F486955

General Info

Members Datasets Scaffolds Average Seq Length
964 618 582 227

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000247|Ga0495686_0000247_47723_48445
Length 240
Sequence MTIDINPIGTREDIKLSNAQIAWRAAQDIADGAYVNLGIGFPEMVARYQPPGRQAIFHTENGILNFGEAPPTGEEDWDLINAGKKAVTLRPGAAFFHHADSFAMVRGGHLDVAILGAYQVAQNGDLANWRVGAKGVPAVGGAMDLVHGAKQVCVITEHVTKKGEPKLVDRCTFPLTGVGCITRVYTSHAVVDIVRGRFVLREKLAAMTIGELQAMTGAPLHVDGPVADLVVPKLGGEIND

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
17 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
18 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
19 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
32 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
33 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
34 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
35 2534681786 Brucella suis 92/29 Isolate Unclassified
36 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
37 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
38 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
39 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
40 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
41 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
42 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
43 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
44 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
45 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
46 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
47 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
48 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
49 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
50 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
51 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
52 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
53 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
54 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
55 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
56 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
57 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
58 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
59 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
60 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
61 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
62 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
63 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
64 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
65 2643221558 Rhizobium sp. Root149 Isolate Unclassified
66 2643221568 Rhizobium sp. Root564 Isolate Unclassified
67 2643221582 Rhizobium sp. Root651 Isolate Unclassified
68 2643221591 Devosia sp. Root685 Isolate Unclassified
69 2643221629 Devosia sp. Root105 Isolate Unclassified
70 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
71 2643221662 Devosia sp. Root413D1 Isolate Unclassified
72 2643221674 Devosia sp. Root436 Isolate Unclassified
73 2643221693 Rhizobium sp. Root491 Isolate Unclassified
74 2643221719 Rhizobium sp. Root274 Isolate Unclassified
75 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
76 2718217882 Rhizobium sp. N741 Isolate Nodule
77 2718217927 Rhizobium sp. N324 Isolate Nodule
78 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
79 2718218009 Rhizobium sp. N561 Isolate Nodule
80 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
81 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
82 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
83 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
84 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
85 2718218363 Rhizobium sp. N113 Isolate Nodule
86 2718218365 Rhizobium sp. N731 Isolate Nodule
87 2718218366 Rhizobium sp. N621 Isolate Nodule
88 2718218423 Rhizobium sp. N941 Isolate Nodule
89 2721755514 Rhizobium sp. N6212 Isolate Nodule
90 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
91 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
92 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
93 2721755809 Rhizobium sp. N541 Isolate Nodule
94 2721755810 Rhizobium sp. N871 Isolate Nodule
95 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
96 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
97 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
98 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
99 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
100 2728369365 Rhizobium sp. N1341 Isolate Nodule
101 2728369397 Rhizobium sp. N1314 Isolate Nodule
102 2738541293 Rhizobium sp. GV031 Isolate Unclassified
103 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
104 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
105 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
106 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
107 2791355256 Rhizobium sp. M10 Isolate Nodule
108 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
109 2791355260 Rhizobium sp. L9 Isolate Nodule
110 2791355261 Rhizobium sp. J15 Isolate Nodule
111 2791355262 Rhizobium sp. M1 Isolate Nodule
112 2791355263 Rhizobium chutanense C5 Isolate Nodule
113 2791355264 Rhizobium sp. S9 Isolate Nodule
114 2791355265 Rhizobium sp. H4 Isolate Nodule
115 2791355266 Rhizobium sp. L43 Isolate Nodule
116 2791355267 Rhizobium sp. L18 Isolate Nodule
117 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
118 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
119 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
120 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
121 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
122 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
123 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
124 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
125 2802429633 Rhizobium anhuiense J3 Isolate Nodule
126 2802429634 Rhizobium anhuiense S10 Isolate Nodule
127 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
128 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
129 2802429637 Rhizobium anhuiense C15 Isolate Nodule
130 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
131 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
132 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
133 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
134 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
135 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
136 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
137 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
138 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
139 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
140 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
141 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
142 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
143 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
144 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
145 2838048938 Rhizobium pisi 27/80 Isolate Nodule
146 2838061910 Rhizobium phaseoli L15 Isolate Nodule
147 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
148 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
149 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
150 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
151 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
152 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
153 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
154 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
155 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
156 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
157 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
158 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
159 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
160 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
161 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
162 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
163 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
164 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
165 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
166 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
167 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
168 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
169 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
170 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
171 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
172 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
173 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
174 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
175 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
176 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
177 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
178 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
179 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
180 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
181 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
182 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
183 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
184 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
185 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
186 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
187 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
188 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
189 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
190 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
191 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
192 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
193 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
194 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
195 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
196 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
197 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
198 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
199 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
200 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
201 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
202 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
203 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
204 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
205 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
206 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
207 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
208 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
209 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
210 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
211 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
212 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
213 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
214 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
215 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
216 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
217 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
218 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
219 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
220 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
221 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
222 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
223 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
224 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
225 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
226 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
227 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
228 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
229 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
230 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
231 2854911287 Brucella lupini LUP21 Isolate Unclassified
232 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
233 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
234 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
235 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
236 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
237 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
238 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
239 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
240 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
241 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
242 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
243 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
244 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
245 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
246 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
247 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
248 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
249 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
250 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
251 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
252 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
253 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
254 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
255 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
256 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
257 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
258 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
259 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
260 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
261 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
262 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
263 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
264 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
265 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
266 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
267 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
268 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
269 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
270 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
271 2933599457 Rhizobium phaseoli M3 Isolate Nodule
272 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
273 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
274 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
275 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
