F486972

General Info

Members Datasets Scaffolds Average Seq Length
965 397 965 183

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10063757|Ga0213876_100637572
Length 183
Sequence MSIDVGARLRGLRTTFGLSQRELARRAGVTNGLISLIEQNRVSPSVSSLKKVLDGVPMSLAEFFTLDPGTAVPQSVFAADELVELGNEELSLRLVAAQRPGRQLTILHERYAAGAGTGEDMLMHRGEEGGVVVRGKVELTVGGVARVLSPGEAYYFSSQLPHRFRNVGREPCEIISASTPPTF

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
237 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
238 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
239 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
240 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
241 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
247 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
250 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
251 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
355 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
356 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
373 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
376 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
377 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
378 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
379 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
380 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
382 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
383 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
389 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
390 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
391 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.01
Nodule 0
Rhizoplane 4.97
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 5.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C9875 2010549000 Bacteria 838
2 SwRhRL2b_contig_2220656 2162886007 Bacteria 2287
3 rootH1_10101733 3300003316 Bacteria 2135
4 rootH2_10016870 3300003320 Bacteria 1461
5 rootH1_10033537 3300003323 Bacteria 6912
6 Ga0065704_10011697 3300005289 Bacteria 4054
7 Ga0065712_10070294 3300005290 Bacteria 6136
8 Ga0065715_10136644 3300005293 Bacteria 1919
9 Ga0070676_10111192 3300005328 Bacteria 1706
10 Ga0070683_100509493 3300005329 Unclassified 1150
11 Ga0070690_100012452 3300005330 Bacteria 5003
12 Ga0070690_100034482 3300005330 Bacteria 3171
13 Ga0070690_100442761 3300005330 Bacteria 962
14 Ga0070690_101014645 3300005330 Bacteria 654
15 Ga0070670_100150538 3300005331 Bacteria 2014
16 Ga0070670_100176738 3300005331 Bacteria 1853
17 Ga0070677_10246646 3300005333 Bacteria 884
18 Ga0068869_100387362 3300005334 Bacteria 1147
19 Ga0070666_10084334 3300005335 Bacteria 2174
20 Ga0070666_10160843 3300005335 Bacteria 1569
21 Ga0070680_100005497 3300005336 Bacteria 9590
22 Ga0070680_100169769 3300005336 Bacteria 1835
23 Ga0070680_100232785 3300005336 Bacteria 1556
24 Ga0070682_100197138 3300005337 Bacteria 1418
25 Ga0070682_100380023 3300005337 Bacteria 1062
26 Ga0070682_100579687 3300005337 Bacteria 882
27 Ga0068868_100028250 3300005338 Bacteria 4287
28 Ga0070689_100002266 3300005340 Bacteria 12501
29 Ga0070689_100003597 3300005340 Bacteria 10332
30 Ga0070689_100641499 3300005340 Bacteria 923
31 Ga0070691_10107204 3300005341 Bacteria 1394
32 Ga0070687_100274690 3300005343 Bacteria 1058
33 Ga0070687_100779705 3300005343 Bacteria 675
34 Ga0070687_100883988 3300005343 Bacteria 639
35 Ga0070661_100070943 3300005344 Bacteria 2563
36 Ga0070661_100694517 3300005344 Bacteria 829
37 Ga0070668_100107972 3300005347 Bacteria 2213
38 Ga0070669_100176852 3300005353 Bacteria 1667
39 Ga0070669_100320947 3300005353 Bacteria 1250
40 Ga0070675_100001269 3300005354 Bacteria 18440
41 Ga0070675_100187299 3300005354 Bacteria 1792
42 Ga0070675_100444151 3300005354 Bacteria 1162
43 Ga0070675_100457919 3300005354 Bacteria 1145
44 Ga0070671_100000657 3300005355 Bacteria 24836
45 Ga0070671_100110753 3300005355 Bacteria 2306
46 Ga0070673_100020159 3300005364 Bacteria 4804
47 Ga0070673_100092132 3300005364 Bacteria 2478
48 Ga0070673_100173114 3300005364 Bacteria 1843
49 Ga0070673_100364754 3300005364 Bacteria 1285
50 Ga0070673_100548881 3300005364 Bacteria 1049
51 Ga0070688_100005304 3300005365 Bacteria 6781
52 Ga0070667_100022143 3300005367 Bacteria 5272
53 Ga0070667_100037857 3300005367 Bacteria 4044
54 Ga0070667_100296137 3300005367 Bacteria 1456
55 Ga0070709_10116089 3300005434 Bacteria 1807
56 Ga0070709_10156402 3300005434 Bacteria 1581
57 Ga0070709_10789025 3300005434 Unclassified 745
58 Ga0070714_100004027 3300005435 Bacteria 11045
59 Ga0070714_100058875 3300005435 Bacteria 3293
60 Ga0070714_100263841 3300005435 Bacteria 1595
61 Ga0070713_100003765 3300005436 Bacteria 10041
62 Ga0070713_100004406 3300005436 Bacteria 9453
63 Ga0070713_100112568 3300005436 Bacteria 2375
64 Ga0070713_100231427 3300005436 Unclassified 1680
65 Ga0070710_10002005 3300005437 Bacteria 9640
66 Ga0070710_10102895 3300005437 Bacteria 1704
67 Ga0070710_10987364 3300005437 Bacteria 613
68 Ga0070701_10024998 3300005438 Bacteria 2895
69 Ga0070701_10205419 3300005438 Bacteria 1167
70 Ga0070701_10227177 3300005438 Bacteria 1116
71 Ga0070711_100062958 3300005439 Bacteria 2587
72 Ga0070711_100135726 3300005439 Bacteria 1838
73 Ga0070705_100005025 3300005440 Bacteria 6434
74 Ga0070705_100141213 3300005440 Bacteria 1585
75 Ga0070705_101001623 3300005440 Bacteria 678
76 Ga0070700_100179598 3300005441 Bacteria 1472
77 Ga0070700_100195867 3300005441 Bacteria 1416
78 Ga0070700_100246164 3300005441 Bacteria 1280
79 Ga0070694_100039533 3300005444 Bacteria 3140
80 Ga0070694_100257513 3300005444 Bacteria 1322
81 Ga0070694_100289354 3300005444 Bacteria 1252
82 Ga0070663_100628945 3300005455 Bacteria 906
83 Ga0070663_100828828 3300005455 Bacteria 795
84 Ga0070663_101623125 3300005455 Bacteria 577
85 Ga0070678_100001882 3300005456 Bacteria 11328
86 Ga0070678_101182414 3300005456 Bacteria 709
87 Ga0070678_101341327 3300005456 Bacteria 666
88 Ga0070662_100106771 3300005457 Bacteria 2127
89 Ga0070662_100121887 3300005457 Bacteria 2000
90 Ga0070681_10000738 3300005458 Bacteria 27069
91 Ga0070681_10001577 3300005458 Bacteria 20233
92 Ga0070681_10015379 3300005458 Bacteria 7614
93 Ga0070681_10024230 3300005458 Bacteria 6109
94 Ga0070681_10048512 3300005458 Bacteria 4243
95 Ga0070681_10049548 3300005458 Bacteria 4194
96 Ga0070681_10141489 3300005458 Bacteria 2336
97 Ga0070681_10740875 3300005458 Bacteria 899
98 Ga0068867_100012777 3300005459 Bacteria 5940
99 Ga0068867_100047736 3300005459 Bacteria 3148
100 Ga0068867_100179522 3300005459 Bacteria 1682
101 Ga0070685_10002528 3300005466 Bacteria 9382
102 Ga0070685_10083125 3300005466 Bacteria 1923
103 Ga0070685_10480368 3300005466 Unclassified 876
104 Ga0070706_100293187 3300005467 Bacteria 1518
105 Ga0070699_100022483 3300005518 Bacteria 5435
106 Ga0070699_101116196 3300005518 Bacteria 723
107 Ga0070679_100000469 3300005530 Bacteria 34407
108 Ga0070679_100005515 3300005530 Bacteria 11722
109 Ga0070679_100087639 3300005530 Bacteria 3100
110 Ga0070679_100116286 3300005530 Bacteria 2659
111 Ga0070679_100155886 3300005530 Bacteria 2258
112 Ga0070679_101525989 3300005530 Bacteria 615
113 Ga0070684_100513922 3300005535 Bacteria 1110
114 Ga0070684_100575395 3300005535 Bacteria 1046
115 Ga0068853_100250645 3300005539 Bacteria 1624
116 Ga0068853_100286241 3300005539 Bacteria 1520
117 Ga0068853_100526451 3300005539 Bacteria 1118
118 Ga0068853_100570492 3300005539 Bacteria 1073
119 Ga0070672_100027580 3300005543 Bacteria 4238
120 Ga0070672_100029661 3300005543 Bacteria 4104
121 Ga0070672_100054834 3300005543 Bacteria 3122
122 Ga0070672_100167369 3300005543 Bacteria 1826
123 Ga0070672_100530695 3300005543 Bacteria 1020
124 Ga0070686_100002735 3300005544 Bacteria 9706
125 Ga0070695_100009460 3300005545 Bacteria 5804
126 Ga0070696_100020484 3300005546 Bacteria 4481
127 Ga0070696_100092350 3300005546 Bacteria 2157
128 Ga0070693_100040423 3300005547 Bacteria 2618
129 Ga0070693_100287006 3300005547 Bacteria 1104
130 Ga0070665_100000543 3300005548 Bacteria 52995
131 Ga0070665_100006529 3300005548 Bacteria 11855
132 Ga0070665_100009640 3300005548 Bacteria 9766
133 Ga0070665_100029937 3300005548 Bacteria 5479
134 Ga0070665_100032219 3300005548 Bacteria 5276
135 Ga0070665_100053459 3300005548 Bacteria 4050
136 Ga0070665_100107978 3300005548 Bacteria 2785
137 Ga0070665_100341674 3300005548 Bacteria 1502
138 Ga0070665_100391338 3300005548 Bacteria 1398
139 Ga0070704_100053103 3300005549 Bacteria 2863
140 Ga0070704_100405079 3300005549 Bacteria 1165
141 Ga0068855_100001482 3300005563 Bacteria 29366
142 Ga0068855_100001838 3300005563 Bacteria 26405
143 Ga0068855_100094225 3300005563 Bacteria 3453
144 Ga0068855_100169063 3300005563 Bacteria 2477
145 Ga0068855_100318422 3300005563 Bacteria 1720
146 Ga0070664_100276073 3300005564 Bacteria 1515
147 Ga0070664_100966490 3300005564 Bacteria 800
148 Ga0068857_100035066 3300005577 Bacteria 4441
149 Ga0068857_100154869 3300005577 Bacteria 2078
150 Ga0068857_100223179 3300005577 Bacteria 1722
151 Ga0068854_100446984 3300005578 Bacteria 1079
152 Ga0068856_100004498 3300005614 Bacteria 13867
153 Ga0068856_100529173 3300005614 Bacteria 1200
154 Ga0068856_100546507 3300005614 Bacteria 1179
155 Ga0068856_100626688 3300005614 Bacteria 1096
156 Ga0068856_100832996 3300005614 Unclassified 942
157 Ga0070702_100006702 3300005615 Bacteria 5471
158 Ga0070702_100009527 3300005615 Bacteria 4757
159 Ga0068852_100366968 3300005616 Bacteria 1409
160 Ga0068852_100439742 3300005616 Bacteria 1289
161 Ga0068859_100000929 3300005617 Bacteria 29994
162 Ga0068859_100009204 3300005617 Bacteria 9973
163 Ga0068859_100125227 3300005617 Bacteria 2638
164 Ga0068859_100228640 3300005617 Bacteria 1948
165 Ga0068859_100354535 3300005617 Bacteria 1562
166 Ga0068859_102080647 3300005617 Bacteria 627
167 Ga0068864_100004892 3300005618 Bacteria 10973
168 Ga0068866_10137770 3300005718 Bacteria 1397
169 Ga0068861_100001663 3300005719 Bacteria 14225
170 Ga0068861_100002156 3300005719 Bacteria 12755
171 Ga0068861_100012276 3300005719 Bacteria 5975
172 Ga0068861_100036200 3300005719 Bacteria 3661
173 Ga0068861_100226488 3300005719 Bacteria 1583
174 Ga0068861_101289985 3300005719 Bacteria 710
175 Ga0068851_10179076 3300005834 Bacteria 1173
176 Ga0068870_10134943 3300005840 Bacteria 1438
177 Ga0068863_100001099 3300005841 Bacteria 27025
178 Ga0068863_100048854 3300005841 Bacteria 4011
179 Ga0068863_100060367 3300005841 Bacteria 3586
180 Ga0068863_100414724 3300005841 Bacteria 1318
181 Ga0068863_100469460 3300005841 Bacteria 1236
182 Ga0068863_100500360 3300005841 Bacteria 1197
183 Ga0068858_100002788 3300005842 Bacteria 17562
184 Ga0068858_100024983 3300005842 Bacteria 5560
185 Ga0068858_100029209 3300005842 Bacteria 5119
186 Ga0068858_100029595 3300005842 Bacteria 5086
187 Ga0068858_100110818 3300005842 Bacteria 2563
188 Ga0068858_100253828 3300005842 Bacteria 1671
189 Ga0068860_100002907 3300005843 Bacteria 17741
190 Ga0068860_100055609 3300005843 Bacteria 3762
191 Ga0068860_100171261 3300005843 Bacteria 2097
192 Ga0068862_100013694 3300005844 Bacteria 6718
193 Ga0068862_100024285 3300005844 Bacteria 5085
194 Ga0068862_100158654 3300005844 Bacteria 2018
195 Ga0068862_100162582 3300005844 Bacteria 1994
196 Ga0068862_101006079 3300005844 Bacteria 825
197 Ga0081455_10016058 3300005937 Bacteria 7243
198 Ga0081539_10000028 3300005985 Bacteria 328182
199 Ga0070717_10044415 3300006028 Bacteria 3628
200 Ga0075432_10048877 3300006058 Bacteria 1489
201 Ga0070715_10000714 3300006163 Bacteria 8928
202 Ga0070716_100007820 3300006173 Bacteria 5283
203 Ga0070716_100342283 3300006173 Bacteria 1055
204 Ga0070712_100000750 3300006175 Bacteria 19154
205 Ga0070712_100082000 3300006175 Bacteria 2339
206 Ga0097621_100072320 3300006237 Bacteria 2852
207 Ga0097621_100114721 3300006237 Bacteria 2280
208 Ga0097621_100126691 3300006237 Bacteria 2169
209 Ga0097621_100141911 3300006237 Bacteria 2053
210 Ga0097621_100564154 3300006237 Bacteria 1037
211 Ga0068871_100062807 3300006358 Bacteria 3036
212 Ga0068871_100094236 3300006358 Bacteria 2499
213 Ga0068871_100415797 3300006358 Bacteria 1200
214 Ga0068871_100544488 3300006358 Bacteria 1051
215 Ga0068871_100654374 3300006358 Unclassified 959
216 Ga0075428_100002070 3300006844 Bacteria 21641
217 Ga0075428_100004658 3300006844 Bacteria 15175
218 Ga0075428_100012224 3300006844 Bacteria 9545
219 Ga0075428_100038164 3300006844 Bacteria 5286
220 Ga0075428_100380745 3300006844 Bacteria 1513
221 Ga0075430_100075385 3300006846 Bacteria 2828
222 Ga0075430_100336650 3300006846 Bacteria 1247
223 Ga0075431_100000030 3300006847 Bacteria 72683
224 Ga0075431_100018484 3300006847 Bacteria 7099
225 Ga0075431_100256976 3300006847 Bacteria 1774
226 Ga0075434_100551957 3300006871 Bacteria 1172
227 Ga0075429_100006776 3300006880 Bacteria 9936
228 Ga0075429_100100005 3300006880 Bacteria 2531
229 Ga0075429_100107637 3300006880 Bacteria 2436
230 Ga0075429_100679284 3300006880 Bacteria 902
231 Ga0075429_101278567 3300006880 Bacteria 640
232 Ga0068865_100005989 3300006881 Bacteria 7408
233 Ga0068865_100032027 3300006881 Bacteria 3509
234 Ga0068865_100154253 3300006881 Bacteria 1745
235 Ga0068865_100256914 3300006881 Bacteria 1381
236 Ga0097620_100000929 3300006931 Bacteria 29994
237 Ga0097620_100009203 3300006931 Bacteria 9973
238 Ga0097620_100125225 3300006931 Bacteria 2638
239 Ga0097620_100228650 3300006931 Bacteria 1948
240 Ga0097620_100354551 3300006931 Bacteria 1562
241 Ga0097620_102080195 3300006931 Bacteria 627
242 Ga0075435_100389863 3300007076 Bacteria 1197
243 Ga0075435_100609771 3300007076 Bacteria 947
244 Ga0099794_10011136 3300007265 Bacteria 3844
245 Ga0099794_10021256 3300007265 Bacteria 2946
246 Ga0099795_10037368 3300007788 Bacteria 1708
247 Ga0105240_10002127 3300009093 Bacteria 32338
248 Ga0105240_10002705 3300009093 Bacteria 28172
249 Ga0105240_10009513 3300009093 Bacteria 13757
250 Ga0105240_10019061 3300009093 Bacteria 9177
251 Ga0105240_10043180 3300009093 Bacteria 5739
252 Ga0105240_10062866 3300009093 Bacteria 4620
253 Ga0105240_10268433 3300009093 Bacteria 1966
254 Ga0105240_10578905 3300009093 Bacteria 1239
255 Ga0105240_10779600 3300009093 Bacteria 1037
256 Ga0105240_11130489 3300009093 Unclassified 832
257 Ga0111539_10009762 3300009094 Bacteria 12114
258 Ga0111539_10065955 3300009094 Bacteria 4276
259 Ga0111539_10168629 3300009094 Bacteria 2558
260 Ga0111539_10233281 3300009094 Bacteria 2142
261 Ga0111539_10284440 3300009094 Bacteria 1925
262 Ga0111539_10498440 3300009094 Bacteria 1418
263 Ga0111539_10704175 3300009094 Bacteria 1176
264 Ga0111539_11374338 3300009094 Bacteria 819
265 Ga0105245_10019110 3300009098 Bacteria 5998
266 Ga0105245_10541684 3300009098 Bacteria 1185
267 Ga0105247_10000390 3300009101 Bacteria 37263
268 Ga0105247_10008064 3300009101 Bacteria 6435
269 Ga0105247_10065548 3300009101 Bacteria 2260
270 Ga0105247_10434298 3300009101 Unclassified 943
271 Ga0114129_10153233 3300009147 Bacteria 3154
272 Ga0114129_10272428 3300009147 Bacteria 2264
273 Ga0114129_10939058 3300009147 Bacteria 1093
274 Ga0105243_10102731 3300009148 Bacteria 2376
275 Ga0105243_10168742 3300009148 Bacteria 1893
276 Ga0105243_10391033 3300009148 Bacteria 1289
277 Ga0105243_11630474 3300009148 Bacteria 672
278 Ga0105241_10034500 3300009174 Bacteria 3802
279 Ga0105241_10473736 3300009174 Bacteria 1112
280 Ga0105241_10541193 3300009174 Bacteria 1044
281 Ga0105241_10940212 3300009174 Bacteria 805
282 Ga0105242_10006693 3300009176 Bacteria 8894
283 Ga0105242_10019979 3300009176 Bacteria 5248
284 Ga0105242_10648072 3300009176 Bacteria 1027
285 Ga0105248_10001404 3300009177 Bacteria 26898
286 Ga0105248_10010920 3300009177 Bacteria 10020
287 Ga0105248_10030432 3300009177 Bacteria 6027
288 Ga0105248_10075402 3300009177 Bacteria 3791
289 Ga0105248_11171076 3300009177 Bacteria 869
290 Ga0105248_11812101 3300009177 Bacteria 692
291 Ga0105237_10007658 3300009545 Bacteria 11802
292 Ga0105237_10162994 3300009545 Bacteria 2228
293 Ga0105237_10217056 3300009545 Bacteria 1913
294 Ga0105237_10793924 3300009545 Bacteria 953
