F486972
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 965 | 397 | 965 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10063757|Ga0213876_100637572 |
| Length | 183 |
| Sequence | MSIDVGARLRGLRTTFGLSQRELARRAGVTNGLISLIEQNRVSPSVSSLKKVLDGVPMSLAEFFTLDPGTAVPQSVFAADELVELGNEELSLRLVAAQRPGRQLTILHERYAAGAGTGEDMLMHRGEEGGVVVRGKVELTVGGVARVLSPGEAYYFSSQLPHRFRNVGREPCEIISASTPPTF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 244 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 245 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 246 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 247 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 248 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 249 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 250 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 251 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 252 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 255 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 256 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 257 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 261 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 262 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 326 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 327 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 355 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 357 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 373 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 374 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 375 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 377 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 380 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 381 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 382 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 383 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 387 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 389 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 392 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.01 |
| Nodule | 0 |
| Rhizoplane | 4.97 |
| Rhizosphere | 86.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C9875 | 2010549000 | Bacteria | 838 |
| 2 | SwRhRL2b_contig_2220656 | 2162886007 | Bacteria | 2287 |
| 3 | rootH1_10101733 | 3300003316 | Bacteria | 2135 |
| 4 | rootH2_10016870 | 3300003320 | Bacteria | 1461 |
| 5 | rootH1_10033537 | 3300003323 | Bacteria | 6912 |
| 6 | Ga0065704_10011697 | 3300005289 | Bacteria | 4054 |
| 7 | Ga0065712_10070294 | 3300005290 | Bacteria | 6136 |
| 8 | Ga0065715_10136644 | 3300005293 | Bacteria | 1919 |
| 9 | Ga0070676_10111192 | 3300005328 | Bacteria | 1706 |
| 10 | Ga0070683_100509493 | 3300005329 | Unclassified | 1150 |
| 11 | Ga0070690_100012452 | 3300005330 | Bacteria | 5003 |
| 12 | Ga0070690_100034482 | 3300005330 | Bacteria | 3171 |
| 13 | Ga0070690_100442761 | 3300005330 | Bacteria | 962 |
| 14 | Ga0070690_101014645 | 3300005330 | Bacteria | 654 |
| 15 | Ga0070670_100150538 | 3300005331 | Bacteria | 2014 |
| 16 | Ga0070670_100176738 | 3300005331 | Bacteria | 1853 |
