F486950

General Info

Members Datasets Scaffolds Average Seq Length
964 321 1928 266

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000133|Ga0495650_0000133_11643_12494
Length 283
Sequence MWHDIRSLNATASGLMAVTVVASLAAGVWWISQRPMFTLKTVRVESIYDMDLKHVNELTVRNGVVGKITGNFFTANLEQVRTTFEAVPWVRRATVRREWPNQLIVDVEEHEPLGTWGEDGRLLSVKGDVFTANLAEADDEHPLPGFDGPEGSEKEVLAKFAELRKWFAPVKLVPETLSLSNRYAWTVGLDNGMTVALGREQNKDTMKKRVDRLVAVYPQLVARLQDGSIETIDMRYPNGLALASKALNVPLDGTKPVKAATKKKAPVSTGSSSKTSSKTNKQI

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
117 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
118 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
258 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
259 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
260 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
261 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
264 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
267 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
268 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
269 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
270 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
271 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
272 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
273 2643221556 Massilia sp. Root1485 Isolate Unclassified
274 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
275 2643221638 Duganella sp. Root336D2 Isolate Unclassified
276 2643221645 Massilia sp. Root351 Isolate Unclassified
277 2643221664 Massilia sp. Root418 Isolate Unclassified
278 2643221684 Massilia sp. Root133 Isolate Unclassified
279 2738541280 Massilia sp. GV090 Isolate Unclassified
280 2738541297 Duganella sp. GV083 Isolate Unclassified
281 2738541300 Massilia sp. GV016 Isolate Unclassified
282 2738541357 Duganella sp. GV053 Isolate Unclassified
283 2738543003 Duganella sp. GV066 Isolate Unclassified
284 2738543018 Massilia sp. GV045 Isolate Unclassified
285 2738543026 Duganella sp. GV089 Isolate Unclassified
286 2738543029 Duganella sp. GV039 Isolate Unclassified
287 2738543030 Massilia sp. GV097 Isolate Unclassified
288 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
289 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
290 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
291 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
292 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
293 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
294 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
295 2821131069 Duganella sp. 1224 Isolate Unclassified
296 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
297 2842711865 Duganella sp. R-73148 Isolate Unclassified
298 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
299 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
300 2857553236 Duganella sp. R-74557 Isolate Unclassified
301 2857558681 Duganella sp. R-74565 Isolate Unclassified
302 2857564685 Duganella sp. R-74599 Isolate Unclassified
303 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
304 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
305 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
306 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
307 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
308 2904424332 Duganella sp. 1411 Isolate Rhizosphere
309 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
310 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
311 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
312 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
313 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
314 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
315 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
316 2919476304 Duganella sp. 3397 Isolate Unclassified
317 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
318 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
319 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
320 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
321 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.09
Metatranscriptomes 0.1
Isolates 5.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.4
Nodule 0.93
Rhizoplane 3.32
Rhizosphere 77.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0000133 3300046471 Bacteria 173878
2 JGI25155J39150_1000903 3300002704 Bacteria 4124
3 JGI25155J39150_1000904 3300002704 Bacteria 4109
4 JGI25156J39149_1000823 3300002705 Bacteria 15732
5 JGI25154J39366_1000731 3300002738 Bacteria 14771
6 JGI25154J39366_1004022 3300002738 Bacteria 2795
7 JGI25154J39366_1004037 3300002738 Bacteria 2783
8 JGI25157J39369_1001361 3300002741 Bacteria 9610
9 JGI25150J39212_1002710 3300002774 Bacteria 4317
10 JGI25159J45721_1004330 3300002987 Bacteria 4737
11 JGI25159J45721_1010869 3300002987 Bacteria 2280
12 rootH2_10146404 3300003320 Bacteria 1016
13 rootL2_10151043 3300003322 Bacteria 1137
14 rootH1_10204259 3300003323 Bacteria 1271
15 JGI25160J50197_1029770 3300003354 Bacteria 1436
16 JGI25161J50226_1004014 3300003374 Bacteria 3184
17 JGI25161J50226_1006048 3300003374 Bacteria 2243
18 Ga0007409J51694_1044304 3300003575 Bacteria 1645
19 Ga0055538_1000051 3300003751 Bacteria 129958
20 Ga0055539_1000076 3300003752 Bacteria 129958
21 Ga0055533_1000082 3300003756 Bacteria 129958
22 Ga0055532_1000018 3300003758 Bacteria 305466
23 Ga0055525_1000006 3300003759 Bacteria 642912
24 Ga0055525_1000109 3300003759 Bacteria 129958
25 Ga0055535_1002873 3300003761 Bacteria 5405
26 Ga0055529_1000190 3300003763 Bacteria 84003
27 Ga0055526_1000195 3300003771 Bacteria 52500
28 Ga0055526_1001666 3300003771 Bacteria 15573
29 Ga0055526_1022272 3300003771 Bacteria 2162
30 Ga0055537_1000052 3300003773 Bacteria 82841
31 Ga0055537_1000103 3300003773 Bacteria 63399
32 Ga0055537_1003412 3300003773 Bacteria 4895
33 Ga0055524_1001183 3300003775 Bacteria 15567
34 Ga0055524_1025272 3300003775 Bacteria 1863
35 Ga0055524_1041882 3300003775 Bacteria 1147
36 Ga0055534_1000254 3300003784 Bacteria 37129
37 Ga0055534_1001676 3300003784 Bacteria 8495
38 Ga0055528_1000031 3300003790 Bacteria 120960
39 Ga0055528_1004431 3300003790 Bacteria 6770
40 Ga0055530_10008966 3300003791 Bacteria 3915
41 Ga0055541_1000053 3300003841 Bacteria 129958
42 Ga0055543_1005491 3300004625 Bacteria 3222
43 Ga0055543_1007667 3300004625 Bacteria 2468
44 Ga0065165_1002165 3300005262 Bacteria 17754
45 Ga0065165_1013605 3300005262 Bacteria 3222
46 Ga0065165_1015061 3300005262 Bacteria 2966
47 Ga0065165_1032029 3300005262 Bacteria 1653
48 Ga0070658_10161603 3300005327 Bacteria 1879
49 Ga0070683_100273521 3300005329 Bacteria 1607
50 Ga0070670_100058189 3300005331 Bacteria 3318
51 Ga0070660_100079404 3300005339 Bacteria 2574
52 Ga0070660_100131842 3300005339 Bacteria 2000
53 Ga0070661_100194564 3300005344 Bacteria 1547
54 Ga0070675_100341795 3300005354 Bacteria 1326
55 Ga0070659_100191403 3300005366 Bacteria 1681
56 Ga0070659_100262031 3300005366 Bacteria 1434
57 Ga0070662_100327575 3300005457 Bacteria 1250
58 Ga0068855_100002635 3300005563 Bacteria 22121
59 Ga0068855_100015358 3300005563 Bacteria 9218
60 Ga0068855_100152188 3300005563 Bacteria 2630
61 Ga0070664_100092754 3300005564 Bacteria 2615
62 Ga0068854_100007673 3300005578 Bacteria 6899
63 Ga0068854_100353843 3300005578 Bacteria 1203
64 Ga0068856_100272998 3300005614 Bacteria 1707
65 Ga0068852_100002652 3300005616 Bacteria 12362
66 Ga0075363_100152514 3300006048 Bacteria 1305
67 Ga0075364_10147955 3300006051 Bacteria 1582
68 Ga0070712_100028465 3300006175 Bacteria 3738
69 Ga0075362_10057409 3300006177 Bacteria 1754
70 Ga0097621_100335047 3300006237 Bacteria 1343
71 Ga0079104_1009540 3300006946 Bacteria 3277
72 Ga0079104_1011025 3300006946 Bacteria 2933
73 Ga0099826_10000006 3300006948 Bacteria 432260
74 Ga0105251_10027953 3300009011 Bacteria 2853
75 Ga0105244_10007276 3300009036 Bacteria 7045
76 Ga0105244_10028198 3300009036 Bacteria 3015
77 Ga0105244_10040521 3300009036 Bacteria 2418
78 Ga0105244_10050239 3300009036 Bacteria 2128
79 Ga0105240_10024611 3300009093 Bacteria 7930
80 Ga0105240_10158570 3300009093 Bacteria 2689
81 Ga0105240_10313801 3300009093 Bacteria 1789
82 Ga0105245_10205608 3300009098 Bacteria 1893
83 Ga0105243_10086802 3300009148 Bacteria 2567
84 Ga0105243_10320951 3300009148 Bacteria 1411
85 Ga0105241_10009003 3300009174 Bacteria 7341
86 Ga0105242_10327667 3300009176 Bacteria 1407
87 Ga0105237_10025642 3300009545 Bacteria 6026
88 Ga0105238_10000004 3300009551 Bacteria 390514
89 Ga0105239_10001082 3300010375 Bacteria 37759
90 Ga0105239_10691113 3300010375 Bacteria 1166
91 Ga0105246_10141371 3300011119 Bacteria 1810
92 Ga0157373_10126058 3300013100 Bacteria 1800
93 Ga0157371_10000010 3300013102 Bacteria 384921
94 Ga0182008_10005626 3300014497 Bacteria 7101
95 Ga0182008_10040352 3300014497 Bacteria 2331
96 Ga0182008_10074964 3300014497 Bacteria 1665
97 Ga0157377_10129544 3300014745 Bacteria 1539
98 Ga0182006_1000030 3300015261 Bacteria 242894
99 Ga0182006_1000169 3300015261 Bacteria 68993
100 Ga0182006_1012297 3300015261 Bacteria 3743
101 Ga0182006_1023267 3300015261 Bacteria 2567
102 Ga0182006_1068628 3300015261 Bacteria 1320
103 Ga0182007_10001378 3300015262 Bacteria 13061
104 Ga0182005_1000003 3300015265 Bacteria 683269
105 Ga0182005_1000021 3300015265 Bacteria 272185
106 Ga0163161_10014987 3300017792 Bacteria 5401
107 Ga0163161_10187771 3300017792 Bacteria 1587
108 Ga0213872_10000382 3300021361 Bacteria 37031
109 Ga0213872_10000622 3300021361 Bacteria 26830
110 Ga0213872_10002407 3300021361 Bacteria 11040
111 Ga0213872_10005394 3300021361 Bacteria 6591
112 Ga0213872_10026673 3300021361 Bacteria 2653
113 Ga0213872_10035945 3300021361 Bacteria 2264
114 Ga0209435_100007 3300025206 Bacteria 516857
115 Ga0209435_101147 3300025206 Bacteria 3652
116 Ga0209436_101121 3300025208 Bacteria 9938
117 Ga0209784_100083 3300025224 Bacteria 131194
118 Ga0209566_100102 3300025225 Bacteria 131194
119 Ga0209674_100125 3300025226 Bacteria 131194
120 Ga0209147_100017 3300025229 Bacteria 516857
121 Ga0209563_100022 3300025230 Bacteria 643318
122 Ga0209563_100120 3300025230 Bacteria 131194
123 Ga0209437_100088 3300025233 Bacteria 251174
124 Ga0209437_106872 3300025233 Bacteria 1878