276 2936381700 Rhizobium chutanense C16 Isolate Unclassified
277 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
278 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
279 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
280 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
281 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
282 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
283 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
284 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
285 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
286 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
287 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
288 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
289 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
290 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
291 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
292 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
293 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
294 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
295 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
296 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
297 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
298 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
299 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
300 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
301 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
302 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
303 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
304 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
305 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
306 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
307 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
308 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
309 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
310 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
311 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
312 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
313 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
314 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
315 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
316 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
317 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
318 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
319 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
320 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
321 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
322 2996887358 Rhizobium sp. R711 Isolate Nodule
323 2996893221 Rhizobium sp. R635 Isolate Nodule
324 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
325 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
326 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
327 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
328 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
329 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
330 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
331 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
332 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
333 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
334 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
335 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
336 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
337 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
338 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
339 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
340 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
341 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
342 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
343 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
344 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
345 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
346 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
347 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
348 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
349 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
350 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
351 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
352 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
353 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
354 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
355 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
356 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
357 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
358 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
359 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
360 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
361 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
362 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
363 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
364 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
365 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
366 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
367 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
368 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
369 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
370 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
371 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
372 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
373 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
374 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
375 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
376 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
377 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
378 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
379 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
380 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
381 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
382 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
383 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
384 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
385 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
386 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
387 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
388 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
389 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
390 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
391 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
392 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
393 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
394 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
395 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
396 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
397 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
398 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
399 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
400 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
401 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
402 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
403 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
404 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
405 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
406 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
407 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
408 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
409 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
420 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
421 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
422 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
423 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
424 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
426 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
427 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
428 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
429 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
430 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
431 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
432 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
433 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
434 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
435 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
436 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
437 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
438 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
439 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
440 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
441 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
442 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
443 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
444 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
445 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
446 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
447 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
448 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
449 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
450 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
451 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
452 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
453 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
454 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
455 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
456 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
457 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
458 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
459 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
460 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
461 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
462 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
463 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
464 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
465 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
466 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
467 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
468 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
469 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
470 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
471 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
472 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
473 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
474 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
475 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
476 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
477 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
478 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
479 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
480 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
481 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
482 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
483 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
484 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
485 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
486 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
487 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
488 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
489 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
490 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
491 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
492 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
493 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
494 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
495 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
496 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
497 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
498 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
499 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
500 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
501 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
502 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
503 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
504 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
505 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
506 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
507 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
508 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
513 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
516 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
523 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
524 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
525 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
526 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
527 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
528 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
529 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
530 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
531 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
532 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
533 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
534 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
537 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
538 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
539 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
540 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
541 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
542 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
543 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
544 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
545 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
546 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
547 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
548 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
549 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
550 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
551 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