| 17 | Ga0070677_10246646 | 3300005333 | Bacteria | 884 |
| 18 | Ga0068869_100387362 | 3300005334 | Bacteria | 1147 |
| 19 | Ga0070666_10084334 | 3300005335 | Bacteria | 2174 |
| 20 | Ga0070666_10160843 | 3300005335 | Bacteria | 1569 |
| 21 | Ga0070680_100005497 | 3300005336 | Bacteria | 9590 |
| 22 | Ga0070680_100169769 | 3300005336 | Bacteria | 1835 |
| 23 | Ga0070680_100232785 | 3300005336 | Bacteria | 1556 |
| 24 | Ga0070682_100197138 | 3300005337 | Bacteria | 1418 |
| 25 | Ga0070682_100380023 | 3300005337 | Bacteria | 1062 |
| 26 | Ga0070682_100579687 | 3300005337 | Bacteria | 882 |
| 27 | Ga0068868_100028250 | 3300005338 | Bacteria | 4287 |
| 28 | Ga0070689_100002266 | 3300005340 | Bacteria | 12501 |
| 29 | Ga0070689_100003597 | 3300005340 | Bacteria | 10332 |
| 30 | Ga0070689_100641499 | 3300005340 | Bacteria | 923 |
| 31 | Ga0070691_10107204 | 3300005341 | Bacteria | 1394 |
| 32 | Ga0070687_100274690 | 3300005343 | Bacteria | 1058 |
| 33 | Ga0070687_100779705 | 3300005343 | Bacteria | 675 |
| 34 | Ga0070687_100883988 | 3300005343 | Bacteria | 639 |
| 35 | Ga0070661_100070943 | 3300005344 | Bacteria | 2563 |
| 36 | Ga0070661_100694517 | 3300005344 | Bacteria | 829 |
| 37 | Ga0070668_100107972 | 3300005347 | Bacteria | 2213 |
| 38 | Ga0070669_100176852 | 3300005353 | Bacteria | 1667 |
| 39 | Ga0070669_100320947 | 3300005353 | Bacteria | 1250 |
| 40 | Ga0070675_100001269 | 3300005354 | Bacteria | 18440 |
| 41 | Ga0070675_100187299 | 3300005354 | Bacteria | 1792 |
| 42 | Ga0070675_100444151 | 3300005354 | Bacteria | 1162 |
| 43 | Ga0070675_100457919 | 3300005354 | Bacteria | 1145 |
| 44 | Ga0070671_100000657 | 3300005355 | Bacteria | 24836 |
| 45 | Ga0070671_100110753 | 3300005355 | Bacteria | 2306 |
| 46 | Ga0070673_100020159 | 3300005364 | Bacteria | 4804 |
| 47 | Ga0070673_100092132 | 3300005364 | Bacteria | 2478 |
| 48 | Ga0070673_100173114 | 3300005364 | Bacteria | 1843 |
| 49 | Ga0070673_100364754 | 3300005364 | Bacteria | 1285 |
| 50 | Ga0070673_100548881 | 3300005364 | Bacteria | 1049 |
| 51 | Ga0070688_100005304 | 3300005365 | Bacteria | 6781 |
| 52 | Ga0070667_100022143 | 3300005367 | Bacteria | 5272 |
| 53 | Ga0070667_100037857 | 3300005367 | Bacteria | 4044 |
| 54 | Ga0070667_100296137 | 3300005367 | Bacteria | 1456 |
| 55 | Ga0070709_10116089 | 3300005434 | Bacteria | 1807 |
| 56 | Ga0070709_10156402 | 3300005434 | Bacteria | 1581 |
| 57 | Ga0070709_10789025 | 3300005434 | Unclassified | 745 |
| 58 | Ga0070714_100004027 | 3300005435 | Bacteria | 11045 |
| 59 | Ga0070714_100058875 | 3300005435 | Bacteria | 3293 |
| 60 | Ga0070714_100263841 | 3300005435 | Bacteria | 1595 |
| 61 | Ga0070713_100003765 | 3300005436 | Bacteria | 10041 |
| 62 | Ga0070713_100004406 | 3300005436 | Bacteria | 9453 |
| 63 | Ga0070713_100112568 | 3300005436 | Bacteria | 2375 |
| 64 | Ga0070713_100231427 | 3300005436 | Unclassified | 1680 |
| 65 | Ga0070710_10002005 | 3300005437 | Bacteria | 9640 |
| 66 | Ga0070710_10102895 | 3300005437 | Bacteria | 1704 |
| 67 | Ga0070710_10987364 | 3300005437 | Bacteria | 613 |
| 68 | Ga0070701_10024998 | 3300005438 | Bacteria | 2895 |