125 Ga0209258_100215 3300025242 Bacteria 114444
126 Ga0207425_1000013 3300025245 Bacteria 497384
127 Ga0207425_1000370 3300025245 Bacteria 31022
128 Ga0209646_1000044 3300025246 Bacteria 334596
129 Ga0209646_1000126 3300025246 Bacteria 132815
130 Ga0209646_1002496 3300025246 Bacteria 4043
131 Ga0209026_1000052 3300025250 Bacteria 248897
132 Ga0209026_1001175 3300025250 Bacteria 12147
133 Ga0209026_1014406 3300025250 Bacteria 1321
134 Ga0209677_100076 3300025253 Bacteria 131194
135 Ga0209677_101962 3300025253 Bacteria 8201
136 Ga0209148_1001468 3300025254 Bacteria 11896
137 Ga0209759_1000782 3300025256 Bacteria 26600
138 Ga0209759_1001215 3300025256 Bacteria 15837
139 Ga0209129_1000106 3300025258 Bacteria 156102
140 Ga0209565_1000035 3300025263 Bacteria 298125
141 Ga0209565_1004160 3300025263 Bacteria 4488
142 Ga0209565_1009050 3300025263 Bacteria 2560
143 Ga0209455_1000033 3300025272 Bacteria 504606
144 Ga0209673_1000006 3300025273 Bacteria 650600
145 Ga0209673_1008389 3300025273 Bacteria 4605
146 Ga0209130_1000086 3300025284 Bacteria 157063
147 Ga0209130_1002898 3300025284 Bacteria 7895
148 Ga0209130_1007695 3300025284 Bacteria 3285
149 Ga0209675_1000005 3300025291 Bacteria 849192
150 Ga0209675_1006075 3300025291 Bacteria 4927
151 Ga0209025_1002336 3300025294 Bacteria 20474
152 Ga0209564_1000028 3300025295 Bacteria 510986
153 Ga0209564_1000032 3300025295 Bacteria 464041
154 Ga0209564_1000083 3300025295 Bacteria 259272
155 Ga0209564_1000088 3300025295 Bacteria 250268
156 Ga0209758_1000031 3300025297 Bacteria 497252
157 Ga0209758_1000343 3300025297 Bacteria 85198
158 Ga0209050_1000078 3300025298 Bacteria 278409
159 Ga0209256_1000035 3300025299 Bacteria 386754
160 Ga0209256_1000305 3300025299 Bacteria 85970
161 Ga0209256_1000443 3300025299 Bacteria 63344
162 Ga0209256_1005775 3300025299 Bacteria 6906
163 Ga0207426_1015578 3300025302 Bacteria 2754
164 Ga0209257_1000097 3300025304 Bacteria 259243
165 Ga0207655_1005215 3300025728 Bacteria 8931
166 Ga0207655_1036952 3300025728 Bacteria 2158
167 Ga0207713_1084899 3300025735 Bacteria 1129
168 Ga0207705_10009312 3300025909 Bacteria 7143
169 Ga0207654_10016214 3300025911 Bacteria 3876
170 Ga0207695_10000566 3300025913 Bacteria 75799
171 Ga0207695_10002142 3300025913 Bacteria 29903
172 Ga0207695_10019040 3300025913 Bacteria 7918
173 Ga0207671_10003833 3300025914 Bacteria 14717
174 Ga0207657_10125767 3300025919 Bacteria 2106
175 Ga0207694_10000107 3300025924 Bacteria 87871
176 Ga0207694_10258626 3300025924 Bacteria 1426
177 Ga0207690_10107787 3300025932 Bacteria 2001
178 Ga0207686_10012008 3300025934 Bacteria 4755
179 Ga0207709_10109803 3300025935 Bacteria 1842
180 Ga0207704_10252619 3300025938 Bacteria 1324
181 Ga0207667_10002292 3300025949 Bacteria 24055
182 Ga0207667_10017805 3300025949 Bacteria 7988
183 Ga0207667_10163155 3300025949 Bacteria 2291
184 Ga0207640_10101897 3300025981 Bacteria 2016
185 Ga0207678_10038748 3300026067 Bacteria 4139
186 Ga0207702_10390224 3300026078 Bacteria 1340
187 Ga0207674_10111232 3300026116 Bacteria 2713
188 Ga0207698_10001307 3300026142 Bacteria 14518
189 Ga0209281_1003433 3300027111 Bacteria 5244
190 Ga0209281_1008041 3300027111 Bacteria 2592
191 Ga0209282_1000003 3300027666 Bacteria 856377
192 Ga0316181_1083718 3300030744 Bacteria 4201
193 Ga0307513_10152900 3300031456 Bacteria 2213
194 Ga0307408_100000932 3300031548 Bacteria 22811
195 Ga0307408_100020670 3300031548 Bacteria 4446
196 Ga0307408_100078117 3300031548 Bacteria 2466
197 Ga0265314_10015239 3300031711 Bacteria 6105
198 Ga0307416_100404647 3300032002 Bacteria 1403
199 Ga0307416_100404910 3300032002 Bacteria 1403
200 Ga0307414_10006353 3300032004 Bacteria 6583
201 Ga0395899_0000586 3300037312 Bacteria 38344
202 Ga0395899_0001071 3300037312 Bacteria 24692
203 Ga0395899_0001797 3300037312 Bacteria 17769
204 Ga0395899_0008996 3300037312 Bacteria 7679
205 Ga0395899_0270747 3300037312 Bacteria 1158
206 Ga0395899_0285044 3300037312 Bacteria 1122
207 Ga0395899_0353346 3300037312 Bacteria 982
208 Ga0395900_0000412 3300037418 Bacteria 61636
209 Ga0395900_0005380 3300037418 Bacteria 13414
210 Ga0395900_0024680 3300037418 Bacteria 6152
211 Ga0395900_0039694 3300037418 Bacteria 4850
212 Ga0395900_0082610 3300037418 Bacteria 3300
213 Ga0395900_0090201 3300037418 Bacteria 3150
214 Ga0395900_0099780 3300037418 Bacteria 2982
215 Ga0395900_0380433 3300037418 Bacteria 1379
216 Ga0395898_0279134 3300037466 Bacteria 1593
217 Ga0395898_0331291 3300037466 Bacteria 1451
218 Ga0395905_0013432 3300037471 Bacteria 7846
219 Ga0395905_0016602 3300037471 Bacteria 6997
220 Ga0395905_0026481 3300037471 Bacteria 5466
221 Ga0395905_0131946 3300037471 Bacteria 2349
222 Ga0395905_0142967 3300037471 Bacteria 2250
223 Ga0395905_0551045 3300037471 Bacteria 1054
224 Ga0395901_0000116 3300038443 Bacteria 108190
225 Ga0395901_0001676 3300038443 Bacteria 22857
226 Ga0395901_0039070 3300038443 Bacteria 4910
227 Ga0395901_0130823 3300038443 Bacteria 2637
228 Ga0395901_0140258 3300038443 Bacteria 2540
229 Ga0436361_0007669 3300039447 Bacteria 5259
230 Ga0436361_0009624 3300039447 Bacteria 13832
231 Ga0436361_0027066 3300039447 Bacteria 3899
232 Ga0436361_0075330 3300039447 Bacteria 1155
233 Ga0436361_0178921 3300039447 Bacteria 4772
234 Ga0436361_0182922 3300039447 Bacteria 4403
235 Ga0436361_0188617 3300039447 Bacteria 2355
236 Ga0436361_0237459 3300039447 Bacteria 1548
237 Ga0436361_0566522 3300039447 Bacteria 37173
238 Ga0439448_0001028 3300042005 Bacteria 6970
239 Ga0439448_0070076 3300042005 Bacteria 1167
240 Ga0439450_053921 3300042008 Bacteria 960
241 Ga0439455_0046551 3300042012 Bacteria 1124
242 Ga0439455_0048713 3300042012 Bacteria 1102
243 Ga0450920_026638 3300042122 Bacteria 1129
244 Ga0466969_0152716 3300044656 Bacteria 1063
245 Ga0466972_0003207 3300044658 Bacteria 8123
246 Ga0466972_0191937 3300044658 Bacteria 957
247 Ga0466981_0124873 3300044669 Bacteria 1797
248 Ga0466965_0065285 3300044683 Bacteria 1823
249 Ga0466965_0074309 3300044683 Bacteria 1712
250 Ga0466966_0049316 3300044684 Bacteria 2681
251 Ga0466966_0169857 3300044684 Bacteria 1325
252 Ga0466961_0211088 3300044693 Bacteria 1198
253 Ga0466964_0043014 3300044706 Bacteria 1831
254 Ga0466964_0065604 3300044706 Bacteria 1521
255 Ga0466964_0214466 3300044706 Bacteria 931
256 Ga0466971_0101181 3300044719 Bacteria 1324
257 Ga0466968_0005873 3300044735 Bacteria 4607
258 Ga0466970_0130429 3300044765 Bacteria 1380
259 Ga0466970_0154838 3300044765 Bacteria 1266
260 Ga0466957_0236616 3300044842 Bacteria 1210
261 Ga0466959_0045923 3300045049 Bacteria 3215
262 Ga0466959_0050094 3300045049 Bacteria 3067
263 Ga0466958_0159262 3300045836 Bacteria 1425
264 Ga0466958_0265780 3300045836 Bacteria 1098
265 Ga0466967_0109475 3300045976 Bacteria 2536
266 Ga0466967_0197375 3300045976 Bacteria 1904
267 Ga0466967_0318565 3300045976 Bacteria 1499
268 Ga0466967_0795317 3300045976 Bacteria 939
269 Ga0495617_000011 3300046452 Bacteria 301936
270 Ga0495617_003657 3300046452 Bacteria 5733
271 Ga0495617_010338 3300046452 Bacteria 3196
272 Ga0495617_056761 3300046452 Bacteria 1298
273 Ga0495627_000016 3300046453 Bacteria 318947
274 Ga0495627_000763 3300046453 Bacteria 23901
275 Ga0495627_005564 3300046453 Bacteria 5052
276 Ga0495627_087396 3300046453 Bacteria 898
277 Ga0495603_0093011 3300046455 Bacteria 1762
278 Ga0495590_0000058 3300046457 Bacteria 93362
279 Ga0495590_0000106 3300046457 Bacteria 50464
280 Ga0495590_0013789 3300046457 Bacteria 2964
281 Ga0495591_001143 3300046458 Bacteria 17450
282 Ga0495591_003126 3300046458 Bacteria 8745
283 Ga0495629_0016716 3300046459 Bacteria 5265
284 Ga0495629_0041702 3300046459 Bacteria 3228
285 Ga0495629_0173574 3300046459 Bacteria 1495
286 Ga0495638_0000627 3300046460 Bacteria 39046
287 Ga0495638_0009922 3300046460 Bacteria 6645
288 Ga0495638_0015654 3300046460 Bacteria 5088
289 Ga0495638_0026232 3300046460 Bacteria 3779
290 Ga0495638_0155680 3300046460 Bacteria 1322
291 Ga0495638_0228912 3300046460 Bacteria 1035
292 Ga0495638_0257424 3300046460 Bacteria 959
293 Ga0495653_0000014 3300046463 Bacteria 215253
294 Ga0495653_0258872 3300046463 Bacteria 1151
295 Ga0495650_0000146 3300046471 Bacteria 163598
296 Ga0495650_0000463 3300046471 Bacteria 63012
297 Ga0495650_0001265 3300046471 Bacteria 26082
298 Ga0495650_0002498 3300046471 Bacteria 14767
299 Ga0495650_0004500 3300046471 Bacteria 9523
300 Ga0495650_0006394 3300046471 Bacteria 7346
301 Ga0495650_0020705 3300046471 Bacteria 3200
302 Ga0495580_0040029 3300046472 Bacteria 3351
303 Ga0495580_0113850 3300046472 Bacteria 1879
304 Ga0495582_0014448 3300046473 Bacteria 4339
305 Ga0495605_0000010 3300046474 Bacteria 319487
306 Ga0495605_0000039 3300046474 Bacteria 196802
307 Ga0495605_0000538 3300046474 Bacteria 31464
308 Ga0495605_0008930 3300046474 Bacteria 5651
309 Ga0495605_0026423 3300046474 Bacteria 3018
310 Ga0495605_0040766 3300046474 Bacteria 2316
311 Ga0495605_0055051 3300046474 Bacteria 1923
312 Ga0495605_0056332 3300046474 Bacteria 1896
313 Ga0495605_0066311 3300046474 Bacteria 1715
314 Ga0495605_0086798 3300046474 Bacteria 1455
315 Ga0495605_0125885 3300046474 Bacteria 1158
316 Ga0495664_0116549 3300046477 Bacteria 1615
317 Ga0495584_0000013 3300046491 Bacteria 185735
318 Ga0495584_0002452 3300046491 Bacteria 10520
319 Ga0495584_0005167 3300046491 Bacteria 6928
320 Ga0495584_0007688 3300046491 Bacteria 5612
321 Ga0495584_0012715 3300046491 Bacteria 4296
322 Ga0495584_0016161 3300046491 Bacteria 3805
323 Ga0495584_0016883 3300046491 Bacteria 3720
324 Ga0495584_0094809 3300046491 Bacteria 1506
325 Ga0495584_0098288 3300046491 Bacteria 1479
326 Ga0495584_0101597 3300046491 Bacteria 1453
327 Ga0495585_0000022 3300046492 Bacteria 153475
328 Ga0495585_0000113 3300046492 Bacteria 86842
329 Ga0495585_0001386 3300046492 Bacteria 19160
330 Ga0495585_0006153 3300046492 Bacteria 7488
331 Ga0495585_0012805 3300046492 Bacteria 4933
332 Ga0495585_0022471 3300046492 Bacteria 3620
333 Ga0495585_0026884 3300046492 Bacteria 3285
334 Ga0495585_0027489 3300046492 Bacteria 3246
335 Ga0495585_0033829 3300046492 Bacteria 2891
336 Ga0495585_0049318 3300046492 Bacteria 2338
337 Ga0495585_0087859 3300046492 Bacteria 1677
338 Ga0495585_0105701 3300046492 Bacteria 1501
339 Ga0495585_0117079 3300046492 Bacteria 1412
