_11811243 Ga0207677_118112432 101
460 3300026035 Ga0207703_10180006 Ga0207703_101800062 101
461 3300026035 Ga0207703_10687286 Ga0207703_106872862 101
462 3300026035 Ga0207703_10863343 Ga0207703_108633432 101
463 3300026041 Ga0207639_10990714 Ga0207639_109907142 101
464 3300026041 Ga0207639_11103114 Ga0207639_111031141 101
465 3300026067 Ga0207678_10051746 Ga0207678_100517462 101
466 3300026067 Ga0207678_10190485 Ga0207678_101904852 101
467 3300026067 Ga0207678_11395090 Ga0207678_113950901 101
468 3300026067 Ga0207678_11524405 Ga0207678_115244051 101
469 3300026067 Ga0207678_11809148 Ga0207678_118091481 101
470 3300026075 Ga0207708_10046959 Ga0207708_100469593 101
471 3300026075 Ga0207708_10058239 Ga0207708_100582392 101
472 3300026075 Ga0207708_10077455 Ga0207708_100774553 101
473 3300026075 Ga0207708_10104167 Ga0207708_101041672 101
474 3300026075 Ga0207708_10267045 Ga0207708_102670452 101
475 3300026075 Ga0207708_10696059 Ga0207708_106960592 101
476 3300026075 Ga0207708_11415064 Ga0207708_114150642 101
477 3300026078 Ga0207702_10092653 Ga0207702_100926532 101
478 3300026088 Ga0207641_12292266 Ga0207641_122922661 101
479 3300026089 Ga0207648_10124183 Ga0207648_101241831 101
480 3300026089 Ga0207648_10187344 Ga0207648_101873441 101
481 3300026089 Ga0207648_11067686 Ga0207648_110676861 101
482 3300026095 Ga0207676_10280099 Ga0207676_102800992 101
483 3300026095 Ga0207676_10385037 Ga0207676_103850373 101
484 3300026095 Ga0207676_10942844 Ga0207676_109428442 101
485 3300026095 Ga0207676_11257492 Ga0207676_112574922 101
486 3300026116 Ga0207674_10013614 Ga0207674_1001361410 101
487 3300026116 Ga0207674_10399929 Ga0207674_103999292 101
488 3300026118 Ga0207675_100369599 Ga0207675_1003695992 101
489 3300026118 Ga0207675_100418325 Ga0207675_1004183252 101
490 3300026118 Ga0207675_100551977 Ga0207675_1005519771 101
491 3300026118 Ga0207675_100683476 Ga0207675_1006834762 101
492 3300026118 Ga0207675_100698522 Ga0207675_1006985222 101
493 3300026118 Ga0207675_100992121 Ga0207675_1009921211 101
494 3300026121 Ga0207683_10113879 Ga0207683_101138792 101
495 3300026121 Ga0207683_10185240 Ga0207683_101852402 101
496 3300026121 Ga0207683_10688342 Ga0207683_106883421 101
497 3300026121 Ga0207683_10837266 Ga0207683_108372662 101
498 3300026121 Ga0207683_11707821 Ga0207683_117078211 101
499 3300026142 Ga0207698_11145580 Ga0207698_111455802 101
500 3300026142 Ga0207698_11464131 Ga0207698_114641312 101
501 3300027614 Ga0209970_1097799 Ga0209970_10977992 101
502 3300027682 Ga0209971_1136023 Ga0209971_11360232 101
503 3300027876 Ga0209974_10139179 Ga0209974_101391792 101
504 3300027907 Ga0207428_10238070 Ga0207428_102380701 101
505 3300028380 Ga0268265_10128199 Ga0268265_101281994 101
506 3300028380 Ga0268265_10134270 Ga0268265_101342704 101
507 3300028380 Ga0268265_11705333 Ga0268265_117053331 101
508 3300028381 Ga0268264_11474183 Ga0268264_114741831 101
509 3300028381 Ga0268264_11935325 Ga0268264_119353252 101
510 3300028556 Ga0265337_1025186 Ga0265337_10251864 101
511 3300028563 Ga0265319_1090269 Ga0265319_10902692 101
512 3300028563 Ga0265319_1118035 Ga0265319_11180352 101
513 3300028573 Ga0265334_10017086 Ga0265334_100170864 101
514 3300028573 Ga0265334_10066481 Ga0265334_100664812 101
515 3300028573 Ga0265334_10233234 Ga0265334_102332342 101
516 3300028577 Ga0265318_10027403 Ga0265318_100274034 101
517 3300028577 Ga0265318_10032808 Ga0265318_100328082 101
518 3300028577 Ga0265318_10065308 Ga0265318_100653082 101
519 3300028577 Ga0265318_10205186 Ga0265318_102051862 101
520 3300028653 Ga0265323_10100835 Ga0265323_101008352 101
521 3300028653 Ga0265323_10158006 Ga0265323_101580062 101
522 3300028654 Ga0265322_10023037 Ga0265322_100230372 101
523 3300028654 Ga0265322_10066830 Ga0265322_100668302 101
524 3300028654 Ga0265322_10138898 Ga0265322_101388982 101
525 3300028666 Ga0265336_10021334 Ga0265336_100213341 101
526 3300028666 Ga0265336_10115861 Ga0265336_101158611 101
527 3300028800 Ga0265338_10063875 Ga0265338_100638754 101
528 3300028800 Ga0265338_10210218 Ga0265338_102102182 101
529 3300028800 Ga0265338_10832125 Ga0265338_108321252 101
530 3300028800 Ga0265338_11233506 Ga0265338_112335061 101