295 Ga0105238_10005376 3300009551 Bacteria 12659
296 Ga0105238_10078897 3300009551 Bacteria 3282
297 Ga0105238_10131609 3300009551 Bacteria 2480
298 Ga0105238_10406644 3300009551 Bacteria 1355
299 Ga0105238_10486809 3300009551 Bacteria 1233
300 Ga0105238_10947601 3300009551 Unclassified 880
301 Ga0105249_10036444 3300009553 Bacteria 4461
302 Ga0105249_10073971 3300009553 Bacteria 3153
303 Ga0105249_10186168 3300009553 Bacteria 2023
304 Ga0105249_10349425 3300009553 Bacteria 1498
305 Ga0105249_10459195 3300009553 Bacteria 1313
306 Ga0105249_10559372 3300009553 Bacteria 1195
307 Ga0099796_10004014 3300010159 Bacteria 3503
308 Ga0099796_10027107 3300010159 Bacteria 1827
309 Ga0105239_10019263 3300010375 Bacteria 7537
310 Ga0105239_10233748 3300010375 Bacteria 2063
311 Ga0105239_11375874 3300010375 Bacteria 815
312 Ga0105246_10333158 3300011119 Bacteria 1238
313 Ga0105246_10836110 3300011119 Bacteria 820
314 Ga0157370_10001472 3300013104 Bacteria 29117
315 Ga0157370_10263999 3300013104 Bacteria 1591
316 Ga0157369_10000841 3300013105 Bacteria 39257
317 Ga0157369_10068740 3300013105 Bacteria 3806
318 Ga0157369_10102450 3300013105 Bacteria 3051
319 Ga0157369_11025486 3300013105 Bacteria 844
320 Ga0157374_10032183 3300013296 Bacteria 4773
321 Ga0157374_11018673 3300013296 Bacteria 847
322 Ga0157374_11110920 3300013296 Bacteria 811
323 Ga0157378_10019771 3300013297 Bacteria 5922
324 Ga0163162_10080582 3300013306 Bacteria 3324
325 Ga0163162_10598608 3300013306 Bacteria 1229
326 Ga0163162_10608667 3300013306 Bacteria 1218
327 Ga0163162_10892668 3300013306 Bacteria 1002
328 Ga0157372_10473686 3300013307 Bacteria 1460
329 Ga0157375_10007357 3300013308 Bacteria 9640
330 Ga0157375_10052757 3300013308 Bacteria 3999
331 Ga0157375_10094100 3300013308 Bacteria 3064
332 Ga0157375_10465439 3300013308 Bacteria 1430
333 Ga0157375_12095973 3300013308 Bacteria 673
334 Ga0163163_10003787 3300014325 Bacteria 12882
335 Ga0163163_10109595 3300014325 Bacteria 2788
336 Ga0163163_10426054 3300014325 Bacteria 1386
337 Ga0163163_10444905 3300014325 Bacteria 1356
338 Ga0157380_10000110 3300014326 Bacteria 44612
339 Ga0157380_10121662 3300014326 Bacteria 2212
340 Ga0157380_10182007 3300014326 Bacteria 1847
341 Ga0157380_10288471 3300014326 Bacteria 1505
342 Ga0157380_10752052 3300014326 Bacteria 986
343 Ga0157380_11600129 3300014326 Unclassified 707
344 Ga0157377_10289230 3300014745 Bacteria 1077
345 Ga0157377_10686463 3300014745 Bacteria 742
346 Ga0157379_10020721 3300014968 Bacteria 5818
347 Ga0157379_10029861 3300014968 Bacteria 4848
348 Ga0157379_10063423 3300014968 Bacteria 3304
349 Ga0157379_10254981 3300014968 Bacteria 1593
350 Ga0157379_10276329 3300014968 Bacteria 1528
351 Ga0157379_10373013 3300014968 Bacteria 1308
352 Ga0157376_10144586 3300014969 Bacteria 2137
353 Ga0157376_10150207 3300014969 Bacteria 2100
354 Ga0157376_10290937 3300014969 Bacteria 1542
355 Ga0157376_10553980 3300014969 Bacteria 1138
356 Ga0163161_10131136 3300017792 Bacteria 1891
357 Ga0163161_10197194 3300017792 Bacteria 1550
358 Ga0213874_10003273 3300021377 Bacteria 3575
359 Ga0213874_10015214 3300021377 Bacteria 2026
360 Ga0213876_10063757 3300021384 Bacteria 1946
361 Ga0207682_10003425 3300025893 Bacteria 6901
362 Ga0207682_10010135 3300025893 Bacteria 3698
363 Ga0207692_10119187 3300025898 Bacteria 1475
364 Ga0207692_10322806 3300025898 Bacteria 945
365 Ga0207642_10056367 3300025899 Bacteria 1802
366 Ga0207642_10605368 3300025899 Bacteria 682
367 Ga0207710_10000349 3300025900 Bacteria 33438
368 Ga0207710_10039830 3300025900 Bacteria 2081
369 Ga0207688_10073680 3300025901 Bacteria 1941
370 Ga0207680_10009849 3300025903 Bacteria 4758
371 Ga0207680_10024115 3300025903 Bacteria 3333
372 Ga0207680_10036291 3300025903 Bacteria 2838
373 Ga0207680_10315088 3300025903 Bacteria 1093
374 Ga0207685_10010026 3300025905 Bacteria 2778
375 Ga0207699_10017383 3300025906 Bacteria 3783
376 Ga0207699_10067788 3300025906 Bacteria 2171
377 Ga0207699_10094380 3300025906 Bacteria 1884
378 Ga0207699_10122333 3300025906 Bacteria 1685
379 Ga0207699_10279916 3300025906 Bacteria 1159
380 Ga0207645_10054717 3300025907 Bacteria 2548
381 Ga0207645_10063416 3300025907 Bacteria 2361
382 Ga0207645_10716960 3300025907 Bacteria 680
383 Ga0207643_10046737 3300025908 Bacteria 2447
384 Ga0207654_10037130 3300025911 Bacteria 2725
385 Ga0207707_10000122 3300025912 Bacteria 80159
386 Ga0207707_10001614 3300025912 Bacteria 20779
387 Ga0207707_10014611 3300025912 Bacteria 6840
388 Ga0207707_10025599 3300025912 Bacteria 5161
389 Ga0207707_10054459 3300025912 Bacteria 3482
390 Ga0207707_10083736 3300025912 Bacteria 2785
391 Ga0207695_10003540 3300025913 Bacteria 21874
392 Ga0207695_10032858 3300025913 Bacteria 5672
393 Ga0207695_10045635 3300025913 Bacteria 4650
394 Ga0207695_10051308 3300025913 Bacteria 4332
395 Ga0207695_10070636 3300025913 Bacteria 3568
396 Ga0207695_10094832 3300025913 Bacteria 2990
397 Ga0207695_10195446 3300025913 Bacteria 1939
398 Ga0207695_10615611 3300025913 Bacteria 967
399 Ga0207671_10020859 3300025914 Bacteria 4982
400 Ga0207671_10869086 3300025914 Unclassified 714
401 Ga0207693_10000083 3300025915 Bacteria 84611
402 Ga0207693_10045814 3300025915 Bacteria 3436
403 Ga0207663_10036366 3300025916 Bacteria 2962
404 Ga0207663_10365554 3300025916 Bacteria 1096
405 Ga0207660_10001933 3300025917 Bacteria 13827
406 Ga0207660_10024344 3300025917 Bacteria 4099
407 Ga0207660_10131916 3300025917 Bacteria 1902
408 Ga0207660_10169745 3300025917 Bacteria 1688
409 Ga0207662_10003138 3300025918 Bacteria 8448
410 Ga0207662_10039816 3300025918 Bacteria 2759
411 Ga0207662_10172241 3300025918 Bacteria 1388
412 Ga0207662_10331532 3300025918 Bacteria 1018
413 Ga0207657_10286473 3300025919 Bacteria 1307
414 Ga0207649_10098602 3300025920 Bacteria 1929
415 Ga0207649_10376931 3300025920 Bacteria 1056
416 Ga0207649_10934033 3300025920 Bacteria 681
417 Ga0207652_10000613 3300025921 Bacteria 35518
418 Ga0207652_10008803 3300025921 Bacteria 8128
419 Ga0207652_10127330 3300025921 Bacteria 2269
420 Ga0207652_10398702 3300025921 Bacteria 1241
421 Ga0207681_10105768 3300025923 Bacteria 2038
422 Ga0207681_10252197 3300025923 Bacteria 1378
423 Ga0207694_10041971 3300025924 Bacteria 3527
424 Ga0207694_10044756 3300025924 Bacteria 3417
425 Ga0207694_10092589 3300025924 Bacteria 2386
426 Ga0207694_10481610 3300025924 Bacteria 1038
427 Ga0207694_10830833 3300025924 Bacteria 781
428 Ga0207694_10846327 3300025924 Unclassified 773
429 Ga0207650_10446284 3300025925 Bacteria 1076
430 Ga0207650_10478583 3300025925 Bacteria 1039
431 Ga0207659_10006597 3300025926 Bacteria 7125
432 Ga0207659_10128580 3300025926 Bacteria 1951
433 Ga0207659_10545303 3300025926 Bacteria 985
434 Ga0207659_10566304 3300025926 Bacteria 967
435 Ga0207700_10011337 3300025928 Bacteria 5679
436 Ga0207700_10026505 3300025928 Bacteria 4042
437 Ga0207664_10013517 3300025929 Bacteria 5863
438 Ga0207664_10043030 3300025929 Bacteria 3529
439 Ga0207664_10047267 3300025929 Bacteria 3380
440 Ga0207644_10000660 3300025931 Bacteria 21820
441 Ga0207644_10174134 3300025931 Bacteria 1682
442 Ga0207706_10055844 3300025933 Bacteria 3482
443 Ga0207706_10323827 3300025933 Bacteria 1341
444 Ga0207686_10411020 3300025934 Bacteria 1033
445 Ga0207670_10019610 3300025936 Bacteria 4134
446 Ga0207670_10204666 3300025936 Bacteria 1501
447 Ga0207669_10035440 3300025937 Bacteria 2839
448 Ga0207669_10097759 3300025937 Bacteria 1931
449 Ga0207669_10319320 3300025937 Bacteria 1188
450 Ga0207704_10047013 3300025938 Bacteria 2577
451 Ga0207704_10050165 3300025938 Bacteria 2516
452 Ga0207704_10090212 3300025938 Bacteria 2010
453 Ga0207704_10151418 3300025938 Bacteria 1637
454 Ga0207704_10175278 3300025938 Bacteria 1543
455 Ga0207665_10000587 3300025939 Bacteria 24539
456 Ga0207665_10015240 3300025939 Bacteria 5049
457 Ga0207665_10141497 3300025939 Bacteria 1716
458 Ga0207691_10000808 3300025940 Bacteria 31167
459 Ga0207691_10020237 3300025940 Bacteria 6293
460 Ga0207691_10155413 3300025940 Bacteria 2009
461 Ga0207691_10269659 3300025940 Bacteria 1466
462 Ga0207711_10019836 3300025941 Bacteria 5603
463 Ga0207711_10020918 3300025941 Bacteria 5462
464 Ga0207711_10175845 3300025941 Bacteria 1945
465 Ga0207689_10006816 3300025942 Bacteria 10046
466 Ga0207689_10068790 3300025942 Bacteria 2910
467 Ga0207689_10586526 3300025942 Bacteria 937
468 Ga0207661_10393241 3300025944 Bacteria 1256
469 Ga0207661_10967791 3300025944 Unclassified 784
470 Ga0207679_10035222 3300025945 Bacteria 3539
471 Ga0207679_10255264 3300025945 Bacteria 1493
472 Ga0207679_11287257 3300025945 Unclassified 671
473 Ga0207667_10000798 3300025949 Bacteria 40876
474 Ga0207667_10004634 3300025949 Bacteria 16866
475 Ga0207667_10049362 3300025949 Bacteria 4444
476 Ga0207667_10297061 3300025949 Bacteria 1650
477 Ga0207667_10419651 3300025949 Bacteria 1361
478 Ga0207651_10012726 3300025960 Bacteria 4777
479 Ga0207651_10021532 3300025960 Bacteria 3921
480 Ga0207651_10044659 3300025960 Bacteria 2967
481 Ga0207651_10130569 3300025960 Bacteria 1922
482 Ga0207651_10420972 3300025960 Bacteria 1140
483 Ga0207712_10041797 3300025961 Bacteria 3153
484 Ga0207712_10046720 3300025961 Bacteria 3003
485 Ga0207668_10044717 3300025972 Bacteria 3015
486 Ga0207668_10621621 3300025972 Bacteria 943
487 Ga0207658_10435869 3300025986 Bacteria 1158
488 Ga0207658_10768776 3300025986 Bacteria 873
489 Ga0207658_11501410 3300025986 Bacteria 616
490 Ga0207677_10044619 3300026023 Bacteria 2955
491 Ga0207677_10497306 3300026023 Bacteria 1053
492 Ga0207703_10002919 3300026035 Bacteria 14548
493 Ga0207703_10004149 3300026035 Bacteria 11947
494 Ga0207703_10071608 3300026035 Bacteria 2864
495 Ga0207703_10122843 3300026035 Bacteria 2231
496 Ga0207703_10226563 3300026035 Bacteria 1674
497 Ga0207703_10463879 3300026035 Unclassified 1185
498 Ga0207639_10174985 3300026041 Bacteria 1821
499 Ga0207639_10197304 3300026041 Bacteria 1723
500 Ga0207678_10057667 3300026067 Bacteria 3342
501 Ga0207678_10143351 3300026067 Bacteria 2039
502 Ga0207708_10126206 3300026075 Bacteria 1997
503 Ga0207708_10143037 3300026075 Bacteria 1878
504 Ga0207708_10262327 3300026075 Bacteria 1395
505 Ga0207702_10021375 3300026078 Bacteria 5357
506 Ga0207702_10024278 3300026078 Bacteria 5030
507 Ga0207702_10449937 3300026078 Bacteria 1249
508 Ga0207702_11134358 3300026078 Bacteria 776
509 Ga0207641_10000266 3300026088 Bacteria 66298
510 Ga0207641_10004267 3300026088 Bacteria 12427
511 Ga0207641_10072695 3300026088 Bacteria 2962
512 Ga0207641_10078506 3300026088 Bacteria 2859
513 Ga0207648_10011589 3300026089 Bacteria 8302
514 Ga0207648_10307452 3300026089 Bacteria 1423
515 Ga0207648_10420128 3300026089 Bacteria 1214
516 Ga0207648_10538471 3300026089 Bacteria 1071
517 Ga0207648_10550578 3300026089 Bacteria 1060
518 Ga0207676_10000965 3300026095 Bacteria 22224
519 Ga0207674_10045038 3300026116 Bacteria 4541
520 Ga0207674_10324191 3300026116 Bacteria 1490
521 Ga0207675_100001909 3300026118 Bacteria 20795
522 Ga0207675_100017235 3300026118 Bacteria 6745
523 Ga0207675_100021368 3300026118 Bacteria 6028
524 Ga0207675_100108282 3300026118 Bacteria 2621
525 Ga0207675_100262014 3300026118 Bacteria 1676
526 Ga0207683_10002455 3300026121 Bacteria 16158
527 Ga0207683_10012739 3300026121 Bacteria 7176
528 Ga0207683_10418636 3300026121 Bacteria 1234
529 Ga0207683_10988293 3300026121 Bacteria 781
530 Ga0207428_10018642 3300027907 Bacteria 5924
531 Ga0207428_10037638 3300027907 Bacteria 3935
532 Ga0207428_10053868 3300027907 Bacteria 3206
533 Ga0207428_10077052 3300027907 Bacteria 2610
534 Ga0265356_1001033 3300028017 Bacteria 4386
535 Ga0268266_10000159 3300028379 Bacteria 126969
536 Ga0268266_10004018 3300028379 Bacteria 14227
537 Ga0268266_10018604 3300028379 Bacteria 5921
538 Ga0268266_10020525 3300028379 Bacteria 5631
539 Ga0268266_10021131 3300028379 Bacteria 5545
540 Ga0268266_10021707 3300028379 Bacteria 5471
541 Ga0268266_10036776 3300028379 Bacteria 4170
542 Ga0268266_10103250 3300028379 Bacteria 2515
543 Ga0268266_10113600 3300028379 Bacteria 2402
544 Ga0268266_10229263 3300028379 Bacteria 1710
545 Ga0268266_10474874 3300028379 Bacteria 1191
546 Ga0268265_10015831 3300028380 Bacteria 5170
547 Ga0268265_10026933 3300028380 Bacteria 4096
548 Ga0268265_10085663 3300028380 Bacteria 2502
549 Ga0268265_10269110 3300028380 Bacteria 1519
550 Ga0268265_10400670 3300028380 Bacteria 1268
551 Ga0268265_10421531 3300028380 Bacteria 1239
552 Ga0268265_10486922 3300028380 Bacteria 1160
553 Ga0268265_10513957 3300028380 Bacteria 1131
554 Ga0268264_10000047 3300028381 Bacteria 349944
555 Ga0268264_10000140 3300028381 Bacteria 171592
556 Ga0268264_10037266 3300028381 Bacteria 4009
557 Ga0268264_10326291 3300028381 Bacteria 1453
558 Ga0265334_10012381 3300028573 Bacteria 3585
559 Ga0307517_10215405 3300028786 Unclassified 1176
560 Ga0307515_10001652 3300028794 Bacteria 49628
561 Ga0307515_10121290 3300028794 Bacteria 2958
562 Ga0307515_10195041 3300028794 Bacteria 1921
563 Ga0307515_10606956 3300028794 Unclassified 705
564 Ga0307511_10000268 3300030521 Bacteria 54105
565 Ga0307511_10051996 3300030521 Bacteria 3273
566 Ga0265770_1000007 3300030878 Bacteria 20558
567 Ga0265760_10005135 3300031090 Bacteria 3751
568 Ga0265760_10098769 3300031090 Bacteria 921
569 Ga0265340_10275247 3300031247 Bacteria 748
570 Ga0265339_10226767 3300031249 Bacteria 912
571 Ga0265331_10002039 3300031250 Bacteria 13998
572 Ga0307513_10049297 3300031456 Bacteria 4563
573 Ga0307513_10053175 3300031456 Bacteria 4355
574 Ga0307513_10113314 3300031456 Bacteria 2700
575 Ga0307513_10115262 3300031456 Bacteria 2670
576 Ga0307513_10181146 3300031456 Bacteria 1970
577 Ga0307509_10001396 3300031507 Bacteria 40975
578 Ga0307509_10042256 3300031507 Bacteria 4942
579 Ga0307509_10059381 3300031507 Bacteria 4047
580 Ga0307509_10643087 3300031507 Bacteria 730
581 Ga0307408_100134284 3300031548 Bacteria 1934
582 Ga0307508_10207321 3300031616 Bacteria 1561
583 Ga0316576_10051790 3300031727 Bacteria 2988
584 Ga0316576_10068868 3300031727 Bacteria 2609
585 Ga0316576_10096611 3300031727 Bacteria 2205
586 Ga0316576_10201666 3300031727 Bacteria 1499
587 Ga0316578_10431437 3300031728 Bacteria 780
588 Ga0307516_10002208 3300031730 Bacteria 26358
589 Ga0307405_10048178 3300031731 Bacteria 2627
590 Ga0307405_10620416 3300031731 Bacteria 885
591 Ga0307413_10010738 3300031824 Bacteria 4460
592 Ga0307413_10030393 3300031824 Bacteria 3034
593 Ga0307413_10254987 3300031824 Bacteria 1304
594 Ga0307413_10282177 3300031824 Bacteria 1250
595 Ga0307410_10006032 3300031852 Bacteria 6496
596 Ga0307410_10111930 3300031852 Bacteria 1976
597 Ga0307406_10010319 3300031901 Bacteria 5264
598 Ga0307406_10220386 3300031901 Bacteria 1410
599 Ga0307406_10271691 3300031901 Bacteria 1288
600 Ga0307406_10609286 3300031901 Bacteria 901
601 Ga0307406_10859982 3300031901 Bacteria 769
602 Ga0307407_10015668 3300031903 Bacteria 3756
603 Ga0307407_10041476 3300031903 Bacteria 2574
604 Ga0307412_10286848 3300031911 Bacteria 1295
605 Ga0307412_10691078 3300031911 Bacteria 875
606 Ga0307412_11447345 3300031911 Bacteria 623
607 Ga0307409_100189418 3300031995 Bacteria 1830
608 Ga0307409_100427238 3300031995 Bacteria 1272
609 Ga0307409_100677127 3300031995 Bacteria 1028
610 Ga0307416_100192517 3300032002 Bacteria 1925
611 Ga0307416_100368594 3300032002 Bacteria 1461
612 Ga0307416_100458569 3300032002 Bacteria 1329
613 Ga0307416_101119484 3300032002 Bacteria 892
614 Ga0307416_102014556 3300032002 Bacteria 680
615 Ga0307414_10459409 3300032004 Bacteria 1119
616 Ga0307414_11059891 3300032004 Bacteria 748
617 Ga0307411_10014764 3300032005 Bacteria 4359
618 Ga0307411_10078816 3300032005 Bacteria 2259
619 Ga0307411_10160080 3300032005 Bacteria 1685
620 Ga0307411_10272327 3300032005 Bacteria 1343
621 Ga0307411_10399134 3300032005 Bacteria 1136
622 Ga0307411_10544499 3300032005 Bacteria 989
623 Ga0307411_10763428 3300032005 Unclassified 848
624 Ga0307411_11100196 3300032005 Bacteria 716
625 Ga0307411_11380182 3300032005 Bacteria 644
626 Ga0307415_100061002 3300032126 Bacteria 2609
627 Ga0307415_100115502 3300032126 Bacteria 2001