340 Ga0495585_0124887 3300046492 Bacteria 1358
341 Ga0495585_0126458 3300046492 Bacteria 1348
342 Ga0495585_0172244 3300046492 Bacteria 1117
343 Ga0495585_0216852 3300046492 Bacteria 967
344 Ga0495594_0004259 3300046499 Bacteria 7348
345 Ga0495594_0015503 3300046499 Bacteria 4004
346 Ga0495594_0045308 3300046499 Bacteria 2414
347 Ga0495594_0062914 3300046499 Bacteria 2055
348 Ga0495594_0070396 3300046499 Bacteria 1944
349 Ga0495596_0001233 3300046500 Bacteria 14911
350 Ga0495596_0003331 3300046500 Bacteria 8180
351 Ga0495596_0007247 3300046500 Bacteria 5017
352 Ga0495596_0009426 3300046500 Bacteria 4292
353 Ga0495596_0010042 3300046500 Bacteria 4140
354 Ga0495596_0010675 3300046500 Bacteria 3991
355 Ga0495596_0025918 3300046500 Bacteria 2366
356 Ga0495596_0049265 3300046500 Bacteria 1651
357 Ga0495596_0060983 3300046500 Bacteria 1469
358 Ga0495596_0071002 3300046500 Bacteria 1352
359 Ga0495596_0104437 3300046500 Bacteria 1100
360 Ga0495596_0152751 3300046500 Bacteria 896
361 Ga0495607_0004188 3300046501 Bacteria 10712
362 Ga0495607_0005132 3300046501 Bacteria 9461
363 Ga0495607_0007344 3300046501 Bacteria 7634
364 Ga0495607_0008224 3300046501 Bacteria 7139
365 Ga0495607_0009130 3300046501 Bacteria 6741
366 Ga0495607_0009309 3300046501 Bacteria 6657
367 Ga0495607_0033362 3300046501 Bacteria 3133
368 Ga0495607_0048161 3300046501 Bacteria 2493
369 Ga0495607_0056733 3300046501 Bacteria 2247
370 Ga0495607_0068636 3300046501 Bacteria 1987
371 Ga0495607_0077822 3300046501 Bacteria 1831
372 Ga0495607_0106983 3300046501 Bacteria 1488
373 Ga0495607_0117772 3300046501 Bacteria 1399
374 Ga0495607_0141513 3300046501 Bacteria 1240
375 Ga0495607_0204421 3300046501 Bacteria 975
376 Ga0495583_0000116 3300046506 Bacteria 135355
377 Ga0495583_0000183 3300046506 Bacteria 106663
378 Ga0495583_0000346 3300046506 Bacteria 73089
379 Ga0495583_0001913 3300046506 Bacteria 19244
380 Ga0495583_0005617 3300046506 Bacteria 8452
381 Ga0495583_0026460 3300046506 Bacteria 2875
382 Ga0495583_0041649 3300046506 Bacteria 2149
383 Ga0495583_0054490 3300046506 Bacteria 1810
384 Ga0495583_0097471 3300046506 Bacteria 1258
385 Ga0495583_0102328 3300046506 Bacteria 1221
386 Ga0495583_0112450 3300046506 Bacteria 1152
387 Ga0495606_0000004 3300046507 Bacteria 406209
388 Ga0495606_0000366 3300046507 Bacteria 77471
389 Ga0495606_0003214 3300046507 Bacteria 17599
390 Ga0495606_0003330 3300046507 Bacteria 17148
391 Ga0495606_0004560 3300046507 Bacteria 13764
392 Ga0495606_0004565 3300046507 Bacteria 13753
393 Ga0495606_0035679 3300046507 Bacteria 3396
394 Ga0495606_0039905 3300046507 Bacteria 3158
395 Ga0495606_0042863 3300046507 Bacteria 3023
396 Ga0495606_0044389 3300046507 Bacteria 2956
397 Ga0495606_0066522 3300046507 Bacteria 2285
398 Ga0495606_0096980 3300046507 Bacteria 1802
399 Ga0495610_0000007 3300046512 Bacteria 820919
400 Ga0495610_0001668 3300046512 Bacteria 19525
401 Ga0495610_0002052 3300046512 Bacteria 17212
402 Ga0495610_0017359 3300046512 Bacteria 4106
403 Ga0495610_0063055 3300046512 Bacteria 1756
404 Ga0495610_0143074 3300046512 Bacteria 1027
405 Ga0495616_0000886 3300046513 Bacteria 21668
406 Ga0495616_0002203 3300046513 Bacteria 13026
407 Ga0495616_0008138 3300046513 Bacteria 6234
408 Ga0495616_0011430 3300046513 Bacteria 5086
409 Ga0495616_0018277 3300046513 Bacteria 3850
410 Ga0495616_0023298 3300046513 Bacteria 3331
411 Ga0495616_0045053 3300046513 Bacteria 2234
412 Ga0495616_0054519 3300046513 Bacteria 1982
413 Ga0495616_0066640 3300046513 Bacteria 1751
414 Ga0495616_0113247 3300046513 Bacteria 1258
415 Ga0495616_0150880 3300046513 Bacteria 1051
416 Ga0495620_0001481 3300046515 Bacteria 14039
417 Ga0495630_0014367 3300046517 Bacteria 5768
418 Ga0495630_0021709 3300046517 Bacteria 4741
419 Ga0495631_0005291 3300046518 Bacteria 6776
420 Ga0495631_0005660 3300046518 Bacteria 6518
421 Ga0495631_0006226 3300046518 Bacteria 6180
422 Ga0495631_0007915 3300046518 Bacteria 5380
423 Ga0495631_0010634 3300046518 Bacteria 4551
424 Ga0495631_0011563 3300046518 Bacteria 4337
425 Ga0495631_0012775 3300046518 Bacteria 4093
426 Ga0495631_0020114 3300046518 Bacteria 3123
427 Ga0495631_0028312 3300046518 Bacteria 2556
428 Ga0495631_0067622 3300046518 Bacteria 1545
429 Ga0495631_0091635 3300046518 Bacteria 1308
430 Ga0495631_0118846 3300046518 Bacteria 1136
431 Ga0495632_0001028 3300046519 Bacteria 24124
432 Ga0495632_0002302 3300046519 Bacteria 14704
433 Ga0495632_0004450 3300046519 Bacteria 9519
434 Ga0495632_0004520 3300046519 Bacteria 9429
435 Ga0495632_0006884 3300046519 Bacteria 7234
436 Ga0495632_0027760 3300046519 Bacteria 2960
437 Ga0495632_0057631 3300046519 Bacteria 1895
438 Ga0495632_0067636 3300046519 Bacteria 1722
439 Ga0495632_0079692 3300046519 Bacteria 1563
440 Ga0495632_0118632 3300046519 Bacteria 1237
441 Ga0495637_0000028 3300046520 Bacteria 144203
442 Ga0495637_0000954 3300046520 Bacteria 18480
443 Ga0495637_0019492 3300046520 Bacteria 3135
444 Ga0495637_0027619 3300046520 Bacteria 2537
445 Ga0495637_0060396 3300046520 Bacteria 1557
446 Ga0495637_0062835 3300046520 Bacteria 1518
447 Ga0495643_0001967 3300046522 Bacteria 17235
448 Ga0495643_0011296 3300046522 Bacteria 5447
449 Ga0495643_0013328 3300046522 Bacteria 4924
450 Ga0495643_0014155 3300046522 Bacteria 4753
451 Ga0495643_0022739 3300046522 Bacteria 3571
452 Ga0495643_0032979 3300046522 Bacteria 2869
453 Ga0495643_0076024 3300046522 Bacteria 1756
454 Ga0495643_0140105 3300046522 Bacteria 1207
455 Ga0495644_0005071 3300046523 Bacteria 5152
456 Ga0495644_0010228 3300046523 Bacteria 3615
457 Ga0495644_0014085 3300046523 Bacteria 3063
458 Ga0495644_0015473 3300046523 Bacteria 2921
459 Ga0495644_0046639 3300046523 Bacteria 1628
460 Ga0495644_0071886 3300046523 Bacteria 1300
461 Ga0495644_0080643 3300046523 Bacteria 1226
462 Ga0495644_0086678 3300046523 Bacteria 1180
463 Ga0495648_0000004 3300046524 Bacteria 373639
464 Ga0495648_0000959 3300046524 Bacteria 29756
465 Ga0495648_0008094 3300046524 Bacteria 8311
466 Ga0495648_0016571 3300046524 Bacteria 5307
467 Ga0495648_0017399 3300046524 Bacteria 5139
468 Ga0495648_0021055 3300046524 Bacteria 4527
469 Ga0495648_0034423 3300046524 Bacteria 3296
470 Ga0495648_0046099 3300046524 Bacteria 2705
471 Ga0495648_0054128 3300046524 Bacteria 2426
472 Ga0495648_0103892 3300046524 Bacteria 1561
473 Ga0495648_0108491 3300046524 Bacteria 1516
474 Ga0495663_0004726 3300046525 Bacteria 3812
475 Ga0495666_0014119 3300046526 Bacteria 3981
476 Ga0495666_0026583 3300046526 Bacteria 2851
477 Ga0495642_0000192 3300046528 Bacteria 36285
478 Ga0495642_0003054 3300046528 Bacteria 6660
479 Ga0495642_0004695 3300046528 Bacteria 5292
480 Ga0495642_0008562 3300046528 Bacteria 3914
481 Ga0495642_0017090 3300046528 Bacteria 2832
482 Ga0495642_0018572 3300046528 Bacteria 2721
483 Ga0495642_0074273 3300046528 Bacteria 1425
484 Ga0495642_0077465 3300046528 Bacteria 1396
485 Ga0495642_0085783 3300046528 Bacteria 1329
486 Ga0495642_0093345 3300046528 Bacteria 1275
487 Ga0495642_0168782 3300046528 Bacteria 950
488 Ga0495652_0014511 3300046529 Bacteria 7070
489 Ga0495652_0032367 3300046529 Bacteria 4574
490 Ga0495654_0000034 3300046530 Bacteria 196519
491 Ga0495654_0024101 3300046530 Bacteria 3147
492 Ga0495654_0032713 3300046530 Bacteria 2635
493 Ga0495654_0047265 3300046530 Bacteria 2115
494 Ga0495654_0048514 3300046530 Bacteria 2083
495 Ga0495654_0083222 3300046530 Bacteria 1496
496 Ga0495654_0095058 3300046530 Bacteria 1378
497 Ga0495665_0081673 3300046531 Bacteria 1699
498 Ga0495665_0099954 3300046531 Bacteria 1522
499 Ga0495665_0142662 3300046531 Bacteria 1251
500 Ga0495640_0043745 3300046533 Bacteria 3117
501 Ga0495586_0025993 3300046535 Bacteria 3132
502 Ga0495586_0065502 3300046535 Bacteria 1980
503 Ga0495586_0104447 3300046535 Bacteria 1574
504 Ga0495586_0184320 3300046535 Bacteria 1181
505 Ga0495587_0005967 3300046536 Bacteria 7940
506 Ga0495587_0014440 3300046536 Bacteria 4953
507 Ga0495609_0000005 3300046538 Bacteria 439165
508 Ga0495609_0002200 3300046538 Bacteria 12224
509 Ga0495609_0004608 3300046538 Bacteria 7486
510 Ga0495609_0005373 3300046538 Bacteria 6754
511 Ga0495609_0013673 3300046538 Bacteria 3829
512 Ga0495609_0014101 3300046538 Bacteria 3762
513 Ga0495609_0025980 3300046538 Bacteria 2682
514 Ga0495609_0064933 3300046538 Bacteria 1609
515 Ga0495609_0089692 3300046538 Bacteria 1337
516 Ga0495609_0095475 3300046538 Bacteria 1290
517 Ga0495609_0102220 3300046538 Bacteria 1241
518 Ga0495609_0137606 3300046538 Bacteria 1043
519 Ga0495597_0002058 3300046542 Bacteria 13415
520 Ga0495597_0003749 3300046542 Bacteria 8665
521 Ga0495597_0006439 3300046542 Bacteria 6075
522 Ga0495597_0007831 3300046542 Bacteria 5389
523 Ga0495597_0009171 3300046542 Bacteria 4906
524 Ga0495597_0020980 3300046542 Bacteria 3038
525 Ga0495597_0021281 3300046542 Bacteria 3016
526 Ga0495597_0031813 3300046542 Bacteria 2397
527 Ga0495597_0036552 3300046542 Bacteria 2210
528 Ga0495597_0053023 3300046542 Bacteria 1784
529 Ga0495597_0149109 3300046542 Bacteria 960
530 Ga0495622_0000431 3300046557 Bacteria 27552
531 Ga0495622_0017240 3300046557 Bacteria 3362
532 Ga0495622_0034328 3300046557 Bacteria 2366
533 Ga0495622_0063784 3300046557 Bacteria 1704
534 Ga0495622_0084648 3300046557 Bacteria 1458
535 Ga0495622_0094309 3300046557 Bacteria 1374
536 Ga0495622_0117628 3300046557 Bacteria 1215
537 Ga0495633_0001323 3300046558 Bacteria 19469
538 Ga0495633_0002334 3300046558 Bacteria 13489
539 Ga0495633_0005934 3300046558 Bacteria 7345
540 Ga0495633_0007634 3300046558 Bacteria 6191
541 Ga0495633_0010333 3300046558 Bacteria 5101
542 Ga0495633_0011467 3300046558 Bacteria 4774
543 Ga0495633_0011829 3300046558 Bacteria 4678
544 Ga0495633_0013554 3300046558 Bacteria 4290
545 Ga0495633_0016155 3300046558 Bacteria 3857
546 Ga0495633_0021809 3300046558 Bacteria 3197
547 Ga0495633_0025153 3300046558 Bacteria 2933
548 Ga0495633_0047934 3300046558 Bacteria 2018
549 Ga0495633_0056645 3300046558 Bacteria 1841
550 Ga0495633_0077446 3300046558 Bacteria 1548
551 Ga0495633_0080431 3300046558 Bacteria 1516
552 Ga0495633_0111430 3300046558 Bacteria 1269
553 Ga0495633_0167648 3300046558 Bacteria 1012
554 Ga0495656_0002682 3300046615 Bacteria 5943
555 Ga0495656_0037666 3300046615 Bacteria 1999
556 Ga0495656_0040845 3300046615 Bacteria 1935