| 69 | Ga0070701_10205419 | 3300005438 | Bacteria | 1167 |
| 70 | Ga0070701_10227177 | 3300005438 | Bacteria | 1116 |
| 71 | Ga0070711_100062958 | 3300005439 | Bacteria | 2587 |
| 72 | Ga0070711_100135726 | 3300005439 | Bacteria | 1838 |
| 73 | Ga0070705_100005025 | 3300005440 | Bacteria | 6434 |
| 74 | Ga0070705_100141213 | 3300005440 | Bacteria | 1585 |
| 75 | Ga0070705_101001623 | 3300005440 | Bacteria | 678 |
| 76 | Ga0070700_100179598 | 3300005441 | Bacteria | 1472 |
| 77 | Ga0070700_100195867 | 3300005441 | Bacteria | 1416 |
| 78 | Ga0070700_100246164 | 3300005441 | Bacteria | 1280 |
| 79 | Ga0070694_100039533 | 3300005444 | Bacteria | 3140 |
| 80 | Ga0070694_100257513 | 3300005444 | Bacteria | 1322 |
| 81 | Ga0070694_100289354 | 3300005444 | Bacteria | 1252 |
| 82 | Ga0070663_100628945 | 3300005455 | Bacteria | 906 |
| 83 | Ga0070663_100828828 | 3300005455 | Bacteria | 795 |
| 84 | Ga0070663_101623125 | 3300005455 | Bacteria | 577 |
| 85 | Ga0070678_100001882 | 3300005456 | Bacteria | 11328 |
| 86 | Ga0070678_101182414 | 3300005456 | Bacteria | 709 |
| 87 | Ga0070678_101341327 | 3300005456 | Bacteria | 666 |
| 88 | Ga0070662_100106771 | 3300005457 | Bacteria | 2127 |
| 89 | Ga0070662_100121887 | 3300005457 | Bacteria | 2000 |
| 90 | Ga0070681_10000738 | 3300005458 | Bacteria | 27069 |
| 91 | Ga0070681_10001577 | 3300005458 | Bacteria | 20233 |
| 92 | Ga0070681_10015379 | 3300005458 | Bacteria | 7614 |
| 93 | Ga0070681_10024230 | 3300005458 | Bacteria | 6109 |
| 94 | Ga0070681_10048512 | 3300005458 | Bacteria | 4243 |
| 95 | Ga0070681_10049548 | 3300005458 | Bacteria | 4194 |
| 96 | Ga0070681_10141489 | 3300005458 | Bacteria | 2336 |
| 97 | Ga0070681_10740875 | 3300005458 | Bacteria | 899 |
| 98 | Ga0068867_100012777 | 3300005459 | Bacteria | 5940 |
| 99 | Ga0068867_100047736 | 3300005459 | Bacteria | 3148 |
| 100 | Ga0068867_100179522 | 3300005459 | Bacteria | 1682 |
| 101 | Ga0070685_10002528 | 3300005466 | Bacteria | 9382 |
| 102 | Ga0070685_10083125 | 3300005466 | Bacteria | 1923 |
| 103 | Ga0070685_10480368 | 3300005466 | Unclassified | 876 |
| 104 | Ga0070706_100293187 | 3300005467 | Bacteria | 1518 |
| 105 | Ga0070699_100022483 | 3300005518 | Bacteria | 5435 |
| 106 | Ga0070699_101116196 | 3300005518 | Bacteria | 723 |
| 107 | Ga0070679_100000469 | 3300005530 | Bacteria | 34407 |
| 108 | Ga0070679_100005515 | 3300005530 | Bacteria | 11722 |
| 109 | Ga0070679_100087639 | 3300005530 | Bacteria | 3100 |
| 110 | Ga0070679_100116286 | 3300005530 | Bacteria | 2659 |
| 111 | Ga0070679_100155886 | 3300005530 | Bacteria | 2258 |
| 112 | Ga0070679_101525989 | 3300005530 | Bacteria | 615 |
| 113 | Ga0070684_100513922 | 3300005535 | Bacteria | 1110 |
| 114 | Ga0070684_100575395 | 3300005535 | Bacteria | 1046 |
| 115 | Ga0068853_100250645 | 3300005539 | Bacteria | 1624 |
| 116 | Ga0068853_100286241 | 3300005539 | Bacteria | 1520 |
| 117 | Ga0068853_100526451 | 3300005539 | Bacteria | 1118 |
| 118 | Ga0068853_100570492 | 3300005539 | Bacteria | 1073 |
| 119 | Ga0070672_100027580 | 3300005543 | Bacteria | 4238 |
| 120 | Ga0070672_100029661 | 3300005543 | Bacteria | 4104 |