628 Ga0307415_100171048 3300032126 Bacteria 1694
629 Ga0307415_100180680 3300032126 Bacteria 1655
630 Ga0307415_100511231 3300032126 Bacteria 1052
631 Ga0307415_100534046 3300032126 Bacteria 1032
632 Ga0307415_100825375 3300032126 Bacteria 848
633 Ga0307507_10426193 3300033179 Unclassified 743
634 Ga0307510_10005539 3300033180 Bacteria 15049
635 Ga0307510_10256592 3300033180 Bacteria 1232
636 Ga0373923_0009894 3300035111 Bacteria 3454
637 Ga0373923_0077208 3300035111 Bacteria 1440
638 Ga0373936_0013613 3300035113 Bacteria 3104
639 Ga0373945_0211837 3300035116 Bacteria 808
640 Ga0373956_0164325 3300035119 Bacteria 1047
641 Ga0373957_0055727 3300035120 Bacteria 1521
642 Ga0373957_0068871 3300035120 Bacteria 1381
643 Ga0373957_0131475 3300035120 Bacteria 1019
644 Ga0373960_0077475 3300035121 Bacteria 1040
645 Ga0373943_0326457 3300035170 Bacteria 876
646 Ga0373946_0234066 3300035171 Bacteria 891
647 Ga0373955_0009251 3300035172 Bacteria 4613
648 Ga0373955_0069928 3300035172 Bacteria 1960
649 Ga0373961_0016704 3300035241 Bacteria 1894
650 Ga0373962_0115306 3300035242 Bacteria 852
651 Ga0316574_0010344 3300035398 Bacteria 5269
652 Ga0316574_0014494 3300035398 Bacteria 4557
653 Ga0316574_0016384 3300035398 Bacteria 4319
654 Ga0316574_0025283 3300035398 Bacteria 3563
655 Ga0316574_0138730 3300035398 Bacteria 1566
656 Ga0316574_0141004 3300035398 Unclassified 1553
657 Ga0316574_0264702 3300035398 Bacteria 1097
658 Ga0373931_0775174 3300035691 Bacteria 638
659 Ga0373927_0020690 3300035695 Bacteria 4315
660 Ga0373927_0269784 3300035695 Bacteria 1119
661 Ga0373933_0180346 3300035724 Bacteria 1347
662 Ga0373937_0006608 3300036401 Bacteria 10014
663 Ga0373937_0025980 3300036401 Bacteria 5289
664 Ga0373937_0088213 3300036401 Bacteria 2872
665 Ga0373937_0259964 3300036401 Bacteria 1637
666 Ga0316584_0003331 3300036712 Bacteria 10410
667 Ga0316584_0187258 3300036712 Bacteria 1531
668 Ga0436364_1238211 3300037853 Bacteria 791
669 Ga0436365_1772567 3300039437 Bacteria 10964
670 Ga0436365_1859648 3300039437 Bacteria 1448
671 Ga0436360_0066373 3300039438 Bacteria 2182
672 Ga0436360_0659686 3300039438 Bacteria 2043
673 Ga0436360_0995015 3300039438 Bacteria 3240
674 Ga0436361_0066890 3300039447 Bacteria 3227
675 Ga0436361_0251740 3300039447 Bacteria 1320
676 Ga0436363_0461713 3300039450 Bacteria 4270
677 Ga0436363_0641697 3300039450 Bacteria 6231
678 Ga0436363_1646651 3300039450 Bacteria 6351
679 Ga0436362_0815706 3300039453 Bacteria 796
680 Ga0436362_1231019 3300039453 Bacteria 1153
681 Ga0451789_0293465 3300041443 Bacteria 1492
682 Ga0451791_0653772 3300041451 Bacteria 3342
683 Ga0451793_0640635 3300041452 Bacteria 2133
684 Ga0451793_0947639 3300041452 Bacteria 869
685 Ga0451797_0966810 3300041453 Bacteria 2540
686 Ga0451800_0973983 3300041459 Bacteria 808
687 Ga0451800_1658630 3300041459 Unclassified 1312
688 Ga0451802_1934902 3300041460 Bacteria 1327
689 Ga0451802_1935343 3300041460 Bacteria 2703
690 Ga0451807_0065623 3300041486 Bacteria 5261
691 Ga0451807_2246987 3300041486 Bacteria 4233
692 Ga0451807_2285000 3300041486 Unclassified 892
693 Ga0451833_1190085 3300041491 Bacteria 1016
694 Ga0451849_1405876 3300041505 Bacteria 783
695 Ga0451851_1138035 3300041507 Bacteria 1048
696 Ga0439442_023326 3300042002 Bacteria 1286
697 Ga0439448_0113438 3300042005 Bacteria 927
698 Ga0439449_0052926 3300042007 Bacteria 1501
699 Ga0450896_037636 3300042133 Bacteria 747
700 Ga0439444_0024418 3300042437 Bacteria 1092
701 Ga0439459_0093011 3300042438 Bacteria 728
702 Ga0439464_0045734 3300042439 Bacteria 1257
703 Ga0451577_0017859 3300042876 Bacteria 6544
704 Ga0451577_0076774 3300042876 Bacteria 2978
705 Ga0451577_0158358 3300042876 Bacteria 2038
706 Ga0466969_0010650 3300044656 Bacteria 4872
707 Ga0466969_0018694 3300044656 Bacteria 3608
708 Ga0466972_0099651 3300044658 Bacteria 1375
709 Ga0453683_0071396 3300044673 Bacteria 2172
710 Ga0466965_0121950 3300044683 Bacteria 1347
711 Ga0466965_0176878 3300044683 Bacteria 1125
712 Ga0466966_0018782 3300044684 Bacteria 4554
713 Ga0466966_0211198 3300044684 Unclassified 1173
714 Ga0466966_0581404 3300044684 Bacteria 674
715 Ga0466961_0005738 3300044693 Bacteria 7854
716 Ga0466964_0017568 3300044706 Bacteria 2737
717 Ga0453684_0032214 3300044712 Bacteria 7344
718 Ga0453684_0068289 3300044712 Bacteria 4514
719 Ga0453684_0476960 3300044712 Bacteria 1384
720 Ga0453684_0934179 3300044712 Bacteria 927
721 Ga0466971_0000216 3300044719 Bacteria 22087
722 Ga0466970_0002740 3300044765 Bacteria 8508
723 Ga0466957_0001530 3300044842 Bacteria 12173
724 Ga0466960_0061910 3300044901 Bacteria 1838
725 Ga0466959_0002645 3300045049 Bacteria 11497
726 Ga0466959_0010436 3300045049 Bacteria 6641
727 Ga0466959_0014163 3300045049 Bacteria 5789
728 Ga0466959_0100728 3300045049 Bacteria 2067
729 Ga0451576_0023536 3300045051 Bacteria 6668
730 Ga0451576_0215678 3300045051 Bacteria 2004
731 Ga0451576_1038706 3300045051 Bacteria 858
732 Ga0466958_0011057 3300045836 Bacteria 5074
733 Ga0495592_0122645 3300046454 Bacteria 1826
734 Ga0495590_0026392 3300046457 Bacteria 2039
735 Ga0495591_019311 3300046458 Bacteria 2285
736 Ga0495638_0029681 3300046460 Bacteria 3526
737 Ga0495638_0042983 3300046460 Bacteria 2853
738 Ga0495638_0467349 3300046460 Unclassified 641
739 Ga0495580_0002317 3300046472 Bacteria 16600
740 Ga0495580_0011390 3300046472 Bacteria 6882
741 Ga0495580_0038431 3300046472 Bacteria 3428
742 Ga0495580_0250819 3300046472 Bacteria 1212
743 Ga0495580_0745606 3300046472 Bacteria 638
744 Ga0495582_0171548 3300046473 Bacteria 1235
745 Ga0495594_0225796 3300046499 Bacteria 1068
746 Ga0495610_0299294 3300046512 Bacteria 621
747 Ga0495616_0003520 3300046513 Bacteria 10013
748 Ga0495618_0070893 3300046514 Bacteria 2217
749 Ga0495620_0181440 3300046515 Bacteria 814
750 Ga0495632_0030336 3300046519 Bacteria 2807
751 Ga0495632_0030443 3300046519 Bacteria 2801
752 Ga0495632_0319753 3300046519 Bacteria 686
753 Ga0495644_0019850 3300046523 Bacteria 2566
754 Ga0495648_0058796 3300046524 Bacteria 2297
755 Ga0495652_0258438 3300046529 Bacteria 1287
756 Ga0495665_0044595 3300046531 Bacteria 2356
757 Ga0495586_0055117 3300046535 Bacteria 2155
758 Ga0495586_0484897 3300046535 Bacteria 713
759 Ga0495621_0024354 3300046539 Bacteria 2021
760 Ga0495621_0048158 3300046539 Bacteria 1517
761 Ga0495621_0088361 3300046539 Bacteria 1165
762 Ga0495633_0156593 3300046558 Bacteria 1051
763 Ga0495656_0054433 3300046615 Bacteria 1722
764 Ga0495668_0489013 3300046616 Bacteria 678
765 Ga0495625_0004128 3300046660 Bacteria 13860
766 Ga0495625_0056977 3300046660 Bacteria 2780
767 Ga0495625_0084823 3300046660 Bacteria 2200
768 Ga0495625_0150529 3300046660 Bacteria 1565
769 Ga0495625_0277573 3300046660 Bacteria 1079
770 Ga0495659_0160024 3300046664 Bacteria 908
771 Ga0495657_0072326 3300046675 Bacteria 2249
772 Ga0495599_0099033 3300046678 Bacteria 1817
773 Ga0495623_0061473 3300046679 Bacteria 2356
774 Ga0495647_0022229 3300046681 Bacteria 2290
775 Ga0495647_0028574 3300046681 Bacteria 2057
776 Ga0495647_0141218 3300046681 Bacteria 1027
777 Ga0495658_0010043 3300046683 Bacteria 4728
778 Ga0495658_0510274 3300046683 Bacteria 769
779 Ga0495669_0357713 3300046684 Bacteria 706
780 Ga0495649_0070992 3300046694 Bacteria 1867
781 Ga0495581_0149843 3300047315 Bacteria 1362
782 Ga0495604_0031892 3300047317 Bacteria 4178
783 Ga0495674_0449767 3300047319 Unclassified 1035
784 Ga0495672_0063383 3300047320 Bacteria 2122
785 Ga0495681_0037726 3300047470 Bacteria 2377
786 Ga0495686_0068125 3300047472 Bacteria 2196
787 Ga0495602_0035047 3300048088 Bacteria 4685
788 Ga0495626_0223542 3300048091 Unclassified 764
789 Ga0496100_0014282 3300048903 Bacteria 4607
790 Ga0496100_0924555 3300048903 Bacteria 685
791 Ga0496101_0002781 3300048904 Bacteria 10726
792 Ga0496101_0058777 3300048904 Bacteria 2786
793 Ga0496102_0004283 3300048905 Bacteria 12064
794 Ga0496102_0015204 3300048905 Bacteria 6700
795 Ga0496102_0025670 3300048905 Bacteria 5249
796 Ga0496102_0239250 3300048905 Bacteria 1712
797 Ga0496103_0054969 3300048906 Bacteria 2468
798 Ga0496103_0157107 3300048906 Bacteria 1458
799 Ga0496104_0166549 3300048907 Bacteria 2113
800 Ga0496104_0183740 3300048907 Bacteria 2001
801 Ga0496104_0205567 3300048907 Bacteria 1881
802 Ga0496105_0038751 3300048908 Bacteria 3926
803 Ga0496106_0023670 3300048909 Bacteria 4564
804 Ga0496106_0092723 3300048909 Bacteria 2333
805 Ga0496106_0131648 3300048909 Bacteria 1962
806 Ga0496106_0232287 3300048909 Bacteria 1473
807 Ga0496106_1019094 3300048909 Bacteria 651
808 Ga0496107_0014224 3300048910 Bacteria 5572
809 Ga0496107_0704523 3300048910 Bacteria 742
810 Ga0496108_0012714 3300048911 Bacteria 6856
811 Ga0496108_0578231 3300048911 Bacteria 979
812 Ga0496110_0000749 3300048913 Bacteria 22420
813 Ga0496110_0352827 3300048913 Bacteria 1340
814 Ga0496111_0007317 3300048914 Bacteria 7223
815 Ga0496112_0005843 3300048915 Bacteria 10714
816 Ga0496112_0149992 3300048915 Bacteria 2299
817 Ga0496113_0024231 3300048916 Bacteria 4310
818 Ga0496113_0034940 3300048916 Bacteria 3672
819 Ga0496114_0001864 3300048917 Bacteria 15980
820 Ga0496114_0031729 3300048917 Bacteria 4346
821 Ga0496114_0139070 3300048917 Bacteria 2101
822 Ga0496114_0546027 3300048917 Bacteria 1024
823 Ga0496115_0019186 3300048918 Bacteria 5260
824 Ga0496115_0255565 3300048918 Bacteria 1442
825 Ga0496116_0009552 3300048919 Bacteria 8261
826 Ga0496117_0000151 3300048920 Bacteria 148304
827 Ga0496117_0365928 3300048920 Bacteria 739
828 Ga0496118_0000016 3300048921 Bacteria 549586
829 Ga0496118_0053120 3300048921 Bacteria 3084
830 Ga0496118_0061427 3300048921 Bacteria 2783
831 Ga0496118_0071775 3300048921 Bacteria 2491
832 Ga0496119_0007663 3300048922 Bacteria 9669
833 Ga0496119_0026068 3300048922 Bacteria 4063
834 Ga0496120_0002631 3300048923 Bacteria 17782
835 Ga0496120_0079655 3300048923 Bacteria 1777
836 Ga0496121_0003216 3300048924 Bacteria 23498
837 Ga0496121_0062952 3300048924 Bacteria 3035
838 Ga0496121_0088943 3300048924 Bacteria 2419
839 Ga0496124_0036662 3300048927 Bacteria 4274
840 Ga0496125_0000759 3300048928 Bacteria 52858
841 Ga0496125_0015343 3300048928 Bacteria 7416
842 Ga0496125_0042383 3300048928 Bacteria 3877
843 Ga0496126_0001875 3300048929 Bacteria 30586
844 Ga0496126_0059047 3300048929 Bacteria 3455
845 Ga0501299_089863 3300049522 Bacteria 696
846 Ga0501031_0108948 3300049568 Bacteria 1809
847 Ga0501031_0189438 3300049568 Bacteria 1343
848 Ga0501032_0198951 3300049569 Bacteria 1308
849 Ga0501033_0125845 3300049570 Bacteria 1858
850 Ga0501033_0331458 3300049570 Bacteria 1068
851 Ga0501034_1339501 3300049571 Bacteria 592
852 Ga0501036_0019918 3300049572 Bacteria 5632
853 Ga0501036_0030927 3300049572 Bacteria 4524
854 Ga0501036_0314169 3300049572 Bacteria 1310
855 Ga0501037_0029609 3300049573 Bacteria 4045
856 Ga0501037_0074819 3300049573 Bacteria 2460
857 Ga0501038_0025407 3300049574 Bacteria 5280
858 Ga0501038_0110786 3300049574 Bacteria 2274
859 Ga0501039_0005021 3300049575 Bacteria 10042
860 Ga0501039_0534782 3300049575 Bacteria 920
861 Ga0501040_0001902 3300049576 Bacteria 13423
862 Ga0501040_0020637 3300049576 Bacteria 4392
863 Ga0501041_0003543 3300049577 Bacteria 8977
864 Ga0501041_0027415 3300049577 Bacteria 3432
865 Ga0501042_0020076 3300049578 Bacteria 4648
866 Ga0501042_0069390 3300049578 Bacteria 2520
867 Ga0501043_0047241 3300049579 Bacteria 3384
868 Ga0501046_0008614 3300049580 Bacteria 8870
869 Ga0501046_0065359 3300049580 Bacteria 2838
870 Ga0501046_0071635 3300049580 Bacteria 2693
871 Ga0501046_0447081 3300049580 Bacteria 930
872 Ga0501048_0031048 3300049582 Bacteria 3866
873 Ga0501048_0122126 3300049582 Bacteria 1840
874 Ga0501068_0039428 3300049584 Bacteria 2832
875 Ga0501068_0040215 3300049584 Bacteria 2806
876 Ga0501069_0069086 3300049585 Bacteria 1978
877 Ga0501070_0235381 3300049586 Bacteria 1500
878 Ga0501071_0000689 3300049587 Bacteria 17671
879 Ga0501071_0050039 3300049587 Bacteria 3009
880 Ga0501072_0002540 3300049588 Bacteria 13673
881 Ga0501072_0027868 3300049588 Bacteria 4408
882 Ga0501072_0785763 3300049588 Bacteria 746
883 Ga0501075_0003894 3300049591 Bacteria 10047
884 Ga0501076_0000782 3300049592 Bacteria 20500
885 Ga0501076_0025012 3300049592 Bacteria 4618
886 Ga0501077_0009125 3300049593 Bacteria 6158
887 Ga0501077_0069821 3300049593 Bacteria 2226
888 Ga0501209_026366 3300049656 Bacteria 1434
889 Ga0501249_007490 3300049679 Bacteria 2256
890 Ga0501257_089169 3300049686 Bacteria 801
891 Ga0501079_0001340 3300049741 Bacteria 17314
892 Ga0501079_0017298 3300049741 Bacteria 5505
893 Ga0501080_0005127 3300049742 Bacteria 11672
894 Ga0501080_0185062 3300049742 Bacteria 1915
895 Ga0501080_0839020 3300049742 Bacteria 804
896 Ga0501081_0010808 3300049743 Bacteria 5962
897 Ga0501081_0051401 3300049743 Bacteria 2842
898 Ga0501081_0544209 3300049743 Bacteria 867
899 Ga0501083_0259029 3300049744 Bacteria 1132
900 Ga0501035_0038912 3300049822 Bacteria 4306
901 Ga0501035_0052512 3300049822 Bacteria 3647
902 Ga0501044_0121003 3300049823 Bacteria 2619
903 Ga0501044_0648569 3300049823 Bacteria 945
904 Ga0501045_0000401 3300049824 Bacteria 26284
905 Ga0501045_0020016 3300049824 Bacteria 4777
906 Ga0501045_0116565 3300049824 Bacteria 1982
907 nmdc:mga05p37_1003701_c1 3300050507 Bacteria 886
908 nmdc:mga09592_139542_c1 3300050508 Bacteria 2089
909 nmdc:mga09592_79156_c1 3300050508 Bacteria 2798
910 nmdc:mga0qj67_105459_c1 3300050509 Bacteria 2274
911 nmdc:mga0qj67_119265_c1 3300050509 Bacteria 2133
912 nmdc:mga0qj67_369301_c1 3300050509 Bacteria 1159
913 nmdc:mga0qj67_441560_c1 3300050509 Bacteria 1048
914 nmdc:mga06r32_12456_c1 3300050510 Bacteria 7675
915 nmdc:mga06r32_140547_c1 3300050510 Bacteria 2390
916 nmdc:mga06r32_24616_c1 3300050510 Bacteria 5591
917 nmdc:mga06r32_259443_c1 3300050510 Bacteria 1726
918 nmdc:mga06r32_87594_c1 3300050510 Bacteria 3038
919 nmdc:mga08y16_1026529_c1 3300050511 Bacteria 803
920 nmdc:mga08y16_117632_c1 3300050511 Bacteria 2766
921 nmdc:mga08y16_1181637_c1 3300050511 Bacteria 736
922 nmdc:mga08y16_2161_c1 3300050511 Bacteria 20167
923 nmdc:mga08y16_24822_c1 3300050511 Bacteria 6325
924 nmdc:mga08y16_508240_c1 3300050511 Bacteria 1223
925 nmdc:mga08y16_66436_c1 3300050511 Bacteria 3764
926 nmdc:mga08y16_920464_c1 3300050511 Bacteria 859
927 nmdc:mga0rr50_297944_c1 3300050513 Bacteria 1348
928 nmdc:mga0rr50_430501_c1 3300050513 Bacteria 1117
929 nmdc:mga0a205_692174_c1 3300050515 Bacteria 869
930 Ga0495612_0160887 3300053078 Bacteria 980
931 Ga0495612_0352621 3300053078 Bacteria 664
932 Ga0500646_0119074 3300053090 Bacteria 847
933 Ga0500583_0051673 3300053092 Bacteria 1910
934 Ga0500583_0068826 3300053092 Bacteria 1689
935 Ga0500651_0187399 3300053093 Bacteria 1226
936 Ga0500641_0348540 3300053096 Bacteria 596
937 Ga0500660_127142 3300053100 Bacteria 1046
938 Ga0500556_0085210 3300053104 Bacteria 1200
939 Ga0500556_0095777 3300053104 Bacteria 1138
940 Ga0500562_080488 3300053108 Bacteria 881
941 Ga0500569_010238 3300053109 Bacteria 2202
942 Ga0500592_025572 3300053116 Bacteria 953
943 Ga0500595_095061 3300053119 Bacteria 859
944 Ga0500652_081380 3300053131 Bacteria 1348
945 Ga0500652_139261 3300053131 Bacteria 1010
946 Ga0500658_0008480 3300053134 Bacteria 3796
947 Ga0500559_0039884 3300053136 Bacteria 2044
948 Ga0500568_0037122 3300053139 Bacteria 1978
949 Ga0500588_0002779 3300053146 Bacteria 3617
950 Ga0500616_0000073 3300053153 Bacteria 231290
951 Ga0500622_0002406 3300053156 Bacteria 13523
952 Ga0500622_0005698 3300053156 Bacteria 7404
953 Ga0500622_0014061 3300053156 Bacteria 4302
954 Ga0500627_0073504 3300053158 Bacteria 1517
955 Ga0500630_043962 3300053159 Bacteria 2174
956 Ga0500633_0092643 3300053160 Bacteria 1105
957 Ga0500633_0133288 3300053160 Bacteria 928
958 Ga0500636_0101843 3300053177 Bacteria 1632
959 Ga0500637_0000126 3300053178 Bacteria 27714
960 Ga0501084_0120250 3300054114 Bacteria 2208
961 Ga0501084_0321710 3300054114 Bacteria 1306
962 Ga0501082_0006995 3300060353 Bacteria 9738
963 Ga0466962_0038104 3300061719 Bacteria 2302
964 Ga0530510_0018068 3300061734 Bacteria 4998
965 Ga0530510_0034834 3300061734 Bacteria 3627