552 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
553 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
554 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
555 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
556 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
557 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
558 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
559 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
560 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
561 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
562 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
563 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
564 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
565 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
566 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
567 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
568 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
570 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
571 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
572 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
573 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
574 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
575 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
576 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
577 8005258706 Rhizobium sp. R693 Isolate Nodule
578 8005275841 Rhizobium sp. N4311 Isolate Nodule
579 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
580 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
581 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
582 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
583 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
584 8005321885 Rhizobium sp. R72 Isolate Nodule
585 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
586 8005382845 Rhizobium sp. R634 Isolate Nodule
587 8005395548 Rhizobium sp. R339 Isolate Nodule
588 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
589 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
590 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
591 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
592 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
593 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
594 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
595 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
596 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
597 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
598 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
599 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
600 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
601 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
602 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
603 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
604 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
605 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
606 8018176218 Rhizobium sp. N122 Isolate Nodule
607 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
608 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
609 8024501048 Rhizobium sp. H4 Isolate Nodule
610 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
611 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
612 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
613 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
614 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
615 8056382006 Rhizobium croatiense 13T Isolate Nodule
616 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
617 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
618 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.17
Metatranscriptomes 0.21
Isolates 39.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 18.57
Nodule 28.22
Rhizoplane 2.28
Rhizosphere 29.77
Stem 0
Stem Tuber 0
Unclassified 20.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001244 3300001979 Bacteria 11527
2 JGI24740J21852_10025462 3300001979 Bacteria 1994
3 JGI25155J39150_1000226 3300002704 Bacteria 22197
4 JGI25156J39149_1000523 3300002705 Bacteria 22196
5 JGI25162J39368_1000643 3300002737 Bacteria 24740
6 JGI25154J39366_1000435 3300002738 Bacteria 22198
7 JGI25158J39367_1000333 3300002739 Bacteria 10470
8 JGI25157J39369_1000562 3300002741 Bacteria 22196
9 JGI25152J39213_1000009 3300002773 Bacteria 138285
10 JGI25152J39213_1008711 3300002773 Bacteria 2489
11 JGI25152J39213_1019205 3300002773 Bacteria 1247
12 JGI25152J39213_1021022 3300002773 Bacteria 1152
13 JGI25150J39212_1000016 3300002774 Bacteria 153945
14 JGI25150J39212_1005997 3300002774 Bacteria 2548
15 JGI25150J39212_1011588 3300002774 Bacteria 1591
16 JGI25159J45721_1000259 3300002987 Bacteria 24699
17 JGI25151J46595_10000073 3300003187 Bacteria 136684
18 JGI25151J46595_10000450 3300003187 Bacteria 39793
19 JGI25151J46595_10001434 3300003187 Bacteria 16205
20 JGI25151J46595_10040065 3300003187 Bacteria 1721
21 JGI25165J46597_1000018 3300003214 Bacteria 374701
22 JGI25153J46596_10003932 3300003215 Bacteria 8149
23 JGI25153J46596_10011000 3300003215 Bacteria 4036
24 JGI25153J46596_10051833 3300003215 Bacteria 1172
25 JGI25153J46596_10051835 3300003215 Bacteria 1172
26 rootH1_10051069 3300003316 Bacteria 1149
27 rootH2_10062452 3300003320 Bacteria 7787
28 rootH2_10274575 3300003320 Bacteria 1391
29 rootL2_10016841 3300003322 Bacteria 4498
30 rootH1_10098563 3300003323 Bacteria 2005
31 rootH1_10139127 3300003323 Bacteria 2686
32 JGI25160J50197_1000364 3300003354 Bacteria 29646
33 JGI25160J50197_1016250 3300003354 Bacteria 2405
34 JGI25160J50197_1043181 3300003354 Bacteria 1018
35 JGI25161J50226_1000025 3300003374 Bacteria 148471
36 Ga0006562J51391_1027838 3300003578 Bacteria 2501
37 Ga0055526_1009616 3300003771 Bacteria 4622
38 Ga0055526_1013283 3300003771 Bacteria 3497
39 Ga0055526_1014607 3300003771 Bacteria 3215
40 Ga0055526_1015707 3300003771 Bacteria 3020
41 Ga0055524_1004472 3300003775 Bacteria 6453
42 Ga0055524_1012855 3300003775 Bacteria 3191
43 Ga0055524_1028604 3300003775 Bacteria 1666
44 Ga0055524_1028863 3300003775 Bacteria 1654
45 Ga0055524_1031158 3300003775 Bacteria 1539
46 Ga0055536_1004314 3300003781 Bacteria 7313
47 Ga0055528_1001290 3300003790 Bacteria 15735
48 Ga0055528_1001322 3300003790 Bacteria 15487
49 Ga0055528_1008357 3300003790 Bacteria 4447
50 Ga0055528_1012912 3300003790 Bacteria 3205
51 Ga0055528_1012995 3300003790 Bacteria 3191
52 Ga0055540_1000050 3300003792 Bacteria 145565
53 Ga0055540_1015059 3300003792 Bacteria 2270
54 Ga0055540_1015719 3300003792 Bacteria 2187
55 Ga0055531_10032706 3300003794 Bacteria 1693
56 Ga0055531_10048710 3300003794 Bacteria 1140
57 Ga0058692_1005506 3300003856 Bacteria 3604
58 Ga0058692_1010761 3300003856 Bacteria 2248
59 Ga0058692_1017916 3300003856 Bacteria 1543
60 Ga0055543_1000021 3300004625 Bacteria 150116
61 Ga0055543_1000651 3300004625 Bacteria 18441
62 Ga0065165_1005129 3300005262 Bacteria 7584
63 Ga0065165_1014429 3300005262 Bacteria 3067
64 Ga0065165_1016426 3300005262 Bacteria 2772
65 Ga0070670_100000287 3300005331 Bacteria 44454
66 Ga0070661_100182105 3300005344 Bacteria 1599
67 Ga0070668_100107213 3300005347 Bacteria 2221
68 Ga0070669_100294973 3300005353 Bacteria 1303
69 Ga0070671_100031183 3300005355 Bacteria 4403
70 Ga0070663_100398071 3300005455 Bacteria 1125
71 Ga0068853_100296713 3300005539 Bacteria 1493
72 Ga0070665_100010868 3300005548 Bacteria 9208
73 Ga0070665_100399205 3300005548 Bacteria 1383
74 Ga0070665_100819330 3300005548 Bacteria 944
75 Ga0068856_100027127 3300005614 Bacteria 5588
76 Ga0075365_10005711 3300006038 Bacteria 6746
77 Ga0075365_10019675 3300006038 Bacteria 4173
78 Ga0075363_100016811 3300006048 Bacteria 3617
79 Ga0075363_100066577 3300006048 Bacteria 1950
80 Ga0075363_100086943 3300006048 Bacteria 1717
81 Ga0075364_10050795 3300006051 Bacteria 2707
82 Ga0075362_10005537 3300006177 Bacteria 4630
83 Ga0075362_10026588 3300006177 Bacteria 2473
84 Ga0075362_10062209 3300006177 Bacteria 1691
85 Ga0075367_10016961 3300006178 Bacteria 3987
86 Ga0075367_10040424 3300006178 Bacteria 2722
87 Ga0075369_10040862 3300006186 Bacteria 1984
88 Ga0075366_10008700 3300006195 Bacteria 5652
89 Ga0075366_10015473 3300006195 Bacteria 4372
90 Ga0075366_10127258 3300006195 Bacteria 1537
91 Ga0075366_10449802 3300006195 Bacteria 795
92 Ga0075370_10045293 3300006353 Bacteria 2488
93 Ga0075370_10208405 3300006353 Bacteria 1154
94 Ga0075428_100136220 3300006844 Bacteria 2670
95 Ga0079104_1000014 3300006946 Bacteria 337362
96 Ga0079104_1026447 3300006946 Bacteria 1498
97 Ga0099826_10000053 3300006948 Bacteria 72398
98 Ga0099826_10005883 3300006948 Bacteria 8855
99 Ga0111539_10086794 3300009094 Bacteria 3676
100 Ga0123342_1038216 3300009766 Bacteria 1884
101 Ga0105239_10074367 3300010375 Bacteria 3736
102 Ga0105239_10298027 3300010375 Bacteria 1816
103 Ga0105239_11090329 3300010375 Bacteria 919
104 Ga0105246_10505539 3300011119 Bacteria 1027
105 Ga0157373_10015004 3300013100 Bacteria 5666
106 Ga0157371_10000005 3300013102 Bacteria 416456
107 Ga0157370_10000036 3300013104 Bacteria 136933
108 Ga0157370_10346943 3300013104 Bacteria 1368
109 Ga0157369_10119591 3300013105 Bacteria 2795
110 Ga0157372_10384582 3300013307 Bacteria 1635
111 Ga0157372_10827842 3300013307 Bacteria 1075
112 Ga0228710_1016272 3300022740 Bacteria 7828
113 Ga0209435_100025 3300025206 Bacteria 198776
114 Ga0209436_100044 3300025208 Bacteria 70547
115 Ga0209437_100022 3300025233 Bacteria 625694
116 Ga0207425_1000054 3300025245 Bacteria 153997
117 Ga0207425_1000563 3300025245 Bacteria 21840
118 Ga0209646_1000083 3300025246 Bacteria 198777
119 Ga0209026_1000078 3300025250 Bacteria 198777
120 Ga0209148_1006665 3300025254 Bacteria 2479
121 Ga0209759_1000060 3300025256 Bacteria 198777
122 Ga0209129_1000016 3300025258 Bacteria 485491
123 Ga0209129_1000108 3300025258 Bacteria 153997
124 Ga0209129_1001041 3300025258 Bacteria 16395
125 Ga0209129_1002193 3300025258 Bacteria 9813
126 Ga0209129_1004085 3300025258 Bacteria 5948
127 Ga0209129_1009206 3300025258 Bacteria 2637
128 Ga0209129_1010912 3300025258 Bacteria 2218
129 Ga0209233_1000031 3300025261 Bacteria 624646
130 Ga0209673_1000005 3300025273 Bacteria 692788
131 Ga0209673_1000023 3300025273 Bacteria 411385
132 Ga0209673_1001431 3300025273 Bacteria 22751
133 Ga0209673_1001452 3300025273 Bacteria 22431
134 Ga0209673_1005506 3300025273 Bacteria 6343
135 Ga0209673_1005673 3300025273 Bacteria 6232
136 Ga0209673_1007097 3300025273 Bacteria 5249
137 Ga0209673_1016330 3300025273 Bacteria 2781
138 Ga0209130_1000001 3300025284 Bacteria 831557
139 Ga0209676_1000580 3300025292 Bacteria 55127
140 Ga0209025_1000072 3300025294 Bacteria 283452
141 Ga0209025_1000126 3300025294 Bacteria 200866
142 Ga0209025_1000189 3300025294 Bacteria 153997
143 Ga0209025_1000227 3300025294 Bacteria 132244
144 Ga0209025_1000954 3300025294 Bacteria 43693
145 Ga0209025_1009630 3300025294 Bacteria 6693
146 Ga0209025_1010879 3300025294 Bacteria 6094
147 Ga0209025_1014290 3300025294 Bacteria 4898
148 Ga0209025_1066429 3300025294 Bacteria 1310
149 Ga0209025_1083727 3300025294 Bacteria 1072
150 Ga0209564_1000100 3300025295 Bacteria 224016
151 Ga0209564_1001312 3300025295 Bacteria 26661
152 Ga0209564_1003600 3300025295 Bacteria 10319
153 Ga0209564_1010874 3300025295 Bacteria 4142
154 Ga0209564_1029654 3300025295 Bacteria 1716
155 Ga0209758_1000053 3300025297 Bacteria 337751
156 Ga0209758_1000162 3300025297 Bacteria 153997
157 Ga0209758_1000915 3300025297 Bacteria 39992
158 Ga0209758_1002167 3300025297 Bacteria 20638
159 Ga0209758_1006709 3300025297 Bacteria 8117
160 Ga0209758_1011606 3300025297 Bacteria 5072
161 Ga0209758_1013079 3300025297 Bacteria 4564
162 Ga0209758_1032215 3300025297 Bacteria 2132
163 Ga0209758_1066349 3300025297 Bacteria 1160
164 Ga0209050_1010932 3300025298 Bacteria 4388
165 Ga0209050_1014761 3300025298 Bacteria 3337
166 Ga0209256_1000956 3300025299 Bacteria 34976
167 Ga0209256_1001713 3300025299 Bacteria 21052
168 Ga0209256_1006645 3300025299 Bacteria 6031
169 Ga0209256_1018136 3300025299 Bacteria 2303
170 Ga0207426_1000005 3300025302 Bacteria 1037188
171 Ga0207426_1000035 3300025302 Bacteria 448327
172 Ga0207426_1002644 3300025302 Bacteria 11044
173 Ga0209051_1000062 3300025303 Bacteria 251081
174 Ga0209051_1024100 3300025303 Bacteria 2512
175 Ga0209051_1056100 3300025303 Bacteria 1273
176 Ga0209257_1005009 3300025304 Bacteria 9659
177 Ga0209257_1011782 3300025304 Bacteria 4152
178 Ga0209257_1030674 3300025304 Bacteria 1731
179 Ga0207649_10153962 3300025920 Bacteria 1586
180 Ga0207681_10023362 3300025923 Bacteria 3954
181 Ga0207650_10001289 3300025925 Bacteria 18184
182 Ga0207706_10444156 3300025933 Bacteria 1122
183 Ga0207709_10045310 3300025935 Bacteria 2662
184 Ga0207667_10347168 3300025949 Bacteria 1514
185 Ga0207668_10538445 3300025972 Bacteria 1010
186 Ga0207678_10106260 3300026067 Bacteria 2395
187 Ga0207678_10394713 3300026067 Bacteria 1197
188 Ga0207678_10500687 3300026067 Bacteria 1059
189 Ga0207702_10009256 3300026078 Bacteria 8278
190 Ga0209281_1000032 3300027111 Bacteria 401727
191 Ga0209281_1000554 3300027111 Bacteria 45927
192 Ga0209281_1007528 3300027111 Bacteria 2726
193 Ga0209371_1000003 3300027312 Bacteria 1122971
194 Ga0209371_1001207 3300027312 Bacteria 18681
195 Ga0209282_1000060 3300027666 Bacteria 97673
196 Ga0209282_1001174 3300027666 Bacteria 14074
197 Ga0209813_10033759 3300027866 Bacteria 1523
198 Ga0209974_10095710 3300027876 Bacteria 1033
199 Ga0268266_10010600 3300028379 Bacteria 8035
200 Ga0268266_10935903 3300028379 Bacteria 838
201 Ga0268256_1000004 3300030500 Bacteria 1122967
202 Ga0268256_1006864 3300030500 Bacteria 4159
203 Ga0268256_1013664 3300030500 Bacteria 2446
204 Ga0268256_1015057 3300030500 Bacteria 2272
205 Ga0268256_1024033 3300030500 Bacteria 1570
206 Ga0316182_1428536 3300030745 Bacteria 2994
207 Ga0307513_10043500 3300031456 Bacteria 4931
208 Ga0307513_10108796 3300031456 Bacteria 2771
209 Ga0307513_10271171 3300031456 Bacteria 1480
210 Ga0307408_100542891 3300031548 Bacteria 1025
211 Ga0307405_10003862 3300031731 Bacteria 6983
212 Ga0307405_10253376 3300031731 Bacteria 1311
213 Ga0307406_10008039 3300031901 Bacteria 5873
214 Ga0307406_10009976 3300031901 Bacteria 5342
215 Ga0307406_10067389 3300031901 Bacteria 2333
216 Ga0307412_10099862 3300031911 Bacteria 2050
217 Ga0307412_10128346 3300031911 Bacteria 1838
218 Ga0307412_10414715 3300031911 Bacteria 1100
219 Ga0315914_1000005 3300031967 Bacteria 242195