531 3300029957 Ga0265324_10006906 Ga0265324_100069064 101
532 3300031235 Ga0265330_10022220 Ga0265330_100222203 101
533 3300031235 Ga0265330_10023113 Ga0265330_100231132 101
534 3300031235 Ga0265330_10033335 Ga0265330_100333352 101
535 3300031235 Ga0265330_10043710 Ga0265330_100437102 101
536 3300031235 Ga0265330_10201803 Ga0265330_102018032 101
537 3300031235 Ga0265330_10299656 Ga0265330_102996562 101
538 3300031235 Ga0265330_10369136 Ga0265330_103691362 101
539 3300031238 Ga0265332_10018915 Ga0265332_100189152 101
540 3300031239 Ga0265328_10051663 Ga0265328_100516632 101
541 3300031239 Ga0265328_10110104 Ga0265328_101101042 101
542 3300031240 Ga0265320_10008973 Ga0265320_100089733 101
543 3300031240 Ga0265320_10153210 Ga0265320_101532102 101
544 3300031240 Ga0265320_10166058 Ga0265320_101660582 101
545 3300031240 Ga0265320_10286496 Ga0265320_102864962 101
546 3300031240 Ga0265320_10431330 Ga0265320_104313302 101
547 3300031241 Ga0265325_10024484 Ga0265325_100244842 101
548 3300031241 Ga0265325_10065109 Ga0265325_100651092 101
549 3300031241 Ga0265325_10079666 Ga0265325_100796662 101
550 3300031241 Ga0265325_10082224 Ga0265325_100822242 101
551 3300031241 Ga0265325_10155077 Ga0265325_101550772 101
552 3300031242 Ga0265329_10001690 Ga0265329_1000169013 101
553 3300031242 Ga0265329_10040372 Ga0265329_100403723 101
554 3300031242 Ga0265329_10049764 Ga0265329_100497643 101
555 3300031247 Ga0265340_10002587 Ga0265340_100025876 101
556 3300031247 Ga0265340_10006154 Ga0265340_100061548 101
557 3300031247 Ga0265340_10010584 Ga0265340_100105845 101
558 3300031247 Ga0265340_10014489 Ga0265340_100144892 101
559 3300031247 Ga0265340_10023721 Ga0265340_100237213 101
560 3300031247 Ga0265340_10117125 Ga0265340_101171252 101
561 3300031249 Ga0265339_10028210 Ga0265339_100282102 101
562 3300031249 Ga0265339_10090867 Ga0265339_100908672 101
563 3300031249 Ga0265339_10138978 Ga0265339_101389782 101
564 3300031249 Ga0265339_10173500 Ga0265339_101735002 101
565 3300031249 Ga0265339_10198339 Ga0265339_101983392 101
566 3300031250 Ga0265331_10017780 Ga0265331_100177802 101
567 3300031250 Ga0265331_10352040 Ga0265331_103520402 101
568 3300031344 Ga0265316_10012137 Ga0265316_100121375 101
569 3300031344 Ga0265316_10029418 Ga0265316_100294186 101
570 3300031344 Ga0265316_10043169 Ga0265316_100431691 101
571 3300031344 Ga0265316_10084578 Ga0265316_100845782 101
572 3300031344 Ga0265316_10332295 Ga0265316_103322952 101
573 3300031344 Ga0265316_10349136 Ga0265316_103491362 101
574 3300031548 Ga0307408_100077221 Ga0307408_1000772214 101
575 3300031595 Ga0265313_10005225 Ga0265313_100052254 101
576 3300031595 Ga0265313_10075370 Ga0265313_100753702 101
577 3300031595 Ga0265313_10115404 Ga0265313_101154042 101
578 3300031595 Ga0265313_10204676 Ga0265313_102046762 101
579 3300031595 Ga0265313_10261075 Ga0265313_102610752 101
580 3300031711 Ga0265314_10002544 Ga0265314_100025444 101
581 3300031711 Ga0265314_10003068 Ga0265314_100030686 101
582 3300031711 Ga0265314_10148599 Ga0265314_101485992 101
583 3300031711 Ga0265314_10193558 Ga0265314_101935582 101
584 3300031711 Ga0265314_10631335 Ga0265314_106313351 101
585 3300031712 Ga0265342_10006227 Ga0265342_1000622710 101
586 3300031712 Ga0265342_10021592 Ga0265342_100215922 101
587 3300031712 Ga0265342_10057470 Ga0265342_100574704 101
588 3300031712 Ga0265342_10284736 Ga0265342_102847361 101
589 3300031712 Ga0265342_10576802 Ga0265342_105768022 101
590 3300031731 Ga0307405_10336232 Ga0307405_103362322 101
591 3300031824 Ga0307413_10961791 Ga0307413_109617912 101
592 3300031852 Ga0307410_10477906 Ga0307410_104779062 101
593 3300031903 Ga0307407_10376319 Ga0307407_103763192 101
594 3300031903 Ga0307407_10595052 Ga0307407_105950522 101
595 3300031995 Ga0307409_100139853 Ga0307409_1001398532 101
596 3300031995 Ga0307409_100199728 Ga0307409_1001997282 101
597 3300032002 Ga0307416_100001176 Ga0307416_10000117615 101
598 3300032002 Ga0307416_100660880 Ga0307416_1006608802 101
599 3300032002 Ga0307416_101852880 Ga0307416_1018528802 101
600 3300032002 Ga0307416_102954160 Ga0307416_1029541602 101
601 3300032005 Ga0307411_10363239 Ga0307411_103632392 101