557 Ga0495656_0103108 3300046615 Bacteria 1322
558 Ga0495656_0118383 3300046615 Bacteria 1247
559 Ga0495668_0000136 3300046616 Bacteria 111262
560 Ga0495668_0000714 3300046616 Bacteria 40056
561 Ga0495668_0001539 3300046616 Bacteria 21864
562 Ga0495668_0001987 3300046616 Bacteria 17898
563 Ga0495668_0002289 3300046616 Bacteria 16101
564 Ga0495668_0002780 3300046616 Bacteria 13940
565 Ga0495668_0006582 3300046616 Bacteria 7582
566 Ga0495668_0012333 3300046616 Bacteria 5070
567 Ga0495668_0034617 3300046616 Bacteria 2832
568 Ga0495668_0036500 3300046616 Bacteria 2753
569 Ga0495668_0041946 3300046616 Bacteria 2547
570 Ga0495668_0055021 3300046616 Bacteria 2198
571 Ga0495668_0059214 3300046616 Bacteria 2113
572 Ga0495668_0125371 3300046616 Bacteria 1405
573 Ga0495634_0009252 3300046642 Bacteria 7271
574 Ga0495634_0055208 3300046642 Bacteria 2656
575 Ga0495611_0001201 3300046648 Bacteria 13420
576 Ga0495611_0039215 3300046648 Bacteria 2108
577 Ga0495611_0043341 3300046648 Bacteria 2011
578 Ga0495611_0054023 3300046648 Bacteria 1814
579 Ga0495611_0095778 3300046648 Bacteria 1374
580 Ga0495625_0000257 3300046660 Bacteria 82608
581 Ga0495625_0008397 3300046660 Bacteria 8818
582 Ga0495625_0008424 3300046660 Bacteria 8803
583 Ga0495625_0020272 3300046660 Bacteria 5136
584 Ga0495625_0029275 3300046660 Bacteria 4121
585 Ga0495625_0064369 3300046660 Bacteria 2586
586 Ga0495625_0072752 3300046660 Bacteria 2410
587 Ga0495625_0083001 3300046660 Bacteria 2228
588 Ga0495625_0092658 3300046660 Bacteria 2087
589 Ga0495625_0111301 3300046660 Bacteria 1871
590 Ga0495625_0115751 3300046660 Bacteria 1829
591 Ga0495625_0121678 3300046660 Bacteria 1775
592 Ga0495635_0047558 3300046663 Bacteria 2958
593 Ga0495659_0000958 3300046664 Bacteria 10212
594 Ga0495659_0003135 3300046664 Bacteria 5307
595 Ga0495659_0072811 3300046664 Bacteria 1290
596 Ga0495661_0000266 3300046665 Bacteria 59871
597 Ga0495661_0001306 3300046665 Bacteria 21236
598 Ga0495661_0007202 3300046665 Bacteria 7758
599 Ga0495661_0007222 3300046665 Bacteria 7746
600 Ga0495661_0011557 3300046665 Bacteria 5986
601 Ga0495661_0015180 3300046665 Bacteria 5142
602 Ga0495661_0023759 3300046665 Bacteria 3974
603 Ga0495661_0032040 3300046665 Bacteria 3326
604 Ga0495661_0036891 3300046665 Bacteria 3055
605 Ga0495661_0046324 3300046665 Bacteria 2655
606 Ga0495661_0058755 3300046665 Bacteria 2291
607 Ga0495661_0058953 3300046665 Bacteria 2286
608 Ga0495661_0065569 3300046665 Bacteria 2139
609 Ga0495661_0086076 3300046665 Bacteria 1799
610 Ga0495661_0087639 3300046665 Bacteria 1779
611 Ga0495661_0088107 3300046665 Bacteria 1772
612 Ga0495661_0128168 3300046665 Bacteria 1394
613 Ga0495588_0000059 3300046674 Bacteria 263358
614 Ga0495588_0014365 3300046674 Bacteria 3789
615 Ga0495588_0102351 3300046674 Bacteria 1505
616 Ga0495588_0105232 3300046674 Bacteria 1484
617 Ga0495588_0120400 3300046674 Bacteria 1383
618 Ga0495588_0122849 3300046674 Bacteria 1369
619 Ga0495588_0182600 3300046674 Bacteria 1108
620 Ga0495623_0023671 3300046679 Bacteria 3962
621 Ga0495623_0094483 3300046679 Bacteria 1828
622 Ga0495623_0196116 3300046679 Bacteria 1163
623 Ga0495646_0168251 3300046680 Bacteria 1209
624 Ga0495669_0000478 3300046684 Bacteria 18569
625 Ga0495669_0000703 3300046684 Bacteria 14609
626 Ga0495669_0001250 3300046684 Bacteria 10570
627 Ga0495669_0004391 3300046684 Bacteria 5821
628 Ga0495669_0027362 3300046684 Bacteria 2494
629 Ga0495669_0034337 3300046684 Bacteria 2235
630 Ga0495669_0064094 3300046684 Bacteria 1667
631 Ga0495669_0079768 3300046684 Bacteria 1501
632 Ga0495613_0036807 3300046689 Bacteria 3629
633 Ga0495613_0251387 3300046689 Bacteria 1233
634 Ga0495624_0020480 3300046690 Bacteria 4401
635 Ga0495670_0002558 3300046691 Bacteria 8989
636 Ga0495670_0003391 3300046691 Bacteria 7838
637 Ga0495670_0007582 3300046691 Bacteria 5334
638 Ga0495670_0008595 3300046691 Bacteria 5025
639 Ga0495670_0015349 3300046691 Bacteria 3765
640 Ga0495670_0028706 3300046691 Bacteria 2758
641 Ga0495670_0070831 3300046691 Bacteria 1764
642 Ga0495670_0113539 3300046691 Bacteria 1403
643 Ga0495670_0115302 3300046691 Bacteria 1393
644 Ga0495671_0000033 3300046692 Bacteria 197509
645 Ga0495671_0000718 3300046692 Bacteria 23936
646 Ga0495671_0015145 3300046692 Bacteria 4139
647 Ga0495671_0031664 3300046692 Bacteria 2704
648 Ga0495671_0046342 3300046692 Bacteria 2173
649 Ga0495671_0053133 3300046692 Bacteria 2011
650 Ga0495671_0059003 3300046692 Bacteria 1897
651 Ga0495671_0098694 3300046692 Bacteria 1428
652 Ga0495649_0000648 3300046694 Bacteria 28291
653 Ga0495649_0005239 3300046694 Bacteria 8298
654 Ga0495649_0006115 3300046694 Bacteria 7524
655 Ga0495649_0059151 3300046694 Bacteria 2063
656 Ga0495649_0069807 3300046694 Bacteria 1884
657 Ga0495649_0116924 3300046694 Bacteria 1411
658 Ga0495649_0238126 3300046694 Bacteria 937
659 Ga0495589_0000024 3300046794 Bacteria 191021
660 Ga0495589_0000047 3300046794 Bacteria 117810
661 Ga0495589_0006143 3300046794 Bacteria 6344
662 Ga0495589_0006608 3300046794 Bacteria 6110
663 Ga0495589_0031652 3300046794 Bacteria 2662
664 Ga0495589_0036149 3300046794 Bacteria 2476
665 Ga0495589_0041445 3300046794 Bacteria 2298
666 Ga0495589_0046985 3300046794 Bacteria 2140
667 Ga0495589_0071292 3300046794 Bacteria 1698
668 Ga0495589_0091504 3300046794 Bacteria 1477
669 Ga0495589_0111646 3300046794 Bacteria 1319
670 Ga0495589_0117324 3300046794 Bacteria 1282
671 Ga0495589_0134821 3300046794 Bacteria 1184
672 Ga0495600_0013073 3300046809 Bacteria 5208
673 Ga0495600_0094108 3300046809 Bacteria 1954
674 Ga0495600_0097922 3300046809 Bacteria 1912
675 Ga0495660_0000170 3300046810 Bacteria 70588
676 Ga0495660_0001802 3300046810 Bacteria 14107
677 Ga0495660_0004464 3300046810 Bacteria 8462
678 Ga0495660_0004831 3300046810 Bacteria 8131
679 Ga0495660_0033132 3300046810 Bacteria 2899
680 Ga0495660_0041270 3300046810 Bacteria 2556
681 Ga0495660_0052670 3300046810 Bacteria 2210
682 Ga0495660_0053775 3300046810 Bacteria 2184
683 Ga0495660_0060937 3300046810 Bacteria 2025
684 Ga0495660_0069402 3300046810 Bacteria 1873
685 Ga0495660_0090291 3300046810 Bacteria 1593
686 Ga0495660_0103954 3300046810 Bacteria 1458
687 Ga0495660_0138126 3300046810 Bacteria 1215
688 Ga0495581_0030961 3300047315 Bacteria 3099
689 Ga0495581_0125807 3300047315 Bacteria 1492
690 Ga0495581_0131337 3300047315 Bacteria 1459
691 Ga0495581_0134789 3300047315 Bacteria 1439
692 Ga0495581_0311430 3300047315 Bacteria 920
693 Ga0495604_0015699 3300047317 Bacteria 6043
694 Ga0495604_0054517 3300047317 Bacteria 3084
695 Ga0495604_0156245 3300047317 Bacteria 1615
696 Ga0495604_0360932 3300047317 Bacteria 963
697 Ga0495604_0371460 3300047317 Bacteria 946
698 Ga0495636_0000477 3300047318 Bacteria 14744
699 Ga0495636_0005218 3300047318 Bacteria 5095
700 Ga0495636_0051922 3300047318 Bacteria 1719
701 Ga0495636_0074716 3300047318 Bacteria 1452
702 Ga0495636_0138255 3300047318 Bacteria 1087
703 Ga0495636_0168131 3300047318 Bacteria 990
704 Ga0495674_0004055 3300047319 Bacteria 14173
705 Ga0495672_0000005 3300047320 Bacteria 593294
706 Ga0495672_0000099 3300047320 Bacteria 140634
707 Ga0495672_0000227 3300047320 Bacteria 80295
708 Ga0495672_0000508 3300047320 Bacteria 44840
709 Ga0495672_0000582 3300047320 Bacteria 41296
710 Ga0495672_0001291 3300047320 Bacteria 24984
711 Ga0495672_0007431 3300047320 Bacteria 8242
712 Ga0495672_0035796 3300047320 Bacteria 3054
713 Ga0495672_0039090 3300047320 Bacteria 2888
714 Ga0495672_0073119 3300047320 Bacteria 1934
715 Ga0495672_0075511 3300047320 Bacteria 1895
716 Ga0495672_0116395 3300047320 Bacteria 1427
717 Ga0495672_0128107 3300047320 Bacteria 1339
718 Ga0495676_0000135 3300047321 Bacteria 55966
719 Ga0495676_0062839 3300047321 Bacteria 2897
720 Ga0495676_0115145 3300047321 Bacteria 1966
721 Ga0495676_0121801 3300047321 Bacteria 1896
722 Ga0495680_0002926 3300047322 Bacteria 17151
723 Ga0495683_0000330 3300047323 Bacteria 39863
724 Ga0495683_0001443 3300047323 Bacteria 15599
725 Ga0495683_0008998 3300047323 Bacteria 5328
726 Ga0495683_0019056 3300047323 Bacteria 3541
727 Ga0495683_0021636 3300047323 Bacteria 3313
728 Ga0495683_0038721 3300047323 Bacteria 2413
729 Ga0495683_0047484 3300047323 Bacteria 2155
730 Ga0495683_0052437 3300047323 Bacteria 2036
731 Ga0495683_0068550 3300047323 Bacteria 1744
732 Ga0495683_0102115 3300047323 Bacteria 1378
733 Ga0495683_0122884 3300047323 Bacteria 1230
734 Ga0495683_0126371 3300047323 Bacteria 1209
735 Ga0495683_0159625 3300047323 Bacteria 1043
736 Ga0495687_000008 3300047443 Bacteria 546666
737 Ga0495687_000283 3300047443 Bacteria 66901
738 Ga0495687_000609 3300047443 Bacteria 41802
739 Ga0495687_001103 3300047443 Bacteria 26281
740 Ga0495687_001268 3300047443 Bacteria 23860
741 Ga0495687_003420 3300047443 Bacteria 11515
742 Ga0495687_003422 3300047443 Bacteria 11512
743 Ga0495687_003464 3300047443 Bacteria 11404
744 Ga0495687_005735 3300047443 Bacteria 7816
745 Ga0495687_010116 3300047443 Bacteria 5199
746 Ga0495675_0008225 3300047444 Bacteria 6454
747 Ga0495675_0010625 3300047444 Bacteria 5756
748 Ga0495675_0145101 3300047444 Bacteria 1469
749 Ga0495677_0000007 3300047445 Bacteria 181193
750 Ga0495677_0000272 3300047445 Bacteria 22753
751 Ga0495677_0007024 3300047445 Bacteria 4218
752 Ga0495677_0012797 3300047445 Bacteria 3058
753 Ga0495677_0016033 3300047445 Bacteria 2720
754 Ga0495677_0016439 3300047445 Bacteria 2685
755 Ga0495677_0017195 3300047445 Bacteria 2622
756 Ga0495677_0019775 3300047445 Bacteria 2441
757 Ga0495677_0023464 3300047445 Bacteria 2239
758 Ga0495677_0026921 3300047445 Bacteria 2085
759 Ga0495677_0027085 3300047445 Bacteria 2079
760 Ga0495677_0030913 3300047445 Bacteria 1949
761 Ga0495677_0053361 3300047445 Bacteria 1490
762 Ga0495677_0062648 3300047445 Bacteria 1380
763 Ga0495677_0098663 3300047445 Bacteria 1104
764 Ga0495679_002252 3300047446 Bacteria 9985
765 Ga0495679_006356 3300047446 Bacteria 5100
766 Ga0495679_020303 3300047446 Bacteria 2315
767 Ga0495679_047986 3300047446 Bacteria 1293
768 Ga0495679_054104 3300047446 Bacteria 1196
769 Ga0495685_000322 3300047447 Bacteria 15394
770 Ga0495685_001700 3300047447 Bacteria 6777
771 Ga0495685_019822 3300047447 Bacteria 2311
772 Ga0495685_065666 3300047447 Bacteria 1219
773 Ga0495673_0000031 3300047469 Bacteria 447868