220 Ga0315914_1030781 3300031967 Bacteria 2726
221 Ga0307409_100084234 3300031995 Bacteria 2581
222 Ga0307409_100445978 3300031995 Bacteria 1248
223 Ga0307414_10113440 3300032004 Bacteria 2069
224 Ga0307414_10200276 3300032004 Bacteria 1623
225 Ga0315913_1001354 3300033430 Bacteria 26738
226 Ga0315915_1000004 3300033464 Bacteria 403083
227 Ga0315915_1035715 3300033464 Bacteria 2726
228 Ga0373927_0000144 3300035695 Bacteria 55726
229 Ga0373933_0000225 3300035724 Bacteria 37547
230 Ga0373925_0000481 3300037068 Bacteria 39959
231 Ga0395899_0000030 3300037312 Bacteria 329063
232 Ga0395900_0000023 3300037418 Bacteria 336048
233 Ga0395898_0000038 3300037466 Bacteria 329063
234 Ga0395905_0000021 3300037471 Bacteria 329054
235 Ga0395905_0002704 3300037471 Bacteria 19430
236 Ga0395905_0013777 3300037471 Bacteria 7740
237 Ga0395905_0539385 3300037471 Bacteria 1067
238 Ga0395901_0000018 3300038443 Bacteria 336048
239 Ga0400483_035765 3300039062 Bacteria 1093
240 Ga0400483_187596 3300039062 Bacteria 2651
241 Ga0400483_212907 3300039062 Bacteria 1649
242 Ga0400483_231877 3300039062 Bacteria 1400
243 Ga0400483_232189 3300039062 Bacteria 1012
244 Ga0400483_235336 3300039062 Bacteria 2038
245 Ga0436360_0617542 3300039438 Bacteria 1999
246 Ga0439436_0001082 3300041404 Bacteria 7677
247 Ga0439439_0019167 3300041406 Bacteria 1696
248 Ga0439447_029341 3300041407 Bacteria 1393
249 Ga0439465_0000386 3300041413 Bacteria 12739
250 Ga0439465_0003987 3300041413 Bacteria 4813
251 Ga0439465_0090865 3300041413 Bacteria 1044
252 Ga0439465_0093379 3300041413 Bacteria 1032
253 Ga0439465_0169867 3300041413 Bacteria 785
254 Ga0451833_0603395 3300041491 Bacteria 1480
255 Ga0451833_0665716 3300041491 Bacteria 1524
256 Ga0451835_0302878 3300041492 Bacteria 4736
257 Ga0451835_0368583 3300041492 Bacteria 996
258 Ga0451837_0394499 3300041494 Bacteria 4486
259 Ga0451839_0179417 3300041496 Bacteria 1098
260 Ga0451839_0549133 3300041496 Bacteria 1565
261 Ga0451845_0115605 3300041501 Bacteria 1510
262 Ga0451845_0120596 3300041501 Bacteria 1479
263 Ga0451847_0512936 3300041503 Bacteria 1273
264 Ga0451847_0574386 3300041503 Bacteria 1543
265 Ga0451849_0637463 3300041505 Bacteria 2135
266 Ga0451849_0982181 3300041505 Bacteria 1337
267 Ga0451851_0622280 3300041507 Bacteria 2032
268 Ga0451843_0405285 3300041509 Bacteria 1351
269 Ga0451843_1679605 3300041509 Bacteria 1068
270 Ga0451855_1371073 3300041511 Bacteria 1173
271 Ga0451853_0037451 3300041512 Bacteria 1256
272 Ga0451853_1615945 3300041512 Bacteria 1089
273 Ga0451853_1919292 3300041512 Bacteria 1852
274 Ga0439449_0037625 3300042007 Bacteria 1800
275 Ga0439462_0013794 3300042015 Bacteria 2074
276 Ga0450908_020074 3300042184 Bacteria 1176
277 Ga0451576_0153989 3300045051 Bacteria 2398
278 Ga0495605_0258720 3300046474 Bacteria 743
279 Ga0495585_0036491 3300046492 Bacteria 2771
280 Ga0495596_0135201 3300046500 Bacteria 957
281 Ga0495607_0198603 3300046501 Bacteria 994
282 Ga0495606_0018676 3300046507 Bacteria 5189
283 Ga0495606_0093923 3300046507 Bacteria 1839
284 Ga0495606_0142149 3300046507 Bacteria 1416
285 Ga0495606_0161756 3300046507 Bacteria 1305
286 Ga0495610_0030990 3300046512 Bacteria 2794
287 Ga0495610_0091967 3300046512 Bacteria 1373
288 Ga0495631_0075762 3300046518 Bacteria 1452
289 Ga0495631_0084117 3300046518 Bacteria 1371
290 Ga0495632_0125872 3300046519 Bacteria 1195
291 Ga0495643_0007073 3300046522 Bacteria 7283
292 Ga0495643_0028580 3300046522 Bacteria 3124
293 Ga0495643_0064130 3300046522 Bacteria 1941
294 Ga0495643_0187616 3300046522 Bacteria 1000
295 Ga0495648_0133243 3300046524 Bacteria 1318
296 Ga0495654_0000140 3300046530 Bacteria 75508
297 Ga0495597_0139189 3300046542 Bacteria 1002
298 Ga0495633_0070191 3300046558 Bacteria 1635
299 Ga0495668_0134208 3300046616 Bacteria 1355
300 Ga0495668_0135259 3300046616 Bacteria 1349
301 Ga0495625_0003110 3300046660 Bacteria 16956
302 Ga0495625_0018939 3300046660 Bacteria 5357
303 Ga0495661_0209377 3300046665 Bacteria 1016
304 Ga0495588_0008240 3300046674 Bacteria 4773
305 Ga0495671_0041131 3300046692 Bacteria 2329
306 Ga0495649_0025746 3300046694 Bacteria 3276
307 Ga0495660_0036074 3300046810 Bacteria 2759
308 Ga0495660_0163505 3300046810 Bacteria 1090
309 Ga0495687_047057 3300047443 Bacteria 1858
310 Ga0495686_0000247 3300047472 Bacteria 97327
311 Ga0495686_0060194 3300047472 Bacteria 2361
312 Ga0495686_0206196 3300047472 Bacteria 1126
313 Ga0495615_0025740 3300048090 Bacteria 1368
314 Ga0496101_0075561 3300048904 Bacteria 2480
315 Ga0496101_0081350 3300048904 Bacteria 2395
316 Ga0496101_0105173 3300048904 Bacteria 2118
317 Ga0496102_0575367 3300048905 Bacteria 1049
318 Ga0496103_0145236 3300048906 Bacteria 1518
319 Ga0496104_0039384 3300048907 Bacteria 4426
320 Ga0496104_0129961 3300048907 Bacteria 2419
321 Ga0496106_0000275 3300048909 Bacteria 36354
322 Ga0496106_0137161 3300048909 Bacteria 1922
323 Ga0496110_0012841 3300048913 Bacteria 6901
324 Ga0496110_0195772 3300048913 Bacteria 1835
325 Ga0496111_0042218 3300048914 Bacteria 3274
326 Ga0496111_0159461 3300048914 Bacteria 1675
327 Ga0496113_0223530 3300048916 Bacteria 1501
328 Ga0496116_0000049 3300048919 Bacteria 314452
329 Ga0496116_0000540 3300048919 Bacteria 50890
330 Ga0496116_0003416 3300048919 Bacteria 15704
331 Ga0496116_0029441 3300048919 Bacteria 3959
332 Ga0496116_0043913 3300048919 Bacteria 3041
333 Ga0496116_0081815 3300048919 Bacteria 2000
334 Ga0496117_0001006 3300048920 Bacteria 43135
335 Ga0496117_0003204 3300048920 Bacteria 19352
336 Ga0496117_0011462 3300048920 Bacteria 7941
337 Ga0496117_0014973 3300048920 Bacteria 6645
338 Ga0496117_0057991 3300048920 Bacteria 2684
339 Ga0496117_0140153 3300048920 Bacteria 1450
340 Ga0496117_0165772 3300048920 Bacteria 1289
341 Ga0496117_0192627 3300048920 Bacteria 1159
342 Ga0496117_0268165 3300048920 Bacteria 921
343 Ga0496118_0002190 3300048921 Bacteria 27152
344 Ga0496118_0002306 3300048921 Bacteria 25910
345 Ga0496118_0003748 3300048921 Bacteria 18793
346 Ga0496118_0008892 3300048921 Bacteria 10264
347 Ga0496118_0011605 3300048921 Bacteria 8578
348 Ga0496118_0017443 3300048921 Bacteria 6535
349 Ga0496118_0023636 3300048921 Bacteria 5331
350 Ga0496118_0030457 3300048921 Bacteria 4502
351 Ga0496118_0057602 3300048921 Bacteria 2911
352 Ga0496118_0145578 3300048921 Bacteria 1493
353 Ga0496119_0008555 3300048922 Bacteria 8975
354 Ga0496119_0020971 3300048922 Bacteria 4738
355 Ga0496119_0043412 3300048922 Bacteria 2840
356 Ga0496119_0050238 3300048922 Bacteria 2572
357 Ga0496119_0113440 3300048922 Bacteria 1501
358 Ga0496119_0116544 3300048922 Bacteria 1474
359 Ga0496120_0000148 3300048923 Bacteria 116605
360 Ga0496120_0011016 3300048923 Bacteria 6245
361 Ga0496120_0034808 3300048923 Bacteria 3014
362 Ga0496121_0000174 3300048924 Bacteria 143186
363 Ga0496121_0008832 3300048924 Bacteria 11736
364 Ga0496121_0021827 3300048924 Bacteria 6251
365 Ga0496121_0035458 3300048924 Bacteria 4471
366 Ga0496121_0074623 3300048924 Bacteria 2712
367 Ga0496121_0110594 3300048924 Bacteria 2096
368 Ga0496121_0149829 3300048924 Bacteria 1718
369 Ga0496121_0170577 3300048924 Bacteria 1581
370 Ga0496121_0411409 3300048924 Bacteria 883
371 Ga0496122_0000024 3300048925 Bacteria 372400
372 Ga0496122_0000050 3300048925 Bacteria 267874
373 Ga0496122_0000185 3300048925 Bacteria 144350
374 Ga0496122_0002162 3300048925 Bacteria 28814
375 Ga0496122_0004155 3300048925 Bacteria 18276
376 Ga0496122_0021063 3300048925 Bacteria 5856
377 Ga0496122_0022046 3300048925 Bacteria 5675
378 Ga0496122_0022313 3300048925 Bacteria 5631
379 Ga0496122_0037419 3300048925 Bacteria 3906
380 Ga0496122_0099615 3300048925 Bacteria 1947
381 Ga0496122_0115056 3300048925 Bacteria 1753
382 Ga0496122_0154508 3300048925 Bacteria 1410
383 Ga0496123_0000023 3300048926 Bacteria 346894
384 Ga0496123_0000105 3300048926 Bacteria 167806
385 Ga0496123_0000926 3300048926 Bacteria 45845
386 Ga0496123_0006469 3300048926 Bacteria 11336
387 Ga0496123_0016385 3300048926 Bacteria 6022
388 Ga0496123_0022230 3300048926 Bacteria 4895
389 Ga0496123_0038897 3300048926 Bacteria 3335
390 Ga0496123_0049273 3300048926 Bacteria 2826
391 Ga0496123_0097870 3300048926 Bacteria 1717
392 Ga0496124_0000094 3300048927 Bacteria 189147
393 Ga0496124_0000111 3300048927 Bacteria 166285
394 Ga0496124_0000200 3300048927 Bacteria 117910
395 Ga0496124_0001598 3300048927 Bacteria 32591
396 Ga0496124_0001736 3300048927 Bacteria 30598
397 Ga0496124_0013394 3300048927 Bacteria 8007
398 Ga0496124_0016824 3300048927 Bacteria 6932
399 Ga0496124_0042659 3300048927 Bacteria 3905
400 Ga0496124_0052587 3300048927 Bacteria 3459
401 Ga0496124_0053602 3300048927 Bacteria 3417
402 Ga0496124_0176410 3300048927 Bacteria 1649
403 Ga0496125_0000115 3300048928 Bacteria 181994
404 Ga0496125_0000359 3300048928 Bacteria 86115
405 Ga0496125_0000617 3300048928 Bacteria 60041
406 Ga0496125_0000982 3300048928 Bacteria 44569
407 Ga0496125_0002851 3300048928 Bacteria 21764
408 Ga0496125_0022315 3300048928 Bacteria 5881
409 Ga0496125_0055100 3300048928 Bacteria 3243
410 Ga0496125_0097617 3300048928 Bacteria 2176
411 Ga0496125_0174449 3300048928 Bacteria 1440
412 Ga0496126_0000808 3300048929 Bacteria 56013
413 Ga0496126_0002560 3300048929 Bacteria 24323
414 Ga0496126_0045668 3300048929 Bacteria 4024
415 Ga0496126_0182078 3300048929 Bacteria 1784
416 Ga0496126_0221924 3300048929 Bacteria 1587
417 Ga0496126_0300839 3300048929 Bacteria 1323
418 Ga0501031_0006133 3300049568 Bacteria 7846
419 Ga0501031_0054615 3300049568 Bacteria 2602
420 Ga0501031_0248637 3300049568 Bacteria 1156
421 Ga0501032_0000122 3300049569 Bacteria 64671
422 Ga0501032_0005297 3300049569 Bacteria 9593
423 Ga0501032_0083369 3300049569 Bacteria 2126
424 Ga0501032_0093926 3300049569 Bacteria 1989
425 Ga0501032_0211028 3300049569 Bacteria 1266
426 Ga0501033_0000099 3300049570 Bacteria 82339
427 Ga0501033_0000660 3300049570 Bacteria 31872
428 Ga0501033_0001575 3300049570 Bacteria 20086
429 Ga0501033_0017461 3300049570 Bacteria 5421
430 Ga0501033_0022222 3300049570 Bacteria 4786
431 Ga0501033_0066854 3300049570 Bacteria 2643
432 Ga0501033_0161519 3300049570 Bacteria 1613
433 Ga0501033_0169425 3300049570 Bacteria 1569
434 Ga0501034_0000162 3300049571 Bacteria 125834
435 Ga0501034_0000220 3300049571 Bacteria 109015
436 Ga0501034_0009374 3300049571 Bacteria 10255
437 Ga0501034_0029657 3300049571 Bacteria 5562
438 Ga0501034_0036956 3300049571 Bacteria 4945
439 Ga0501034_0071996 3300049571 Bacteria 3465
440 Ga0501034_0085527 3300049571 Bacteria 3155
441 Ga0501034_0091868 3300049571 Bacteria 3033
442 Ga0501034_0113852 3300049571 Bacteria 2694
443 Ga0501034_0471950 3300049571 Bacteria 1170
444 Ga0501034_0619466 3300049571 Bacteria 986
445 Ga0501034_0758723 3300049571 Bacteria 865
446 Ga0501034_0851116 3300049571 Bacteria 802
447 Ga0501036_0000130 3300049572 Bacteria 48057
448 Ga0501036_0212339 3300049572 Bacteria 1626
449 Ga0501036_0375239 3300049572 Bacteria 1187
450 Ga0501037_0000039 3300049573 Bacteria 119902
451 Ga0501037_0000105 3300049573 Bacteria 79431
452 Ga0501038_0000289 3300049574 Bacteria 42809
453 Ga0501038_0039069 3300049574 Bacteria 4153
454 Ga0501038_0059957 3300049574 Bacteria 3258
455 Ga0501038_0069505 3300049574 Bacteria 2991
456 Ga0501038_0147596 3300049574 Bacteria 1919
457 Ga0501038_0549945 3300049574 Bacteria 878
458 Ga0501039_0000055 3300049575 Bacteria 91098
459 Ga0501039_0303580 3300049575 Bacteria 1255
460 Ga0501040_0260046 3300049576 Bacteria 1239
461 Ga0501041_0194283 3300049577 Bacteria 1271
462 Ga0501043_0000037 3300049579 Bacteria 131656
463 Ga0501043_0000055 3300049579 Bacteria 105522
464 Ga0501043_0139122 3300049579 Bacteria 1902
465 Ga0501043_0151336 3300049579 Bacteria 1816
466 Ga0501043_0171901 3300049579 Bacteria 1690
467 Ga0501043_0190480 3300049579 Bacteria 1595
468 Ga0501043_0274121 3300049579 Bacteria 1294
469 Ga0501046_0013131 3300049580 Bacteria 7029
470 Ga0501046_0405019 3300049580 Bacteria 985
471 Ga0501047_0011138 3300049581 Bacteria 8510
472 Ga0501047_0023470 3300049581 Bacteria 5921
473 Ga0501047_0071714 3300049581 Bacteria 3334
474 Ga0501047_0107587 3300049581 Bacteria 2670
475 Ga0501047_0234509 3300049581 Bacteria 1687
476 Ga0501047_0266824 3300049581 Bacteria 1558
477 Ga0501047_0686304 3300049581 Bacteria 842
478 Ga0501048_0109571 3300049582 Bacteria 1950
479 Ga0501067_0017282 3300049583 Bacteria 3987
480 Ga0501068_0009194 3300049584 Bacteria 5521
481 Ga0501068_0070969 3300049584 Bacteria 2126
482 Ga0501068_0243069 3300049584 Bacteria 1146
483 Ga0501069_0000106 3300049585 Bacteria 38605
484 Ga0501069_0014016 3300049585 Bacteria 4282
485 Ga0501070_0000781 3300049586 Bacteria 28933
486 Ga0501070_0001320 3300049586 Bacteria 22173
487 Ga0501070_0005565 3300049586 Bacteria 10743
488 Ga0501070_0031293 3300049586 Bacteria 4458
489 Ga0501070_0075880 3300049586 Bacteria 2783
490 Ga0501070_0152900 3300049586 Bacteria 1903
491 Ga0501070_0238914 3300049586 Bacteria 1487
492 Ga0501071_0001762 3300049587 Bacteria 12758
493 Ga0501073_0023715 3300049589 Bacteria 4405
494 Ga0501073_0025307 3300049589 Bacteria 4258
495 Ga0501074_0000072 3300049590 Bacteria 48714
496 Ga0501074_0125545 3300049590 Bacteria 1835
497 Ga0501238_015915 3300049671 Bacteria 1039
498 Ga0501079_0184008 3300049741 Bacteria 1631
499 Ga0501079_0405903 3300049741 Bacteria 1069
500 Ga0501080_0000168 3300049742 Bacteria 47595
501 Ga0501080_0000878 3300049742 Bacteria 24606
502 Ga0501080_0035396 3300049742 Bacteria 4660
503 Ga0501080_0267537 3300049742 Bacteria 1556
504 Ga0501083_0000484 3300049744 Bacteria 25530
505 Ga0501280_007883 3300049776 Bacteria 1487
506 Ga0501035_0000108 3300049822 Bacteria 100975
507 Ga0501035_0000183 3300049822 Bacteria 76563
508 Ga0501035_0001424 3300049822 Bacteria 24501
509 Ga0501035_0004384 3300049822 Bacteria 13400
510 Ga0501035_0005434 3300049822 Bacteria 12047
511 Ga0501035_0006107 3300049822 Bacteria 11338
512 Ga0501035_0039921 3300049822 Bacteria 4244
513 Ga0501035_0076834 3300049822 Bacteria 2952
514 Ga0501035_0114580 3300049822 Bacteria 2360
515 Ga0501035_0207966 3300049822 Bacteria 1675
516 Ga0501035_0338438 3300049822 Bacteria 1261
517 Ga0501035_0593297 3300049822 Bacteria 903
518 Ga0501044_0000009 3300049823 Bacteria 270072
519 Ga0501044_0004154 3300049823 Bacteria 16266
520 Ga0501044_0008502 3300049823 Bacteria 11249
521 Ga0501044_0095517 3300049823 Bacteria 2995
522 Ga0501044_0135965 3300049823 Bacteria 2449
523 Ga0501044_0157562 3300049823 Bacteria 2249
524 Ga0501044_0183787 3300049823 Bacteria 2056
525 Ga0501044_0188141 3300049823 Bacteria 2028
526 Ga0501044_0446711 3300049823 Bacteria 1200