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0947639 Ga0451793_0947639_119_685 171
2 3300005340 Ga0070689_100641499 Ga0070689_1006414992 178
3 3300005367 Ga0070667_100022143 Ga0070667_1000221433 178
4 3300005458 Ga0070681_10001577 Ga0070681_1000157710 180
5 3300005530 Ga0070679_100116286 Ga0070679_1001162862 180
6 3300005834 Ga0068851_10179076 Ga0068851_101790762 180
7 3300009174 Ga0105241_10940212 Ga0105241_109402122 180
8 3300013296 Ga0157374_10032183 Ga0157374_100321833 180
9 3300025912 Ga0207707_10054459 Ga0207707_100544593 180
10 3300025921 Ga0207652_10127330 Ga0207652_101273302 180
11 3300031727 Ga0316576_10096611 Ga0316576_100966112 180
12 3300031728 Ga0316578_10431437 Ga0316578_104314371 180
13 3300035398 Ga0316574_0138730 Ga0316574_0138730_329_871 180
14 3300005458 Ga0070681_10015379 Ga0070681_100153795 181
15 3300005458 Ga0070681_10048512 Ga0070681_100485123 181
16 3300005530 Ga0070679_100000469 Ga0070679_1000004698 181
17 3300005530 Ga0070679_100155886 Ga0070679_1001558862 181
18 3300005535 Ga0070684_100513922 Ga0070684_1005139222 181
19 3300005539 Ga0068853_100286241 Ga0068853_1002862412 181
20 3300005539 Ga0068853_100526451 Ga0068853_1005264511 181
21 3300005563 Ga0068855_100001482 Ga0068855_10000148224 181
22 3300005563 Ga0068855_100094225 Ga0068855_1000942253 181
23 3300005614 Ga0068856_100529173 Ga0068856_1005291732 181
24 3300009093 Ga0105240_10002705 Ga0105240_100027059 181
25 3300009093 Ga0105240_10019061 Ga0105240_100190613 181
26 3300009551 Ga0105238_10005376 Ga0105238_100053762 181
27 3300009551 Ga0105238_10406644 Ga0105238_104066441 181
28 3300010375 Ga0105239_10233748 Ga0105239_102337482 181
29 3300013104 Ga0157370_10001472 Ga0157370_100014725 181
30 3300013104 Ga0157370_10263999 Ga0157370_102639992 181
31 3300013105 Ga0157369_10000841 Ga0157369_100008415 181
32 3300013105 Ga0157369_10068740 Ga0157369_100687402 181
33 3300025912 Ga0207707_10000122 Ga0207707_1000012228 181
34 3300025912 Ga0207707_10014611 Ga0207707_100146112 181
35 3300025913 Ga0207695_10003540 Ga0207695_1000354018 181
36 3300025913 Ga0207695_10032858 Ga0207695_100328582 181
37 3300025917 Ga0207660_10001933 Ga0207660_1000193311 181
38 3300025921 Ga0207652_10000613 Ga0207652_1000061321 181
39 3300025921 Ga0207652_10398702 Ga0207652_103987022 181
40 3300025924 Ga0207694_10044756 Ga0207694_100447562 181
41 3300025949 Ga0207667_10000798 Ga0207667_1000079823 181
42 3300025949 Ga0207667_10049362 Ga0207667_100493622 181
43 3300026078 Ga0207702_10449937 Ga0207702_104499372 181
44 2010549000 RicEn_C9875 RicEn_172490 182
45 2162886007 SwRhRL2b_contig_2220656 SwRhRL2b_0475.00005270 182
46 3300003316 rootH1_10101733 rootH1_101017333 182
47 3300003320 rootH2_10016870 rootH2_100168702 182
48 3300003323 rootH1_10033537 rootH1_100335372 182
49 3300005289 Ga0065704_10011697 Ga0065704_100116972 182
50 3300005290 Ga0065712_10070294 Ga0065712_100702945 182
51 3300005293 Ga0065715_10136644 Ga0065715_101366442 182
52 3300005328 Ga0070676_10111192 Ga0070676_101111922 182
53 3300005329 Ga0070683_100509493 Ga0070683_1005094932 182
54 3300005330 Ga0070690_100012452 Ga0070690_1000124522 182
55 3300005330 Ga0070690_100034482 Ga0070690_1000344822 182
56 3300005330 Ga0070690_100442761 Ga0070690_1004427611 182
57 3300005330 Ga0070690_101014645 Ga0070690_1010146451 182
58 3300005331 Ga0070670_100150538 Ga0070670_1001505381 182
59 3300005331 Ga0070670_100176738 Ga0070670_1001767382 182
60 3300005333 Ga0070677_10246646 Ga0070677_102466462 182
61 3300005334 Ga0068869_100387362 Ga0068869_1003873622 182
62 3300005335 Ga0070666_10084334 Ga0070666_100843342 182
63 3300005335 Ga0070666_10160843 Ga0070666_101608432 182
64 3300005336 Ga0070680_100005497 Ga0070680_1000054976 182
65 3300005336 Ga0070680_100169769 Ga0070680_1001697692 182
66 3300005336 Ga0070680_100232785 Ga0070680_1002327852 182
67 3300005337 Ga0070682_100197138 Ga0070682_1001971382 182
68 3300005337 Ga0070682_100380023 Ga0070682_1003800231 182
69 3300005337 Ga0070682_100579687 Ga0070682_1005796871 182
70 3300005338 Ga0068868_100028250 Ga0068868_1000282503 182
71 3300005340 Ga0070689_100002266 Ga0070689_1000022669 182
72 3300005340 Ga0070689_100003597 Ga0070689_1000035977 182
73 3300005341 Ga0070691_10107204 Ga0070691_101072042 182
74 3300005343 Ga0070687_100274690 Ga0070687_1002746901 182
75 3300005343 Ga0070687_100779705 Ga0070687_1007797051 182
76 3300005343 Ga0070687_100883988 Ga0070687_1008839881 182
77 3300005344 Ga0070661_100070943 Ga0070661_1000709432 182
78 3300005344 Ga0070661_100694517 Ga0070661_1006945172 182
79 3300005347 Ga0070668_100107972 Ga0070668_1001079722 182
80 3300005353 Ga0070669_100176852 Ga0070669_1001768522 182
81 3300005353 Ga0070669_100320947 Ga0070669_1003209472 182
82 3300005354 Ga0070675_100001269 Ga0070675_10000126918 182
83 3300005354 Ga0070675_100187299 Ga0070675_1001872992 182
84 3300005354 Ga0070675_100444151 Ga0070675_1004441511 182
85 3300005354 Ga0070675_100457919 Ga0070675_1004579192 182
86 3300005355 Ga0070671_100000657 Ga0070671_1000006579 182
87 3300005355 Ga0070671_100110753 Ga0070671_1001107532 182
88 3300005364 Ga0070673_100020159 Ga0070673_1000201594 182
89 3300005364 Ga0070673_100092132 Ga0070673_1000921322 182
90 3300005364 Ga0070673_100173114 Ga0070673_1001731142 182
91 3300005364 Ga0070673_100364754 Ga0070673_1003647542 182
92 3300005364 Ga0070673_100548881 Ga0070673_1005488812 182
93 3300005365 Ga0070688_100005304 Ga0070688_1000053047 182
94 3300005367 Ga0070667_100037857 Ga0070667_1000378574 182
95 3300005367 Ga0070667_100296137 Ga0070667_1002961372 182
96 3300005434 Ga0070709_10116089 Ga0070709_101160892 182
97 3300005434 Ga0070709_10156402 Ga0070709_101564022 182
98 3300005434 Ga0070709_10789025 Ga0070709_107890252 182
99 3300005435 Ga0070714_100004027 Ga0070714_1000040276 182
100 3300005435 Ga0070714_100058875 Ga0070714_1000588752 182
101 3300005435 Ga0070714_100263841 Ga0070714_1002638412 182
102 3300005436 Ga0070713_100003765 Ga0070713_1000037653 182
103 3300005436 Ga0070713_100004406 Ga0070713_10000440610 182
104 3300005436 Ga0070713_100112568 Ga0070713_1001125681 182
105 3300005436 Ga0070713_100231427 Ga0070713_1002314271 182
106 3300005437 Ga0070710_10002005 Ga0070710_100020056 182
107 3300005437 Ga0070710_10102895 Ga0070710_101028952 182
108 3300005437 Ga0070710_10987364 Ga0070710_109873641 182
109 3300005438 Ga0070701_10024998 Ga0070701_100249981 182
110 3300005438 Ga0070701_10205419 Ga0070701_102054192 182
111 3300005438 Ga0070701_10227177 Ga0070701_102271771 182
112 3300005439 Ga0070711_100062958 Ga0070711_1000629583 182
113 3300005439 Ga0070711_100135726 Ga0070711_1001357261 182
114 3300005440 Ga0070705_100005025 Ga0070705_1000050254 182
115 3300005440 Ga0070705_100141213 Ga0070705_1001412132 182
116 3300005440 Ga0070705_101001623 Ga0070705_1010016231 182
117 3300005441 Ga0070700_100179598 Ga0070700_1001795982 182
118 3300005441 Ga0070700_100195867 Ga0070700_1001958672 182
119 3300005441 Ga0070700_100246164 Ga0070700_1002461642 182
120 3300005444 Ga0070694_100039533 Ga0070694_1000395333 182
121 3300005444 Ga0070694_100257513 Ga0070694_1002575132 182
122 3300005444 Ga0070694_100289354 Ga0070694_1002893542 182
123 3300005455 Ga0070663_100628945 Ga0070663_1006289451 182
124 3300005455 Ga0070663_100828828 Ga0070663_1008288282 182
125 3300005455 Ga0070663_101623125 Ga0070663_1016231251 182
126 3300005456 Ga0070678_100001882 Ga0070678_1000018827 182
127 3300005456 Ga0070678_101182414 Ga0070678_1011824141 182
128 3300005456 Ga0070678_101341327 Ga0070678_1013413271 182
129 3300005457 Ga0070662_100106771 Ga0070662_1001067712 182
130 3300005457 Ga0070662_100121887 Ga0070662_1001218872 182
131 3300005458 Ga0070681_10000738 Ga0070681_1000073812 182
132 3300005458 Ga0070681_10024230 Ga0070681_100242308 182
133 3300005458 Ga0070681_10049548 Ga0070681_100495484 182
134 3300005458 Ga0070681_10141489 Ga0070681_101414892 182
135 3300005458 Ga0070681_10740875 Ga0070681_107408751 182
136 3300005459 Ga0068867_100012777 Ga0068867_1000127773 182
137 3300005459 Ga0068867_100047736 Ga0068867_1000477362 182
138 3300005459 Ga0068867_100179522 Ga0068867_1001795222 182
139 3300005466 Ga0070685_10002528 Ga0070685_100025286 182
140 3300005466 Ga0070685_10083125 Ga0070685_100831252 182
141 3300005466 Ga0070685_10480368 Ga0070685_104803682 182
142 3300005467 Ga0070706_100293187 Ga0070706_1002931872 182
143 3300005518 Ga0070699_100022483 Ga0070699_1000224832 182
144 3300005518 Ga0070699_101116196 Ga0070699_1011161961 182
145 3300005530 Ga0070679_100005515 Ga0070679_1000055158 182
146 3300005530 Ga0070679_100087639 Ga0070679_1000876393 182
147 3300005530 Ga0070679_101525989 Ga0070679_1015259891 182
148 3300005535 Ga0070684_100575395 Ga0070684_1005753952 182
149 3300005539 Ga0068853_100250645 Ga0068853_1002506452 182
150 3300005539 Ga0068853_100570492 Ga0068853_1005704922 182
151 3300005543 Ga0070672_100027580 Ga0070672_1000275803 182
152 3300005543 Ga0070672_100029661 Ga0070672_1000296613 182
153 3300005543 Ga0070672_100054834 Ga0070672_1000548342 182
154 3300005543 Ga0070672_100167369 Ga0070672_1001673692 182
155 3300005543 Ga0070672_100530695 Ga0070672_1005306952 182
156 3300005544 Ga0070686_100002735 Ga0070686_1000027352 182
157 3300005545 Ga0070695_100009460 Ga0070695_1000094602 182
158 3300005546 Ga0070696_100020484 Ga0070696_1000204842 182
159 3300005546 Ga0070696_100092350 Ga0070696_1000923502 182
160 3300005547 Ga0070693_100040423 Ga0070693_1000404232 182
161 3300005547 Ga0070693_100287006 Ga0070693_1002870062 182
162 3300005548 Ga0070665_100000543 Ga0070665_10000054310 182
163 3300005548 Ga0070665_100006529 Ga0070665_1000065296 182
164 3300005548 Ga0070665_100009640 Ga0070665_1000096409 182
165 3300005548 Ga0070665_100029937 Ga0070665_1000299372 182
166 3300005548 Ga0070665_100032219 Ga0070665_1000322192 182
167 3300005548 Ga0070665_100053459 Ga0070665_1000534593 182
168 3300005548 Ga0070665_100107978 Ga0070665_1001079783 182
169 3300005548 Ga0070665_100341674 Ga0070665_1003416742 182
170 3300005548 Ga0070665_100391338 Ga0070665_1003913382 182
171 3300005549 Ga0070704_100053103 Ga0070704_1000531032 182
172 3300005549 Ga0070704_100405079 Ga0070704_1004050792 182
173 3300005563 Ga0068855_100001838 Ga0068855_10000183817 182
174 3300005563 Ga0068855_100169063 Ga0068855_1001690632 182
175 3300005563 Ga0068855_100318422 Ga0068855_1003184222 182
176 3300005564 Ga0070664_100276073 Ga0070664_1002760732 182
177 3300005564 Ga0070664_100966490 Ga0070664_1009664901 182
178 3300005577 Ga0068857_100035066 Ga0068857_1000350664 182
179 3300005577 Ga0068857_100154869 Ga0068857_1001548692 182
180 3300005577 Ga0068857_100223179 Ga0068857_1002231792 182
181 3300005578 Ga0068854_100446984 Ga0068854_1004469841 182
182 3300005614 Ga0068856_100004498 Ga0068856_10000449812 182
183 3300005614 Ga0068856_100546507 Ga0068856_1005465072 182
184 3300005614 Ga0068856_100626688 Ga0068856_1006266881 182
185 3300005614 Ga0068856_100832996 Ga0068856_1008329962 182
186 3300005615 Ga0070702_100006702 Ga0070702_1000067024 182
187 3300005615 Ga0070702_100009527 Ga0070702_1000095274 182
188 3300005616 Ga0068852_100366968 Ga0068852_1003669682 182
189 3300005616 Ga0068852_100439742 Ga0068852_1004397422 182
190 3300005617 Ga0068859_100000929 Ga0068859_1000009298 182
191 3300005617 Ga0068859_100009204 Ga0068859_1000092045 182
192 3300005617 Ga0068859_100125227 Ga0068859_1001252273 182
193 3300005617 Ga0068859_100228640 Ga0068859_1002286402 182
194 3300005617 Ga0068859_100354535 Ga0068859_1003545352 182
195 3300005617 Ga0068859_102080647 Ga0068859_1020806471 182
196 3300005618 Ga0068864_100004892 Ga0068864_10000489211 182
197 3300005718 Ga0068866_10137770 Ga0068866_101377702 182
198 3300005719 Ga0068861_100001663 Ga0068861_1000016632 182
199 3300005719 Ga0068861_100002156 Ga0068861_1000021565 182
200 3300005719 Ga0068861_100012276 Ga0068861_1000122766 182
201 3300005719 Ga0068861_100036200 Ga0068861_1000362002 182
202 3300005719 Ga0068861_100226488 Ga0068861_1002264882 182
203 3300005719 Ga0068861_101289985 Ga0068861_1012899851 182
204 3300005840 Ga0068870_10134943 Ga0068870_101349432 182
205 3300005841 Ga0068863_100001099 Ga0068863_10000109921 182
206 3300005841 Ga0068863_100048854 Ga0068863_1000488541 182
207 3300005841 Ga0068863_100060367 Ga0068863_1000603673 182
208 3300005841 Ga0068863_100414724 Ga0068863_1004147242 182
209 3300005841 Ga0068863_100469460 Ga0068863_1004694601 182
210 3300005841 Ga0068863_100500360 Ga0068863_1005003601 182
211 3300005842 Ga0068858_100002788 Ga0068858_1000027882 182
212 3300005842 Ga0068858_100024983 Ga0068858_1000249834 182
213 3300005842 Ga0068858_100029209 Ga0068858_1000292092 182
214 3300005842 Ga0068858_100029595 Ga0068858_1000295955 182
215 3300005842 Ga0068858_100110818 Ga0068858_1001108183 182
216 3300005842 Ga0068858_100253828 Ga0068858_1002538282 182
217 3300005843 Ga0068860_100002907 Ga0068860_10000290711 182
218 3300005843 Ga0068860_100055609 Ga0068860_1000556093 182
219 3300005843 Ga0068860_100171261 Ga0068860_1001712612 182
220 3300005844 Ga0068862_100013694 Ga0068862_1000136944 182
221 3300005844 Ga0068862_100024285 Ga0068862_1000242855 182
222 3300005844 Ga0068862_100158654 Ga0068862_1001586542 182
223 3300005844 Ga0068862_100162582 Ga0068862_1001625822 182
224 3300005844 Ga0068862_101006079 Ga0068862_1010060791 182
225 3300005937 Ga0081455_10016058 Ga0081455_100160582 182
226 3300005985 Ga0081539_10000028 Ga0081539_10000028246 182
227 3300006028 Ga0070717_10044415 Ga0070717_100444153 182
228 3300006058 Ga0075432_10048877 Ga0075432_100488772 182
229 3300006163 Ga0070715_10000714 Ga0070715_100007148 182
230 3300006173 Ga0070716_100007820 Ga0070716_1000078202 182
231 3300006173 Ga0070716_100342283 Ga0070716_1003422832 182
232 3300006175 Ga0070712_100000750 Ga0070712_10000075015 182
233 3300006175 Ga0070712_100082000 Ga0070712_1000820002 182
234 3300006237 Ga0097621_100072320 Ga0097621_1000723202 182
235 3300006237 Ga0097621_100114721 Ga0097621_1001147212 182
236 3300006237 Ga0097621_100126691 Ga0097621_1001266912 182
237 3300006237 Ga0097621_100141911 Ga0097621_1001419112 182
238 3300006237 Ga0097621_100564154 Ga0097621_1005641542 182
239 3300006358 Ga0068871_100062807 Ga0068871_1000628073 182
240 3300006358 Ga0068871_100094236 Ga0068871_1000942362 182
241 3300006358 Ga0068871_100415797 Ga0068871_1004157972 182
242 3300006358 Ga0068871_100544488 Ga0068871_1005444882 182
243 3300006358 Ga0068871_100654374 Ga0068871_1006543742 182
244 3300006844 Ga0075428_100002070 Ga0075428_10000207019 182
245 3300006844 Ga0075428_100004658 Ga0075428_10000465815 182
246 3300006844 Ga0075428_100012224 Ga0075428_1000122248 182
247 3300006844 Ga0075428_100038164 Ga0075428_1000381645 182
248 3300006844 Ga0075428_100380745 Ga0075428_1003807452 182