| 121 | Ga0070672_100054834 | 3300005543 | Bacteria | 3122 |
| 122 | Ga0070672_100167369 | 3300005543 | Bacteria | 1826 |
| 123 | Ga0070672_100530695 | 3300005543 | Bacteria | 1020 |
| 124 | Ga0070686_100002735 | 3300005544 | Bacteria | 9706 |
| 125 | Ga0070695_100009460 | 3300005545 | Bacteria | 5804 |
| 126 | Ga0070696_100020484 | 3300005546 | Bacteria | 4481 |
| 127 | Ga0070696_100092350 | 3300005546 | Bacteria | 2157 |
| 128 | Ga0070693_100040423 | 3300005547 | Bacteria | 2618 |
| 129 | Ga0070693_100287006 | 3300005547 | Bacteria | 1104 |
| 130 | Ga0070665_100000543 | 3300005548 | Bacteria | 52995 |
| 131 | Ga0070665_100006529 | 3300005548 | Bacteria | 11855 |
| 132 | Ga0070665_100009640 | 3300005548 | Bacteria | 9766 |
| 133 | Ga0070665_100029937 | 3300005548 | Bacteria | 5479 |
| 134 | Ga0070665_100032219 | 3300005548 | Bacteria | 5276 |
| 135 | Ga0070665_100053459 | 3300005548 | Bacteria | 4050 |
| 136 | Ga0070665_100107978 | 3300005548 | Bacteria | 2785 |
| 137 | Ga0070665_100341674 | 3300005548 | Bacteria | 1502 |
| 138 | Ga0070665_100391338 | 3300005548 | Bacteria | 1398 |
| 139 | Ga0070704_100053103 | 3300005549 | Bacteria | 2863 |
| 140 | Ga0070704_100405079 | 3300005549 | Bacteria | 1165 |
| 141 | Ga0068855_100001482 | 3300005563 | Bacteria | 29366 |
| 142 | Ga0068855_100001838 | 3300005563 | Bacteria | 26405 |
| 143 | Ga0068855_100094225 | 3300005563 | Bacteria | 3453 |
| 144 | Ga0068855_100169063 | 3300005563 | Bacteria | 2477 |
| 145 | Ga0068855_100318422 | 3300005563 | Bacteria | 1720 |
| 146 | Ga0070664_100276073 | 3300005564 | Bacteria | 1515 |
| 147 | Ga0070664_100966490 | 3300005564 | Bacteria | 800 |
| 148 | Ga0068857_100035066 | 3300005577 | Bacteria | 4441 |
| 149 | Ga0068857_100154869 | 3300005577 | Bacteria | 2078 |
| 150 | Ga0068857_100223179 | 3300005577 | Bacteria | 1722 |
| 151 | Ga0068854_100446984 | 3300005578 | Bacteria | 1079 |
| 152 | Ga0068856_100004498 | 3300005614 | Bacteria | 13867 |
| 153 | Ga0068856_100529173 | 3300005614 | Bacteria | 1200 |
| 154 | Ga0068856_100546507 | 3300005614 | Bacteria | 1179 |
| 155 | Ga0068856_100626688 | 3300005614 | Bacteria | 1096 |
| 156 | Ga0068856_100832996 | 3300005614 | Unclassified | 942 |
| 157 | Ga0070702_100006702 | 3300005615 | Bacteria | 5471 |
| 158 | Ga0070702_100009527 | 3300005615 | Bacteria | 4757 |
| 159 | Ga0068852_100366968 | 3300005616 | Bacteria | 1409 |
| 160 | Ga0068852_100439742 | 3300005616 | Bacteria | 1289 |
| 161 | Ga0068859_100000929 | 3300005617 | Bacteria | 29994 |
| 162 | Ga0068859_100009204 | 3300005617 | Bacteria | 9973 |
| 163 | Ga0068859_100125227 | 3300005617 | Bacteria | 2638 |
| 164 | Ga0068859_100228640 | 3300005617 | Bacteria | 1948 |
| 165 | Ga0068859_100354535 | 3300005617 | Bacteria | 1562 |
| 166 | Ga0068859_102080647 | 3300005617 | Bacteria | 627 |
| 167 | Ga0068864_100004892 | 3300005618 | Bacteria | 10973 |
| 168 | Ga0068866_10137770 | 3300005718 | Bacteria | 1397 |
| 169 | Ga0068861_100001663 | 3300005719 | Bacteria | 14225 |
| 170 | Ga0068861_100002156 | 3300005719 | Bacteria | 12755 |
| 171 | Ga0068861_100012276 | 3300005719 | Bacteria | 5975 |