527 Ga0501045_0050724 3300049824 Bacteria 3028
528 nmdc:mga03683_1751_c2 3300050489 Bacteria 3330
529 nmdc:mga03683_56479_c1 3300050489 Bacteria 1650
530 nmdc:mga03683_88541_c1 3300050489 Bacteria 1347
531 nmdc:mga03n38_161235_c1 3300050490 Bacteria 1136
532 nmdc:mga03n38_45833_c1 3300050490 Bacteria 1927
533 nmdc:mga03n38_60061_c1 3300050490 Bacteria 1727
534 nmdc:mga00v17_21_c1 3300050491 Bacteria 55853
535 nmdc:mga00v17_34_c1 3300050491 Bacteria 85919
536 nmdc:mga0yw44_529990_c1 3300050492 Bacteria 799
537 nmdc:mga0yw44_66335_c1 3300050492 Bacteria 2227
538 nmdc:mga0k408_13145_c1 3300050493 Bacteria 4535
539 nmdc:mga0k408_164327_c1 3300050493 Bacteria 1323
540 nmdc:mga0k408_174781_c1 3300050493 Bacteria 1280
541 nmdc:mga06z11_12959_c1 3300050494 Bacteria 3643
542 nmdc:mga04h51_160512_c1 3300050495 Bacteria 865
543 nmdc:mga09592_375676_c1 3300050508 Bacteria 1229
544 nmdc:mga08y16_81031_c1 3300050511 Bacteria 3384
545 nmdc:mga0sz30_40204_c1 3300050516 Bacteria 1965
546 nmdc:mga0sz30_78596_c1 3300050516 Bacteria 1426
547 Ga0500578_0031037 3300053086 Bacteria 3434
548 Ga0500578_0043993 3300053086 Bacteria 2866
549 Ga0500578_0308632 3300053086 Bacteria 936
550 Ga0500641_0001823 3300053096 Bacteria 7554
551 Ga0500556_0000026 3300053104 Bacteria 166874
552 Ga0500560_000117 3300053107 Bacteria 8346
553 Ga0500569_035701 3300053109 Bacteria 1426
554 Ga0500569_043549 3300053109 Bacteria 1326
555 Ga0500572_003877 3300053111 Bacteria 3402
556 Ga0500594_0064928 3300053118 Bacteria 1061
557 Ga0500608_091810 3300053122 Bacteria 1418
558 Ga0500618_000008 3300053125 Bacteria 214678
559 Ga0500618_000249 3300053125 Bacteria 42747
560 Ga0500618_003707 3300053125 Bacteria 5137
561 Ga0500618_054376 3300053125 Bacteria 903
562 Ga0500658_0000229 3300053134 Bacteria 26848
563 Ga0500658_0024221 3300053134 Bacteria 2324
564 Ga0500658_0049711 3300053134 Bacteria 1709
565 Ga0500559_0002561 3300053136 Bacteria 9324
566 Ga0500561_0000067 3300053137 Bacteria 20534
567 Ga0500568_0001013 3300053139 Bacteria 19244
568 Ga0500568_0112378 3300053139 Bacteria 1017
569 Ga0500573_0003730 3300053140 Bacteria 7926
570 Ga0500604_0008820 3300053151 Bacteria 2678
571 Ga0500616_0000094 3300053153 Bacteria 181038
572 Ga0500616_0007710 3300053153 Bacteria 6795
573 Ga0500616_0055995 3300053153 Bacteria 2059
574 Ga0500622_0000185 3300053156 Bacteria 66073
575 Ga0500624_002108 3300053157 Bacteria 2770
576 Ga0500633_0001027 3300053160 Bacteria 4960
577 Ga0500634_0107380 3300053161 Bacteria 1384
578 Ga0500636_0000038 3300053177 Bacteria 70653
579 Ga0500636_0000888 3300053177 Bacteria 16050
580 Ga0587088_002917 3300059508 Bacteria 2013
581 Ga0501082_0040730 3300060353 Bacteria 4006
582 Ga0501082_0585706 3300060353 Bacteria 976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2808606401 2809065267 208
2 iso_pu_bacteria 2808606404 2809081199 208
3 iso_pu_bacteria 2808606405 2809085599 208
4 iso_pu_bacteria 2880518877 2880522950 208
5 3300048924 Ga0496121_0008832 Ga0496121_0008832_6907_7611 214
6 iso_pu_bacteria 2848992105 2848996728 214
7 3300035724 Ga0373933_0000225 Ga0373933_0000225_25128_25787 218
8 iso_pu_bacteria 2643221629 2644169079 218
9 iso_pu_bacteria 2643221662 2644350491 218
10 iso_pu_bacteria 2881161766 2881163839 218
11 iso_pu_bacteria 2888350351 2888351558 218
12 iso_pu_bacteria 2958092219 2958099262 218
13 iso_pu_bacteria 2977864932 2977870089 218
14 iso_pu_bacteria 2979742915 2979749152 218
15 iso_pu_bacteria 2643221591 2643966271 219
16 iso_pu_bacteria 2643221674 2644412482 219
17 iso_pu_bacteria 2841734538 2841735478 219
18 iso_pu_bacteria 2871474448 2871476189 219
19 iso_pu_bacteria 2878788777 2878795495 219
20 iso_pu_bacteria 2885312484 2885318676 219
21 iso_pu_bacteria 2919679072 2919682794 219
22 iso_pu_bacteria 2937836603 2937842294 219
23 iso_pu_bacteria 2937843397 2937847764 219
24 iso_pu_bacteria 2939669807 2939671160 219
25 iso_pu_bacteria 2958071322 2958075524 219
26 iso_pu_bacteria 2996310559 2996315605 219
27 iso_pu_bacteria 3000405567 3000406904 219
28 iso_pu_bacteria 3004211236 3004217667 219
29 iso_pu_bacteria 3004218560 3004220014 219
30 iso_pu_bacteria 8004633249 8004639419 219
31 iso_pu_bacteria 2582581304 2585255830 221
32 iso_pu_bacteria 2585427594 2585847624 221
33 iso_pu_bacteria 2738541293 2738803966 221
34 3300001979 JGI24740J21852_10025462 JGI24740J21852_100254622 222
35 3300005344 Ga0070661_100182105 Ga0070661_1001821052 222
36 3300010375 Ga0105239_10298027 Ga0105239_102980272 222
37 3300025920 Ga0207649_10153962 Ga0207649_101539622 222
38 3300031731 Ga0307405_10003862 Ga0307405_100038622 222
39 3300041413 Ga0439465_0090865 Ga0439465_0090865_236_904 222
40 3300048921 Ga0496118_0145578 Ga0496118_0145578_98_766 222
41 3300003320 rootH2_10062452 rootH2_100624522 223
42 3300003320 rootH2_10274575 rootH2_102745752 223
43 3300003323 rootH1_10139127 rootH1_101391273 223
44 3300005539 Ga0068853_100296713 Ga0068853_1002967132 223
45 3300006048 Ga0075363_100066577 Ga0075363_1000665772 223
46 3300006177 Ga0075362_10062209 Ga0075362_100622092 223
47 3300006178 Ga0075367_10040424 Ga0075367_100404243 223
48 3300006195 Ga0075366_10015473 Ga0075366_100154733 223
49 3300006844 Ga0075428_100136220 Ga0075428_1001362202 223
50 3300009094 Ga0111539_10086794 Ga0111539_100867944 223
51 3300010375 Ga0105239_11090329 Ga0105239_110903292 223
52 3300013307 Ga0157372_10827842 Ga0157372_108278422 223
53 3300025294 Ga0209025_1014290 Ga0209025_10142903 223
54 3300025949 Ga0207667_10347168 Ga0207667_103471682 223
55 3300026067 Ga0207678_10394713 Ga0207678_103947132 223
56 3300027876 Ga0209974_10095710 Ga0209974_100957102 223
57 3300031456 Ga0307513_10271171 Ga0307513_102711712 223
58 3300031995 Ga0307409_100445978 Ga0307409_1004459782 223
59 3300032004 Ga0307414_10113440 Ga0307414_101134402 223
60 3300032004 Ga0307414_10200276 Ga0307414_102002762 223
61 3300037312 Ga0395899_0000030 Ga0395899_0000030_59781_60452 223
62 3300037418 Ga0395900_0000023 Ga0395900_0000023_66187_66858 223
63 3300037466 Ga0395898_0000038 Ga0395898_0000038_59781_60452 223
64 3300037471 Ga0395905_0000021 Ga0395905_0000021_59781_60452 223
65 3300038443 Ga0395901_0000018 Ga0395901_0000018_66187_66858 223
66 3300039438 Ga0436360_0617542 Ga0436360_0617542_1280_1969 223
67 3300045051 Ga0451576_0153989 Ga0451576_0153989_267_944 223
68 3300048914 Ga0496111_0159461 Ga0496111_0159461_644_1318 223
69 3300048928 Ga0496125_0000115 Ga0496125_0000115_165361_166035 223
70 3300049568 Ga0501031_0006133 Ga0501031_0006133_5051_5722 223
71 3300049568 Ga0501031_0054615 Ga0501031_0054615_1069_1740 223
72 3300049568 Ga0501031_0248637 Ga0501031_0248637_218_889 223
73 3300049569 Ga0501032_0000122 Ga0501032_0000122_5739_6410 223
74 3300049569 Ga0501032_0005297 Ga0501032_0005297_3767_4438 223
75 3300049569 Ga0501032_0083369 Ga0501032_0083369_482_1153 223
76 3300049570 Ga0501033_0000099 Ga0501033_0000099_59940_60611 223
77 3300049570 Ga0501033_0000660 Ga0501033_0000660_25942_26613 223
78 3300049570 Ga0501033_0017461 Ga0501033_0017461_2684_3355 223
79 3300049570 Ga0501033_0022222 Ga0501033_0022222_2119_2790 223
80 3300049570 Ga0501033_0066854 Ga0501033_0066854_1103_1774 223
81 3300049570 Ga0501033_0161519 Ga0501033_0161519_295_966 223
82 3300049570 Ga0501033_0169425 Ga0501033_0169425_692_1363 223
83 3300049571 Ga0501034_0000162 Ga0501034_0000162_24371_25045 223
84 3300049571 Ga0501034_0000220 Ga0501034_0000220_97409_98080 223
85 3300049571 Ga0501034_0009374 Ga0501034_0009374_7701_8372 223
86 3300049571 Ga0501034_0029657 Ga0501034_0029657_1409_2080 223
87 3300049571 Ga0501034_0036956 Ga0501034_0036956_773_1444 223
88 3300049571 Ga0501034_0085527 Ga0501034_0085527_2376_3047 223
89 3300049571 Ga0501034_0091868 Ga0501034_0091868_1963_2634 223
90 3300049571 Ga0501034_0113852 Ga0501034_0113852_1570_2244 223
91 3300049571 Ga0501034_0471950 Ga0501034_0471950_178_849 223
92 3300049571 Ga0501034_0619466 Ga0501034_0619466_124_795 223
93 3300049571 Ga0501034_0758723 Ga0501034_0758723_41_712 223
94 3300049572 Ga0501036_0000130 Ga0501036_0000130_16370_17041 223
95 3300049572 Ga0501036_0375239 Ga0501036_0375239_459_1130 223
96 3300049573 Ga0501037_0000039 Ga0501037_0000039_71801_72472 223
97 3300049573 Ga0501037_0000105 Ga0501037_0000105_21177_21848 223
98 3300049574 Ga0501038_0000289 Ga0501038_0000289_29946_30617 223
99 3300049574 Ga0501038_0039069 Ga0501038_0039069_258_929 223
100 3300049574 Ga0501038_0147596 Ga0501038_0147596_664_1335 223
101 3300049574 Ga0501038_0549945 Ga0501038_0549945_96_767 223
102 3300049575 Ga0501039_0000055 Ga0501039_0000055_42430_43101 223
103 3300049575 Ga0501039_0303580 Ga0501039_0303580_13_690 223
104 3300049576 Ga0501040_0260046 Ga0501040_0260046_162_833 223
105 3300049577 Ga0501041_0194283 Ga0501041_0194283_577_1248 223
106 3300049579 Ga0501043_0000037 Ga0501043_0000037_58426_59097 223
107 3300049579 Ga0501043_0000055 Ga0501043_0000055_37534_38205 223
108 3300049579 Ga0501043_0139122 Ga0501043_0139122_734_1405 223
109 3300049579 Ga0501043_0151336 Ga0501043_0151336_74_745 223
110 3300049579 Ga0501043_0190480 Ga0501043_0190480_578_1249 223
111 3300049580 Ga0501046_0013131 Ga0501046_0013131_5510_6181 223
112 3300049581 Ga0501047_0011138 Ga0501047_0011138_2609_3280 223
113 3300049581 Ga0501047_0023470 Ga0501047_0023470_2259_2930 223
114 3300049581 Ga0501047_0107587 Ga0501047_0107587_930_1601 223
115 3300049581 Ga0501047_0234509 Ga0501047_0234509_55_726 223
116 3300049581 Ga0501047_0266824 Ga0501047_0266824_295_966 223
117 3300049582 Ga0501048_0109571 Ga0501048_0109571_1128_1799 223
118 3300049583 Ga0501067_0017282 Ga0501067_0017282_2457_3128 223
119 3300049584 Ga0501068_0009194 Ga0501068_0009194_3090_3761 223
120 3300049585 Ga0501069_0000106 Ga0501069_0000106_21730_22401 223
121 3300049585 Ga0501069_0014016 Ga0501069_0014016_1137_1808 223
122 3300049586 Ga0501070_0000781 Ga0501070_0000781_23200_23871 223
123 3300049586 Ga0501070_0001320 Ga0501070_0001320_5191_5862 223
124 3300049586 Ga0501070_0005565 Ga0501070_0005565_5097_5768 223
125 3300049586 Ga0501070_0031293 Ga0501070_0031293_3701_4372 223
126 3300049586 Ga0501070_0075880 Ga0501070_0075880_379_1050 223
127 3300049586 Ga0501070_0152900 Ga0501070_0152900_385_1056 223
128 3300049586 Ga0501070_0238914 Ga0501070_0238914_764_1435 223
129 3300049587 Ga0501071_0001762 Ga0501071_0001762_6910_7581 223
130 3300049589 Ga0501073_0023715 Ga0501073_0023715_2501_3172 223
131 3300049589 Ga0501073_0025307 Ga0501073_0025307_1957_2628 223
132 3300049590 Ga0501074_0000072 Ga0501074_0000072_19490_20161 223
133 3300049590 Ga0501074_0125545 Ga0501074_0125545_1006_1677 223
134 3300049741 Ga0501079_0184008 Ga0501079_0184008_539_1210 223
135 3300049741 Ga0501079_0405903 Ga0501079_0405903_47_718 223
136 3300049742 Ga0501080_0000168 Ga0501080_0000168_39352_40023 223
137 3300049742 Ga0501080_0000878 Ga0501080_0000878_5244_5915 223
138 3300049742 Ga0501080_0035396 Ga0501080_0035396_1152_1823 223
139 3300049744 Ga0501083_0000484 Ga0501083_0000484_16931_17602 223
140 3300049822 Ga0501035_0000108 Ga0501035_0000108_41978_42649 223
141 3300049822 Ga0501035_0000183 Ga0501035_0000183_66790_67461 223
142 3300049822 Ga0501035_0001424 Ga0501035_0001424_19988_20659 223
143 3300049822 Ga0501035_0004384 Ga0501035_0004384_6536_7207 223
144 3300049822 Ga0501035_0005434 Ga0501035_0005434_2694_3365 223
145 3300049822 Ga0501035_0039921 Ga0501035_0039921_371_1042 223
146 3300049822 Ga0501035_0076834 Ga0501035_0076834_1815_2486 223
147 3300049822 Ga0501035_0114580 Ga0501035_0114580_438_1109 223
148 3300049822 Ga0501035_0593297 Ga0501035_0593297_218_889 223
149 3300049823 Ga0501044_0000009 Ga0501044_0000009_201393_202064 223
150 3300049823 Ga0501044_0004154 Ga0501044_0004154_6351_7022 223
151 3300049823 Ga0501044_0008502 Ga0501044_0008502_4484_5155 223
152 3300049823 Ga0501044_0095517 Ga0501044_0095517_1025_1696 223
153 3300049823 Ga0501044_0135965 Ga0501044_0135965_49_720 223
154 3300049823 Ga0501044_0157562 Ga0501044_0157562_807_1478 223
155 3300049823 Ga0501044_0183787 Ga0501044_0183787_990_1661 223
156 3300049823 Ga0501044_0188141 Ga0501044_0188141_310_981 223
157 3300049824 Ga0501045_0050724 Ga0501045_0050724_1244_1915 223
158 3300050489 nmdc:mga03683_1751_c2 nmdc:mga03683_1751_c2_2403_3074 223
159 3300050489 nmdc:mga03683_56479_c1 nmdc:mga03683_56479_c1_788_1459 223
160 3300050490 nmdc:mga03n38_45833_c1 nmdc:mga03n38_45833_c1_459_1130 223
161 3300050490 nmdc:mga03n38_60061_c1 nmdc:mga03n38_60061_c1_616_1287 223
162 3300050493 nmdc:mga0k408_13145_c1 nmdc:mga0k408_13145_c1_502_1173 223
163 3300050508 nmdc:mga09592_375676_c1 nmdc:mga09592_375676_c1_207_878 223
164 3300050511 nmdc:mga08y16_81031_c1 nmdc:mga08y16_81031_c1_2546_3217 223
165 3300053096 Ga0500641_0001823 Ga0500641_0001823_6097_6768 223
166 3300053139 Ga0500568_0112378 Ga0500568_0112378_38_715 223
167 3300060353 Ga0501082_0040730 Ga0501082_0040730_1805_2476 223
168 3300060353 Ga0501082_0585706 Ga0501082_0585706_262_933 223
169 iso_pu_bacteria 2510065057 2510307679 223
170 iso_pu_bacteria 2512875026 2512974812 223
171 iso_pu_bacteria 2513237089 2513603853 223
172 iso_pu_bacteria 2513237156 2513984758 223
173 iso_pu_bacteria 2513237160 2514004191 223
174 iso_pu_bacteria 2516653046 2516897914 223
175 iso_pu_bacteria 2517487022 2517567459 223
176 iso_pu_bacteria 2524023207 2524453184 223
177 iso_pu_bacteria 2802428858 2802718346 223
178 iso_pu_bacteria 2802428859 2802725860 223
179 iso_pu_bacteria 2802428860 2802731432 223
180 iso_pu_bacteria 2802428861 2802736377 223
181 iso_pu_bacteria 2802428862 2802744351 223
182 iso_pu_bacteria 2802428863 2802750059 223
183 iso_pu_bacteria 2840878972 2840882655 223
184 iso_pu_bacteria 2891048133 2891049810 223
185 iso_pu_bacteria 2915980308 2915981003 223
186 iso_pu_bacteria 2916021584 2916026324 223
187 iso_pu_bacteria 2916048683 2916053788 223
188 iso_pu_bacteria 2916061851 2916064531 223
189 iso_pu_bacteria 2916076590 2916081011 223
190 iso_pu_bacteria 2921250672 2921251343 223
191 iso_pu_bacteria 2921257292 2921263301 223
192 iso_pu_bacteria 2937023124 2937024425 223
193 iso_pu_bacteria 2937029754 2937035933 223
194 iso_pu_bacteria 2937036028 2937036399 223
195 iso_pu_bacteria 2937078374 2937084784 223
196 iso_pu_bacteria 2937084907 2937089169 223
197 iso_pu_bacteria 2957375807 2957376039 223
198 iso_pu_bacteria 2957382221 2957385888 223
199 iso_pu_bacteria 2957395598 2957400609 223
200 iso_pu_bacteria 2957402308 2957406081 223
201 iso_pu_bacteria 2957437181 2957439627 223
202 iso_pu_bacteria 2960591022 2960592509 223
203 iso_pu_bacteria 2960631154 2960636106 223
204 iso_pu_bacteria 2960680706 2960681146 223