249 3300006846 Ga0075430_100075385 Ga0075430_1000753852 182
250 3300006846 Ga0075430_100336650 Ga0075430_1003366502 182
251 3300006847 Ga0075431_100000030 Ga0075431_1000000303 182
252 3300006847 Ga0075431_100018484 Ga0075431_1000184847 182
253 3300006847 Ga0075431_100256976 Ga0075431_1002569762 182
254 3300006871 Ga0075434_100551957 Ga0075434_1005519572 182
255 3300006880 Ga0075429_100006776 Ga0075429_1000067769 182
256 3300006880 Ga0075429_100100005 Ga0075429_1001000052 182
257 3300006880 Ga0075429_100107637 Ga0075429_1001076372 182
258 3300006880 Ga0075429_100679284 Ga0075429_1006792841 182
259 3300006880 Ga0075429_101278567 Ga0075429_1012785671 182
260 3300006881 Ga0068865_100005989 Ga0068865_1000059897 182
261 3300006881 Ga0068865_100032027 Ga0068865_1000320273 182
262 3300006881 Ga0068865_100154253 Ga0068865_1001542532 182
263 3300006881 Ga0068865_100256914 Ga0068865_1002569142 182
264 3300006931 Ga0097620_100000929 Ga0097620_1000009298 182
265 3300006931 Ga0097620_100009203 Ga0097620_1000092035 182
266 3300006931 Ga0097620_100125225 Ga0097620_1001252253 182
267 3300006931 Ga0097620_100228650 Ga0097620_1002286502 182
268 3300006931 Ga0097620_100354551 Ga0097620_1003545512 182
269 3300006931 Ga0097620_102080195 Ga0097620_1020801951 182
270 3300007076 Ga0075435_100389863 Ga0075435_1003898632 182
271 3300007076 Ga0075435_100609771 Ga0075435_1006097712 182
272 3300007265 Ga0099794_10011136 Ga0099794_100111362 182
273 3300007265 Ga0099794_10021256 Ga0099794_100212562 182
274 3300007788 Ga0099795_10037368 Ga0099795_100373682 182
275 3300009093 Ga0105240_10002127 Ga0105240_1000212716 182
276 3300009093 Ga0105240_10009513 Ga0105240_100095138 182
277 3300009093 Ga0105240_10043180 Ga0105240_100431802 182
278 3300009093 Ga0105240_10062866 Ga0105240_100628663 182
279 3300009093 Ga0105240_10268433 Ga0105240_102684332 182
280 3300009093 Ga0105240_10578905 Ga0105240_105789052 182
281 3300009093 Ga0105240_10779600 Ga0105240_107796002 182
282 3300009093 Ga0105240_11130489 Ga0105240_111304892 182
283 3300009094 Ga0111539_10009762 Ga0111539_100097628 182
284 3300009094 Ga0111539_10065955 Ga0111539_100659552 182
285 3300009094 Ga0111539_10168629 Ga0111539_101686292 182
286 3300009094 Ga0111539_10233281 Ga0111539_102332812 182
287 3300009094 Ga0111539_10284440 Ga0111539_102844402 182
288 3300009094 Ga0111539_10498440 Ga0111539_104984402 182
289 3300009094 Ga0111539_10704175 Ga0111539_107041752 182
290 3300009094 Ga0111539_11374338 Ga0111539_113743381 182
291 3300009098 Ga0105245_10019110 Ga0105245_100191104 182
292 3300009098 Ga0105245_10541684 Ga0105245_105416843 182
293 3300009101 Ga0105247_10000390 Ga0105247_1000039035 182
294 3300009101 Ga0105247_10008064 Ga0105247_100080643 182
295 3300009101 Ga0105247_10065548 Ga0105247_100655482 182
296 3300009101 Ga0105247_10434298 Ga0105247_104342982 182
297 3300009147 Ga0114129_10153233 Ga0114129_101532333 182
298 3300009147 Ga0114129_10272428 Ga0114129_102724282 182
299 3300009147 Ga0114129_10939058 Ga0114129_109390582 182
300 3300009148 Ga0105243_10102731 Ga0105243_101027313 182
301 3300009148 Ga0105243_10168742 Ga0105243_101687422 182
302 3300009148 Ga0105243_10391033 Ga0105243_103910331 182
303 3300009148 Ga0105243_11630474 Ga0105243_116304741 182
304 3300009174 Ga0105241_10034500 Ga0105241_100345005 182
305 3300009174 Ga0105241_10473736 Ga0105241_104737362 182
306 3300009174 Ga0105241_10541193 Ga0105241_105411932 182
307 3300009176 Ga0105242_10006693 Ga0105242_100066939 182
308 3300009176 Ga0105242_10019979 Ga0105242_100199793 182
309 3300009176 Ga0105242_10648072 Ga0105242_106480722 182
310 3300009177 Ga0105248_10001404 Ga0105248_100014042 182
311 3300009177 Ga0105248_10010920 Ga0105248_100109206 182
312 3300009177 Ga0105248_10030432 Ga0105248_100304326 182
313 3300009177 Ga0105248_10075402 Ga0105248_100754023 182
314 3300009177 Ga0105248_11171076 Ga0105248_111710762 182
315 3300009177 Ga0105248_11812101 Ga0105248_118121011 182
316 3300009545 Ga0105237_10007658 Ga0105237_1000765810 182
317 3300009545 Ga0105237_10162994 Ga0105237_101629942 182
318 3300009545 Ga0105237_10217056 Ga0105237_102170562 182
319 3300009545 Ga0105237_10793924 Ga0105237_107939241 182
320 3300009551 Ga0105238_10078897 Ga0105238_100788973 182
321 3300009551 Ga0105238_10131609 Ga0105238_101316091 182
322 3300009551 Ga0105238_10486809 Ga0105238_104868092 182
323 3300009551 Ga0105238_10947601 Ga0105238_109476012 182
324 3300009553 Ga0105249_10036444 Ga0105249_100364442 182
325 3300009553 Ga0105249_10073971 Ga0105249_100739712 182
326 3300009553 Ga0105249_10186168 Ga0105249_101861682 182
327 3300009553 Ga0105249_10349425 Ga0105249_103494252 182
328 3300009553 Ga0105249_10459195 Ga0105249_104591952 182
329 3300009553 Ga0105249_10559372 Ga0105249_105593722 182
330 3300010159 Ga0099796_10004014 Ga0099796_100040142 182
331 3300010159 Ga0099796_10027107 Ga0099796_100271072 182
332 3300010375 Ga0105239_10019263 Ga0105239_100192636 182
333 3300010375 Ga0105239_11375874 Ga0105239_113758741 182
334 3300011119 Ga0105246_10333158 Ga0105246_103331582 182
335 3300011119 Ga0105246_10836110 Ga0105246_108361102 182
336 3300013105 Ga0157369_10102450 Ga0157369_101024502 182
337 3300013105 Ga0157369_11025486 Ga0157369_110254861 182
338 3300013296 Ga0157374_11018673 Ga0157374_110186732 182
339 3300013296 Ga0157374_11110920 Ga0157374_111109202 182
340 3300013297 Ga0157378_10019771 Ga0157378_100197712 182
341 3300013306 Ga0163162_10080582 Ga0163162_100805823 182
342 3300013306 Ga0163162_10598608 Ga0163162_105986081 182
343 3300013306 Ga0163162_10608667 Ga0163162_106086672 182
344 3300013306 Ga0163162_10892668 Ga0163162_108926682 182
345 3300013307 Ga0157372_10473686 Ga0157372_104736862 182
346 3300013308 Ga0157375_10007357 Ga0157375_100073579 182
347 3300013308 Ga0157375_10052757 Ga0157375_100527573 182
348 3300013308 Ga0157375_10094100 Ga0157375_100941003 182
349 3300013308 Ga0157375_10465439 Ga0157375_104654392 182
350 3300013308 Ga0157375_12095973 Ga0157375_120959731 182
351 3300014325 Ga0163163_10003787 Ga0163163_100037875 182
352 3300014325 Ga0163163_10109595 Ga0163163_101095953 182
353 3300014325 Ga0163163_10426054 Ga0163163_104260542 182
354 3300014325 Ga0163163_10444905 Ga0163163_104449052 182
355 3300014326 Ga0157380_10000110 Ga0157380_1000011018 182
356 3300014326 Ga0157380_10121662 Ga0157380_101216622 182
357 3300014326 Ga0157380_10182007 Ga0157380_101820072 182
358 3300014326 Ga0157380_10288471 Ga0157380_102884712 182
359 3300014326 Ga0157380_10752052 Ga0157380_107520522 182
360 3300014326 Ga0157380_11600129 Ga0157380_116001291 182
361 3300014745 Ga0157377_10289230 Ga0157377_102892302 182
362 3300014745 Ga0157377_10686463 Ga0157377_106864631 182
363 3300014968 Ga0157379_10020721 Ga0157379_100207212 182
364 3300014968 Ga0157379_10029861 Ga0157379_100298612 182
365 3300014968 Ga0157379_10063423 Ga0157379_100634233 182
366 3300014968 Ga0157379_10254981 Ga0157379_102549812 182
367 3300014968 Ga0157379_10276329 Ga0157379_102763291 182
368 3300014968 Ga0157379_10373013 Ga0157379_103730132 182
369 3300014969 Ga0157376_10144586 Ga0157376_101445862 182
370 3300014969 Ga0157376_10150207 Ga0157376_101502072 182
371 3300014969 Ga0157376_10290937 Ga0157376_102909372 182
372 3300014969 Ga0157376_10553980 Ga0157376_105539802 182
373 3300017792 Ga0163161_10131136 Ga0163161_101311361 182
374 3300017792 Ga0163161_10197194 Ga0163161_101971941 182
375 3300021377 Ga0213874_10003273 Ga0213874_100032731 182
376 3300021377 Ga0213874_10015214 Ga0213874_100152142 182
377 3300021384 Ga0213876_10063757 Ga0213876_100637572 182
378 3300025893 Ga0207682_10003425 Ga0207682_100034255 182
379 3300025893 Ga0207682_10010135 Ga0207682_100101352 182
380 3300025898 Ga0207692_10119187 Ga0207692_101191872 182
381 3300025898 Ga0207692_10322806 Ga0207692_103228062 182
382 3300025899 Ga0207642_10056367 Ga0207642_100563672 182
383 3300025899 Ga0207642_10605368 Ga0207642_106053681 182
384 3300025900 Ga0207710_10000349 Ga0207710_100003497 182
385 3300025900 Ga0207710_10039830 Ga0207710_100398302 182
386 3300025901 Ga0207688_10073680 Ga0207688_100736802 182
387 3300025903 Ga0207680_10009849 Ga0207680_100098491 182
388 3300025903 Ga0207680_10024115 Ga0207680_100241155 182
389 3300025903 Ga0207680_10036291 Ga0207680_100362913 182
390 3300025903 Ga0207680_10315088 Ga0207680_103150882 182
391 3300025905 Ga0207685_10010026 Ga0207685_100100262 182
392 3300025906 Ga0207699_10017383 Ga0207699_100173832 182
393 3300025906 Ga0207699_10067788 Ga0207699_100677882 182
394 3300025906 Ga0207699_10094380 Ga0207699_100943802 182
395 3300025906 Ga0207699_10122333 Ga0207699_101223332 182
396 3300025906 Ga0207699_10279916 Ga0207699_102799162 182
397 3300025907 Ga0207645_10054717 Ga0207645_100547172 182
398 3300025907 Ga0207645_10063416 Ga0207645_100634163 182
399 3300025907 Ga0207645_10716960 Ga0207645_107169601 182
400 3300025908 Ga0207643_10046737 Ga0207643_100467372 182
401 3300025911 Ga0207654_10037130 Ga0207654_100371302 182
402 3300025912 Ga0207707_10001614 Ga0207707_1000161411 182
403 3300025912 Ga0207707_10025599 Ga0207707_100255993 182
404 3300025912 Ga0207707_10083736 Ga0207707_100837362 182
405 3300025913 Ga0207695_10045635 Ga0207695_100456351 182
406 3300025913 Ga0207695_10051308 Ga0207695_100513082 182
407 3300025913 Ga0207695_10070636 Ga0207695_100706363 182
408 3300025913 Ga0207695_10094832 Ga0207695_100948322 182
409 3300025913 Ga0207695_10195446 Ga0207695_101954463 182
410 3300025913 Ga0207695_10615611 Ga0207695_106156112 182
411 3300025914 Ga0207671_10020859 Ga0207671_100208595 182
412 3300025914 Ga0207671_10869086 Ga0207671_108690861 182
413 3300025915 Ga0207693_10000083 Ga0207693_1000008334 182
414 3300025915 Ga0207693_10045814 Ga0207693_100458142 182
415 3300025916 Ga0207663_10036366 Ga0207663_100363662 182
416 3300025916 Ga0207663_10365554 Ga0207663_103655542 182
417 3300025917 Ga0207660_10024344 Ga0207660_100243443 182
418 3300025917 Ga0207660_10131916 Ga0207660_101319162 182
419 3300025917 Ga0207660_10169745 Ga0207660_101697452 182
420 3300025918 Ga0207662_10003138 Ga0207662_100031388 182
421 3300025918 Ga0207662_10039816 Ga0207662_100398163 182
422 3300025918 Ga0207662_10172241 Ga0207662_101722412 182
423 3300025918 Ga0207662_10331532 Ga0207662_103315322 182
424 3300025919 Ga0207657_10286473 Ga0207657_102864732 182
425 3300025920 Ga0207649_10098602 Ga0207649_100986022 182
426 3300025920 Ga0207649_10376931 Ga0207649_103769312 182
427 3300025920 Ga0207649_10934033 Ga0207649_109340331 182
428 3300025921 Ga0207652_10008803 Ga0207652_100088038 182
429 3300025923 Ga0207681_10105768 Ga0207681_101057682 182
430 3300025923 Ga0207681_10252197 Ga0207681_102521972 182
431 3300025924 Ga0207694_10041971 Ga0207694_100419712 182
432 3300025924 Ga0207694_10092589 Ga0207694_100925893 182
433 3300025924 Ga0207694_10481610 Ga0207694_104816102 182
434 3300025924 Ga0207694_10830833 Ga0207694_108308331 182
435 3300025924 Ga0207694_10846327 Ga0207694_108463272 182
436 3300025925 Ga0207650_10446284 Ga0207650_104462842 182
437 3300025925 Ga0207650_10478583 Ga0207650_104785832 182
438 3300025926 Ga0207659_10006597 Ga0207659_100065976 182
439 3300025926 Ga0207659_10128580 Ga0207659_101285802 182
440 3300025926 Ga0207659_10545303 Ga0207659_105453032 182
441 3300025926 Ga0207659_10566304 Ga0207659_105663042 182
442 3300025928 Ga0207700_10011337 Ga0207700_100113375 182
443 3300025928 Ga0207700_10026505 Ga0207700_100265052 182
444 3300025929 Ga0207664_10013517 Ga0207664_100135173 182
445 3300025929 Ga0207664_10043030 Ga0207664_100430302 182
446 3300025929 Ga0207664_10047267 Ga0207664_100472675 182
447 3300025931 Ga0207644_10000660 Ga0207644_100006603 182
448 3300025931 Ga0207644_10174134 Ga0207644_101741342 182
449 3300025933 Ga0207706_10055844 Ga0207706_100558443 182
450 3300025933 Ga0207706_10323827 Ga0207706_103238272 182
451 3300025934 Ga0207686_10411020 Ga0207686_104110202 182
452 3300025936 Ga0207670_10019610 Ga0207670_100196102 182
453 3300025936 Ga0207670_10204666 Ga0207670_102046662 182
454 3300025937 Ga0207669_10035440 Ga0207669_100354403 182
455 3300025937 Ga0207669_10097759 Ga0207669_100977592 182
456 3300025937 Ga0207669_10319320 Ga0207669_103193201 182
457 3300025938 Ga0207704_10047013 Ga0207704_100470133 182
458 3300025938 Ga0207704_10050165 Ga0207704_100501653 182
459 3300025938 Ga0207704_10090212 Ga0207704_100902122 182
460 3300025938 Ga0207704_10151418 Ga0207704_101514182 182
461 3300025938 Ga0207704_10175278 Ga0207704_101752782 182
462 3300025939 Ga0207665_10000587 Ga0207665_100005877 182
463 3300025939 Ga0207665_10015240 Ga0207665_100152402 182
464 3300025939 Ga0207665_10141497 Ga0207665_101414972 182
465 3300025940 Ga0207691_10000808 Ga0207691_1000080820 182
466 3300025940 Ga0207691_10020237 Ga0207691_100202373 182
467 3300025940 Ga0207691_10155413 Ga0207691_101554132 182
468 3300025940 Ga0207691_10269659 Ga0207691_102696592 182
469 3300025941 Ga0207711_10019836 Ga0207711_100198362 182
470 3300025941 Ga0207711_10020918 Ga0207711_100209186 182
471 3300025941 Ga0207711_10175845 Ga0207711_101758452 182
472 3300025942 Ga0207689_10006816 Ga0207689_100068165 182
473 3300025942 Ga0207689_10068790 Ga0207689_100687902 182
474 3300025942 Ga0207689_10586526 Ga0207689_105865262 182
475 3300025944 Ga0207661_10393241 Ga0207661_103932411 182
476 3300025944 Ga0207661_10967791 Ga0207661_109677911 182
477 3300025945 Ga0207679_10035222 Ga0207679_100352223 182
478 3300025945 Ga0207679_10255264 Ga0207679_102552642 182
479 3300025945 Ga0207679_11287257 Ga0207679_112872571 182
480 3300025949 Ga0207667_10004634 Ga0207667_1000463413 182
481 3300025949 Ga0207667_10297061 Ga0207667_102970612 182
482 3300025949 Ga0207667_10419651 Ga0207667_104196512 182
483 3300025960 Ga0207651_10012726 Ga0207651_100127263 182
484 3300025960 Ga0207651_10021532 Ga0207651_100215322 182
485 3300025960 Ga0207651_10044659 Ga0207651_100446592 182
486 3300025960 Ga0207651_10130569 Ga0207651_101305692 182
487 3300025960 Ga0207651_10420972 Ga0207651_104209722 182
488 3300025961 Ga0207712_10041797 Ga0207712_100417972 182
489 3300025961 Ga0207712_10046720 Ga0207712_100467202 182
490 3300025972 Ga0207668_10044717 Ga0207668_100447173 182
491 3300025972 Ga0207668_10621621 Ga0207668_106216212 182
492 3300025986 Ga0207658_10435869 Ga0207658_104358692 182
493 3300025986 Ga0207658_10768776 Ga0207658_107687761 182
494 3300025986 Ga0207658_11501410 Ga0207658_115014101 182
495 3300026023 Ga0207677_10044619 Ga0207677_100446193 182
496 3300026023 Ga0207677_10497306 Ga0207677_104973062 182
497 3300026035 Ga0207703_10002919 Ga0207703_100029193 182
498 3300026035 Ga0207703_10004149 Ga0207703_100041492 182
499 3300026035 Ga0207703_10071608 Ga0207703_100716082 182