602 3300032126 Ga0307415_100526118 Ga0307415_1005261182 101
603 3300032126 Ga0307415_101773278 Ga0307415_1017732781 101
604 3300034820 Ga0373959_0065518 Ga0373959_0065518_349_654 101
605 3300034820 Ga0373959_0101059 Ga0373959_0101059_358_663 101
606 3300035084 Ga0373928_0092712 Ga0373928_0092712_85_390 101
607 3300035085 Ga0373929_0104037 Ga0373929_0104037_97_402 101
608 3300035112 Ga0373932_0244480 Ga0373932_0244480_334_642 101
609 3300035115 Ga0373941_0257761 Ga0373941_0257761_26_331 101
610 3300035121 Ga0373960_0215663 Ga0373960_0215663_97_402 101
611 3300035172 Ga0373955_0214708 Ga0373955_0214708_668_973 101
612 3300035207 Ga0373942_0096437 Ga0373942_0096437_50_355 101
613 3300035242 Ga0373962_0033326 Ga0373962_0033326_1071_1376 101
614 3300035242 Ga0373962_0108938 Ga0373962_0108938_25_330 101
615 3300035725 Ga0373947_0611394 Ga0373947_0611394_227_532 101
616 3300037312 Ga0395899_0549168 Ga0395899_0549168_356_661 101
617 3300037418 Ga0395900_0439904 Ga0395900_0439904_154_459 101
618 3300037418 Ga0395900_0501778 Ga0395900_0501778_724_1029 101
619 3300037471 Ga0395905_0858116 Ga0395905_0858116_496_801 101
620 3300038443 Ga0395901_0280227 Ga0395901_0280227_27_332 101
621 3300038443 Ga0395901_2021374 Ga0395901_2021374_74_379 101
622 3300039437 Ga0436365_1485382 Ga0436365_1485382_587_892 101
623 3300041441 Ga0451787_536941 Ga0451787_536941_109_435 101
624 3300041441 Ga0451787_675165 Ga0451787_675165_48_353 101
625 3300041451 Ga0451791_1458017 Ga0451791_1458017_121_426 101
626 3300041452 Ga0451793_1125082 Ga0451793_1125082_128_436 101
627 3300041456 Ga0451795_1460265 Ga0451795_1460265_167_475 101
628 3300041456 Ga0451795_1537678 Ga0451795_1537678_352_678 101
629 3300041460 Ga0451802_0894001 Ga0451802_0894001_100_405 101
630 3300041501 Ga0451845_0263999 Ga0451845_0263999_301_609 101
631 3300041509 Ga0451843_0151156 Ga0451843_0151156_255_560 101
632 3300041511 Ga0451855_1451656 Ga0451855_1451656_34_339 101
633 3300041512 Ga0451853_0129182 Ga0451853_0129182_29_334 101
634 3300041512 Ga0451853_0135129 Ga0451853_0135129_18_392 101
635 3300041512 Ga0451853_0628733 Ga0451853_0628733_136_441 101
636 3300041512 Ga0451853_1064254 Ga0451853_1064254_850_1158 101
637 3300041512 Ga0451853_2873151 Ga0451853_2873151_487_792 101
638 3300042118 Ga0450914_007210 Ga0450914_007210_369_674 101
639 3300042436 Ga0439435_0254332 Ga0439435_0254332_12_317 101
640 3300042530 Ga0450916_065330 Ga0450916_065330_73_378 101
641 3300042530 Ga0450916_097568 Ga0450916_097568_101_406 101
642 3300044673 Ga0453683_0792285 Ga0453683_0792285_286_594 101
643 3300044706 Ga0466964_0452518 Ga0466964_0452518_147_452 101
644 3300046454 Ga0495592_0602507 Ga0495592_0602507_82_390 101
645 3300046454 Ga0495592_0639995 Ga0495592_0639995_285_590 101
646 3300046454 Ga0495592_0740542 Ga0495592_0740542_254_559 101
647 3300046459 Ga0495629_0239440 Ga0495629_0239440_822_1127 101
648 3300046459 Ga0495629_0267819 Ga0495629_0267819_675_980 101
649 3300046461 Ga0495641_0548427 Ga0495641_0548427_23_328 101
650 3300046473 Ga0495582_0254788 Ga0495582_0254788_414_719 101
651 3300046511 Ga0495608_0310088 Ga0495608_0310088_455_763 101
652 3300046516 Ga0495628_0285421 Ga0495628_0285421_655_960 101
653 3300046517 Ga0495630_0298151 Ga0495630_0298151_713_1021 101
654 3300046523 Ga0495644_0273886 Ga0495644_0273886_42_347 101
655 3300046529 Ga0495652_0538504 Ga0495652_0538504_439_744 101
656 3300046531 Ga0495665_0550653 Ga0495665_0550653_245_550 101
657 3300046533 Ga0495640_0287391 Ga0495640_0287391_584_889 101
658 3300046559 Ga0495667_0115528 Ga0495667_0115528_620_925 101
659 3300046615 Ga0495656_0689355 Ga0495656_0689355_193_498 101
660 3300046663 Ga0495635_0062887 Ga0495635_0062887_1396_1701 101
661 3300046663 Ga0495635_0599985 Ga0495635_0599985_221_529 101
662 3300046675 Ga0495657_0330408 Ga0495657_0330408_364_669 101
663 3300046680 Ga0495646_0345956 Ga0495646_0345956_116_421 101
664 3300046689 Ga0495613_0582585 Ga0495613_0582585_67_372 101
665 3300046690 Ga0495624_0900012 Ga0495624_0900012_122_427 101
666 3300046694 Ga0495649_0622869 Ga0495649_0622869_207_512 101
667 3300046794 Ga0495589_0539536 Ga0495589_0539536_145_450 101