205 iso_pu_bacteria 2960693952 2960694063 223
206 iso_pu_bacteria 2964615318 2964620967 223
207 iso_pu_bacteria 2967686174 2967691991 223
208 iso_pu_bacteria 2967728569 2967733383 223
209 iso_pu_bacteria 2967755722 2967756057 223
210 iso_pu_bacteria 2970026789 2970029676 223
211 iso_pu_bacteria 2970102677 2970103829 223
212 iso_pu_bacteria 2970122695 2970124192 223
213 iso_pu_bacteria 2970143518 2970144914 223
214 iso_pu_bacteria 2977530762 2977537265 223
215 iso_pu_bacteria 2977544691 2977550118 223
216 iso_pu_bacteria 2995392953 2995397142 223
217 iso_pu_bacteria 8003999396 8004006177 223
218 3300002773 JGI25152J39213_1000009 JGI25152J39213_1000009112 224
219 3300002774 JGI25150J39212_1000016 JGI25150J39212_100001623 224
220 3300003187 JGI25151J46595_10000073 JGI25151J46595_10000073111 224
221 3300003215 JGI25153J46596_10003932 JGI25153J46596_100039326 224
222 3300025245 Ga0207425_1000054 Ga0207425_100005424 224
223 3300025258 Ga0209129_1000108 Ga0209129_100010824 224
224 3300025273 Ga0209673_1005673 Ga0209673_10056733 224
225 3300025294 Ga0209025_1000189 Ga0209025_100018924 224
226 3300025297 Ga0209758_1000162 Ga0209758_1000162130 224
227 3300025303 Ga0209051_1056100 Ga0209051_10561002 224
228 3300031911 Ga0307412_10099862 Ga0307412_100998622 224
229 3300039062 Ga0400483_035765 Ga0400483_035765_283_960 224
230 3300039062 Ga0400483_187596 Ga0400483_187596_1238_1915 224
231 3300039062 Ga0400483_212907 Ga0400483_212907_104_781 224
232 3300039062 Ga0400483_231877 Ga0400483_231877_539_1219 224
233 3300039062 Ga0400483_232189 Ga0400483_232189_63_740 224
234 3300039062 Ga0400483_235336 Ga0400483_235336_96_770 224
235 3300048904 Ga0496101_0075561 Ga0496101_0075561_213_905 224
236 3300048913 Ga0496110_0012841 Ga0496110_0012841_1399_2076 224
237 3300048919 Ga0496116_0003416 Ga0496116_0003416_9521_10213 224
238 3300048919 Ga0496116_0043913 Ga0496116_0043913_611_1303 224
239 3300048920 Ga0496117_0011462 Ga0496117_0011462_4450_5142 224
240 3300048920 Ga0496117_0014973 Ga0496117_0014973_613_1305 224
241 3300048921 Ga0496118_0008892 Ga0496118_0008892_1598_2290 224
242 3300048921 Ga0496118_0017443 Ga0496118_0017443_1876_2568 224
243 3300048922 Ga0496119_0116544 Ga0496119_0116544_85_774 224
244 3300048924 Ga0496121_0035458 Ga0496121_0035458_540_1232 224
245 3300048924 Ga0496121_0170577 Ga0496121_0170577_426_1118 224
246 3300048924 Ga0496121_0411409 Ga0496121_0411409_102_791 224
247 3300048925 Ga0496122_0021063 Ga0496122_0021063_1794_2486 224
248 3300048925 Ga0496122_0022313 Ga0496122_0022313_1362_2054 224
249 3300048925 Ga0496122_0099615 Ga0496122_0099615_1245_1922 224
250 3300048926 Ga0496123_0016385 Ga0496123_0016385_303_995 224
251 3300048926 Ga0496123_0022230 Ga0496123_0022230_754_1446 224
252 3300048926 Ga0496123_0038897 Ga0496123_0038897_1510_2187 224
253 3300048927 Ga0496124_0000200 Ga0496124_0000200_32788_33480 224
254 3300048927 Ga0496124_0176410 Ga0496124_0176410_276_953 224
255 3300048928 Ga0496125_0097617 Ga0496125_0097617_230_922 224
256 iso_pu_bacteria 2615840624 2616295166 224
257 iso_pu_bacteria 2738541293 2738805715 224
258 iso_pu_bacteria 2791355262 2793333028 224
259 iso_pu_bacteria 2837678835 2837679625 224
260 iso_pu_bacteria 2509276021 2509385460 225
261 iso_pu_bacteria 2509276033 2509448492 225
262 iso_pu_bacteria 2510917022 2511132879 225
263 iso_pu_bacteria 2510917026 2511172047 225
264 iso_pu_bacteria 2510917030 2511197605 225
265 iso_pu_bacteria 2513237085 2513576507 225
266 iso_pu_bacteria 2513237093 2513631798 225
267 iso_pu_bacteria 2513237103 2513709732 225
268 iso_pu_bacteria 2513237159 2514001173 225
269 iso_pu_bacteria 2513237159 2514001374 225
270 iso_pu_bacteria 2515154134 2515741891 225
271 iso_pu_bacteria 2516653077 2517041992 225
272 iso_pu_bacteria 2516653085 2517080972 225
273 iso_pu_bacteria 2524023209 2524457151 225
274 iso_pu_bacteria 2529292951 2530644468 225
275 iso_pu_bacteria 2534681786 2535486597 225
276 iso_pu_bacteria 2558860983 2561467717 225
277 iso_pu_bacteria 2582581298 2585221669 225
278 iso_pu_bacteria 2582581307 2585272406 225
279 iso_pu_bacteria 2582581866 2585397587 225
280 iso_pu_bacteria 2585427526 2585524142 225
281 iso_pu_bacteria 2585427528 2585539178 225
282 iso_pu_bacteria 2585427529 2585544161 225
283 iso_pu_bacteria 2585427531 2585561531 225
284 iso_pu_bacteria 2585427593 2585837130 225
285 iso_pu_bacteria 2585427608 2585899379 225
286 iso_pu_bacteria 2585427609 2585906759 225
287 iso_pu_bacteria 2585427633 2585992526 225
288 iso_pu_bacteria 2585427634 2586003281 225
289 iso_pu_bacteria 2585428125 2587982180 225
290 iso_pu_bacteria 2599185156 2599335932 225
291 iso_pu_bacteria 2599185236 2599720499 225
292 iso_pu_bacteria 2615840698 2616552564 225
293 iso_pu_bacteria 2643221558 2643814797 225
294 iso_pu_bacteria 2667528174 2671112981 225
295 iso_pu_bacteria 2718217882 2719183714 225
296 iso_pu_bacteria 2718218009 2719728155 225
297 iso_pu_bacteria 2718218363 2721145016 225
298 iso_pu_bacteria 2718218365 2721155750 225
299 iso_pu_bacteria 2718218366 2721167103 225
300 iso_pu_bacteria 2721755514 2722838081 225
301 iso_pu_bacteria 2721755810 2724042349 225
302 iso_pu_bacteria 2728369365 2730161854 225
303 iso_pu_bacteria 2728369397 2730300857 225
304 iso_pu_bacteria 2738541333 2739033626 225
305 iso_pu_bacteria 2765235942 2766068347 225
306 iso_pu_bacteria 2791355256 2793296458 225
307 iso_pu_bacteria 2791355259 2793317236 225
308 iso_pu_bacteria 2791355260 2793324094 225
309 iso_pu_bacteria 2791355263 2793340155 225
310 iso_pu_bacteria 2791355264 2793346190 225
311 iso_pu_bacteria 2791355266 2793357825 225
312 iso_pu_bacteria 2791355267 2793366564 225
313 iso_pu_bacteria 2802429605 2805928053 225
314 iso_pu_bacteria 2802429606 2805933879 225
315 iso_pu_bacteria 2802429633 2806044875 225
316 iso_pu_bacteria 2802429634 2806053966 225
317 iso_pu_bacteria 2802429635 2806059942 225
318 iso_pu_bacteria 2802429636 2806066003 225
319 iso_pu_bacteria 2802429637 2806075534 225
320 iso_pu_bacteria 2818991448 2819610273 225
321 iso_pu_bacteria 2818991461 2819682543 225
322 iso_pu_bacteria 2821123053 2821128939 225
323 iso_pu_bacteria 2838022645 2838025041 225
324 iso_pu_bacteria 2838029111 2838033826 225
325 iso_pu_bacteria 2838042994 2838046641 225
326 iso_pu_bacteria 2838668709 2838671443 225
327 iso_pu_bacteria 2838680041 2838684386 225
328 iso_pu_bacteria 2838686498 2838694054 225
329 iso_pu_bacteria 2838694306 2838699877 225
330 iso_pu_bacteria 2838701080 2838704290 225
331 iso_pu_bacteria 2838707686 2838711838 225
332 iso_pu_bacteria 2838729681 2838734714 225
333 iso_pu_bacteria 2838736955 2838742254 225
334 iso_pu_bacteria 2838742623 2838749522 225
335 iso_pu_bacteria 2841840854 2841846110 225
336 iso_pu_bacteria 2841851746 2841858823 225
337 iso_pu_bacteria 2841864319 2841869720 225
338 iso_pu_bacteria 2842077413 2842081853 225
339 iso_pu_bacteria 2842110456 2842117574 225
340 iso_pu_bacteria 2842118031 2842122429 225
341 iso_pu_bacteria 2842140634 2842145814 225
342 iso_pu_bacteria 2842146304 2842149092 225
343 iso_pu_bacteria 2842156927 2842163020 225
344 iso_pu_bacteria 2842163707 2842167003 225
345 iso_pu_bacteria 2842180545 2842186627 225
346 iso_pu_bacteria 2842192696 2842195210 225
347 iso_pu_bacteria 2842198810 2842203241 225
348 iso_pu_bacteria 2842205361 2842210229 225
349 iso_pu_bacteria 2842217011 2842222316 225
350 iso_pu_bacteria 2842229732 2842236836 225
351 iso_pu_bacteria 2842237096 2842241250 225
352 iso_pu_bacteria 2842243621 2842250479 225
353 iso_pu_bacteria 2842250916 2842253741 225
354 iso_pu_bacteria 2842257432 2842260953 225
355 iso_pu_bacteria 2842271015 2842276244 225
356 iso_pu_bacteria 2842278818 2842283683 225
357 iso_pu_bacteria 2842285085 2842289722 225
358 iso_pu_bacteria 2842291075 2842295508 225
359 iso_pu_bacteria 2842298080 2842299295 225
360 iso_pu_bacteria 2842304105 2842310812 225
361 iso_pu_bacteria 2842317721 2842318950 225
362 iso_pu_bacteria 2842341865 2842343959 225
363 iso_pu_bacteria 2842357229 2842358762 225
364 iso_pu_bacteria 2842370503 2842376700 225
365 iso_pu_bacteria 2842377471 2842381716 225
366 iso_pu_bacteria 2842384541 2842388977 225
367 iso_pu_bacteria 2842395702 2842396319 225
368 iso_pu_bacteria 2842402390 2842407136 225
369 iso_pu_bacteria 2842409023 2842414029 225
370 iso_pu_bacteria 2842415677 2842420670 225
371 iso_pu_bacteria 2842475841 2842480573 225
372 iso_pu_bacteria 2842489311 2842491862 225
373 iso_pu_bacteria 2842495871 2842499469 225
374 iso_pu_bacteria 2842502639 2842507146 225
375 iso_pu_bacteria 2842509118 2842512193 225
376 iso_pu_bacteria 2842521101 2842526850 225
377 iso_pu_bacteria 2842521101 2842527000 225
378 iso_pu_bacteria 2842922631 2842926914 225
379 iso_pu_bacteria 2844454524 2844461179 225
380 iso_pu_bacteria 2854911287 2854916465 225
381 iso_pu_bacteria 2857531043 2857536404 225
382 iso_pu_bacteria 2891373044 2891374600 225
383 iso_pu_bacteria 2899803654 2899808281 225
384 iso_pu_bacteria 2915650412 2915652643 225
385 iso_pu_bacteria 2919100787 2919103391 225
386 iso_pu_bacteria 2919171160 2919174128 225
387 iso_pu_bacteria 2919408235 2919412770 225
388 iso_pu_bacteria 2919450847 2919455087 225
389 iso_pu_bacteria 2929138655 2929143809 225
390 iso_pu_bacteria 2933570622 2933577306 225
391 iso_pu_bacteria 2933586486 2933591818 225
392 iso_pu_bacteria 2935894831 2935898273 225
393 iso_pu_bacteria 2935901341 2935905715 225
394 iso_pu_bacteria 2936367885 2936370606 225
395 iso_pu_bacteria 2936375103 2936377832 225
396 iso_pu_bacteria 2936381700 2936384184 225
397 iso_pu_bacteria 2989771324 2989776347 225
398 iso_pu_bacteria 2996893221 2996896982 225
399 iso_pu_bacteria 3005416602 3005421039 225
400 iso_pu_bacteria 3005445848 3005451511 225
401 iso_pu_bacteria 639633055 639651636 225
402 iso_pu_bacteria 8001845381 8001847061 225
403 iso_pu_bacteria 8005301065 8005305073 225
404 iso_pu_bacteria 8005307578 8005313157 225
405 iso_pu_bacteria 8005314921 8005319226 225
406 iso_pu_bacteria 8005484373 8005489441 225
407 iso_pu_bacteria 8005570704 8005576262 225
408 iso_pu_bacteria 8005645114 8005648047 225
409 iso_pu_bacteria 8005658619 8005662110 225
410 iso_pu_bacteria 8005682033 8005683980 225
411 iso_pu_bacteria 8005688590 8005689383 225
412 iso_pu_bacteria 8005695170 8005698301 225
413 iso_pu_bacteria 8018127388 8018129336 225
414 iso_pu_bacteria 8023680758 8023682336 225
415 iso_pu_bacteria 8024501048 8024505530 225
416 iso_pu_bacteria 8046767195 8046774613 225
417 iso_pu_bacteria 8055431914 8055435458 225
418 iso_pu_bacteria 8056375014 8056375227 225
419 iso_pu_bacteria 8057575449 8057581385 225
420 iso_pu_bacteria 8057874678 8057880651 225
421 3300053125 Ga0500618_000008 Ga0500618_000008_46303_46998 226
422 3300006946 Ga0079104_1026447 Ga0079104_10264472 227
423 3300022740 Ga0228710_1016272 Ga0228710_10162723 227
424 3300027111 Ga0209281_1000554 Ga0209281_100055428 227
425 3300027111 Ga0209281_1007528 Ga0209281_10075283 227
426 3300027666 Ga0209282_1000060 Ga0209282_1000060104 227
427 3300031967 Ga0315914_1000005 Ga0315914_100000525 227
428 3300031967 Ga0315914_1030781 Ga0315914_10307812 227
429 3300033430 Ga0315913_1001354 Ga0315913_10013542 227
430 3300033464 Ga0315915_1000004 Ga0315915_1000004304 227
431 3300033464 Ga0315915_1035715 Ga0315915_10357153 227
432 3300048928 Ga0496125_0000359 Ga0496125_0000359_69833_70519 227
433 iso_pu_bacteria 2537561587 2537873123 227
434 iso_pu_bacteria 2554235003 2554244470 227
435 iso_pu_bacteria 2558860242 2559297685 227
436 iso_pu_bacteria 2582581294 2585202806 227
437 iso_pu_bacteria 2599185210 2599603750 227
438 iso_pu_bacteria 2600255279 2601612479 227
439 iso_pu_bacteria 2600255308 2601749020 227
440 iso_pu_bacteria 2643221582 2643917486 227
441 iso_pu_bacteria 2643221693 2644522660 227
442 iso_pu_bacteria 2808606387 2808989196 227
443 iso_pu_bacteria 2818991439 2819557732 227
444 iso_pu_bacteria 2838675328 2838679881 227
445 iso_pu_bacteria 2838714209 2838717678 227
446 iso_pu_bacteria 2838719591 2838724452 227
447 iso_pu_bacteria 2838724970 2838729606 227
448 iso_pu_bacteria 2841846520 2841850045 227
449 iso_pu_bacteria 2841859092 2841861170 227
450 iso_pu_bacteria 2842124991 2842128517 227
451 iso_pu_bacteria 2842130223 2842134563 227
452 iso_pu_bacteria 2842152218 2842156605 227
453 iso_pu_bacteria 2842170452 2842173923 227
454 iso_pu_bacteria 2842175837 2842180226 227
455 iso_pu_bacteria 2842187318 2842192225 227
456 iso_pu_bacteria 2842211629 2842216495 227
457 iso_pu_bacteria 2842224351 2842229261 227
458 iso_pu_bacteria 2842515876 2842518563 227
459 iso_pu_bacteria 2899792073 2899793076 227
460 iso_pu_bacteria 2899845264 2899849722 227
461 iso_pu_bacteria 2919114240 2919117958 227
462 iso_pu_bacteria 2926754445 2926757727 227
463 iso_pu_bacteria 2926760298 2926764648 227
464 iso_pu_bacteria 2933006813 2933010342 227
465 iso_pu_bacteria 2933011516 2933014189 227
466 iso_pu_bacteria 2933594066 2933597211 227
467 iso_pu_bacteria 2979089926 2979090241 227
468 iso_pu_bacteria 2979095461 2979095771 227
469 iso_pu_bacteria 2979100975 2979102772 227
470 iso_pu_bacteria 2984509177 2984509339 227
471 iso_pu_bacteria 2984518228 2984519961 227
472 iso_pu_bacteria 2984537506 2984537669 227
473 iso_pu_bacteria 2984601300 2984604417 227
474 iso_pu_bacteria 2996887358 2996891426 227
475 iso_pu_bacteria 3005409236 3005413991 227
476 iso_pu_bacteria 650716007 650844130 227
477 iso_pu_bacteria 8003570095 8003573318 227
478 iso_pu_bacteria 8003570095 8003575220 227
479 iso_pu_bacteria 8005258706 8005263977 227
480 iso_pu_bacteria 8005321885 8005325953 227
481 3300013307 Ga0157372_10384582 Ga0157372_103845822 228
482 3300031901 Ga0307406_10008039 Ga0307406_100080394 228
483 3300048922 Ga0496119_0113440 Ga0496119_0113440_317_1003 228
484 3300048925 Ga0496122_0154508 Ga0496122_0154508_471_1157 228
485 3300048927 Ga0496124_0053602 Ga0496124_0053602_1477_2163 228
486 3300048929 Ga0496126_0002560 Ga0496126_0002560_1693_2379 228
487 3300053104 Ga0500556_0000026 Ga0500556_0000026_51101_51787 228
488 iso_pu_bacteria 2791355253 2793281304 228
489 iso_pu_bacteria 8018150411 8018152404 228
490 3300001979 JGI24740J21852_10001244 JGI24740J21852_100012443 229
491 3300002704 JGI25155J39150_1000226 JGI25155J39150_100022618 229
492 3300002705 JGI25156J39149_1000523 JGI25156J39149_100052318 229
493 3300002737 JGI25162J39368_1000643 JGI25162J39368_10006434 229
494 3300002738 JGI25154J39366_1000435 JGI25154J39366_100043518 229
495 3300002739 JGI25158J39367_1000333 JGI25158J39367_100033312 229
496 3300002741 JGI25157J39369_1000562 JGI25157J39369_100056218 229
497 3300002773 JGI25152J39213_1008711 JGI25152J39213_10087113 229