774 Ga0495673_0000032 3300047469 Bacteria 375856
775 Ga0495673_0010885 3300047469 Bacteria 4920
776 Ga0495673_0017001 3300047469 Bacteria 3705
777 Ga0495681_0001145 3300047470 Bacteria 20136
778 Ga0495681_0007609 3300047470 Bacteria 6891
779 Ga0495681_0023073 3300047470 Bacteria 3313
780 Ga0495681_0027386 3300047470 Bacteria 2948
781 Ga0495681_0028913 3300047470 Bacteria 2843
782 Ga0495681_0034798 3300047470 Bacteria 2506
783 Ga0495681_0040853 3300047470 Bacteria 2255
784 Ga0495681_0046347 3300047470 Bacteria 2073
785 Ga0495681_0063979 3300047470 Bacteria 1686
786 Ga0495681_0064600 3300047470 Bacteria 1675
787 Ga0495681_0068118 3300047470 Bacteria 1620
788 Ga0495681_0091380 3300047470 Bacteria 1343
789 Ga0495681_0125993 3300047470 Bacteria 1094
790 Ga0495686_0000244 3300047472 Bacteria 98321
791 Ga0495686_0003101 3300047472 Bacteria 14687
792 Ga0495686_0015815 3300047472 Bacteria 5135
793 Ga0495686_0038059 3300047472 Bacteria 3078
794 Ga0495686_0046265 3300047472 Bacteria 2751
795 Ga0495686_0071414 3300047472 Bacteria 2137
796 Ga0495686_0073254 3300047472 Bacteria 2104
797 Ga0495593_0009351 3300047673 Bacteria 5689
798 Ga0495593_0012576 3300047673 Bacteria 4833
799 Ga0495593_0029803 3300047673 Bacteria 2989
800 Ga0495593_0075119 3300047673 Bacteria 1752
801 Ga0495593_0077577 3300047673 Bacteria 1721
802 Ga0495602_0020901 3300048088 Bacteria 6458
803 Ga0495602_0069191 3300048088 Bacteria 3027
804 Ga0495614_0012946 3300048089 Bacteria 3657
805 Ga0495614_0017667 3300048089 Bacteria 3097
806 Ga0495614_0076971 3300048089 Bacteria 1442
807 Ga0495615_0004411 3300048090 Bacteria 2456
808 Ga0495626_0000047 3300048091 Bacteria 161939
809 Ga0495626_0001065 3300048091 Bacteria 23440
810 Ga0495626_0008756 3300048091 Bacteria 5509
811 Ga0495626_0014506 3300048091 Bacteria 4060
812 Ga0495626_0027409 3300048091 Bacteria 2770
813 Ga0495626_0038570 3300048091 Bacteria 2264
814 Ga0495626_0054505 3300048091 Bacteria 1835
815 Ga0495626_0074133 3300048091 Bacteria 1523
816 Ga0495626_0075576 3300048091 Bacteria 1505
817 Ga0495626_0078193 3300048091 Bacteria 1473
818 Ga0495626_0104853 3300048091 Bacteria 1229
819 Ga0495626_0149509 3300048091 Bacteria 985
820 Ga0496101_0024575 3300048904 Bacteria 4170
821 Ga0496102_0000877 3300048905 Bacteria 28674
822 Ga0496102_0117440 3300048905 Bacteria 2482
823 Ga0496102_0381953 3300048905 Bacteria 1325
824 Ga0496103_0010480 3300048906 Bacteria 5486
825 Ga0496103_0072271 3300048906 Bacteria 2160
826 Ga0496103_0110959 3300048906 Bacteria 1742
827 Ga0496103_0185303 3300048906 Bacteria 1338
828 Ga0496105_0333738 3300048908 Bacteria 1213
829 Ga0496106_0071359 3300048909 Bacteria 2654
830 Ga0496106_0179124 3300048909 Bacteria 1682
831 Ga0496107_0129127 3300048910 Bacteria 1865
832 Ga0496107_0197039 3300048910 Bacteria 1497
833 Ga0496108_0127385 3300048911 Bacteria 2187
834 Ga0496108_0298637 3300048911 Bacteria 1403
835 Ga0496108_0661431 3300048911 Bacteria 908
836 Ga0496109_0026732 3300048912 Bacteria 5147
837 Ga0496109_0242306 3300048912 Bacteria 1697
838 Ga0496109_0291072 3300048912 Bacteria 1540
839 Ga0496110_0008056 3300048913 Bacteria 8454
840 Ga0496110_0011259 3300048913 Bacteria 7312
841 Ga0496111_0046887 3300048914 Bacteria 3113
842 Ga0496111_0291138 3300048914 Bacteria 1211
843 Ga0496111_0362281 3300048914 Bacteria 1073
844 Ga0496113_0121260 3300048916 Bacteria 2044
845 Ga0496113_0145116 3300048916 Bacteria 1869
846 Ga0496114_0175944 3300048917 Bacteria 1867
847 Ga0496114_0217514 3300048917 Bacteria 1677
848 Ga0496115_0029431 3300048918 Bacteria 4313
849 Ga0496115_0070652 3300048918 Bacteria 2830
850 Ga0496115_0206703 3300048918 Bacteria 1622
851 Ga0496116_0026187 3300048919 Bacteria 4271
852 Ga0496116_0057292 3300048919 Bacteria 2549
853 Ga0496116_0105778 3300048919 Bacteria 1668
854 Ga0496116_0185864 3300048919 Bacteria 1106
855 Ga0496117_0000056 3300048920 Bacteria 271417
856 Ga0496117_0188276 3300048920 Bacteria 1179
857 Ga0496118_0000047 3300048921 Bacteria 271417
858 Ga0496120_0032366 3300048923 Bacteria 3154
859 Ga0496121_0065545 3300048924 Bacteria 2954
860 Ga0496121_0083876 3300048924 Bacteria 2514
861 Ga0496122_0003500 3300048925 Bacteria 20624
862 Ga0496122_0011365 3300048925 Bacteria 9025
863 Ga0496122_0048040 3300048925 Bacteria 3287
864 Ga0496122_0062149 3300048925 Bacteria 2736
865 Ga0496122_0233908 3300048925 Bacteria 1042
866 Ga0496123_0001889 3300048926 Bacteria 27331
867 Ga0496123_0004206 3300048926 Bacteria 15365
868 Ga0496123_0004451 3300048926 Bacteria 14721
869 Ga0496123_0008303 3300048926 Bacteria 9559
870 Ga0496123_0167277 3300048926 Bacteria 1164
871 Ga0496124_0012172 3300048927 Bacteria 8516
872 Ga0496124_0014920 3300048927 Bacteria 7481
873 Ga0496124_0097405 3300048927 Bacteria 2388
874 Ga0496124_0142204 3300048927 Bacteria 1892
875 Ga0496124_0190827 3300048927 Bacteria 1568
876 Ga0496124_0209199 3300048927 Bacteria 1477
877 Ga0496124_0367245 3300048927 Bacteria 1012
878 Ga0496125_0000785 3300048928 Bacteria 51744
879 Ga0496125_0009271 3300048928 Bacteria 10158
880 Ga0496125_0012169 3300048928 Bacteria 8561
881 Ga0496125_0026533 3300048928 Bacteria 5274
882 Ga0496125_0118833 3300048928 Bacteria 1892
883 Ga0496126_0016156 3300048929 Bacteria 7478
884 Ga0495678_000001 3300049459 Bacteria 1060340
885 Ga0495678_000189 3300049459 Bacteria 72122
886 Ga0495678_001123 3300049459 Bacteria 22226
887 Ga0495678_001477 3300049459 Bacteria 18405
888 Ga0495678_001970 3300049459 Bacteria 14790
889 Ga0495678_003765 3300049459 Bacteria 9159
890 Ga0495678_033602 3300049459 Bacteria 2116
891 Ga0495678_035744 3300049459 Bacteria 2033
892 Ga0495682_0002215 3300049460 Bacteria 9399
893 Ga0495682_0009187 3300049460 Bacteria 3867
894 Ga0495682_0015458 3300049460 Bacteria 2892
895 Ga0495682_0025202 3300049460 Bacteria 2213
896 Ga0495682_0031171 3300049460 Bacteria 1971
897 Ga0495682_0074129 3300049460 Bacteria 1224
898 Ga0501047_0173021 3300049581 Bacteria 2028
899 Ga0501227_007844 3300049665 Bacteria 2290
900 Ga0501227_040624 3300049665 Bacteria 1148
901 Ga0501230_011025 3300049667 Bacteria 1424
902 Ga0501238_006124 3300049671 Bacteria 1543
903 Ga0501248_003291 3300049678 Bacteria 1158
904 Ga0501279_004414 3300049775 Bacteria 1846
905 Ga0501035_0002555 3300049822 Bacteria 17797
906 Ga0500618_011098 3300053125 Bacteria 2398
907 Ga0500586_045478 3300053145 Bacteria 1502
908 Ga0466962_0091766 3300061719 Bacteria 1455
909 2511248887 2511231003 Bacteria 5606035
910 2511386092 2511231026 Bacteria 5225445
911 2521561052 2521172590 Bacteria 5047645
912 2550696358 2548876994 Bacteria 4904866
913 2553006062 2551306416 Bacteria 6152985
914 2601672088 2600255292 Bacteria 6300551
915 2643789795 2643221554 Bacteria 6603920
916 2643796901 2643221556 Bacteria 7251154
917 2644027196 2643221603 Bacteria 6147767
918 2644214483 2643221638 Bacteria 6579467
919 2644249853 2643221645 Bacteria 7207331
920 2644358517 2643221664 Bacteria 7272945
921 2644469994 2643221684 Bacteria 7145183
922 2738739450 2738541280 Bacteria 6630198
923 2738827673 2738541297 Bacteria 6549566
924 2738846025 2738541300 Bacteria 6675882
925 2739151469 2738541357 Bacteria 6549408
926 2739193389 2738543003 Bacteria 6549560
927 2739275822 2738543018 Bacteria 6718814
928 2739319865 2738543026 Bacteria 6549408
929 2739338106 2738543029 Bacteria 6549249
930 2739344866 2738543030 Bacteria 6719714
931 2765567490 2765235838 Bacteria 5445269
932 2808983055 2808606386 Bacteria 4471946
933 2809130574 2808606415 Bacteria 4576710
934 2809147233 2808606418 Bacteria 6724496
935 2809149949 2808606419 Bacteria 4576925
936 2819594274 2818991445 Bacteria 4955017
937 2819617437 2818991449 Bacteria 5518009
938 2821135961 2821131069 Bacteria 6108407
939 2839095068 2839094727 Bacteria 5534556
940 2842713088 2842711865 Bacteria 7155354
941 2852621833 2852618963 Bacteria 4577824
942 2857552452 2857547612 Bacteria 6179999
943 2857555644 2857553236 Bacteria 6166726
944 2857561831 2857558681 Bacteria 6617694
945 2857569302 2857564685 Bacteria 6290584
946 2884814617 2884811622 Bacteria 5552861
947 2884839610 2884836552 Bacteria 5219991
948 2884856580 2884852848 Bacteria 5221161
949 2885085906 2885080285 Bacteria 6355622
950 2896157926 2896154374 Bacteria 5221518
951 2904429459 2904424332 Bacteria 7633521
952 2904442310 2904439833 Bacteria 5931679
953 2904533588 2904530477 Bacteria 5876334
954 2904586543 2904584206 Bacteria 6028872
955 2904591643 2904589729 Bacteria 6113573
956 2904602219 2904601388 Bacteria 5884906
957 2919050569 2919046199 Bacteria 5567169
958 2919083458 2919079590 Bacteria 5946433
959 2919479310 2919476304 Bacteria 5888696
960 2923514902 2923510766 Bacteria 5926163
961 2928133605 2928130867 Bacteria 5467269
962 2932415274 2932410948 Bacteria 6312192
963 2932421078 2932416698 Bacteria 6315112
964 8047676826 8047673197 Bacteria 7395230
965 Ga0495650_0000133
966 JGI25155J39150_1000903
967 JGI25155J39150_1000904
968 JGI25156J39149_1000823
969 JGI25154J39366_1000731
970 JGI25154J39366_1004022
971 JGI25154J39366_1004037
972 JGI25157J39369_1001361
973 JGI25150J39212_1002710
974 JGI25159J45721_1004330
975 JGI25159J45721_1010869
976 rootH2_10146404
977 rootL2_10151043
978 rootH1_10204259
979 JGI25160J50197_1029770
980 JGI25161J50226_1004014
981 JGI25161J50226_1006048
982 Ga0007409J51694_1044304
983 Ga0055538_1000051
984 Ga0055539_1000076
985 Ga0055533_1000082
986 Ga0055532_1000018
987 Ga0055525_1000006
988 Ga0055525_1000109
989 Ga0055535_1002873
990 Ga0055529_1000190
991 Ga0055526_1000195
992 Ga0055526_1001666
993 Ga0055526_1022272
994 Ga0055537_1000052
995 Ga0055537_1000103
996 Ga0055537_1003412
997 Ga0055524_1001183
998 Ga0055524_1025272
999 Ga0055524_1041882
1000 Ga0055534_1000254
1001 Ga0055534_1001676
1002 Ga0055528_1000031
1003 Ga0055528_1004431
1004 Ga0055530_10008966
1005 Ga0055541_1000053
1006 Ga0055543_1005491
1007 Ga0055543_1007667
1008 Ga0065165_1002165
1009 Ga0065165_1013605
1010 Ga0065165_1015061
1011 Ga0065165_1032029
1012 Ga0070658_10161603
1013 Ga0070683_100273521
1014 Ga0070670_100058189
1015 Ga0070660_100079404
1016 Ga0070660_100131842
1017 Ga0070661_100194564
1018 Ga0070675_100341795
1019 Ga0070659_100191403
1020 Ga0070659_100262031
1021 Ga0070662_100327575
1022 Ga0068855_100002635
1023 Ga0068855_100015358
1024 Ga0068855_100152188