500 3300026035 Ga0207703_10122843 Ga0207703_101228432 182
501 3300026035 Ga0207703_10226563 Ga0207703_102265632 182
502 3300026035 Ga0207703_10463879 Ga0207703_104638792 182
503 3300026041 Ga0207639_10174985 Ga0207639_101749852 182
504 3300026041 Ga0207639_10197304 Ga0207639_101973042 182
505 3300026067 Ga0207678_10057667 Ga0207678_100576673 182
506 3300026067 Ga0207678_10143351 Ga0207678_101433512 182
507 3300026075 Ga0207708_10126206 Ga0207708_101262062 182
508 3300026075 Ga0207708_10143037 Ga0207708_101430372 182
509 3300026075 Ga0207708_10262327 Ga0207708_102623272 182
510 3300026078 Ga0207702_10021375 Ga0207702_100213752 182
511 3300026078 Ga0207702_10024278 Ga0207702_100242783 182
512 3300026078 Ga0207702_11134358 Ga0207702_111343582 182
513 3300026088 Ga0207641_10000266 Ga0207641_1000026663 182
514 3300026088 Ga0207641_10004267 Ga0207641_100042672 182
515 3300026088 Ga0207641_10072695 Ga0207641_100726952 182
516 3300026088 Ga0207641_10078506 Ga0207641_100785062 182
517 3300026089 Ga0207648_10011589 Ga0207648_100115898 182
518 3300026089 Ga0207648_10307452 Ga0207648_103074522 182
519 3300026089 Ga0207648_10420128 Ga0207648_104201282 182
520 3300026089 Ga0207648_10538471 Ga0207648_105384712 182
521 3300026089 Ga0207648_10550578 Ga0207648_105505782 182
522 3300026095 Ga0207676_10000965 Ga0207676_100009656 182
523 3300026116 Ga0207674_10045038 Ga0207674_100450384 182
524 3300026116 Ga0207674_10324191 Ga0207674_103241912 182
525 3300026118 Ga0207675_100001909 Ga0207675_1000019094 182
526 3300026118 Ga0207675_100017235 Ga0207675_1000172353 182
527 3300026118 Ga0207675_100021368 Ga0207675_1000213682 182
528 3300026118 Ga0207675_100108282 Ga0207675_1001082822 182
529 3300026118 Ga0207675_100262014 Ga0207675_1002620142 182
530 3300026121 Ga0207683_10002455 Ga0207683_100024556 182
531 3300026121 Ga0207683_10012739 Ga0207683_100127397 182
532 3300026121 Ga0207683_10418636 Ga0207683_104186362 182
533 3300026121 Ga0207683_10988293 Ga0207683_109882932 182
534 3300027907 Ga0207428_10018642 Ga0207428_100186421 182
535 3300027907 Ga0207428_10037638 Ga0207428_100376383 182
536 3300027907 Ga0207428_10053868 Ga0207428_100538683 182
537 3300027907 Ga0207428_10077052 Ga0207428_100770523 182
538 3300028017 Ga0265356_1001033 Ga0265356_10010334 182
539 3300028379 Ga0268266_10000159 Ga0268266_10000159112 182
540 3300028379 Ga0268266_10004018 Ga0268266_100040185 182
541 3300028379 Ga0268266_10018604 Ga0268266_100186042 182
542 3300028379 Ga0268266_10020525 Ga0268266_100205258 182
543 3300028379 Ga0268266_10021131 Ga0268266_100211313 182
544 3300028379 Ga0268266_10021707 Ga0268266_100217075 182
545 3300028379 Ga0268266_10036776 Ga0268266_100367762 182
546 3300028379 Ga0268266_10103250 Ga0268266_101032502 182
547 3300028379 Ga0268266_10113600 Ga0268266_101136002 182
548 3300028379 Ga0268266_10229263 Ga0268266_102292632 182
549 3300028379 Ga0268266_10474874 Ga0268266_104748742 182
550 3300028380 Ga0268265_10015831 Ga0268265_100158315 182
551 3300028380 Ga0268265_10026933 Ga0268265_100269334 182
552 3300028380 Ga0268265_10085663 Ga0268265_100856632 182
553 3300028380 Ga0268265_10269110 Ga0268265_102691102 182
554 3300028380 Ga0268265_10400670 Ga0268265_104006702 182
555 3300028380 Ga0268265_10421531 Ga0268265_104215312 182
556 3300028380 Ga0268265_10486922 Ga0268265_104869222 182
557 3300028380 Ga0268265_10513957 Ga0268265_105139572 182
558 3300028381 Ga0268264_10000047 Ga0268264_1000004721 182
559 3300028381 Ga0268264_10000140 Ga0268264_1000014020 182
560 3300028381 Ga0268264_10037266 Ga0268264_100372664 182
561 3300028381 Ga0268264_10326291 Ga0268264_103262912 182
562 3300028573 Ga0265334_10012381 Ga0265334_100123813 182
563 3300028786 Ga0307517_10215405 Ga0307517_102154052 182
564 3300028794 Ga0307515_10001652 Ga0307515_1000165230 182
565 3300028794 Ga0307515_10121290 Ga0307515_101212902 182
566 3300028794 Ga0307515_10195041 Ga0307515_101950412 182
567 3300028794 Ga0307515_10606956 Ga0307515_106069561 182
568 3300030521 Ga0307511_10000268 Ga0307511_1000026819 182
569 3300030521 Ga0307511_10051996 Ga0307511_100519962 182
570 3300030878 Ga0265770_1000007 Ga0265770_100000716 182
571 3300031090 Ga0265760_10005135 Ga0265760_100051352 182
572 3300031090 Ga0265760_10098769 Ga0265760_100987691 182
573 3300031247 Ga0265340_10275247 Ga0265340_102752471 182
574 3300031249 Ga0265339_10226767 Ga0265339_102267671 182
575 3300031250 Ga0265331_10002039 Ga0265331_100020399 182
576 3300031456 Ga0307513_10049297 Ga0307513_100492974 182
577 3300031456 Ga0307513_10053175 Ga0307513_100531754 182
578 3300031456 Ga0307513_10113314 Ga0307513_101133142 182
579 3300031456 Ga0307513_10115262 Ga0307513_101152622 182
580 3300031456 Ga0307513_10181146 Ga0307513_101811461 182
581 3300031507 Ga0307509_10001396 Ga0307509_1000139625 182
582 3300031507 Ga0307509_10042256 Ga0307509_100422562 182
583 3300031507 Ga0307509_10059381 Ga0307509_100593813 182
584 3300031507 Ga0307509_10643087 Ga0307509_106430872 182
585 3300031548 Ga0307408_100134284 Ga0307408_1001342842 182
586 3300031616 Ga0307508_10207321 Ga0307508_102073212 182
587 3300031727 Ga0316576_10051790 Ga0316576_100517902 182
588 3300031727 Ga0316576_10068868 Ga0316576_100688682 182
589 3300031727 Ga0316576_10201666 Ga0316576_102016662 182
590 3300031730 Ga0307516_10002208 Ga0307516_1000220817 182
591 3300031731 Ga0307405_10048178 Ga0307405_100481782 182
592 3300031731 Ga0307405_10620416 Ga0307405_106204162 182
593 3300031824 Ga0307413_10010738 Ga0307413_100107384 182
594 3300031824 Ga0307413_10030393 Ga0307413_100303932 182
595 3300031824 Ga0307413_10254987 Ga0307413_102549872 182
596 3300031824 Ga0307413_10282177 Ga0307413_102821771 182
597 3300031852 Ga0307410_10006032 Ga0307410_100060324 182
598 3300031852 Ga0307410_10111930 Ga0307410_101119302 182
599 3300031901 Ga0307406_10010319 Ga0307406_100103192 182
600 3300031901 Ga0307406_10220386 Ga0307406_102203862 182
601 3300031901 Ga0307406_10271691 Ga0307406_102716912 182
602 3300031901 Ga0307406_10609286 Ga0307406_106092862 182
603 3300031901 Ga0307406_10859982 Ga0307406_108599821 182
604 3300031903 Ga0307407_10015668 Ga0307407_100156683 182
605 3300031903 Ga0307407_10041476 Ga0307407_100414762 182
606 3300031911 Ga0307412_10286848 Ga0307412_102868481 182
607 3300031911 Ga0307412_10691078 Ga0307412_106910781 182
608 3300031911 Ga0307412_11447345 Ga0307412_114473451 182
609 3300031995 Ga0307409_100189418 Ga0307409_1001894182 182
610 3300031995 Ga0307409_100427238 Ga0307409_1004272382 182
611 3300031995 Ga0307409_100677127 Ga0307409_1006771272 182
612 3300032002 Ga0307416_100192517 Ga0307416_1001925172 182
613 3300032002 Ga0307416_100368594 Ga0307416_1003685942 182
614 3300032002 Ga0307416_100458569 Ga0307416_1004585692 182
615 3300032002 Ga0307416_101119484 Ga0307416_1011194842 182
616 3300032002 Ga0307416_102014556 Ga0307416_1020145561 182
617 3300032004 Ga0307414_10459409 Ga0307414_104594092 182
618 3300032004 Ga0307414_11059891 Ga0307414_110598911 182
619 3300032005 Ga0307411_10014764 Ga0307411_100147643 182
620 3300032005 Ga0307411_10078816 Ga0307411_100788162 182
621 3300032005 Ga0307411_10160080 Ga0307411_101600802 182
622 3300032005 Ga0307411_10272327 Ga0307411_102723271 182
623 3300032005 Ga0307411_10399134 Ga0307411_103991341 182
624 3300032005 Ga0307411_10544499 Ga0307411_105444991 182
625 3300032005 Ga0307411_10763428 Ga0307411_107634281 182
626 3300032005 Ga0307411_11100196 Ga0307411_111001962 182
627 3300032005 Ga0307411_11380182 Ga0307411_113801821 182
628 3300032126 Ga0307415_100061002 Ga0307415_1000610021 182
629 3300032126 Ga0307415_100115502 Ga0307415_1001155022 182
630 3300032126 Ga0307415_100171048 Ga0307415_1001710482 182
631 3300032126 Ga0307415_100180680 Ga0307415_1001806802 182
632 3300032126 Ga0307415_100511231 Ga0307415_1005112311 182
633 3300032126 Ga0307415_100534046 Ga0307415_1005340461 182
634 3300032126 Ga0307415_100825375 Ga0307415_1008253752 182
635 3300033179 Ga0307507_10426193 Ga0307507_104261931 182
636 3300033180 Ga0307510_10005539 Ga0307510_1000553917 182
637 3300033180 Ga0307510_10256592 Ga0307510_102565922 182
638 3300035111 Ga0373923_0009894 Ga0373923_0009894_2144_2692 182
639 3300035111 Ga0373923_0077208 Ga0373923_0077208_222_770 182
640 3300035113 Ga0373936_0013613 Ga0373936_0013613_1804_2352 182
641 3300035116 Ga0373945_0211837 Ga0373945_0211837_230_778 182
642 3300035119 Ga0373956_0164325 Ga0373956_0164325_253_801 182
643 3300035120 Ga0373957_0055727 Ga0373957_0055727_288_836 182
644 3300035120 Ga0373957_0068871 Ga0373957_0068871_308_856 182
645 3300035120 Ga0373957_0131475 Ga0373957_0131475_86_634 182
646 3300035121 Ga0373960_0077475 Ga0373960_0077475_247_795 182
647 3300035170 Ga0373943_0326457 Ga0373943_0326457_267_815 182
648 3300035171 Ga0373946_0234066 Ga0373946_0234066_277_825 182
649 3300035172 Ga0373955_0009251 Ga0373955_0009251_193_741 182
650 3300035172 Ga0373955_0069928 Ga0373955_0069928_97_645 182
651 3300035241 Ga0373961_0016704 Ga0373961_0016704_1328_1879 182
652 3300035242 Ga0373962_0115306 Ga0373962_0115306_233_781 182
653 3300035398 Ga0316574_0010344 Ga0316574_0010344_396_944 182
654 3300035398 Ga0316574_0014494 Ga0316574_0014494_3724_4353 182
655 3300035398 Ga0316574_0016384 Ga0316574_0016384_333_881 182
656 3300035398 Ga0316574_0025283 Ga0316574_0025283_668_1216 182
657 3300035398 Ga0316574_0141004 Ga0316574_0141004_764_1312 182
658 3300035398 Ga0316574_0264702 Ga0316574_0264702_363_911 182
659 3300035691 Ga0373931_0775174 Ga0373931_0775174_37_585 182
660 3300035695 Ga0373927_0020690 Ga0373927_0020690_630_1178 182
661 3300035695 Ga0373927_0269784 Ga0373927_0269784_244_792 182
662 3300035724 Ga0373933_0180346 Ga0373933_0180346_93_641 182
663 3300036401 Ga0373937_0006608 Ga0373937_0006608_6422_6970 182
664 3300036401 Ga0373937_0025980 Ga0373937_0025980_1886_2434 182
665 3300036401 Ga0373937_0088213 Ga0373937_0088213_2240_2812 182
666 3300036401 Ga0373937_0259964 Ga0373937_0259964_1024_1572 182
667 3300036712 Ga0316584_0003331 Ga0316584_0003331_8429_9058 182
668 3300036712 Ga0316584_0187258 Ga0316584_0187258_945_1493 182
669 3300037853 Ga0436364_1238211 Ga0436364_1238211_29_577 182
670 3300039437 Ga0436365_1772567 Ga0436365_1772567_9799_10350 182
671 3300039437 Ga0436365_1859648 Ga0436365_1859648_412_960 182
672 3300039438 Ga0436360_0066373 Ga0436360_0066373_1506_2063 182
673 3300039438 Ga0436360_0659686 Ga0436360_0659686_688_1236 182
674 3300039438 Ga0436360_0995015 Ga0436360_0995015_898_1446 182
675 3300039447 Ga0436361_0066890 Ga0436361_0066890_1785_2333 182
676 3300039447 Ga0436361_0251740 Ga0436361_0251740_317_865 182
677 3300039450 Ga0436363_0461713 Ga0436363_0461713_2957_3505 182
678 3300039450 Ga0436363_0641697 Ga0436363_0641697_2966_3517 182
679 3300039450 Ga0436363_1646651 Ga0436363_1646651_2680_3228 182
680 3300039453 Ga0436362_0815706 Ga0436362_0815706_79_627 182
681 3300039453 Ga0436362_1231019 Ga0436362_1231019_436_984 182
682 3300041443 Ga0451789_0293465 Ga0451789_0293465_297_845 182
683 3300041451 Ga0451791_0653772 Ga0451791_0653772_1784_2332 182
684 3300041452 Ga0451793_0640635 Ga0451793_0640635_1215_1763 182
685 3300041453 Ga0451797_0966810 Ga0451797_0966810_496_1044 182
686 3300041459 Ga0451800_0973983 Ga0451800_0973983_112_660 182
687 3300041459 Ga0451800_1658630 Ga0451800_1658630_119_667 182
688 3300041460 Ga0451802_1934902 Ga0451802_1934902_626_1174 182
689 3300041460 Ga0451802_1935343 Ga0451802_1935343_509_1057 182
690 3300041486 Ga0451807_0065623 Ga0451807_0065623_4440_4988 182
691 3300041486 Ga0451807_2246987 Ga0451807_2246987_3417_3965 182
692 3300041486 Ga0451807_2285000 Ga0451807_2285000_75_623 182
693 3300041491 Ga0451833_1190085 Ga0451833_1190085_404_952 182
694 3300041505 Ga0451849_1405876 Ga0451849_1405876_94_642 182
695 3300041507 Ga0451851_1138035 Ga0451851_1138035_427_975 182
696 3300042002 Ga0439442_023326 Ga0439442_023326_139_687 182
697 3300042005 Ga0439448_0113438 Ga0439448_0113438_60_608 182
698 3300042007 Ga0439449_0052926 Ga0439449_0052926_864_1412 182
699 3300042133 Ga0450896_037636 Ga0450896_037636_69_617 182
700 3300042437 Ga0439444_0024418 Ga0439444_0024418_155_709 182
701 3300042438 Ga0439459_0093011 Ga0439459_0093011_149_697 182
702 3300042439 Ga0439464_0045734 Ga0439464_0045734_216_764 182
703 3300042876 Ga0451577_0017859 Ga0451577_0017859_3471_4049 182
704 3300042876 Ga0451577_0076774 Ga0451577_0076774_430_1008 182
705 3300042876 Ga0451577_0158358 Ga0451577_0158358_1134_1712 182
706 3300044656 Ga0466969_0010650 Ga0466969_0010650_3778_4326 182
707 3300044656 Ga0466969_0018694 Ga0466969_0018694_1377_1925 182
708 3300044658 Ga0466972_0099651 Ga0466972_0099651_513_1061 182
709 3300044673 Ga0453683_0071396 Ga0453683_0071396_1422_2036 182
710 3300044683 Ga0466965_0121950 Ga0466965_0121950_684_1232 182
711 3300044683 Ga0466965_0176878 Ga0466965_0176878_172_720 182
712 3300044684 Ga0466966_0018782 Ga0466966_0018782_2224_2772 182
713 3300044684 Ga0466966_0211198 Ga0466966_0211198_539_1087 182
714 3300044684 Ga0466966_0581404 Ga0466966_0581404_19_567 182
715 3300044693 Ga0466961_0005738 Ga0466961_0005738_5173_5721 182
716 3300044706 Ga0466964_0017568 Ga0466964_0017568_2008_2556 182
717 3300044712 Ga0453684_0032214 Ga0453684_0032214_3747_4325 182
718 3300044712 Ga0453684_0068289 Ga0453684_0068289_1086_1700 182
719 3300044712 Ga0453684_0476960 Ga0453684_0476960_366_944 182
720 3300044712 Ga0453684_0934179 Ga0453684_0934179_66_695 182
721 3300044719 Ga0466971_0000216 Ga0466971_0000216_20477_21025 182
722 3300044765 Ga0466970_0002740 Ga0466970_0002740_4003_4551 182
723 3300044842 Ga0466957_0001530 Ga0466957_0001530_10104_10652 182
724 3300044901 Ga0466960_0061910 Ga0466960_0061910_293_841 182
725 3300045049 Ga0466959_0002645 Ga0466959_0002645_1935_2483 182
726 3300045049 Ga0466959_0010436 Ga0466959_0010436_4717_5265 182
727 3300045049 Ga0466959_0014163 Ga0466959_0014163_3870_4418 182
728 3300045049 Ga0466959_0100728 Ga0466959_0100728_1294_1842 182
729 3300045051 Ga0451576_0023536 Ga0451576_0023536_2207_2755 182
730 3300045051 Ga0451576_0215678 Ga0451576_0215678_617_1231 182
731 3300045051 Ga0451576_1038706 Ga0451576_1038706_129_677 182
732 3300045836 Ga0466958_0011057 Ga0466958_0011057_892_1440 182
733 3300046454 Ga0495592_0122645 Ga0495592_0122645_611_1159 182
734 3300046457 Ga0495590_0026392 Ga0495590_0026392_1312_1860 182
735 3300046458 Ga0495591_019311 Ga0495591_019311_636_1208 182
736 3300046460 Ga0495638_0029681 Ga0495638_0029681_157_705 182
737 3300046460 Ga0495638_0042983 Ga0495638_0042983_1961_2509 182
738 3300046460 Ga0495638_0467349 Ga0495638_0467349_52_600 182
739 3300046472 Ga0495580_0002317 Ga0495580_0002317_2126_2674 182
740 3300046472 Ga0495580_0011390 Ga0495580_0011390_1311_1859 182
741 3300046472 Ga0495580_0038431 Ga0495580_0038431_2272_2820 182