| 172 | Ga0068861_100036200 | 3300005719 | Bacteria | 3661 |
| 173 | Ga0068861_100226488 | 3300005719 | Bacteria | 1583 |
| 174 | Ga0068861_101289985 | 3300005719 | Bacteria | 710 |
| 175 | Ga0068851_10179076 | 3300005834 | Bacteria | 1173 |
| 176 | Ga0068870_10134943 | 3300005840 | Bacteria | 1438 |
| 177 | Ga0068863_100001099 | 3300005841 | Bacteria | 27025 |
| 178 | Ga0068863_100048854 | 3300005841 | Bacteria | 4011 |
| 179 | Ga0068863_100060367 | 3300005841 | Bacteria | 3586 |
| 180 | Ga0068863_100414724 | 3300005841 | Bacteria | 1318 |
| 181 | Ga0068863_100469460 | 3300005841 | Bacteria | 1236 |
| 182 | Ga0068863_100500360 | 3300005841 | Bacteria | 1197 |
| 183 | Ga0068858_100002788 | 3300005842 | Bacteria | 17562 |
| 184 | Ga0068858_100024983 | 3300005842 | Bacteria | 5560 |
| 185 | Ga0068858_100029209 | 3300005842 | Bacteria | 5119 |
| 186 | Ga0068858_100029595 | 3300005842 | Bacteria | 5086 |
| 187 | Ga0068858_100110818 | 3300005842 | Bacteria | 2563 |
| 188 | Ga0068858_100253828 | 3300005842 | Bacteria | 1671 |
| 189 | Ga0068860_100002907 | 3300005843 | Bacteria | 17741 |
| 190 | Ga0068860_100055609 | 3300005843 | Bacteria | 3762 |
| 191 | Ga0068860_100171261 | 3300005843 | Bacteria | 2097 |
| 192 | Ga0068862_100013694 | 3300005844 | Bacteria | 6718 |
| 193 | Ga0068862_100024285 | 3300005844 | Bacteria | 5085 |
| 194 | Ga0068862_100158654 | 3300005844 | Bacteria | 2018 |
| 195 | Ga0068862_100162582 | 3300005844 | Bacteria | 1994 |
| 196 | Ga0068862_101006079 | 3300005844 | Bacteria | 825 |
| 197 | Ga0081455_10016058 | 3300005937 | Bacteria | 7243 |
| 198 | Ga0081539_10000028 | 3300005985 | Bacteria | 328182 |
| 199 | Ga0070717_10044415 | 3300006028 | Bacteria | 3628 |
| 200 | Ga0075432_10048877 | 3300006058 | Bacteria | 1489 |
| 201 | Ga0070715_10000714 | 3300006163 | Bacteria | 8928 |
| 202 | Ga0070716_100007820 | 3300006173 | Bacteria | 5283 |
| 203 | Ga0070716_100342283 | 3300006173 | Bacteria | 1055 |
| 204 | Ga0070712_100000750 | 3300006175 | Bacteria | 19154 |
| 205 | Ga0070712_100082000 | 3300006175 | Bacteria | 2339 |
| 206 | Ga0097621_100072320 | 3300006237 | Bacteria | 2852 |
| 207 | Ga0097621_100114721 | 3300006237 | Bacteria | 2280 |
| 208 | Ga0097621_100126691 | 3300006237 | Bacteria | 2169 |
| 209 | Ga0097621_100141911 | 3300006237 | Bacteria | 2053 |
| 210 | Ga0097621_100564154 | 3300006237 | Bacteria | 1037 |
| 211 | Ga0068871_100062807 | 3300006358 | Bacteria | 3036 |
| 212 | Ga0068871_100094236 | 3300006358 | Bacteria | 2499 |
| 213 | Ga0068871_100415797 | 3300006358 | Bacteria | 1200 |
| 214 | Ga0068871_100544488 | 3300006358 | Bacteria | 1051 |
| 215 | Ga0068871_100654374 | 3300006358 | Unclassified | 959 |
| 216 | Ga0075428_100002070 | 3300006844 | Bacteria | 21641 |
| 217 | Ga0075428_100004658 | 3300006844 | Bacteria | 15175 |
| 218 | Ga0075428_100012224 | 3300006844 | Bacteria | 9545 |
| 219 | Ga0075428_100038164 | 3300006844 | Bacteria | 5286 |
| 220 | Ga0075428_100380745 | 3300006844 | Bacteria | 1513 |
| 221 | Ga0075430_100075385 | 3300006846 | Bacteria | 2828 |
| 222 | Ga0075430_100336650 | 3300006846 | Bacteria | 1247 |