668 3300046809 Ga0495600_0197212 Ga0495600_0197212_255_560 101
669 3300047319 Ga0495674_0168247 Ga0495674_0168247_594_899 101
670 3300047319 Ga0495674_0443014 Ga0495674_0443014_56_361 101
671 3300047321 Ga0495676_0398141 Ga0495676_0398141_38_343 101
672 3300047444 Ga0495675_0268724 Ga0495675_0268724_511_816 101
673 3300048088 Ga0495602_0218185 Ga0495602_0218185_107_412 101
674 3300048903 Ga0496100_0056711 Ga0496100_0056711_1087_1392 101
675 3300048903 Ga0496100_0069716 Ga0496100_0069716_1487_1792 101
676 3300048903 Ga0496100_1436052 Ga0496100_1436052_57_362 101
677 3300048904 Ga0496101_0034194 Ga0496101_0034194_1633_1938 101
678 3300048904 Ga0496101_0179285 Ga0496101_0179285_473_778 101
679 3300048904 Ga0496101_0373325 Ga0496101_0373325_478_807 101
680 3300048904 Ga0496101_1486336 Ga0496101_1486336_194_499 101
681 3300048905 Ga0496102_0032069 Ga0496102_0032069_2996_3301 101
682 3300048905 Ga0496102_0043371 Ga0496102_0043371_786_1091 101
683 3300048905 Ga0496102_0409977 Ga0496102_0409977_642_947 101
684 3300048905 Ga0496102_0468672 Ga0496102_0468672_812_1117 101
685 3300048905 Ga0496102_0501699 Ga0496102_0501699_37_342 101
686 3300048905 Ga0496102_0732835 Ga0496102_0732835_254_559 101
687 3300048906 Ga0496103_0013350 Ga0496103_0013350_1522_1827 101
688 3300048906 Ga0496103_0334638 Ga0496103_0334638_512_817 101
689 3300048907 Ga0496104_0051704 Ga0496104_0051704_908_1213 101
690 3300048907 Ga0496104_0055493 Ga0496104_0055493_1487_1792 101
691 3300048907 Ga0496104_0114696 Ga0496104_0114696_1745_2050 101
692 3300048907 Ga0496104_0633328 Ga0496104_0633328_89_394 101
693 3300048908 Ga0496105_0024902 Ga0496105_0024902_3626_3931 101
694 3300048908 Ga0496105_0042189 Ga0496105_0042189_1969_2274 101
695 3300048908 Ga0496105_0087184 Ga0496105_0087184_583_888 101
696 3300048908 Ga0496105_0935733 Ga0496105_0935733_80_385 101
697 3300048909 Ga0496106_0106710 Ga0496106_0106710_833_1138 101
698 3300048909 Ga0496106_1119348 Ga0496106_1119348_126_431 101
699 3300048910 Ga0496107_0013738 Ga0496107_0013738_4440_4745 101
700 3300048910 Ga0496107_0122265 Ga0496107_0122265_839_1144 101
701 3300048911 Ga0496108_0030378 Ga0496108_0030378_2716_3021 101
702 3300048911 Ga0496108_0131695 Ga0496108_0131695_1421_1726 101
703 3300048911 Ga0496108_0151149 Ga0496108_0151149_1466_1771 101
704 3300048911 Ga0496108_0177973 Ga0496108_0177973_77_382 101
705 3300048911 Ga0496108_0186787 Ga0496108_0186787_951_1256 101
706 3300048911 Ga0496108_0347605 Ga0496108_0347605_557_862 101
707 3300048911 Ga0496108_1020252 Ga0496108_1020252_40_345 101
708 3300048911 Ga0496108_1034371 Ga0496108_1034371_374_679 101
709 3300048912 Ga0496109_0010978 Ga0496109_0010978_5967_6272 101
710 3300048912 Ga0496109_0017529 Ga0496109_0017529_852_1157 101
711 3300048912 Ga0496109_0065641 Ga0496109_0065641_2875_3180 101
712 3300048912 Ga0496109_0159649 Ga0496109_0159649_339_644 101
713 3300048912 Ga0496109_0259973 Ga0496109_0259973_963_1268 101
714 3300048912 Ga0496109_0452944 Ga0496109_0452944_521_826 101
715 3300048912 Ga0496109_0533530 Ga0496109_0533530_543_848 101
716 3300048912 Ga0496109_1715426 Ga0496109_1715426_172_477 101
717 3300048913 Ga0496110_0082377 Ga0496110_0082377_1459_1764 101
718 3300048913 Ga0496110_0271345 Ga0496110_0271345_794_1099 101
719 3300048913 Ga0496110_0578631 Ga0496110_0578631_507_812 101
720 3300048913 Ga0496110_0698738 Ga0496110_0698738_49_354 101
721 3300048913 Ga0496110_0898695 Ga0496110_0898695_455_760 101
722 3300048914 Ga0496111_0033463 Ga0496111_0033463_2102_2407 101
723 3300048914 Ga0496111_0042138 Ga0496111_0042138_2280_2585 101
724 3300048914 Ga0496111_0121012 Ga0496111_0121012_700_1005 101
725 3300048914 Ga0496111_0121707 Ga0496111_0121707_1338_1643 101
726 3300048914 Ga0496111_1241302 Ga0496111_1241302_159_473 101
727 3300048915 Ga0496112_0005684 Ga0496112_0005684_1491_1796 101
728 3300048915 Ga0496112_0077810 Ga0496112_0077810_936_1241 101
729 3300048915 Ga0496112_0293295 Ga0496112_0293295_886_1191 101
730 3300048915 Ga0496112_0649386 Ga0496112_0649386_282_587 101
731 3300048916 Ga0496113_0005866 Ga0496113_0005866_5821_6126 101
732 3300048916 Ga0496113_0028649 Ga0496113_0028649_2424_2729 101