742 3300046472 Ga0495580_0250819 Ga0495580_0250819_281_853 182
743 3300046472 Ga0495580_0745606 Ga0495580_0745606_53_601 182
744 3300046473 Ga0495582_0171548 Ga0495582_0171548_130_678 182
745 3300046499 Ga0495594_0225796 Ga0495594_0225796_264_836 182
746 3300046512 Ga0495610_0299294 Ga0495610_0299294_51_599 182
747 3300046513 Ga0495616_0003520 Ga0495616_0003520_749_1297 182
748 3300046514 Ga0495618_0070893 Ga0495618_0070893_41_589 182
749 3300046515 Ga0495620_0181440 Ga0495620_0181440_188_736 182
750 3300046519 Ga0495632_0030336 Ga0495632_0030336_2028_2576 182
751 3300046519 Ga0495632_0030443 Ga0495632_0030443_826_1374 182
752 3300046519 Ga0495632_0319753 Ga0495632_0319753_57_605 182
753 3300046523 Ga0495644_0019850 Ga0495644_0019850_511_1083 182
754 3300046524 Ga0495648_0058796 Ga0495648_0058796_1088_1720 182
755 3300046529 Ga0495652_0258438 Ga0495652_0258438_445_993 182
756 3300046531 Ga0495665_0044595 Ga0495665_0044595_505_1053 182
757 3300046535 Ga0495586_0055117 Ga0495586_0055117_369_917 182
758 3300046535 Ga0495586_0484897 Ga0495586_0484897_38_610 182
759 3300046539 Ga0495621_0024354 Ga0495621_0024354_48_620 182
760 3300046539 Ga0495621_0048158 Ga0495621_0048158_168_716 182
761 3300046539 Ga0495621_0088361 Ga0495621_0088361_490_1047 182
762 3300046558 Ga0495633_0156593 Ga0495633_0156593_47_619 182
763 3300046615 Ga0495656_0054433 Ga0495656_0054433_309_857 182
764 3300046616 Ga0495668_0489013 Ga0495668_0489013_26_574 182
765 3300046660 Ga0495625_0004128 Ga0495625_0004128_5461_6069 182
766 3300046660 Ga0495625_0056977 Ga0495625_0056977_1031_1579 182
767 3300046660 Ga0495625_0084823 Ga0495625_0084823_405_953 182
768 3300046660 Ga0495625_0150529 Ga0495625_0150529_1006_1554 182
769 3300046660 Ga0495625_0277573 Ga0495625_0277573_253_801 182
770 3300046664 Ga0495659_0160024 Ga0495659_0160024_93_641 182
771 3300046675 Ga0495657_0072326 Ga0495657_0072326_1067_1615 182
772 3300046678 Ga0495599_0099033 Ga0495599_0099033_629_1177 182
773 3300046679 Ga0495623_0061473 Ga0495623_0061473_268_816 182
774 3300046681 Ga0495647_0022229 Ga0495647_0022229_299_871 182
775 3300046681 Ga0495647_0028574 Ga0495647_0028574_1453_2001 182
776 3300046681 Ga0495647_0141218 Ga0495647_0141218_367_939 182
777 3300046683 Ga0495658_0010043 Ga0495658_0010043_1587_2159 182
778 3300046683 Ga0495658_0510274 Ga0495658_0510274_12_560 182
779 3300046684 Ga0495669_0357713 Ga0495669_0357713_65_616 182
780 3300046694 Ga0495649_0070992 Ga0495649_0070992_864_1496 182
781 3300047315 Ga0495581_0149843 Ga0495581_0149843_757_1305 182
782 3300047317 Ga0495604_0031892 Ga0495604_0031892_3070_3618 182
783 3300047319 Ga0495674_0449767 Ga0495674_0449767_185_733 182
784 3300047320 Ga0495672_0063383 Ga0495672_0063383_1144_1692 182
785 3300047470 Ga0495681_0037726 Ga0495681_0037726_1463_2035 182
786 3300047472 Ga0495686_0068125 Ga0495686_0068125_1227_1775 182
787 3300048088 Ga0495602_0035047 Ga0495602_0035047_2588_3136 182
788 3300048091 Ga0495626_0223542 Ga0495626_0223542_82_630 182
789 3300048903 Ga0496100_0014282 Ga0496100_0014282_1818_2366 182
790 3300048903 Ga0496100_0924555 Ga0496100_0924555_31_579 182
791 3300048904 Ga0496101_0002781 Ga0496101_0002781_1325_1873 182
792 3300048904 Ga0496101_0058777 Ga0496101_0058777_1859_2407 182
793 3300048905 Ga0496102_0004283 Ga0496102_0004283_4121_4669 182
794 3300048905 Ga0496102_0015204 Ga0496102_0015204_2568_3116 182
795 3300048905 Ga0496102_0025670 Ga0496102_0025670_2520_3068 182
796 3300048905 Ga0496102_0239250 Ga0496102_0239250_1011_1559 182
797 3300048906 Ga0496103_0054969 Ga0496103_0054969_1427_1975 182
798 3300048906 Ga0496103_0157107 Ga0496103_0157107_504_1052 182
799 3300048907 Ga0496104_0166549 Ga0496104_0166549_506_1054 182
800 3300048907 Ga0496104_0183740 Ga0496104_0183740_630_1178 182
801 3300048907 Ga0496104_0205567 Ga0496104_0205567_1115_1738 182
802 3300048908 Ga0496105_0038751 Ga0496105_0038751_746_1294 182
803 3300048909 Ga0496106_0023670 Ga0496106_0023670_1797_2345 182
804 3300048909 Ga0496106_0092723 Ga0496106_0092723_601_1149 182
805 3300048909 Ga0496106_0131648 Ga0496106_0131648_197_745 182
806 3300048909 Ga0496106_0232287 Ga0496106_0232287_82_630 182
807 3300048909 Ga0496106_1019094 Ga0496106_1019094_16_573 182
808 3300048910 Ga0496107_0014224 Ga0496107_0014224_2794_3342 182
809 3300048910 Ga0496107_0704523 Ga0496107_0704523_182_730 182
810 3300048911 Ga0496108_0012714 Ga0496108_0012714_2242_2790 182
811 3300048911 Ga0496108_0578231 Ga0496108_0578231_370_918 182
812 3300048913 Ga0496110_0000749 Ga0496110_0000749_1332_1880 182
813 3300048913 Ga0496110_0352827 Ga0496110_0352827_735_1283 182
814 3300048914 Ga0496111_0007317 Ga0496111_0007317_2220_2768 182
815 3300048915 Ga0496112_0005843 Ga0496112_0005843_10015_10563 182
816 3300048915 Ga0496112_0149992 Ga0496112_0149992_1500_2048 182
817 3300048916 Ga0496113_0024231 Ga0496113_0024231_3707_4255 182
818 3300048916 Ga0496113_0034940 Ga0496113_0034940_500_1048 182
819 3300048917 Ga0496114_0001864 Ga0496114_0001864_7249_7797 182
820 3300048917 Ga0496114_0031729 Ga0496114_0031729_1316_1864 182
821 3300048917 Ga0496114_0139070 Ga0496114_0139070_185_733 182
822 3300048917 Ga0496114_0546027 Ga0496114_0546027_191_739 182
823 3300048918 Ga0496115_0019186 Ga0496115_0019186_843_1391 182
824 3300048918 Ga0496115_0255565 Ga0496115_0255565_290_838 182
825 3300048919 Ga0496116_0009552 Ga0496116_0009552_6073_6621 182
826 3300048920 Ga0496117_0000151 Ga0496117_0000151_97290_97838 182
827 3300048920 Ga0496117_0365928 Ga0496117_0365928_107_655 182
828 3300048921 Ga0496118_0000016 Ga0496118_0000016_22359_22907 182
829 3300048921 Ga0496118_0053120 Ga0496118_0053120_64_612 182
830 3300048921 Ga0496118_0061427 Ga0496118_0061427_1500_2048 182
831 3300048921 Ga0496118_0071775 Ga0496118_0071775_1831_2439 182
832 3300048922 Ga0496119_0007663 Ga0496119_0007663_7190_7738 182
833 3300048922 Ga0496119_0026068 Ga0496119_0026068_3413_4045 182
834 3300048923 Ga0496120_0002631 Ga0496120_0002631_3413_4045 182
835 3300048923 Ga0496120_0079655 Ga0496120_0079655_1089_1637 182
836 3300048924 Ga0496121_0003216 Ga0496121_0003216_17594_18142 182
837 3300048924 Ga0496121_0062952 Ga0496121_0062952_2415_2963 182
838 3300048924 Ga0496121_0088943 Ga0496121_0088943_1439_1987 182
839 3300048927 Ga0496124_0036662 Ga0496124_0036662_333_881 182
840 3300048928 Ga0496125_0000759 Ga0496125_0000759_1316_1864 182
841 3300048928 Ga0496125_0015343 Ga0496125_0015343_2813_3361 182
842 3300048928 Ga0496125_0042383 Ga0496125_0042383_1287_1835 182
843 3300048929 Ga0496126_0001875 Ga0496126_0001875_6776_7324 182
844 3300048929 Ga0496126_0059047 Ga0496126_0059047_2846_3394 182
845 3300049522 Ga0501299_089863 Ga0501299_089863_30_578 182
846 3300049568 Ga0501031_0108948 Ga0501031_0108948_222_770 182
847 3300049568 Ga0501031_0189438 Ga0501031_0189438_731_1279 182
848 3300049569 Ga0501032_0198951 Ga0501032_0198951_262_810 182
849 3300049570 Ga0501033_0125845 Ga0501033_0125845_1188_1736 182
850 3300049570 Ga0501033_0331458 Ga0501033_0331458_343_891 182
851 3300049571 Ga0501034_1339501 Ga0501034_1339501_13_561 182
852 3300049572 Ga0501036_0019918 Ga0501036_0019918_4823_5371 182
853 3300049572 Ga0501036_0030927 Ga0501036_0030927_2066_2614 182
854 3300049572 Ga0501036_0314169 Ga0501036_0314169_692_1240 182
855 3300049573 Ga0501037_0029609 Ga0501037_0029609_1340_1888 182
856 3300049573 Ga0501037_0074819 Ga0501037_0074819_1278_1826 182
857 3300049574 Ga0501038_0025407 Ga0501038_0025407_2034_2582 182
858 3300049574 Ga0501038_0110786 Ga0501038_0110786_690_1238 182
859 3300049575 Ga0501039_0005021 Ga0501039_0005021_1675_2223 182
860 3300049575 Ga0501039_0534782 Ga0501039_0534782_71_625 182
861 3300049576 Ga0501040_0001902 Ga0501040_0001902_11332_11880 182
862 3300049576 Ga0501040_0020637 Ga0501040_0020637_1482_2030 182
863 3300049577 Ga0501041_0003543 Ga0501041_0003543_2148_2696 182
864 3300049577 Ga0501041_0027415 Ga0501041_0027415_1656_2204 182
865 3300049578 Ga0501042_0020076 Ga0501042_0020076_2551_3099 182
866 3300049578 Ga0501042_0069390 Ga0501042_0069390_1126_1674 182
867 3300049579 Ga0501043_0047241 Ga0501043_0047241_1031_1579 182
868 3300049580 Ga0501046_0008614 Ga0501046_0008614_1749_2297 182
869 3300049580 Ga0501046_0065359 Ga0501046_0065359_259_807 182
870 3300049580 Ga0501046_0071635 Ga0501046_0071635_647_1195 182
871 3300049580 Ga0501046_0447081 Ga0501046_0447081_61_609 182
872 3300049582 Ga0501048_0031048 Ga0501048_0031048_1526_2074 182
873 3300049582 Ga0501048_0122126 Ga0501048_0122126_100_648 182
874 3300049584 Ga0501068_0039428 Ga0501068_0039428_395_943 182
875 3300049584 Ga0501068_0040215 Ga0501068_0040215_440_988 182
876 3300049585 Ga0501069_0069086 Ga0501069_0069086_422_970 182
877 3300049586 Ga0501070_0235381 Ga0501070_0235381_687_1235 182
878 3300049587 Ga0501071_0000689 Ga0501071_0000689_1693_2241 182
879 3300049587 Ga0501071_0050039 Ga0501071_0050039_1482_2030 182
880 3300049588 Ga0501072_0002540 Ga0501072_0002540_4676_5224 182
881 3300049588 Ga0501072_0027868 Ga0501072_0027868_1824_2372 182
882 3300049588 Ga0501072_0785763 Ga0501072_0785763_44_598 182
883 3300049591 Ga0501075_0003894 Ga0501075_0003894_7639_8187 182
884 3300049592 Ga0501076_0000782 Ga0501076_0000782_7825_8373 182
885 3300049592 Ga0501076_0025012 Ga0501076_0025012_1543_2091 182
886 3300049593 Ga0501077_0009125 Ga0501077_0009125_1656_2204 182
887 3300049593 Ga0501077_0069821 Ga0501077_0069821_1480_2028 182
888 3300049656 Ga0501209_026366 Ga0501209_026366_703_1251 182
889 3300049679 Ga0501249_007490 Ga0501249_007490_1169_1717 182
890 3300049686 Ga0501257_089169 Ga0501257_089169_210_758 182
891 3300049741 Ga0501079_0001340 Ga0501079_0001340_1097_1645 182
892 3300049741 Ga0501079_0017298 Ga0501079_0017298_3265_3813 182
893 3300049742 Ga0501080_0005127 Ga0501080_0005127_6964_7512 182
894 3300049742 Ga0501080_0185062 Ga0501080_0185062_858_1406 182
895 3300049742 Ga0501080_0839020 Ga0501080_0839020_128_676 182
896 3300049743 Ga0501081_0010808 Ga0501081_0010808_744_1292 182
897 3300049743 Ga0501081_0051401 Ga0501081_0051401_596_1144 182
898 3300049743 Ga0501081_0544209 Ga0501081_0544209_132_680 182
899 3300049744 Ga0501083_0259029 Ga0501083_0259029_218_766 182
900 3300049822 Ga0501035_0038912 Ga0501035_0038912_2212_2760 182
901 3300049822 Ga0501035_0052512 Ga0501035_0052512_2532_3080 182
902 3300049823 Ga0501044_0121003 Ga0501044_0121003_2023_2571 182
903 3300049823 Ga0501044_0648569 Ga0501044_0648569_66_614 182
904 3300049824 Ga0501045_0000401 Ga0501045_0000401_24557_25105 182
905 3300049824 Ga0501045_0020016 Ga0501045_0020016_1575_2123 182
906 3300049824 Ga0501045_0116565 Ga0501045_0116565_1249_1803 182
907 3300050507 nmdc:mga05p37_1003701_c1 nmdc:mga05p37_1003701_c1_60_608 182
908 3300050508 nmdc:mga09592_139542_c1 nmdc:mga09592_139542_c1_355_903 182
909 3300050508 nmdc:mga09592_79156_c1 nmdc:mga09592_79156_c1_281_829 182
910 3300050509 nmdc:mga0qj67_105459_c1 nmdc:mga0qj67_105459_c1_1147_1695 182
911 3300050509 nmdc:mga0qj67_119265_c1 nmdc:mga0qj67_119265_c1_160_708 182
912 3300050509 nmdc:mga0qj67_369301_c1 nmdc:mga0qj67_369301_c1_245_793 182
913 3300050509 nmdc:mga0qj67_441560_c1 nmdc:mga0qj67_441560_c1_240_788 182
914 3300050510 nmdc:mga06r32_12456_c1 nmdc:mga06r32_12456_c1_2316_2864 182
915 3300050510 nmdc:mga06r32_140547_c1 nmdc:mga06r32_140547_c1_1288_1836 182
916 3300050510 nmdc:mga06r32_24616_c1 nmdc:mga06r32_24616_c1_4772_5320 182
917 3300050510 nmdc:mga06r32_259443_c1 nmdc:mga06r32_259443_c1_1093_1641 182
918 3300050510 nmdc:mga06r32_87594_c1 nmdc:mga06r32_87594_c1_538_1086 182
919 3300050511 nmdc:mga08y16_1026529_c1 nmdc:mga08y16_1026529_c1_154_702 182
920 3300050511 nmdc:mga08y16_117632_c1 nmdc:mga08y16_117632_c1_1264_1812 182
921 3300050511 nmdc:mga08y16_1181637_c1 nmdc:mga08y16_1181637_c1_153_701 182
922 3300050511 nmdc:mga08y16_2161_c1 nmdc:mga08y16_2161_c1_18952_19500 182
923 3300050511 nmdc:mga08y16_24822_c1 nmdc:mga08y16_24822_c1_132_680 182
924 3300050511 nmdc:mga08y16_508240_c1 nmdc:mga08y16_508240_c1_192_740 182
925 3300050511 nmdc:mga08y16_66436_c1 nmdc:mga08y16_66436_c1_1874_2422 182
926 3300050511 nmdc:mga08y16_920464_c1 nmdc:mga08y16_920464_c1_275_823 182
927 3300050513 nmdc:mga0rr50_297944_c1 nmdc:mga0rr50_297944_c1_279_827 182
928 3300050513 nmdc:mga0rr50_430501_c1 nmdc:mga0rr50_430501_c1_278_826 182
929 3300050515 nmdc:mga0a205_692174_c1 nmdc:mga0a205_692174_c1_67_615 182
930 3300053078 Ga0495612_0160887 Ga0495612_0160887_344_892 182
931 3300053078 Ga0495612_0352621 Ga0495612_0352621_88_636 182
932 3300053090 Ga0500646_0119074 Ga0500646_0119074_94_642 182
933 3300053092 Ga0500583_0051673 Ga0500583_0051673_1077_1625 182
934 3300053092 Ga0500583_0068826 Ga0500583_0068826_682_1230 182
935 3300053093 Ga0500651_0187399 Ga0500651_0187399_235_783 182
936 3300053096 Ga0500641_0348540 Ga0500641_0348540_15_563 182
937 3300053100 Ga0500660_127142 Ga0500660_127142_455_1003 182
938 3300053104 Ga0500556_0085210 Ga0500556_0085210_303_851 182
939 3300053104 Ga0500556_0095777 Ga0500556_0095777_422_970 182
940 3300053108 Ga0500562_080488 Ga0500562_080488_171_719 182
941 3300053109 Ga0500569_010238 Ga0500569_010238_971_1519 182
942 3300053116 Ga0500592_025572 Ga0500592_025572_55_603 182
943 3300053119 Ga0500595_095061 Ga0500595_095061_176_724 182
944 3300053131 Ga0500652_081380 Ga0500652_081380_76_624 182
945 3300053131 Ga0500652_139261 Ga0500652_139261_160_708 182
946 3300053134 Ga0500658_0008480 Ga0500658_0008480_1467_2015 182
947 3300053136 Ga0500559_0039884 Ga0500559_0039884_53_601 182
948 3300053139 Ga0500568_0037122 Ga0500568_0037122_535_1083 182
949 3300053146 Ga0500588_0002779 Ga0500588_0002779_1591_2139 182
950 3300053153 Ga0500616_0000073 Ga0500616_0000073_21864_22412 182
951 3300053156 Ga0500622_0002406 Ga0500622_0002406_1849_2397 182
952 3300053156 Ga0500622_0005698 Ga0500622_0005698_5963_6511 182
953 3300053156 Ga0500622_0014061 Ga0500622_0014061_830_1378 182
954 3300053158 Ga0500627_0073504 Ga0500627_0073504_554_1102 182
955 3300053159 Ga0500630_043962 Ga0500630_043962_1249_1797 182
956 3300053160 Ga0500633_0092643 Ga0500633_0092643_303_851 182
957 3300053160 Ga0500633_0133288 Ga0500633_0133288_154_783 182
958 3300053177 Ga0500636_0101843 Ga0500636_0101843_321_869 182
959 3300053178 Ga0500637_0000126 Ga0500637_0000126_11281_11829 182
960 3300054114 Ga0501084_0120250 Ga0501084_0120250_921_1469 182
961 3300054114 Ga0501084_0321710 Ga0501084_0321710_355_903 182
962 3300060353 Ga0501082_0006995 Ga0501082_0006995_2717_3265 182
963 3300061719 Ga0466962_0038104 Ga0466962_0038104_1174_1722 182
964 3300061734 Ga0530510_0018068 Ga0530510_0018068_2438_2986 182
965 3300061734 Ga0530510_0034834 Ga0530510_0034834_1229_1777 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