| 223 | Ga0075431_100000030 | 3300006847 | Bacteria | 72683 |
| 224 | Ga0075431_100018484 | 3300006847 | Bacteria | 7099 |
| 225 | Ga0075431_100256976 | 3300006847 | Bacteria | 1774 |
| 226 | Ga0075434_100551957 | 3300006871 | Bacteria | 1172 |
| 227 | Ga0075429_100006776 | 3300006880 | Bacteria | 9936 |
| 228 | Ga0075429_100100005 | 3300006880 | Bacteria | 2531 |
| 229 | Ga0075429_100107637 | 3300006880 | Bacteria | 2436 |
| 230 | Ga0075429_100679284 | 3300006880 | Bacteria | 902 |
| 231 | Ga0075429_101278567 | 3300006880 | Bacteria | 640 |
| 232 | Ga0068865_100005989 | 3300006881 | Bacteria | 7408 |
| 233 | Ga0068865_100032027 | 3300006881 | Bacteria | 3509 |
| 234 | Ga0068865_100154253 | 3300006881 | Bacteria | 1745 |
| 235 | Ga0068865_100256914 | 3300006881 | Bacteria | 1381 |
| 236 | Ga0097620_100000929 | 3300006931 | Bacteria | 29994 |
| 237 | Ga0097620_100009203 | 3300006931 | Bacteria | 9973 |
| 238 | Ga0097620_100125225 | 3300006931 | Bacteria | 2638 |
| 239 | Ga0097620_100228650 | 3300006931 | Bacteria | 1948 |
| 240 | Ga0097620_100354551 | 3300006931 | Bacteria | 1562 |
| 241 | Ga0097620_102080195 | 3300006931 | Bacteria | 627 |
| 242 | Ga0075435_100389863 | 3300007076 | Bacteria | 1197 |
| 243 | Ga0075435_100609771 | 3300007076 | Bacteria | 947 |
| 244 | Ga0099794_10011136 | 3300007265 | Bacteria | 3844 |
| 245 | Ga0099794_10021256 | 3300007265 | Bacteria | 2946 |
| 246 | Ga0099795_10037368 | 3300007788 | Bacteria | 1708 |
| 247 | Ga0105240_10002127 | 3300009093 | Bacteria | 32338 |
| 248 | Ga0105240_10002705 | 3300009093 | Bacteria | 28172 |
| 249 | Ga0105240_10009513 | 3300009093 | Bacteria | 13757 |
| 250 | Ga0105240_10019061 | 3300009093 | Bacteria | 9177 |
| 251 | Ga0105240_10043180 | 3300009093 | Bacteria | 5739 |
| 252 | Ga0105240_10062866 | 3300009093 | Bacteria | 4620 |
| 253 | Ga0105240_10268433 | 3300009093 | Bacteria | 1966 |
| 254 | Ga0105240_10578905 | 3300009093 | Bacteria | 1239 |
| 255 | Ga0105240_10779600 | 3300009093 | Bacteria | 1037 |
| 256 | Ga0105240_11130489 | 3300009093 | Unclassified | 832 |
| 257 | Ga0111539_10009762 | 3300009094 | Bacteria | 12114 |
| 258 | Ga0111539_10065955 | 3300009094 | Bacteria | 4276 |
| 259 | Ga0111539_10168629 | 3300009094 | Bacteria | 2558 |
| 260 | Ga0111539_10233281 | 3300009094 | Bacteria | 2142 |
| 261 | Ga0111539_10284440 | 3300009094 | Bacteria | 1925 |
| 262 | Ga0111539_10498440 | 3300009094 | Bacteria | 1418 |
| 263 | Ga0111539_10704175 | 3300009094 | Bacteria | 1176 |
| 264 | Ga0111539_11374338 | 3300009094 | Bacteria | 819 |
| 265 | Ga0105245_10019110 | 3300009098 | Bacteria | 5998 |
| 266 | Ga0105245_10541684 | 3300009098 | Bacteria | 1185 |
| 267 | Ga0105247_10000390 | 3300009101 | Bacteria | 37263 |
| 268 | Ga0105247_10008064 | 3300009101 | Bacteria | 6435 |
| 269 | Ga0105247_10065548 | 3300009101 | Bacteria | 2260 |
| 270 | Ga0105247_10434298 | 3300009101 | Unclassified | 943 |
| 271 | Ga0114129_10153233 | 3300009147 | Bacteria | 3154 |
| 272 | Ga0114129_10272428 | 3300009147 | Bacteria | 2264 |
| 273 | Ga0114129_10939058 | 3300009147 | Bacteria | 1093 |
| 274 | Ga0105243_10102731 | 3300009148 | Bacteria | 2376 |