733 3300048916 Ga0496113_0044627 Ga0496113_0044627_2148_2453 101
734 3300048916 Ga0496113_0862372 Ga0496113_0862372_109_414 101
735 3300048917 Ga0496114_0059876 Ga0496114_0059876_1364_1669 101
736 3300048917 Ga0496114_0267931 Ga0496114_0267931_236_544 101
737 3300048917 Ga0496114_0435160 Ga0496114_0435160_777_1082 101
738 3300048917 Ga0496114_0666000 Ga0496114_0666000_23_328 101
739 3300049568 Ga0501031_0268022 Ga0501031_0268022_652_957 101
740 3300049568 Ga0501031_0307862 Ga0501031_0307862_631_936 101
741 3300049568 Ga0501031_0648614 Ga0501031_0648614_231_536 101
742 3300049569 Ga0501032_0106114 Ga0501032_0106114_118_423 101
743 3300049569 Ga0501032_0161355 Ga0501032_0161355_189_494 101
744 3300049569 Ga0501032_0230613 Ga0501032_0230613_720_1070 101
745 3300049570 Ga0501033_0062904 Ga0501033_0062904_2108_2413 101
746 3300049570 Ga0501033_0272021 Ga0501033_0272021_38_343 101
747 3300049571 Ga0501034_0040812 Ga0501034_0040812_1034_1363 101
748 3300049571 Ga0501034_0047013 Ga0501034_0047013_2953_3282 101
749 3300049571 Ga0501034_0355819 Ga0501034_0355819_613_942 101
750 3300049571 Ga0501034_0431231 Ga0501034_0431231_323_652 101
751 3300049571 Ga0501034_0486794 Ga0501034_0486794_123_452 101
752 3300049572 Ga0501036_0060546 Ga0501036_0060546_894_1199 101
753 3300049572 Ga0501036_0100063 Ga0501036_0100063_1882_2187 101
754 3300049572 Ga0501036_0257087 Ga0501036_0257087_495_800 101
755 3300049572 Ga0501036_0614827 Ga0501036_0614827_461_790 101
756 3300049572 Ga0501036_0648452 Ga0501036_0648452_109_414 101
757 3300049572 Ga0501036_0834258 Ga0501036_0834258_387_716 101
758 3300049572 Ga0501036_1153026 Ga0501036_1153026_250_555 101
759 3300049572 Ga0501036_1166351 Ga0501036_1166351_182_487 101
760 3300049573 Ga0501037_0020704 Ga0501037_0020704_929_1234 101
761 3300049573 Ga0501037_0140868 Ga0501037_0140868_622_951 101
762 3300049574 Ga0501038_0061833 Ga0501038_0061833_1998_2303 101
763 3300049574 Ga0501038_0062771 Ga0501038_0062771_857_1162 101
764 3300049574 Ga0501038_0146108 Ga0501038_0146108_1103_1432 101
765 3300049575 Ga0501039_0138032 Ga0501039_0138032_1007_1312 101
766 3300049575 Ga0501039_0140834 Ga0501039_0140834_531_836 101
767 3300049575 Ga0501039_0316464 Ga0501039_0316464_166_471 101
768 3300049575 Ga0501039_0336837 Ga0501039_0336837_401_706 101
769 3300049575 Ga0501039_0942507 Ga0501039_0942507_284_589 101
770 3300049575 Ga0501039_1028387 Ga0501039_1028387_203_532 101
771 3300049575 Ga0501039_1251568 Ga0501039_1251568_91_396 101
772 3300049575 Ga0501039_1385548 Ga0501039_1385548_183_488 101
773 3300049576 Ga0501040_0047201 Ga0501040_0047201_895_1200 101
774 3300049576 Ga0501040_0114793 Ga0501040_0114793_1090_1395 101
775 3300049576 Ga0501040_0144779 Ga0501040_0144779_890_1195 101
776 3300049576 Ga0501040_0145655 Ga0501040_0145655_50_355 101
777 3300049576 Ga0501040_0174879 Ga0501040_0174879_911_1261 101
778 3300049576 Ga0501040_0200908 Ga0501040_0200908_995_1300 101
779 3300049576 Ga0501040_0955697 Ga0501040_0955697_109_414 101
780 3300049576 Ga0501040_1354537 Ga0501040_1354537_130_435 101
781 3300049577 Ga0501041_0069522 Ga0501041_0069522_840_1145 101
782 3300049577 Ga0501041_0072115 Ga0501041_0072115_378_683 101
783 3300049577 Ga0501041_0132209 Ga0501041_0132209_1148_1498 101
784 3300049577 Ga0501041_0139093 Ga0501041_0139093_689_994 101
785 3300049577 Ga0501041_0269611 Ga0501041_0269611_593_898 101
786 3300049577 Ga0501041_0315809 Ga0501041_0315809_376_681 101
787 3300049577 Ga0501041_1102922 Ga0501041_1102922_180_485 101
788 3300049578 Ga0501042_0113953 Ga0501042_0113953_813_1118 101
789 3300049578 Ga0501042_0268597 Ga0501042_0268597_631_936 101
790 3300049578 Ga0501042_0310767 Ga0501042_0310767_632_937 101
791 3300049578 Ga0501042_0497542 Ga0501042_0497542_327_632 101
792 3300049578 Ga0501042_0561783 Ga0501042_0561783_191_496 101
793 3300049579 Ga0501043_0113573 Ga0501043_0113573_292_597 101
794 3300049579 Ga0501043_0238624 Ga0501043_0238624_296_601 101
795 3300049579 Ga0501043_0467893 Ga0501043_0467893_544_873 101
796 3300049580 Ga0501046_0059012 Ga0501046_0059012_1467_1772 101
797 3300049580 Ga0501046_0150713 Ga0501046_0150713_593_898 101