1025 Ga0070664_100092754
1026 Ga0068854_100007673
1027 Ga0068854_100353843
1028 Ga0068856_100272998
1029 Ga0068852_100002652
1030 Ga0075363_100152514
1031 Ga0075364_10147955
1032 Ga0070712_100028465
1033 Ga0075362_10057409
1034 Ga0097621_100335047
1035 Ga0079104_1009540
1036 Ga0079104_1011025
1037 Ga0099826_10000006
1038 Ga0105251_10027953
1039 Ga0105244_10007276
1040 Ga0105244_10028198
1041 Ga0105244_10040521
1042 Ga0105244_10050239
1043 Ga0105240_10024611
1044 Ga0105240_10158570
1045 Ga0105240_10313801
1046 Ga0105245_10205608
1047 Ga0105243_10086802
1048 Ga0105243_10320951
1049 Ga0105241_10009003
1050 Ga0105242_10327667
1051 Ga0105237_10025642
1052 Ga0105238_10000004
1053 Ga0105239_10001082
1054 Ga0105239_10691113
1055 Ga0105246_10141371
1056 Ga0157373_10126058
1057 Ga0157371_10000010
1058 Ga0182008_10005626
1059 Ga0182008_10040352
1060 Ga0182008_10074964
1061 Ga0157377_10129544
1062 Ga0182006_1000030
1063 Ga0182006_1000169
1064 Ga0182006_1012297
1065 Ga0182006_1023267
1066 Ga0182006_1068628
1067 Ga0182007_10001378
1068 Ga0182005_1000003
1069 Ga0182005_1000021
1070 Ga0163161_10014987
1071 Ga0163161_10187771
1072 Ga0213872_10000382
1073 Ga0213872_10000622
1074 Ga0213872_10002407
1075 Ga0213872_10005394
1076 Ga0213872_10026673
1077 Ga0213872_10035945
1078 Ga0209435_100007
1079 Ga0209435_101147
1080 Ga0209436_101121
1081 Ga0209784_100083
1082 Ga0209566_100102
1083 Ga0209674_100125
1084 Ga0209147_100017
1085 Ga0209563_100022
1086 Ga0209563_100120
1087 Ga0209437_100088
1088 Ga0209437_106872
1089 Ga0209258_100215
1090 Ga0207425_1000013
1091 Ga0207425_1000370
1092 Ga0209646_1000044
1093 Ga0209646_1000126
1094 Ga0209646_1002496
1095 Ga0209026_1000052
1096 Ga0209026_1001175
1097 Ga0209026_1014406
1098 Ga0209677_100076
1099 Ga0209677_101962
1100 Ga0209148_1001468
1101 Ga0209759_1000782
1102 Ga0209759_1001215
1103 Ga0209129_1000106
1104 Ga0209565_1000035
1105 Ga0209565_1004160
1106 Ga0209565_1009050
1107 Ga0209455_1000033
1108 Ga0209673_1000006
1109 Ga0209673_1008389
1110 Ga0209130_1000086
1111 Ga0209130_1002898
1112 Ga0209130_1007695
1113 Ga0209675_1000005
1114 Ga0209675_1006075
1115 Ga0209025_1002336
1116 Ga0209564_1000028
1117 Ga0209564_1000032
1118 Ga0209564_1000083
1119 Ga0209564_1000088
1120 Ga0209758_1000031
1121 Ga0209758_1000343
1122 Ga0209050_1000078
1123 Ga0209256_1000035
1124 Ga0209256_1000305
1125 Ga0209256_1000443
1126 Ga0209256_1005775
1127 Ga0207426_1015578
1128 Ga0209257_1000097
1129 Ga0207655_1005215
1130 Ga0207655_1036952
1131 Ga0207713_1084899
1132 Ga0207705_10009312
1133 Ga0207654_10016214
1134 Ga0207695_10000566
1135 Ga0207695_10002142
1136 Ga0207695_10019040
1137 Ga0207671_10003833
1138 Ga0207657_10125767
1139 Ga0207694_10000107
1140 Ga0207694_10258626
1141 Ga0207690_10107787
1142 Ga0207686_10012008
1143 Ga0207709_10109803
1144 Ga0207704_10252619
1145 Ga0207667_10002292
1146 Ga0207667_10017805
1147 Ga0207667_10163155
1148 Ga0207640_10101897
1149 Ga0207678_10038748
1150 Ga0207702_10390224
1151 Ga0207674_10111232
1152 Ga0207698_10001307
1153 Ga0209281_1003433
1154 Ga0209281_1008041
1155 Ga0209282_1000003
1156 Ga0316181_1083718
1157 Ga0307513_10152900
1158 Ga0307408_100000932
1159 Ga0307408_100020670
1160 Ga0307408_100078117
1161 Ga0265314_10015239
1162 Ga0307416_100404647
1163 Ga0307416_100404910
1164 Ga0307414_10006353
1165 Ga0395899_0000586
1166 Ga0395899_0001071
1167 Ga0395899_0001797
1168 Ga0395899_0008996
1169 Ga0395899_0270747
1170 Ga0395899_0285044
1171 Ga0395899_0353346
1172 Ga0395900_0000412
1173 Ga0395900_0005380
1174 Ga0395900_0024680
1175 Ga0395900_0039694
1176 Ga0395900_0082610
1177 Ga0395900_0090201
1178 Ga0395900_0099780
1179 Ga0395900_0380433
1180 Ga0395898_0279134
1181 Ga0395898_0331291
1182 Ga0395905_0013432
1183 Ga0395905_0016602
1184 Ga0395905_0026481
1185 Ga0395905_0131946
1186 Ga0395905_0142967
1187 Ga0395905_0551045
1188 Ga0395901_0000116
1189 Ga0395901_0001676
1190 Ga0395901_0039070
1191 Ga0395901_0130823
1192 Ga0395901_0140258
1193 Ga0436361_0007669
1194 Ga0436361_0009624
1195 Ga0436361_0027066
1196 Ga0436361_0075330
1197 Ga0436361_0178921
1198 Ga0436361_0182922
1199 Ga0436361_0188617
1200 Ga0436361_0237459
1201 Ga0436361_0566522
1202 Ga0439448_0001028
1203 Ga0439448_0070076
1204 Ga0439450_053921
1205 Ga0439455_0046551
1206 Ga0439455_0048713
1207 Ga0450920_026638
1208 Ga0466969_0152716
1209 Ga0466972_0003207
1210 Ga0466972_0191937
1211 Ga0466981_0124873
1212 Ga0466965_0065285
1213 Ga0466965_0074309
1214 Ga0466966_0049316
1215 Ga0466966_0169857
1216 Ga0466961_0211088
1217 Ga0466964_0043014
1218 Ga0466964_0065604
1219 Ga0466964_0214466
1220 Ga0466971_0101181
1221 Ga0466968_0005873
1222 Ga0466970_0130429
1223 Ga0466970_0154838
1224 Ga0466957_0236616
1225 Ga0466959_0045923
1226 Ga0466959_0050094
1227 Ga0466958_0159262
1228 Ga0466958_0265780
1229 Ga0466967_0109475
1230 Ga0466967_0197375
1231 Ga0466967_0318565
1232 Ga0466967_0795317
1233 Ga0495617_000011
1234 Ga0495617_003657
1235 Ga0495617_010338
1236 Ga0495617_056761
1237 Ga0495627_000016
1238 Ga0495627_000763
1239 Ga0495627_005564
1240 Ga0495627_087396
1241 Ga0495603_0093011
1242 Ga0495590_0000058
1243 Ga0495590_0000106
1244 Ga0495590_0013789
1245 Ga0495591_001143
1246 Ga0495591_003126
1247 Ga0495629_0016716
1248 Ga0495629_0041702
1249 Ga0495629_0173574
1250 Ga0495638_0000627
1251 Ga0495638_0009922
1252 Ga0495638_0015654
1253 Ga0495638_0026232
1254 Ga0495638_0155680
1255 Ga0495638_0228912
1256 Ga0495638_0257424
1257 Ga0495653_0000014
1258 Ga0495653_0258872
1259 Ga0495650_0000146
1260 Ga0495650_0000463
1261 Ga0495650_0001265
1262 Ga0495650_0002498
1263 Ga0495650_0004500
1264 Ga0495650_0006394
1265 Ga0495650_0020705
1266 Ga0495580_0040029
1267 Ga0495580_0113850
1268 Ga0495582_0014448
1269 Ga0495605_0000010
1270 Ga0495605_0000039
1271 Ga0495605_0000538
1272 Ga0495605_0008930
1273 Ga0495605_0026423
1274 Ga0495605_0040766
1275 Ga0495605_0055051
1276 Ga0495605_0056332
1277 Ga0495605_0066311
1278 Ga0495605_0086798
1279 Ga0495605_0125885
1280 Ga0495664_0116549
1281 Ga0495584_0000013
1282 Ga0495584_0002452
1283 Ga0495584_0005167
1284 Ga0495584_0007688
1285 Ga0495584_0012715
1286 Ga0495584_0016161
1287 Ga0495584_0016883
1288 Ga0495584_0094809
1289 Ga0495584_0098288
1290 Ga0495584_0101597
1291 Ga0495585_0000022
1292 Ga0495585_0000113
1293 Ga0495585_0001386
1294 Ga0495585_0006153
1295 Ga0495585_0012805
1296 Ga0495585_0022471
1297 Ga0495585_0026884
1298 Ga0495585_0027489
1299 Ga0495585_0033829
1300 Ga0495585_0049318
1301 Ga0495585_0087859
1302 Ga0495585_0105701
1303 Ga0495585_0117079
1304 Ga0495585_0124887
1305 Ga0495585_0126458
1306 Ga0495585_0172244
1307 Ga0495585_0216852
1308 Ga0495594_0004259
1309 Ga0495594_0015503
1310 Ga0495594_0045308
1311 Ga0495594_0062914
1312 Ga0495594_0070396
1313 Ga0495596_0001233
1314 Ga0495596_0003331
1315 Ga0495596_0007247
1316 Ga0495596_0009426
1317 Ga0495596_0010042
1318 Ga0495596_0010675
1319 Ga0495596_0025918
1320 Ga0495596_0049265
1321 Ga0495596_0060983
1322 Ga0495596_0071002
1323 Ga0495596_0104437
1324 Ga0495596_0152751
1325 Ga0495607_0004188
1326 Ga0495607_0005132
1327 Ga0495607_0007344
1328 Ga0495607_0008224
1329 Ga0495607_0009130
1330 Ga0495607_0009309
1331 Ga0495607_0033362
1332 Ga0495607_0048161
1333 Ga0495607_0056733
1334 Ga0495607_0068636
1335 Ga0495607_0077822
1336 Ga0495607_0106983
1337 Ga0495607_0117772
1338 Ga0495607_0141513
1339 Ga0495607_0204421
1340 Ga0495583_0000116
1341 Ga0495583_0000183
1342 Ga0495583_0000346
1343 Ga0495583_0001913
1344 Ga0495583_0005617
1345 Ga0495583_0026460
1346 Ga0495583_0041649
1347 Ga0495583_0054490
1348 Ga0495583_0097471
1349 Ga0495583_0102328
1350 Ga0495583_0112450
1351 Ga0495606_0000004
1352 Ga0495606_0000366
1353 Ga0495606_0003214
1354 Ga0495606_0003330
1355 Ga0495606_0004560
1356 Ga0495606_0004565
1357 Ga0495606_0035679
1358 Ga0495606_0039905
1359 Ga0495606_0042863
1360 Ga0495606_0044389
1361 Ga0495606_0066522
1362 Ga0495606_0096980
1363 Ga0495610_0000007
1364 Ga0495610_0001668
1365 Ga0495610_0002052
1366 Ga0495610_0017359
1367 Ga0495610_0063055
1368 Ga0495610_0143074
1369 Ga0495616_0000886
1370 Ga0495616_0002203
1371 Ga0495616_0008138
1372 Ga0495616_0011430
1373 Ga0495616_0018277
1374 Ga0495616_0023298
1375 Ga0495616_0045053
1376 Ga0495616_0054519
1377 Ga0495616_0066640
1378 Ga0495616_0113247
1379 Ga0495616_0150880
1380 Ga0495620_0001481
1381 Ga0495630_0014367
1382 Ga0495630_0021709
1383 Ga0495631_0005291
1384 Ga0495631_0005660
1385 Ga0495631_0006226
1386 Ga0495631_0007915
1387 Ga0495631_0010634
1388 Ga0495631_0011563
1389 Ga0495631_0012775
1390 Ga0495631_0020114
1391 Ga0495631_0028312
1392 Ga0495631_0067622
1393 Ga0495631_0091635
1394 Ga0495631_0118846
1395 Ga0495632_0001028
1396 Ga0495632_0002302
1397 Ga0495632_0004450
1398 Ga0495632_0004520
1399 Ga0495632_0006884
1400 Ga0495632_0027760
1401 Ga0495632_0057631
1402 Ga0495632_0067636
1403 Ga0495632_0079692
1404 Ga0495632_0118632
1405 Ga0495637_0000028
1406 Ga0495637_0000954
1407 Ga0495637_0019492
1408 Ga0495637_0027619
1409 Ga0495637_0060396
1410 Ga0495637_0062835
1411 Ga0495643_0001967
1412 Ga0495643_0011296
1413 Ga0495643_0013328
1414 Ga0495643_0014155
1415 Ga0495643_0022739
1416 Ga0495643_0032979
1417 Ga0495643_0076024
1418 Ga0495643_0140105
1419 Ga0495644_0005071
1420 Ga0495644_0010228
1421 Ga0495644_0014085
1422 Ga0495644_0015473
1423 Ga0495644_0046639
1424 Ga0495644_0071886
1425 Ga0495644_0080643
1426 Ga0495644_0086678
1427 Ga0495648_0000004
1428 Ga0495648_0000959
1429 Ga0495648_0008094
1430 Ga0495648_0016571
1431 Ga0495648_0017399
1432 Ga0495648_0021055
1433 Ga0495648_0034423
1434 Ga0495648_0046099
1435 Ga0495648_0054128
1436 Ga0495648_0103892
1437 Ga0495648_0108491
1438 Ga0495663_0004726
1439 Ga0495666_0014119
1440 Ga0495666_0026583
1441 Ga0495642_0000192
1442 Ga0495642_0003054
1443 Ga0495642_0004695
1444 Ga0495642_0008562
1445 Ga0495642_0017090
1446 Ga0495642_0018572
1447 Ga0495642_0074273
1448 Ga0495642_0077465
1449 Ga0495642_0085783
1450 Ga0495642_0093345
1451 Ga0495642_0168782
1452 Ga0495652_0014511
1453 Ga0495652_0032367
1454 Ga0495654_0000034
1455 Ga0495654_0024101
1456 Ga0495654_0032713
1457 Ga0495654_0047265
1458 Ga0495654_0048514
1459 Ga0495654_0083222
1460 Ga0495654_0095058
1461 Ga0495665_0081673
1462 Ga0495665_0099954
1463 Ga0495665_0142662
1464 Ga0495640_0043745
1465 Ga0495586_0025993