498 3300002773 JGI25152J39213_1019205 JGI25152J39213_10192052 229
499 3300002773 JGI25152J39213_1021022 JGI25152J39213_10210222 229
500 3300002774 JGI25150J39212_1005997 JGI25150J39212_10059973 229
501 3300002774 JGI25150J39212_1011588 JGI25150J39212_10115881 229
502 3300002987 JGI25159J45721_1000259 JGI25159J45721_100025911 229
503 3300003187 JGI25151J46595_10000450 JGI25151J46595_1000045035 229
504 3300003187 JGI25151J46595_10001434 JGI25151J46595_100014346 229
505 3300003187 JGI25151J46595_10040065 JGI25151J46595_100400652 229
506 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018241 229
507 3300003215 JGI25153J46596_10011000 JGI25153J46596_100110003 229
508 3300003215 JGI25153J46596_10051833 JGI25153J46596_100518331 229
509 3300003215 JGI25153J46596_10051835 JGI25153J46596_100518351 229
510 3300003316 rootH1_10051069 rootH1_100510692 229
511 3300003322 rootL2_10016841 rootL2_100168415 229
512 3300003323 rootH1_10098563 rootH1_100985633 229
513 3300003354 JGI25160J50197_1000364 JGI25160J50197_100036429 229
514 3300003354 JGI25160J50197_1016250 JGI25160J50197_10162502 229
515 3300003354 JGI25160J50197_1043181 JGI25160J50197_10431812 229
516 3300003374 JGI25161J50226_1000025 JGI25161J50226_100002585 229
517 3300003578 Ga0006562J51391_1027838 Ga0006562J51391_10278382 229
518 3300003771 Ga0055526_1009616 Ga0055526_10096165 229
519 3300003771 Ga0055526_1013283 Ga0055526_10132832 229
520 3300003771 Ga0055526_1014607 Ga0055526_10146074 229
521 3300003771 Ga0055526_1015707 Ga0055526_10157072 229
522 3300003775 Ga0055524_1004472 Ga0055524_10044725 229
523 3300003775 Ga0055524_1012855 Ga0055524_10128552 229
524 3300003775 Ga0055524_1028604 Ga0055524_10286042 229
525 3300003775 Ga0055524_1028863 Ga0055524_10288632 229
526 3300003775 Ga0055524_1031158 Ga0055524_10311582 229
527 3300003781 Ga0055536_1004314 Ga0055536_10043146 229
528 3300003790 Ga0055528_1001290 Ga0055528_10012906 229
529 3300003790 Ga0055528_1001322 Ga0055528_10013226 229
530 3300003790 Ga0055528_1008357 Ga0055528_10083573 229
531 3300003790 Ga0055528_1012912 Ga0055528_10129123 229
532 3300003790 Ga0055528_1012995 Ga0055528_10129954 229
533 3300003792 Ga0055540_1000050 Ga0055540_100005090 229
534 3300003792 Ga0055540_1015059 Ga0055540_10150592 229
535 3300003792 Ga0055540_1015719 Ga0055540_10157192 229
536 3300003794 Ga0055531_10032706 Ga0055531_100327062 229
537 3300003794 Ga0055531_10048710 Ga0055531_100487101 229
538 3300003856 Ga0058692_1005506 Ga0058692_10055062 229
539 3300003856 Ga0058692_1010761 Ga0058692_10107612 229
540 3300003856 Ga0058692_1017916 Ga0058692_10179162 229
541 3300004625 Ga0055543_1000021 Ga0055543_1000021110 229
542 3300004625 Ga0055543_1000651 Ga0055543_100065113 229
543 3300005262 Ga0065165_1005129 Ga0065165_10051297 229
544 3300005262 Ga0065165_1014429 Ga0065165_10144293 229
545 3300005262 Ga0065165_1016426 Ga0065165_10164262 229
546 3300005331 Ga0070670_100000287 Ga0070670_10000028716 229
547 3300005347 Ga0070668_100107213 Ga0070668_1001072133 229
548 3300005353 Ga0070669_100294973 Ga0070669_1002949731 229
549 3300005355 Ga0070671_100031183 Ga0070671_1000311834 229
550 3300005455 Ga0070663_100398071 Ga0070663_1003980712 229
551 3300005548 Ga0070665_100010868 Ga0070665_1000108682 229
552 3300005548 Ga0070665_100399205 Ga0070665_1003992052 229
553 3300005548 Ga0070665_100819330 Ga0070665_1008193302 229
554 3300005614 Ga0068856_100027127 Ga0068856_1000271274 229
555 3300006038 Ga0075365_10005711 Ga0075365_100057116 229
556 3300006038 Ga0075365_10019675 Ga0075365_100196753 229
557 3300006048 Ga0075363_100016811 Ga0075363_1000168111 229
558 3300006048 Ga0075363_100086943 Ga0075363_1000869432 229
559 3300006051 Ga0075364_10050795 Ga0075364_100507952 229
560 3300006177 Ga0075362_10005537 Ga0075362_100055374 229
561 3300006177 Ga0075362_10026588 Ga0075362_100265883 229
562 3300006178 Ga0075367_10016961 Ga0075367_100169613 229
563 3300006186 Ga0075369_10040862 Ga0075369_100408622 229
564 3300006195 Ga0075366_10008700 Ga0075366_100087005 229
565 3300006195 Ga0075366_10127258 Ga0075366_101272582 229
566 3300006195 Ga0075366_10449802 Ga0075366_104498021 229
567 3300006353 Ga0075370_10045293 Ga0075370_100452932 229
568 3300006353 Ga0075370_10208405 Ga0075370_102084052 229
569 3300006946 Ga0079104_1000014 Ga0079104_100001424 229
570 3300006948 Ga0099826_10000053 Ga0099826_1000005315 229
571 3300006948 Ga0099826_10005883 Ga0099826_100058832 229
572 3300009766 Ga0123342_1038216 Ga0123342_10382162 229
573 3300010375 Ga0105239_10074367 Ga0105239_100743672 229
574 3300011119 Ga0105246_10505539 Ga0105246_105055392 229
575 3300013100 Ga0157373_10015004 Ga0157373_100150044 229
576 3300013102 Ga0157371_10000005 Ga0157371_10000005286 229
577 3300013104 Ga0157370_10000036 Ga0157370_1000003696 229
578 3300013104 Ga0157370_10346943 Ga0157370_103469432 229
579 3300013105 Ga0157369_10119591 Ga0157369_101195913 229
580 3300025206 Ga0209435_100025 Ga0209435_100025186 229
581 3300025208 Ga0209436_100044 Ga0209436_10004439 229
582 3300025233 Ga0209437_100022 Ga0209437_100022302 229
583 3300025245 Ga0207425_1000563 Ga0207425_100056322 229
584 3300025246 Ga0209646_1000083 Ga0209646_1000083186 229
585 3300025250 Ga0209026_1000078 Ga0209026_1000078186 229
586 3300025254 Ga0209148_1006665 Ga0209148_10066653 229
587 3300025256 Ga0209759_1000060 Ga0209759_1000060186 229
588 3300025258 Ga0209129_1000016 Ga0209129_1000016284 229
589 3300025258 Ga0209129_1001041 Ga0209129_10010413 229
590 3300025258 Ga0209129_1002193 Ga0209129_100219311 229
591 3300025258 Ga0209129_1004085 Ga0209129_10040858 229
592 3300025258 Ga0209129_1009206 Ga0209129_10092062 229
593 3300025258 Ga0209129_1010912 Ga0209129_10109121 229
594 3300025261 Ga0209233_1000031 Ga0209233_1000031302 229
595 3300025273 Ga0209673_1000005 Ga0209673_1000005312 229
596 3300025273 Ga0209673_1000023 Ga0209673_1000023200 229
597 3300025273 Ga0209673_1001431 Ga0209673_100143115 229
598 3300025273 Ga0209673_1001452 Ga0209673_100145211 229
599 3300025273 Ga0209673_1005506 Ga0209673_10055062 229
600 3300025273 Ga0209673_1007097 Ga0209673_10070975 229
601 3300025273 Ga0209673_1016330 Ga0209673_10163303 229
602 3300025284 Ga0209130_1000001 Ga0209130_1000001159 229
603 3300025292 Ga0209676_1000580 Ga0209676_100058014 229
604 3300025294 Ga0209025_1000072 Ga0209025_100007246 229
605 3300025294 Ga0209025_1000126 Ga0209025_100012617 229
606 3300025294 Ga0209025_1000227 Ga0209025_100022714 229
607 3300025294 Ga0209025_1000954 Ga0209025_100095436 229
608 3300025294 Ga0209025_1009630 Ga0209025_10096304 229
609 3300025294 Ga0209025_1010879 Ga0209025_10108792 229
610 3300025294 Ga0209025_1066429 Ga0209025_10664292 229
611 3300025294 Ga0209025_1083727 Ga0209025_10837272 229
612 3300025295 Ga0209564_1000100 Ga0209564_1000100183 229
613 3300025295 Ga0209564_1001312 Ga0209564_10013123 229
614 3300025295 Ga0209564_1003600 Ga0209564_10036006 229
615 3300025295 Ga0209564_1010874 Ga0209564_10108743 229
616 3300025295 Ga0209564_1029654 Ga0209564_10296542 229
617 3300025297 Ga0209758_1000053 Ga0209758_1000053184 229
618 3300025297 Ga0209758_1000915 Ga0209758_100091529 229
619 3300025297 Ga0209758_1002167 Ga0209758_100216712 229
620 3300025297 Ga0209758_1006709 Ga0209758_10067092 229
621 3300025297 Ga0209758_1011606 Ga0209758_10116067 229
622 3300025297 Ga0209758_1013079 Ga0209758_10130796 229
623 3300025297 Ga0209758_1032215 Ga0209758_10322153 229
624 3300025297 Ga0209758_1066349 Ga0209758_10663492 229
625 3300025298 Ga0209050_1010932 Ga0209050_10109327 229
626 3300025298 Ga0209050_1014761 Ga0209050_10147613 229
627 3300025299 Ga0209256_1000956 Ga0209256_10009569 229
628 3300025299 Ga0209256_1001713 Ga0209256_10017137 229
629 3300025299 Ga0209256_1006645 Ga0209256_10066452 229
630 3300025299 Ga0209256_1018136 Ga0209256_10181361 229
631 3300025302 Ga0207426_1000005 Ga0207426_1000005764 229
632 3300025302 Ga0207426_1000035 Ga0207426_1000035261 229
633 3300025302 Ga0207426_1002644 Ga0207426_100264410 229
634 3300025303 Ga0209051_1000062 Ga0209051_1000062238 229
635 3300025303 Ga0209051_1024100 Ga0209051_10241002 229
636 3300025304 Ga0209257_1005009 Ga0209257_10050092 229
637 3300025304 Ga0209257_1011782 Ga0209257_10117824 229
638 3300025304 Ga0209257_1030674 Ga0209257_10306742 229
639 3300025923 Ga0207681_10023362 Ga0207681_100233623 229
640 3300025925 Ga0207650_10001289 Ga0207650_100012893 229
641 3300025933 Ga0207706_10444156 Ga0207706_104441562 229
642 3300025935 Ga0207709_10045310 Ga0207709_100453102 229
643 3300025972 Ga0207668_10538445 Ga0207668_105384452 229
644 3300026067 Ga0207678_10106260 Ga0207678_101062602 229
645 3300026067 Ga0207678_10500687 Ga0207678_105006872 229
646 3300026078 Ga0207702_10009256 Ga0207702_100092565 229
647 3300027111 Ga0209281_1000032 Ga0209281_100003226 229
648 3300027312 Ga0209371_1000003 Ga0209371_1000003239 229
649 3300027312 Ga0209371_1001207 Ga0209371_100120714 229
650 3300027666 Ga0209282_1001174 Ga0209282_10011742 229
651 3300027866 Ga0209813_10033759 Ga0209813_100337592 229
652 3300028379 Ga0268266_10010600 Ga0268266_100106002 229
653 3300028379 Ga0268266_10935903 Ga0268266_109359031 229
654 3300030500 Ga0268256_1000004 Ga0268256_1000004812 229
655 3300030500 Ga0268256_1006864 Ga0268256_10068643 229
656 3300030500 Ga0268256_1013664 Ga0268256_10136642 229
657 3300030500 Ga0268256_1015057 Ga0268256_10150572 229
658 3300030500 Ga0268256_1024033 Ga0268256_10240332 229
659 3300030745 Ga0316182_1428536 Ga0316182_14285362 229
660 3300031456 Ga0307513_10043500 Ga0307513_100435004 229
661 3300031456 Ga0307513_10108796 Ga0307513_101087962 229
662 3300031548 Ga0307408_100542891 Ga0307408_1005428912 229
663 3300031731 Ga0307405_10253376 Ga0307405_102533762 229
664 3300031901 Ga0307406_10009976 Ga0307406_100099765 229
665 3300031901 Ga0307406_10067389 Ga0307406_100673892 229
666 3300031911 Ga0307412_10128346 Ga0307412_101283462 229
667 3300031911 Ga0307412_10414715 Ga0307412_104147152 229
668 3300031995 Ga0307409_100084234 Ga0307409_1000842342 229
669 3300035695 Ga0373927_0000144 Ga0373927_0000144_34691_35380 229
670 3300037068 Ga0373925_0000481 Ga0373925_0000481_24692_25381 229
671 3300037471 Ga0395905_0002704 Ga0395905_0002704_9270_9968 229
672 3300037471 Ga0395905_0013777 Ga0395905_0013777_2606_3304 229
673 3300037471 Ga0395905_0539385 Ga0395905_0539385_91_789 229
674 3300041404 Ga0439436_0001082 Ga0439436_0001082_4380_5069 229
675 3300041406 Ga0439439_0019167 Ga0439439_0019167_165_854 229
676 3300041407 Ga0439447_029341 Ga0439447_029341_433_1122 229
677 3300041413 Ga0439465_0000386 Ga0439465_0000386_1812_2501 229
678 3300041413 Ga0439465_0003987 Ga0439465_0003987_1834_2538 229
679 3300041413 Ga0439465_0093379 Ga0439465_0093379_260_949 229
680 3300041413 Ga0439465_0169867 Ga0439465_0169867_65_754 229
681 3300041491 Ga0451833_0603395 Ga0451833_0603395_453_1157 229
682 3300041491 Ga0451833_0665716 Ga0451833_0665716_531_1235 229
683 3300041492 Ga0451835_0302878 Ga0451835_0302878_3273_3977 229
684 3300041492 Ga0451835_0368583 Ga0451835_0368583_200_904 229
685 3300041494 Ga0451837_0394499 Ga0451837_0394499_3652_4356 229
686 3300041496 Ga0451839_0179417 Ga0451839_0179417_374_1078 229
687 3300041496 Ga0451839_0549133 Ga0451839_0549133_805_1509 229
688 3300041501 Ga0451845_0115605 Ga0451845_0115605_61_765 229
689 3300041501 Ga0451845_0120596 Ga0451845_0120596_395_1099 229
690 3300041503 Ga0451847_0512936 Ga0451847_0512936_513_1217 229
691 3300041503 Ga0451847_0574386 Ga0451847_0574386_575_1279 229
692 3300041505 Ga0451849_0637463 Ga0451849_0637463_1203_1907 229
693 3300041505 Ga0451849_0982181 Ga0451849_0982181_173_877 229
694 3300041507 Ga0451851_0622280 Ga0451851_0622280_846_1550 229
695 3300041509 Ga0451843_0405285 Ga0451843_0405285_195_899 229
696 3300041509 Ga0451843_1679605 Ga0451843_1679605_29_733 229
697 3300041511 Ga0451855_1371073 Ga0451855_1371073_377_1081 229
698 3300041512 Ga0451853_0037451 Ga0451853_0037451_220_924 229
699 3300041512 Ga0451853_1615945 Ga0451853_1615945_14_715 229
700 3300041512 Ga0451853_1919292 Ga0451853_1919292_642_1346 229
701 3300042007 Ga0439449_0037625 Ga0439449_0037625_95_784 229
702 3300042015 Ga0439462_0013794 Ga0439462_0013794_430_1119 229
703 3300042184 Ga0450908_020074 Ga0450908_020074_289_978 229
704 3300046474 Ga0495605_0258720 Ga0495605_0258720_39_728 229
705 3300046492 Ga0495585_0036491 Ga0495585_0036491_1863_2567 229
706 3300046500 Ga0495596_0135201 Ga0495596_0135201_178_882 229
707 3300046501 Ga0495607_0198603 Ga0495607_0198603_242_946 229
708 3300046507 Ga0495606_0018676 Ga0495606_0018676_917_1606 229
709 3300046507 Ga0495606_0093923 Ga0495606_0093923_960_1649 229
710 3300046507 Ga0495606_0142149 Ga0495606_0142149_631_1320 229
711 3300046507 Ga0495606_0161756 Ga0495606_0161756_555_1244 229
712 3300046512 Ga0495610_0030990 Ga0495610_0030990_446_1135 229
713 3300046512 Ga0495610_0091967 Ga0495610_0091967_74_763 229
714 3300046518 Ga0495631_0075762 Ga0495631_0075762_205_909 229
715 3300046518 Ga0495631_0084117 Ga0495631_0084117_529_1218 229
716 3300046519 Ga0495632_0125872 Ga0495632_0125872_71_760 229
717 3300046522 Ga0495643_0007073 Ga0495643_0007073_6454_7143 229
718 3300046522 Ga0495643_0028580 Ga0495643_0028580_1957_2646 229
719 3300046522 Ga0495643_0064130 Ga0495643_0064130_479_1168 229
720 3300046522 Ga0495643_0187616 Ga0495643_0187616_47_736 229
721 3300046524 Ga0495648_0133243 Ga0495648_0133243_604_1308 229
722 3300046530 Ga0495654_0000140 Ga0495654_0000140_21233_21934 229
723 3300046542 Ga0495597_0139189 Ga0495597_0139189_235_924 229
724 3300046558 Ga0495633_0070191 Ga0495633_0070191_534_1229 229
725 3300046616 Ga0495668_0134208 Ga0495668_0134208_83_772 229
726 3300046616 Ga0495668_0135259 Ga0495668_0135259_445_1134 229
727 3300046660 Ga0495625_0003110 Ga0495625_0003110_4380_5069 229
728 3300046660 Ga0495625_0018939 Ga0495625_0018939_1059_1763 229
729 3300046665 Ga0495661_0209377 Ga0495661_0209377_233_937 229
730 3300046674 Ga0495588_0008240 Ga0495588_0008240_2569_3264 229
731 3300046692 Ga0495671_0041131 Ga0495671_0041131_479_1174 229
732 3300046694 Ga0495649_0025746 Ga0495649_0025746_1486_2175 229
733 3300046810 Ga0495660_0036074 Ga0495660_0036074_2032_2721 229
734 3300046810 Ga0495660_0163505 Ga0495660_0163505_252_956 229
735 3300047443 Ga0495687_047057 Ga0495687_047057_417_1106 229
736 3300047472 Ga0495686_0000247 Ga0495686_0000247_47723_48445 229
737 3300047472 Ga0495686_0060194 Ga0495686_0060194_1288_1977 229
738 3300047472 Ga0495686_0206196 Ga0495686_0206196_343_1032 229
739 3300048090 Ga0495615_0025740 Ga0495615_0025740_507_1211 229
740 3300048904 Ga0496101_0081350 Ga0496101_0081350_687_1391 229