798 3300049580 Ga0501046_0359267 Ga0501046_0359267_669_974 101
799 3300049580 Ga0501046_0891885 Ga0501046_0891885_155_460 101
800 3300049581 Ga0501047_0316576 Ga0501047_0316576_63_392 101
801 3300049581 Ga0501047_0366805 Ga0501047_0366805_612_941 101
802 3300049581 Ga0501047_0780030 Ga0501047_0780030_383_712 101
803 3300049581 Ga0501047_0853041 Ga0501047_0853041_87_392 101
804 3300049582 Ga0501048_0052300 Ga0501048_0052300_717_1022 101
805 3300049582 Ga0501048_0227205 Ga0501048_0227205_728_1033 101
806 3300049582 Ga0501048_0524534 Ga0501048_0524534_240_545 101
807 3300049582 Ga0501048_0566304 Ga0501048_0566304_77_382 101
808 3300049583 Ga0501067_0010872 Ga0501067_0010872_3953_4282 101
809 3300049583 Ga0501067_0037432 Ga0501067_0037432_1871_2200 101
810 3300049583 Ga0501067_0527570 Ga0501067_0527570_255_563 101
811 3300049583 Ga0501067_0663561 Ga0501067_0663561_111_416 101
812 3300049584 Ga0501068_0154001 Ga0501068_0154001_886_1191 101
813 3300049584 Ga0501068_0156275 Ga0501068_0156275_479_784 101
814 3300049584 Ga0501068_0283646 Ga0501068_0283646_638_943 101
815 3300049584 Ga0501068_0898305 Ga0501068_0898305_254_559 101
816 3300049585 Ga0501069_0953147 Ga0501069_0953147_142_471 101
817 3300049586 Ga0501070_0229143 Ga0501070_0229143_1153_1482 101
818 3300049586 Ga0501070_0377057 Ga0501070_0377057_703_1008 101
819 3300049586 Ga0501070_0443328 Ga0501070_0443328_10_339 101
820 3300049586 Ga0501070_0538470 Ga0501070_0538470_145_450 101
821 3300049586 Ga0501070_0756025 Ga0501070_0756025_128_457 101
822 3300049587 Ga0501071_0043355 Ga0501071_0043355_2441_2746 101
823 3300049587 Ga0501071_0107484 Ga0501071_0107484_1729_2034 101
824 3300049587 Ga0501071_0127701 Ga0501071_0127701_1520_1825 101
825 3300049587 Ga0501071_0186980 Ga0501071_0186980_533_838 101
826 3300049587 Ga0501071_0878668 Ga0501071_0878668_104_454 101
827 3300049588 Ga0501072_0078801 Ga0501072_0078801_1337_1642 101
828 3300049588 Ga0501072_0088411 Ga0501072_0088411_1546_1851 101
829 3300049588 Ga0501072_0104740 Ga0501072_0104740_806_1156 101
830 3300049588 Ga0501072_0116622 Ga0501072_0116622_1278_1583 101
831 3300049588 Ga0501072_0134891 Ga0501072_0134891_1347_1652 101
832 3300049588 Ga0501072_0136409 Ga0501072_0136409_120_425 101
833 3300049588 Ga0501072_1086916 Ga0501072_1086916_289_594 101
834 3300049589 Ga0501073_0174531 Ga0501073_0174531_194_523 101
835 3300049589 Ga0501073_0194478 Ga0501073_0194478_791_1120 101
836 3300049589 Ga0501073_0307177 Ga0501073_0307177_92_397 101
837 3300049589 Ga0501073_0365553 Ga0501073_0365553_182_511 101
838 3300049589 Ga0501073_0627446 Ga0501073_0627446_232_537 101
839 3300049589 Ga0501073_0911935 Ga0501073_0911935_119_448 101
840 3300049589 Ga0501073_1164419 Ga0501073_1164419_108_437 101
841 3300049590 Ga0501074_0037653 Ga0501074_0037653_2322_2627 101
842 3300049590 Ga0501074_0083694 Ga0501074_0083694_605_910 101
843 3300049590 Ga0501074_0230080 Ga0501074_0230080_913_1218 101
844 3300049590 Ga0501074_0246753 Ga0501074_0246753_257_562 101
845 3300049590 Ga0501074_0436423 Ga0501074_0436423_47_397 101
846 3300049590 Ga0501074_0893331 Ga0501074_0893331_235_540 101
847 3300049591 Ga0501075_0025569 Ga0501075_0025569_1167_1472 101
848 3300049591 Ga0501075_0070787 Ga0501075_0070787_420_725 101
849 3300049591 Ga0501075_0134970 Ga0501075_0134970_1234_1539 101
850 3300049591 Ga0501075_0156577 Ga0501075_0156577_858_1163 101
851 3300049591 Ga0501075_0329038 Ga0501075_0329038_199_504 101
852 3300049591 Ga0501075_0541518 Ga0501075_0541518_269_574 101
853 3300049591 Ga0501075_0833725 Ga0501075_0833725_67_372 101
854 3300049591 Ga0501075_0849714 Ga0501075_0849714_65_394 101
855 3300049592 Ga0501076_0048131 Ga0501076_0048131_1640_1945 101
856 3300049592 Ga0501076_0052004 Ga0501076_0052004_2099_2404 101
857 3300049592 Ga0501076_0088677 Ga0501076_0088677_2088_2393 101
858 3300049592 Ga0501076_0122268 Ga0501076_0122268_847_1152 101
859 3300049592 Ga0501076_0769621 Ga0501076_0769621_436_741 101
860 3300049592 Ga0501076_0980099 Ga0501076_0980099_12_317 101
861 3300049592 Ga0501076_1486123 Ga0501076_1486123_24_329 101
862 3300049592 Ga0501076_1536942 Ga0501076_1536942_13_318 101