1466 Ga0495586_0065502
1467 Ga0495586_0104447
1468 Ga0495586_0184320
1469 Ga0495587_0005967
1470 Ga0495587_0014440
1471 Ga0495609_0000005
1472 Ga0495609_0002200
1473 Ga0495609_0004608
1474 Ga0495609_0005373
1475 Ga0495609_0013673
1476 Ga0495609_0014101
1477 Ga0495609_0025980
1478 Ga0495609_0064933
1479 Ga0495609_0089692
1480 Ga0495609_0095475
1481 Ga0495609_0102220
1482 Ga0495609_0137606
1483 Ga0495597_0002058
1484 Ga0495597_0003749
1485 Ga0495597_0006439
1486 Ga0495597_0007831
1487 Ga0495597_0009171
1488 Ga0495597_0020980
1489 Ga0495597_0021281
1490 Ga0495597_0031813
1491 Ga0495597_0036552
1492 Ga0495597_0053023
1493 Ga0495597_0149109
1494 Ga0495622_0000431
1495 Ga0495622_0017240
1496 Ga0495622_0034328
1497 Ga0495622_0063784
1498 Ga0495622_0084648
1499 Ga0495622_0094309
1500 Ga0495622_0117628
1501 Ga0495633_0001323
1502 Ga0495633_0002334
1503 Ga0495633_0005934
1504 Ga0495633_0007634
1505 Ga0495633_0010333
1506 Ga0495633_0011467
1507 Ga0495633_0011829
1508 Ga0495633_0013554
1509 Ga0495633_0016155
1510 Ga0495633_0021809
1511 Ga0495633_0025153
1512 Ga0495633_0047934
1513 Ga0495633_0056645
1514 Ga0495633_0077446
1515 Ga0495633_0080431
1516 Ga0495633_0111430
1517 Ga0495633_0167648
1518 Ga0495656_0002682
1519 Ga0495656_0037666
1520 Ga0495656_0040845
1521 Ga0495656_0103108
1522 Ga0495656_0118383
1523 Ga0495668_0000136
1524 Ga0495668_0000714
1525 Ga0495668_0001539
1526 Ga0495668_0001987
1527 Ga0495668_0002289
1528 Ga0495668_0002780
1529 Ga0495668_0006582
1530 Ga0495668_0012333
1531 Ga0495668_0034617
1532 Ga0495668_0036500
1533 Ga0495668_0041946
1534 Ga0495668_0055021
1535 Ga0495668_0059214
1536 Ga0495668_0125371
1537 Ga0495634_0009252
1538 Ga0495634_0055208
1539 Ga0495611_0001201
1540 Ga0495611_0039215
1541 Ga0495611_0043341
1542 Ga0495611_0054023
1543 Ga0495611_0095778
1544 Ga0495625_0000257
1545 Ga0495625_0008397
1546 Ga0495625_0008424
1547 Ga0495625_0020272
1548 Ga0495625_0029275
1549 Ga0495625_0064369
1550 Ga0495625_0072752
1551 Ga0495625_0083001
1552 Ga0495625_0092658
1553 Ga0495625_0111301
1554 Ga0495625_0115751
1555 Ga0495625_0121678
1556 Ga0495635_0047558
1557 Ga0495659_0000958
1558 Ga0495659_0003135
1559 Ga0495659_0072811
1560 Ga0495661_0000266
1561 Ga0495661_0001306
1562 Ga0495661_0007202
1563 Ga0495661_0007222
1564 Ga0495661_0011557
1565 Ga0495661_0015180
1566 Ga0495661_0023759
1567 Ga0495661_0032040
1568 Ga0495661_0036891
1569 Ga0495661_0046324
1570 Ga0495661_0058755
1571 Ga0495661_0058953
1572 Ga0495661_0065569
1573 Ga0495661_0086076
1574 Ga0495661_0087639
1575 Ga0495661_0088107
1576 Ga0495661_0128168
1577 Ga0495588_0000059
1578 Ga0495588_0014365
1579 Ga0495588_0102351
1580 Ga0495588_0105232
1581 Ga0495588_0120400
1582 Ga0495588_0122849
1583 Ga0495588_0182600
1584 Ga0495623_0023671
1585 Ga0495623_0094483
1586 Ga0495623_0196116
1587 Ga0495646_0168251
1588 Ga0495669_0000478
1589 Ga0495669_0000703
1590 Ga0495669_0001250
1591 Ga0495669_0004391
1592 Ga0495669_0027362
1593 Ga0495669_0034337
1594 Ga0495669_0064094
1595 Ga0495669_0079768
1596 Ga0495613_0036807
1597 Ga0495613_0251387
1598 Ga0495624_0020480
1599 Ga0495670_0002558
1600 Ga0495670_0003391
1601 Ga0495670_0007582
1602 Ga0495670_0008595
1603 Ga0495670_0015349
1604 Ga0495670_0028706
1605 Ga0495670_0070831
1606 Ga0495670_0113539
1607 Ga0495670_0115302
1608 Ga0495671_0000033
1609 Ga0495671_0000718
1610 Ga0495671_0015145
1611 Ga0495671_0031664
1612 Ga0495671_0046342
1613 Ga0495671_0053133
1614 Ga0495671_0059003
1615 Ga0495671_0098694
1616 Ga0495649_0000648
1617 Ga0495649_0005239
1618 Ga0495649_0006115
1619 Ga0495649_0059151
1620 Ga0495649_0069807
1621 Ga0495649_0116924
1622 Ga0495649_0238126
1623 Ga0495589_0000024
1624 Ga0495589_0000047
1625 Ga0495589_0006143
1626 Ga0495589_0006608
1627 Ga0495589_0031652
1628 Ga0495589_0036149
1629 Ga0495589_0041445
1630 Ga0495589_0046985
1631 Ga0495589_0071292
1632 Ga0495589_0091504
1633 Ga0495589_0111646
1634 Ga0495589_0117324
1635 Ga0495589_0134821
1636 Ga0495600_0013073
1637 Ga0495600_0094108
1638 Ga0495600_0097922
1639 Ga0495660_0000170
1640 Ga0495660_0001802
1641 Ga0495660_0004464
1642 Ga0495660_0004831
1643 Ga0495660_0033132
1644 Ga0495660_0041270
1645 Ga0495660_0052670
1646 Ga0495660_0053775
1647 Ga0495660_0060937
1648 Ga0495660_0069402
1649 Ga0495660_0090291
1650 Ga0495660_0103954
1651 Ga0495660_0138126
1652 Ga0495581_0030961
1653 Ga0495581_0125807
1654 Ga0495581_0131337
1655 Ga0495581_0134789
1656 Ga0495581_0311430
1657 Ga0495604_0015699
1658 Ga0495604_0054517
1659 Ga0495604_0156245
1660 Ga0495604_0360932
1661 Ga0495604_0371460
1662 Ga0495636_0000477
1663 Ga0495636_0005218
1664 Ga0495636_0051922
1665 Ga0495636_0074716
1666 Ga0495636_0138255
1667 Ga0495636_0168131
1668 Ga0495674_0004055
1669 Ga0495672_0000005
1670 Ga0495672_0000099
1671 Ga0495672_0000227
1672 Ga0495672_0000508
1673 Ga0495672_0000582
1674 Ga0495672_0001291
1675 Ga0495672_0007431
1676 Ga0495672_0035796
1677 Ga0495672_0039090
1678 Ga0495672_0073119
1679 Ga0495672_0075511
1680 Ga0495672_0116395
1681 Ga0495672_0128107
1682 Ga0495676_0000135
1683 Ga0495676_0062839
1684 Ga0495676_0115145
1685 Ga0495676_0121801
1686 Ga0495680_0002926
1687 Ga0495683_0000330
1688 Ga0495683_0001443
1689 Ga0495683_0008998
1690 Ga0495683_0019056
1691 Ga0495683_0021636
1692 Ga0495683_0038721
1693 Ga0495683_0047484
1694 Ga0495683_0052437
1695 Ga0495683_0068550
1696 Ga0495683_0102115
1697 Ga0495683_0122884
1698 Ga0495683_0126371
1699 Ga0495683_0159625
1700 Ga0495687_000008
1701 Ga0495687_000283
1702 Ga0495687_000609
1703 Ga0495687_001103
1704 Ga0495687_001268
1705 Ga0495687_003420
1706 Ga0495687_003422
1707 Ga0495687_003464
1708 Ga0495687_005735
1709 Ga0495687_010116
1710 Ga0495675_0008225
1711 Ga0495675_0010625
1712 Ga0495675_0145101
1713 Ga0495677_0000007
1714 Ga0495677_0000272
1715 Ga0495677_0007024
1716 Ga0495677_0012797
1717 Ga0495677_0016033
1718 Ga0495677_0016439
1719 Ga0495677_0017195
1720 Ga0495677_0019775
1721 Ga0495677_0023464
1722 Ga0495677_0026921
1723 Ga0495677_0027085
1724 Ga0495677_0030913
1725 Ga0495677_0053361
1726 Ga0495677_0062648
1727 Ga0495677_0098663
1728 Ga0495679_002252
1729 Ga0495679_006356
1730 Ga0495679_020303
1731 Ga0495679_047986
1732 Ga0495679_054104
1733 Ga0495685_000322
1734 Ga0495685_001700
1735 Ga0495685_019822
1736 Ga0495685_065666
1737 Ga0495673_0000031
1738 Ga0495673_0000032
1739 Ga0495673_0010885
1740 Ga0495673_0017001
1741 Ga0495681_0001145
1742 Ga0495681_0007609
1743 Ga0495681_0023073
1744 Ga0495681_0027386
1745 Ga0495681_0028913
1746 Ga0495681_0034798
1747 Ga0495681_0040853
1748 Ga0495681_0046347
1749 Ga0495681_0063979
1750 Ga0495681_0064600
1751 Ga0495681_0068118
1752 Ga0495681_0091380
1753 Ga0495681_0125993
1754 Ga0495686_0000244
1755 Ga0495686_0003101
1756 Ga0495686_0015815
1757 Ga0495686_0038059
1758 Ga0495686_0046265
1759 Ga0495686_0071414
1760 Ga0495686_0073254
1761 Ga0495593_0009351
1762 Ga0495593_0012576
1763 Ga0495593_0029803
1764 Ga0495593_0075119
1765 Ga0495593_0077577
1766 Ga0495602_0020901
1767 Ga0495602_0069191
1768 Ga0495614_0012946
1769 Ga0495614_0017667
1770 Ga0495614_0076971
1771 Ga0495615_0004411
1772 Ga0495626_0000047
1773 Ga0495626_0001065
1774 Ga0495626_0008756
1775 Ga0495626_0014506
1776 Ga0495626_0027409
1777 Ga0495626_0038570
1778 Ga0495626_0054505
1779 Ga0495626_0074133
1780 Ga0495626_0075576
1781 Ga0495626_0078193
1782 Ga0495626_0104853
1783 Ga0495626_0149509
1784 Ga0496101_0024575
1785 Ga0496102_0000877
1786 Ga0496102_0117440
1787 Ga0496102_0381953
1788 Ga0496103_0010480
1789 Ga0496103_0072271
1790 Ga0496103_0110959
1791 Ga0496103_0185303
1792 Ga0496105_0333738
1793 Ga0496106_0071359
1794 Ga0496106_0179124
1795 Ga0496107_0129127
1796 Ga0496107_0197039
1797 Ga0496108_0127385
1798 Ga0496108_0298637
1799 Ga0496108_0661431
1800 Ga0496109_0026732
1801 Ga0496109_0242306
1802 Ga0496109_0291072
1803 Ga0496110_0008056
1804 Ga0496110_0011259
1805 Ga0496111_0046887
1806 Ga0496111_0291138
1807 Ga0496111_0362281
1808 Ga0496113_0121260
1809 Ga0496113_0145116
1810 Ga0496114_0175944
1811 Ga0496114_0217514
1812 Ga0496115_0029431
1813 Ga0496115_0070652
1814 Ga0496115_0206703
1815 Ga0496116_0026187
1816 Ga0496116_0057292
1817 Ga0496116_0105778
1818 Ga0496116_0185864
1819 Ga0496117_0000056
1820 Ga0496117_0188276
1821 Ga0496118_0000047
1822 Ga0496120_0032366
1823 Ga0496121_0065545
1824 Ga0496121_0083876
1825 Ga0496122_0003500
1826 Ga0496122_0011365
1827 Ga0496122_0048040
1828 Ga0496122_0062149
1829 Ga0496122_0233908
1830 Ga0496123_0001889
1831 Ga0496123_0004206
1832 Ga0496123_0004451
1833 Ga0496123_0008303
1834 Ga0496123_0167277
1835 Ga0496124_0012172
1836 Ga0496124_0014920
1837 Ga0496124_0097405
1838 Ga0496124_0142204
1839 Ga0496124_0190827
1840 Ga0496124_0209199
1841 Ga0496124_0367245
1842 Ga0496125_0000785
1843 Ga0496125_0009271
1844 Ga0496125_0012169
1845 Ga0496125_0026533
1846 Ga0496125_0118833
1847 Ga0496126_0016156
1848 Ga0495678_000001
1849 Ga0495678_000189
1850 Ga0495678_001123
1851 Ga0495678_001477
1852 Ga0495678_001970
1853 Ga0495678_003765
1854 Ga0495678_033602
1855 Ga0495678_035744
1856 Ga0495682_0002215
1857 Ga0495682_0009187
1858 Ga0495682_0015458
1859 Ga0495682_0025202
1860 Ga0495682_0031171
1861 Ga0495682_0074129
1862 Ga0501047_0173021
1863 Ga0501227_007844
1864 Ga0501227_040624
1865 Ga0501230_011025
1866 Ga0501238_006124
1867 Ga0501248_003291
1868 Ga0501279_004414
1869 Ga0501035_0002555
1870 Ga0500618_011098
1871 Ga0500586_045478
1872 Ga0466962_0091766
1873 2511248887
1874 2511386092
1875 2521561052
1876 2550696358
1877 2553006062
1878 2601672088
1879 2643789795
1880 2643796901
1881 2644027196
1882 2644214483
1883 2644249853
1884 2644358517
1885 2644469994
1886 2738739450
1887 2738827673
1888 2738846025
1889 2739151469
1890 2739193389
1891 2739275822
1892 2739319865
1893 2739338106
1894 2739344866
1895 2765567490
1896 2808983055
1897 2809130574
1898 2809147233
1899 2809149949
1900 2819594274
1901 2819617437
1902 2821135961
1903 2839095068
1904 2842713088
1905 2852621833
1906 2857552452
1907 2857555644
1908 2857561831
1909 2857569302
1910 2884814617
1911 2884839610
1912 2884856580
1913 2885085906
1914 2896157926
1915 2904429459
1916 2904442310
1917 2904533588
1918 2904586543
1919 2904591643
1920 2904602219
1921 2919050569
1922 2919083458
1923 2919479310
1924 2923514902
1925 2928133605
1926 2932415274
1927 2932421078
1928 8047676826