107

178

0.94

PF13560

HTH_31

Helix-turn-helix domain

4

63

0.9

PF01381

HTH_3

Helix-turn-helix

9

63

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.9565 4 65
3clc-assembly1.cif.gz_D crystal structure of the restriction-modification controller protein c.esp1396i tetramer in complex with its natural 35 base-pair operator 0.9513 4 65
2xcj-assembly1.cif.gz_B crystal structure of p2 c, the immunity repressor of temperate e. coli phage p2 0.9421 5 55
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9418 5 64
4i6t-assembly1.cif.gz_A crystal structure of a t36a mutant of the restriction-modification controller protein c.esp1396i 0.9399 4 65
ID Description Score Start End Superfamily
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9624 4 65 1.10.260.40
2b5aA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9565 4 65 1.10.260.40
4x4bA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9534 4 65 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9524 4 65 1.10.260.40
3clcD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9513 4 65 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3M3JZX3-F1-model_v4 deleted 0.9821 75 182
AF-A0A3M3JZX3-F1-model_v4 deleted 0.9644 75 182
AF-A0A7W2GSC8-F1-model_v4 Cupin domain-containing protein 0.964 75 182
AF-A0A3T1DYX9-F1-model_v4 deleted 0.9598 66 180
AF-A0A7Y2URT1-F1-model_v4 Cupin domain-containing protein 0.9569 80 182

Feature Viewer

pLDDT pTM Quality
91.76 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map