863 3300049593 Ga0501077_0028422 Ga0501077_0028422_2775_3080 101
864 3300049593 Ga0501077_0034293 Ga0501077_0034293_1326_1631 101
865 3300049593 Ga0501077_0186922 Ga0501077_0186922_690_995 101
866 3300049593 Ga0501077_0191161 Ga0501077_0191161_546_851 101
867 3300049593 Ga0501077_0850130 Ga0501077_0850130_192_497 101
868 3300049593 Ga0501077_0912259 Ga0501077_0912259_22_327 101
869 3300049741 Ga0501079_0090500 Ga0501079_0090500_1546_1851 101
870 3300049741 Ga0501079_0097020 Ga0501079_0097020_1777_2082 101
871 3300049741 Ga0501079_0106982 Ga0501079_0106982_937_1242 101
872 3300049741 Ga0501079_0233101 Ga0501079_0233101_781_1086 101
873 3300049741 Ga0501079_0337015 Ga0501079_0337015_161_466 101
874 3300049741 Ga0501079_0476712 Ga0501079_0476712_153_458 101
875 3300049741 Ga0501079_0503470 Ga0501079_0503470_103_408 101
876 3300049741 Ga0501079_0547285 Ga0501079_0547285_344_649 101
877 3300049742 Ga0501080_0069798 Ga0501080_0069798_480_785 101
878 3300049742 Ga0501080_0146841 Ga0501080_0146841_1120_1449 101
879 3300049742 Ga0501080_0165757 Ga0501080_0165757_388_693 101
880 3300049742 Ga0501080_0387747 Ga0501080_0387747_577_882 101
881 3300049742 Ga0501080_0416397 Ga0501080_0416397_846_1175 101
882 3300049742 Ga0501080_0535265 Ga0501080_0535265_600_905 101
883 3300049742 Ga0501080_0905909 Ga0501080_0905909_44_373 101
884 3300049742 Ga0501080_1002026 Ga0501080_1002026_124_453 101
885 3300049743 Ga0501081_0006642 Ga0501081_0006642_23_328 101
886 3300049743 Ga0501081_0022707 Ga0501081_0022707_1426_1731 101
887 3300049743 Ga0501081_0356587 Ga0501081_0356587_257_562 101
888 3300049743 Ga0501081_0518939 Ga0501081_0518939_72_377 101
889 3300049743 Ga0501081_0716896 Ga0501081_0716896_206_511 101
890 3300049743 Ga0501081_0748224 Ga0501081_0748224_208_513 101
891 3300049743 Ga0501081_1069891 Ga0501081_1069891_235_540 101
892 3300049744 Ga0501083_0000366 Ga0501083_0000366_23624_23953 101
893 3300049744 Ga0501083_0023852 Ga0501083_0023852_1624_1953 101
894 3300049744 Ga0501083_0057582 Ga0501083_0057582_35_340 101
895 3300049744 Ga0501083_0332767 Ga0501083_0332767_584_913 101
896 3300049744 Ga0501083_0382418 Ga0501083_0382418_38_367 101
897 3300049744 Ga0501083_0666444 Ga0501083_0666444_71_376 101
898 3300049744 Ga0501083_0868747 Ga0501083_0868747_28_357 101
899 3300049822 Ga0501035_0166001 Ga0501035_0166001_608_913 101
900 3300049822 Ga0501035_0986216 Ga0501035_0986216_67_372 101
901 3300049823 Ga0501044_0248359 Ga0501044_0248359_632_961 101
902 3300049823 Ga0501044_0408732 Ga0501044_0408732_751_1080 101
903 3300049823 Ga0501044_0433386 Ga0501044_0433386_862_1191 101
904 3300049824 Ga0501045_0062741 Ga0501045_0062741_1422_1727 101
905 3300049824 Ga0501045_0107082 Ga0501045_0107082_140_445 101
906 3300049824 Ga0501045_0149202 Ga0501045_0149202_894_1199 101
907 3300049824 Ga0501045_0217822 Ga0501045_0217822_747_1097 101
908 3300049824 Ga0501045_0292817 Ga0501045_0292817_203_508 101
909 3300050492 nmdc:mga0yw44_656657_c1 nmdc:mga0yw44_656657_c1_272_577 101
910 3300050507 nmdc:mga05p37_18344_c1 nmdc:mga05p37_18344_c1_1600_1905 101
911 3300050507 nmdc:mga05p37_302458_c1 nmdc:mga05p37_302458_c1_1443_1748 101
912 3300050507 nmdc:mga05p37_311339_c1 nmdc:mga05p37_311339_c1_775_1080 101
913 3300050507 nmdc:mga05p37_70473_c1 nmdc:mga05p37_70473_c1_2289_2594 101
914 3300050511 nmdc:mga08y16_1020227_c1 nmdc:mga08y16_1020227_c1_82_387 101
915 3300050511 nmdc:mga08y16_131922_c1 nmdc:mga08y16_131922_c1_866_1171 101
916 3300050511 nmdc:mga08y16_188128_c1 nmdc:mga08y16_188128_c1_1042_1356 101
917 3300050511 nmdc:mga08y16_474401_c1 nmdc:mga08y16_474401_c1_398_703 101
918 3300050512 nmdc:mga0n895_1484744_c1 nmdc:mga0n895_1484744_c1_210_515 101
919 3300050512 nmdc:mga0n895_318901_c1 nmdc:mga0n895_318901_c1_789_1094 101
920 3300050513 nmdc:mga0rr50_129171_c1 nmdc:mga0rr50_129171_c1_321_626 101
921 3300050513 nmdc:mga0rr50_220059_c1 nmdc:mga0rr50_220059_c1_278_583 101
922 3300050515 nmdc:mga0a205_162884_c1 nmdc:mga0a205_162884_c1_432_737 101
923 3300050515 nmdc:mga0a205_202167_c1 nmdc:mga0a205_202167_c1_340_645 101
924 3300053077 Ga0495601_0016216 Ga0495601_0016216_1864_2169 101
925 3300053077 Ga0495601_0571122 Ga0495601_0571122_352_660 101