741 3300048904 Ga0496101_0105173 Ga0496101_0105173_449_1138 229
742 3300048905 Ga0496102_0575367 Ga0496102_0575367_318_1007 229
743 3300048906 Ga0496103_0145236 Ga0496103_0145236_133_837 229
744 3300048907 Ga0496104_0039384 Ga0496104_0039384_120_821 229
745 3300048907 Ga0496104_0129961 Ga0496104_0129961_161_865 229
746 3300048909 Ga0496106_0000275 Ga0496106_0000275_26117_26806 229
747 3300048909 Ga0496106_0137161 Ga0496106_0137161_757_1461 229
748 3300048913 Ga0496110_0195772 Ga0496110_0195772_1042_1746 229
749 3300048914 Ga0496111_0042218 Ga0496111_0042218_1036_1740 229
750 3300048916 Ga0496113_0223530 Ga0496113_0223530_433_1128 229
751 3300048919 Ga0496116_0000049 Ga0496116_0000049_253250_253951 229
752 3300048919 Ga0496116_0000540 Ga0496116_0000540_43926_44615 229
753 3300048919 Ga0496116_0029441 Ga0496116_0029441_2331_3026 229
754 3300048919 Ga0496116_0081815 Ga0496116_0081815_758_1447 229
755 3300048920 Ga0496117_0001006 Ga0496117_0001006_32258_32947 229
756 3300048920 Ga0496117_0003204 Ga0496117_0003204_17969_18658 229
757 3300048920 Ga0496117_0057991 Ga0496117_0057991_116_805 229
758 3300048920 Ga0496117_0140153 Ga0496117_0140153_223_912 229
759 3300048920 Ga0496117_0165772 Ga0496117_0165772_139_828 229
760 3300048920 Ga0496117_0192627 Ga0496117_0192627_203_898 229
761 3300048920 Ga0496117_0268165 Ga0496117_0268165_58_747 229
762 3300048921 Ga0496118_0002190 Ga0496118_0002190_3733_4422 229
763 3300048921 Ga0496118_0002306 Ga0496118_0002306_22703_23392 229
764 3300048921 Ga0496118_0003748 Ga0496118_0003748_7683_8378 229
765 3300048921 Ga0496118_0011605 Ga0496118_0011605_5620_6315 229
766 3300048921 Ga0496118_0023636 Ga0496118_0023636_4566_5267 229
767 3300048921 Ga0496118_0030457 Ga0496118_0030457_526_1215 229
768 3300048921 Ga0496118_0057602 Ga0496118_0057602_856_1545 229
769 3300048922 Ga0496119_0008555 Ga0496119_0008555_2973_3668 229
770 3300048922 Ga0496119_0020971 Ga0496119_0020971_1050_1745 229
771 3300048922 Ga0496119_0043412 Ga0496119_0043412_2018_2707 229
772 3300048922 Ga0496119_0050238 Ga0496119_0050238_252_956 229
773 3300048923 Ga0496120_0000148 Ga0496120_0000148_17151_17846 229
774 3300048923 Ga0496120_0011016 Ga0496120_0011016_3343_4032 229
775 3300048923 Ga0496120_0034808 Ga0496120_0034808_850_1545 229
776 3300048924 Ga0496121_0000174 Ga0496121_0000174_85134_85823 229
777 3300048924 Ga0496121_0021827 Ga0496121_0021827_4492_5196 229
778 3300048924 Ga0496121_0074623 Ga0496121_0074623_1772_2461 229
779 3300048924 Ga0496121_0110594 Ga0496121_0110594_547_1236 229
780 3300048924 Ga0496121_0149829 Ga0496121_0149829_835_1524 229
781 3300048925 Ga0496122_0000024 Ga0496122_0000024_44891_45580 229
782 3300048925 Ga0496122_0000050 Ga0496122_0000050_111290_111985 229
783 3300048925 Ga0496122_0000185 Ga0496122_0000185_54939_55643 229
784 3300048925 Ga0496122_0002162 Ga0496122_0002162_19804_20493 229
785 3300048925 Ga0496122_0004155 Ga0496122_0004155_10058_10747 229
786 3300048925 Ga0496122_0022046 Ga0496122_0022046_107_796 229
787 3300048925 Ga0496122_0037419 Ga0496122_0037419_2037_2738 229
788 3300048925 Ga0496122_0115056 Ga0496122_0115056_451_1155 229
789 3300048926 Ga0496123_0000023 Ga0496123_0000023_16347_17042 229
790 3300048926 Ga0496123_0000105 Ga0496123_0000105_88574_89278 229
791 3300048926 Ga0496123_0000926 Ga0496123_0000926_31393_32082 229
792 3300048926 Ga0496123_0006469 Ga0496123_0006469_10155_10844 229
793 3300048926 Ga0496123_0049273 Ga0496123_0049273_774_1463 229
794 3300048926 Ga0496123_0097870 Ga0496123_0097870_661_1365 229
795 3300048927 Ga0496124_0000094 Ga0496124_0000094_167815_168504 229
796 3300048927 Ga0496124_0000111 Ga0496124_0000111_121685_122374 229
797 3300048927 Ga0496124_0001598 Ga0496124_0001598_8791_9480 229
798 3300048927 Ga0496124_0001736 Ga0496124_0001736_12490_13179 229
799 3300048927 Ga0496124_0013394 Ga0496124_0013394_1762_2451 229
800 3300048927 Ga0496124_0016824 Ga0496124_0016824_1769_2473 229
801 3300048927 Ga0496124_0042659 Ga0496124_0042659_1950_2645 229
802 3300048927 Ga0496124_0052587 Ga0496124_0052587_2047_2751 229
803 3300048928 Ga0496125_0000617 Ga0496125_0000617_31204_31893 229
804 3300048928 Ga0496125_0000982 Ga0496125_0000982_35552_36241 229
805 3300048928 Ga0496125_0002851 Ga0496125_0002851_5664_6359 229
806 3300048928 Ga0496125_0022315 Ga0496125_0022315_2996_3700 229
807 3300048928 Ga0496125_0055100 Ga0496125_0055100_878_1567 229
808 3300048928 Ga0496125_0174449 Ga0496125_0174449_477_1172 229
809 3300048929 Ga0496126_0000808 Ga0496126_0000808_23134_23823 229
810 3300048929 Ga0496126_0045668 Ga0496126_0045668_2572_3276 229
811 3300048929 Ga0496126_0182078 Ga0496126_0182078_1034_1738 229
812 3300048929 Ga0496126_0221924 Ga0496126_0221924_479_1168 229
813 3300048929 Ga0496126_0300839 Ga0496126_0300839_534_1229 229
814 3300049569 Ga0501032_0093926 Ga0501032_0093926_463_1152 229
815 3300049569 Ga0501032_0211028 Ga0501032_0211028_422_1123 229
816 3300049570 Ga0501033_0001575 Ga0501033_0001575_10587_11288 229
817 3300049571 Ga0501034_0071996 Ga0501034_0071996_2057_2746 229
818 3300049571 Ga0501034_0851116 Ga0501034_0851116_101_790 229
819 3300049572 Ga0501036_0212339 Ga0501036_0212339_706_1395 229
820 3300049574 Ga0501038_0059957 Ga0501038_0059957_1487_2188 229
821 3300049574 Ga0501038_0069505 Ga0501038_0069505_714_1403 229
822 3300049579 Ga0501043_0171901 Ga0501043_0171901_339_1028 229
823 3300049579 Ga0501043_0274121 Ga0501043_0274121_367_1056 229
824 3300049580 Ga0501046_0405019 Ga0501046_0405019_165_866 229
825 3300049581 Ga0501047_0071714 Ga0501047_0071714_446_1135 229
826 3300049581 Ga0501047_0686304 Ga0501047_0686304_25_726 229
827 3300049584 Ga0501068_0070969 Ga0501068_0070969_1252_1953 229
828 3300049584 Ga0501068_0243069 Ga0501068_0243069_254_943 229
829 3300049671 Ga0501238_015915 Ga0501238_015915_182_871 229
830 3300049742 Ga0501080_0267537 Ga0501080_0267537_101_802 229
831 3300049776 Ga0501280_007883 Ga0501280_007883_10_711 229
832 3300049822 Ga0501035_0006107 Ga0501035_0006107_1897_2598 229
833 3300049822 Ga0501035_0207966 Ga0501035_0207966_276_965 229
834 3300049822 Ga0501035_0338438 Ga0501035_0338438_368_1069 229
835 3300049823 Ga0501044_0446711 Ga0501044_0446711_186_887 229
836 3300050489 nmdc:mga03683_88541_c1 nmdc:mga03683_88541_c1_283_972 229
837 3300050490 nmdc:mga03n38_161235_c1 nmdc:mga03n38_161235_c1_252_947 229
838 3300050491 nmdc:mga00v17_21_c1 nmdc:mga00v17_21_c1_26216_26923 229
839 3300050491 nmdc:mga00v17_34_c1 nmdc:mga00v17_34_c1_83493_84188 229
840 3300050492 nmdc:mga0yw44_529990_c1 nmdc:mga0yw44_529990_c1_40_729 229
841 3300050492 nmdc:mga0yw44_66335_c1 nmdc:mga0yw44_66335_c1_1173_1862 229
842 3300050493 nmdc:mga0k408_164327_c1 nmdc:mga0k408_164327_c1_120_815 229
843 3300050493 nmdc:mga0k408_174781_c1 nmdc:mga0k408_174781_c1_100_789 229
844 3300050494 nmdc:mga06z11_12959_c1 nmdc:mga06z11_12959_c1_1479_2168 229
845 3300050495 nmdc:mga04h51_160512_c1 nmdc:mga04h51_160512_c1_104_799 229
846 3300050516 nmdc:mga0sz30_40204_c1 nmdc:mga0sz30_40204_c1_345_1034 229
847 3300050516 nmdc:mga0sz30_78596_c1 nmdc:mga0sz30_78596_c1_595_1290 229
848 3300053086 Ga0500578_0031037 Ga0500578_0031037_2068_2757 229
849 3300053086 Ga0500578_0043993 Ga0500578_0043993_1835_2524 229
850 3300053086 Ga0500578_0308632 Ga0500578_0308632_141_830 229
851 3300053107 Ga0500560_000117 Ga0500560_000117_4846_5541 229
852 3300053109 Ga0500569_035701 Ga0500569_035701_686_1375 229
853 3300053109 Ga0500569_043549 Ga0500569_043549_121_810 229
854 3300053111 Ga0500572_003877 Ga0500572_003877_646_1350 229
855 3300053118 Ga0500594_0064928 Ga0500594_0064928_40_729 229
856 3300053122 Ga0500608_091810 Ga0500608_091810_155_844 229
857 3300053125 Ga0500618_000249 Ga0500618_000249_15473_16177 229
858 3300053125 Ga0500618_003707 Ga0500618_003707_314_1003 229
859 3300053125 Ga0500618_054376 Ga0500618_054376_186_875 229
860 3300053134 Ga0500658_0000229 Ga0500658_0000229_17554_18243 229
861 3300053134 Ga0500658_0024221 Ga0500658_0024221_835_1524 229
862 3300053134 Ga0500658_0049711 Ga0500658_0049711_686_1375 229
863 3300053136 Ga0500559_0002561 Ga0500559_0002561_980_1669 229
864 3300053137 Ga0500561_0000067 Ga0500561_0000067_8719_9414 229
865 3300053139 Ga0500568_0001013 Ga0500568_0001013_16182_16871 229
866 3300053140 Ga0500573_0003730 Ga0500573_0003730_2573_3271 229
867 3300053151 Ga0500604_0008820 Ga0500604_0008820_966_1655 229
868 3300053153 Ga0500616_0000094 Ga0500616_0000094_2300_2989 229
869 3300053153 Ga0500616_0007710 Ga0500616_0007710_1444_2133 229
870 3300053153 Ga0500616_0055995 Ga0500616_0055995_1023_1712 229
871 3300053156 Ga0500622_0000185 Ga0500622_0000185_26292_26981 229
872 3300053157 Ga0500624_002108 Ga0500624_002108_673_1368 229
873 3300053160 Ga0500633_0001027 Ga0500633_0001027_485_1174 229
874 3300053161 Ga0500634_0107380 Ga0500634_0107380_220_915 229
875 3300053177 Ga0500636_0000038 Ga0500636_0000038_23890_24594 229
876 3300053177 Ga0500636_0000888 Ga0500636_0000888_11542_12246 229
877 3300059508 Ga0587088_002917 Ga0587088_002917_579_1274 229
878 iso_pu_bacteria 2510065019 2510136939 229
879 iso_pu_bacteria 2510461069 2510840795 229
880 iso_pu_bacteria 2510461076 2510900262 229
881 iso_pu_bacteria 2513237144 2513911725 229
882 iso_pu_bacteria 2513237146 2513927696 229
883 iso_pu_bacteria 2513237162 2514018732 229
884 iso_pu_bacteria 2515075009 2515115534 229
885 iso_pu_bacteria 2515154113 2515633224 229
886 iso_pu_bacteria 2515154114 2515642450 229
887 iso_pu_bacteria 2515154116 2515658413 229
888 iso_pu_bacteria 2517093000 2517098651 229
889 iso_pu_bacteria 2517287029 2517410812 229
890 iso_pu_bacteria 2599185170 2599414626 229
891 iso_pu_bacteria 2600254933 2600376144 229
892 iso_pu_bacteria 2643221568 2643854735 229
893 iso_pu_bacteria 2643221653 2644299459 229
894 iso_pu_bacteria 2643221719 2644657687 229
895 iso_pu_bacteria 2718217927 2719388415 229
896 iso_pu_bacteria 2718217997 2719668017 229
897 iso_pu_bacteria 2718218199 2720494780 229
898 iso_pu_bacteria 2718218232 2720611108 229
899 iso_pu_bacteria 2718218233 2720616281 229
900 iso_pu_bacteria 2718218235 2720629355 229
901 iso_pu_bacteria 2718218269 2720771927 229
902 iso_pu_bacteria 2718218423 2721403039 229
903 iso_pu_bacteria 2721755556 2723029349 229
904 iso_pu_bacteria 2721755684 2723562972 229
905 iso_pu_bacteria 2721755685 2723570954 229
906 iso_pu_bacteria 2721755809 2724035396 229
907 iso_pu_bacteria 2721755819 2724086747 229
908 iso_pu_bacteria 2721755822 2724106905 229
909 iso_pu_bacteria 2721755823 2724107715 229
910 iso_pu_bacteria 2724679232 2725946576 229
911 iso_pu_bacteria 2728369352 2730105663 229
912 iso_pu_bacteria 2738541317 2738946742 229
913 iso_pu_bacteria 2791355261 2793325994 229
914 iso_pu_bacteria 2791355265 2793357173 229
915 iso_pu_bacteria 2818991272 2819244035 229
916 iso_pu_bacteria 2838016132 2838019425 229
917 iso_pu_bacteria 2838035591 2838036987 229
918 iso_pu_bacteria 2838048938 2838050514 229
919 iso_pu_bacteria 2838061910 2838063212 229
920 iso_pu_bacteria 2838068647 2838071766 229
921 iso_pu_bacteria 2838661181 2838661968 229
922 iso_pu_bacteria 2842264693 2842267974 229
923 iso_pu_bacteria 2842311132 2842311821 229
924 iso_pu_bacteria 2842363717 2842369730 229
925 iso_pu_bacteria 2842422224 2842425399 229
926 iso_pu_bacteria 2842428310 2842432137 229
927 iso_pu_bacteria 2842434925 2842438249 229
928 iso_pu_bacteria 2842441272 2842443945 229
929 iso_pu_bacteria 2842447887 2842454016 229
930 iso_pu_bacteria 2842462802 2842466235 229
931 iso_pu_bacteria 2842469257 2842472781 229
932 iso_pu_bacteria 2854896431 2854899818 229
933 iso_pu_bacteria 2854916844 2854920962 229
934 iso_pu_bacteria 2857516855 2857519147 229
935 iso_pu_bacteria 2913308742 2913311900 229
936 iso_pu_bacteria 2919166419 2919169069 229
937 iso_pu_bacteria 2933016740 2933017444 229
938 iso_pu_bacteria 2933599457 2933602561 229
939 iso_pu_bacteria 2978969890 2978970550 229
940 iso_pu_bacteria 2984587000 2984587557 229
941 iso_pu_bacteria 2989349275 2989351872 229
942 iso_pu_bacteria 2989776772 2989780571 229
943 iso_pu_bacteria 8005246636 8005250277 229
944 iso_pu_bacteria 8005275841 8005277131 229
945 iso_pu_bacteria 8005282627 8005287877 229
946 iso_pu_bacteria 8005289223 8005290601 229
947 iso_pu_bacteria 8005376324 8005381839 229
948 iso_pu_bacteria 8005382845 8005388503 229
949 iso_pu_bacteria 8005395548 8005397673 229
950 iso_pu_bacteria 8005430974 8005437026 229
951 iso_pu_bacteria 8005460587 8005466758 229
952 iso_pu_bacteria 8005497431 8005503034 229
953 iso_pu_bacteria 8005556819 8005562081 229
954 iso_pu_bacteria 8005563573 8005567164 229
955 iso_pu_bacteria 8005619151 8005625559 229
956 iso_pu_bacteria 8005626139 8005630577 229
957 iso_pu_bacteria 8005668836 8005674952 229
958 iso_pu_bacteria 8018163183 8018165877 229
959 iso_pu_bacteria 8018176218 8018182206 229
960 iso_pu_bacteria 8024479707 8024484123 229
961 iso_pu_bacteria 8054460903 8054465379 229
962 iso_pu_bacteria 8054558443 8054561615 229
963 iso_pu_bacteria 8056382006 8056383270 229
964 iso_pu_bacteria 8056875544 8056879759 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

18

211

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nrc-assembly1.cif.gz_A c28a mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9456 11 226
5dbn-assembly1.cif.gz_D crystal structure of atoda complex 0.9419 12 221
3rrl-assembly1.cif.gz_D complex structure of 3-oxoadipate coa-transferase subunit a and b from helicobacter pylori 26695 0.9418 12 219
2nrb-assembly1.cif.gz_B c28s mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9418 13 226
1m3e-assembly2.cif.gz_D succinyl-coa:3-ketoacid coa transferase from pig heart (selenomethionine) 0.9379 13 229
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9419 12 221 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9362 13 222 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9164 12 221 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9073 13 222 3.40.1080.10
1o9lB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9036 13 222 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A1N7NBP6-F1-model_v4 3-oxoadipate CoA-transferase beta subunit 0.9784 9 229 GO:0008410
AF-A0A1J9PPM3-F1-model_v4 deleted 0.9764 10 216
AF-A0A132BQZ0-F1-model_v4 3-oxoadipate CoA-transferase subunit B (EC 2.8.3.6) 0.9757 7 229 GO:0047569
AF-A0A1N6FM07-F1-model_v4 3-oxoadipate CoA-transferase beta subunit 0.9755 9 227 GO:0008410
AF-A0A2E6GJY6-F1-model_v4 3-oxoadipate CoA-transferase 0.9743 9 229 GO:0008410

Feature Viewer

pLDDT pTM Quality
89.35 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map