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08478

POTRA_1

POTRA domain, FtsQ-type

37

110

0.93

PF03799

FtsQ_DivIB_C

Cell division protein FtsQ/DivIB, C-terminal

114

235

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xbt-assembly1.cif.gz_A crystal structure of the adenylation domain of cmng in complex with amp 0.8709 76 118
8bh1-assembly1.cif.gz_C core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8637 107 242
6h9o-assembly2.cif.gz_C complex of the periplasmic domains of bacterial cell division proteins ftsq and ftsb 0.849 40 244
8bh1-assembly1.cif.gz_C core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8342 107 242
6h9o-assembly2.cif.gz_C complex of the periplasmic domains of bacterial cell division proteins ftsq and ftsb 0.8292 40 244
ID Description Score Start End Superfamily
6h9oC01 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.842 40 110 3.10.20.310
2vh2B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cell division protein FtsQ/DivIB 0.8302 112 242 3.40.50.11690
6h9oC01 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8301 40 110 3.10.20.310
af_Q149M9_1223_1377_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7981 172 200 2.120.10.30
af_Q2FZ91_195_261_3.10.20.310 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.7896 38 108 3.10.20.310
ID Description Score Start End GO Terms
AF-A0A6A5LHY4-F1-model_v4 deleted 0.955 37 239
AF-A0A059WX97-F1-model_v4 Cell division protein FtsQ 0.9487 23 239 GO:0005886
GO:0090529
AF-A0A4Q3I9Q0-F1-model_v4 deleted 0.9384 26 245
AF-A0A059WX97-F1-model_v4 Cell division protein FtsQ 0.9361 23 239 GO:0005886
GO:0090529
AF-F8XWS4-F1-model_v4 deleted 0.9309 144 224

Map