926 3300053078 Ga0495612_0094471 Ga0495612_0094471_843_1148 101
927 3300053084 Ga0495595_0100982 Ga0495595_0100982_635_940 101
928 3300053084 Ga0495595_0636284 Ga0495595_0636284_222_530 101
929 3300053085 Ga0495619_0016410 Ga0495619_0016410_2793_3098 101
930 3300053085 Ga0495619_0351950 Ga0495619_0351950_97_402 101
931 3300054114 Ga0501084_0040791 Ga0501084_0040791_1940_2245 101
932 3300054114 Ga0501084_0054711 Ga0501084_0054711_857_1162 101
933 3300054114 Ga0501084_0075715 Ga0501084_0075715_934_1239 101
934 3300054114 Ga0501084_0138566 Ga0501084_0138566_58_387 101
935 3300054114 Ga0501084_0274186 Ga0501084_0274186_395_700 101
936 3300054114 Ga0501084_0440559 Ga0501084_0440559_416_745 101
937 3300054114 Ga0501084_0457983 Ga0501084_0457983_629_934 101
938 3300054114 Ga0501084_0487006 Ga0501084_0487006_666_971 101
939 3300054114 Ga0501084_0525368 Ga0501084_0525368_364_669 101
940 3300054114 Ga0501084_0758980 Ga0501084_0758980_361_666 101
941 3300054114 Ga0501084_0901679 Ga0501084_0901679_109_414 101
942 3300054114 Ga0501084_1100541 Ga0501084_1100541_85_414 101
943 3300054114 Ga0501084_1205252 Ga0501084_1205252_65_370 101
944 3300054114 Ga0501084_1744282 Ga0501084_1744282_24_353 101
945 3300059421 Ga0590071_000189 Ga0590071_000189_13593_13898 101
946 3300059424 Ga0590075_018081 Ga0590075_018081_908_1213 101
947 3300060353 Ga0501082_0036986 Ga0501082_0036986_1041_1346 101
948 3300060353 Ga0501082_0050355 Ga0501082_0050355_910_1215 101
949 3300060353 Ga0501082_0194128 Ga0501082_0194128_1278_1583 101
950 3300060353 Ga0501082_0244033 Ga0501082_0244033_911_1216 101
951 3300060353 Ga0501082_0519190 Ga0501082_0519190_166_471 101
952 3300060353 Ga0501082_0534793 Ga0501082_0534793_383_712 101
953 3300060353 Ga0501082_0662253 Ga0501082_0662253_457_762 101
954 3300060353 Ga0501082_0670203 Ga0501082_0670203_341_670 101
955 3300060353 Ga0501082_1351221 Ga0501082_1351221_278_607 101
956 3300060353 Ga0501082_2023012 Ga0501082_2023012_114_419 101
957 3300061734 Ga0530510_0033333 Ga0530510_0033333_1200_1505 101
958 3300061734 Ga0530510_0060525 Ga0530510_0060525_810_1115 101
959 3300061734 Ga0530510_0083461 Ga0530510_0083461_476_781 101
960 3300061734 Ga0530510_0105394 Ga0530510_0105394_659_964 101
961 3300061734 Ga0530510_0704487 Ga0530510_0704487_201_506 101
962 3300061734 Ga0530510_0900019 Ga0530510_0900019_280_609 101
963 3300061734 Ga0530510_0959485 Ga0530510_0959485_266_571 101
964 3300061734 Ga0530510_1305268 Ga0530510_1305268_33_362 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

30

120

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.9098 13 88
3f42-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein hp0035 from helicobacter pylori 0.902 1 91
1ybx-assembly1.cif.gz_A conserved hypothetical protein cth-383 from clostridium thermocellum 0.8932 3 89
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.8896 18 88
3f42-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein hp0035 from helicobacter pylori 0.8754 1 91
ID Description Score Start End Superfamily
af_Q5A2C3_1280_1430_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9059 28 55 2.130.10.10
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8592 17 84 3.30.1310.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8579 19 84 3.30.1310.10
1ybxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8409 3 89 3.30.1310.10
af_Q4DVG2_30_117_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.832 9 93 3.30.1310.10
ID Description Score Start End GO Terms
AF-A0A838Q4L3-F1-model_v4 Nucleoid-associated protein H0U13_00055 0.9707 4 96 GO:0003677
GO:0005829
GO:0043590
AF-A0A7C2ZGL8-F1-model_v4 Nucleoid-associated protein ENO92_11125 0.9623 4 98 GO:0003677
GO:0005829
GO:0043590
AF-A0A1G2ZLL2-F1-model_v4 Nucleoid-associated protein A2W23_02035 0.9621 1 98 GO:0003677
GO:0005829
GO:0043590
AF-Q1DAZ8-F1-model_v4 Nucleoid-associated protein MXAN_1931 0.9602 4 97 GO:0003677
GO:0005829
GO:0043590
AF-A0A7X8J807-F1-model_v4 Nucleoid-associated protein GX280_04820 0.9565 3 98 GO:0003677
GO:0005829
GO:0043590

Feature Viewer

pLDDT pTM Quality
86.11 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map