| 275 | Ga0105243_10168742 | 3300009148 | Bacteria | 1893 |
| 276 | Ga0105243_10391033 | 3300009148 | Bacteria | 1289 |
| 277 | Ga0105243_11630474 | 3300009148 | Bacteria | 672 |
| 278 | Ga0105241_10034500 | 3300009174 | Bacteria | 3802 |
| 279 | Ga0105241_10473736 | 3300009174 | Bacteria | 1112 |
| 280 | Ga0105241_10541193 | 3300009174 | Bacteria | 1044 |
| 281 | Ga0105241_10940212 | 3300009174 | Bacteria | 805 |
| 282 | Ga0105242_10006693 | 3300009176 | Bacteria | 8894 |
| 283 | Ga0105242_10019979 | 3300009176 | Bacteria | 5248 |
| 284 | Ga0105242_10648072 | 3300009176 | Bacteria | 1027 |
| 285 | Ga0105248_10001404 | 3300009177 | Bacteria | 26898 |
| 286 | Ga0105248_10010920 | 3300009177 | Bacteria | 10020 |
| 287 | Ga0105248_10030432 | 3300009177 | Bacteria | 6027 |
| 288 | Ga0105248_10075402 | 3300009177 | Bacteria | 3791 |
| 289 | Ga0105248_11171076 | 3300009177 | Bacteria | 869 |
| 290 | Ga0105248_11812101 | 3300009177 | Bacteria | 692 |
| 291 | Ga0105237_10007658 | 3300009545 | Bacteria | 11802 |
| 292 | Ga0105237_10162994 | 3300009545 | Bacteria | 2228 |
| 293 | Ga0105237_10217056 | 3300009545 | Bacteria | 1913 |
| 294 | Ga0105237_10793924 | 3300009545 | Bacteria | 953 |
| 295 | Ga0105238_10005376 | 3300009551 | Bacteria | 12659 |
| 296 | Ga0105238_10078897 | 3300009551 | Bacteria | 3282 |
| 297 | Ga0105238_10131609 | 3300009551 | Bacteria | 2480 |
| 298 | Ga0105238_10406644 | 3300009551 | Bacteria | 1355 |
| 299 | Ga0105238_10486809 | 3300009551 | Bacteria | 1233 |
| 300 | Ga0105238_10947601 | 3300009551 | Unclassified | 880 |
| 301 | Ga0105249_10036444 | 3300009553 | Bacteria | 4461 |
| 302 | Ga0105249_10073971 | 3300009553 | Bacteria | 3153 |
| 303 | Ga0105249_10186168 | 3300009553 | Bacteria | 2023 |
| 304 | Ga0105249_10349425 | 3300009553 | Bacteria | 1498 |
| 305 | Ga0105249_10459195 | 3300009553 | Bacteria | 1313 |
| 306 | Ga0105249_10559372 | 3300009553 | Bacteria | 1195 |
| 307 | Ga0099796_10004014 | 3300010159 | Bacteria | 3503 |
| 308 | Ga0099796_10027107 | 3300010159 | Bacteria | 1827 |
| 309 | Ga0105239_10019263 | 3300010375 | Bacteria | 7537 |
| 310 | Ga0105239_10233748 | 3300010375 | Bacteria | 2063 |
| 311 | Ga0105239_11375874 | 3300010375 | Bacteria | 815 |
| 312 | Ga0105246_10333158 | 3300011119 | Bacteria | 1238 |
| 313 | Ga0105246_10836110 | 3300011119 | Bacteria | 820 |
| 314 | Ga0157370_10001472 | 3300013104 | Bacteria | 29117 |
| 315 | Ga0157370_10263999 | 3300013104 | Bacteria | 1591 |
| 316 | Ga0157369_10000841 | 3300013105 | Bacteria | 39257 |
| 317 | Ga0157369_10068740 | 3300013105 | Bacteria | 3806 |
| 318 | Ga0157369_10102450 | 3300013105 | Bacteria | 3051 |
| 319 | Ga0157369_11025486 | 3300013105 | Bacteria | 844 |
| 320 | Ga0157374_10032183 | 3300013296 | Bacteria | 4773 |
| 321 | Ga0157374_11018673 | 3300013296 | Bacteria | 847 |
| 322 | Ga0157374_11110920 | 3300013296 | Bacteria | 811 |
| 323 | Ga0157378_10019771 | 3300013297 | Bacteria | 5922 |
| 324 | Ga0163162_10080582 | 3300013306 | Bacteria | 3324 |
| 325 | Ga0163162_10598608 | 3300013306 | Bacteria | 1229 |
| 326 | Ga0163162_10608667 | 3300013306 | Bacteria | 1218 |
| 327 | Ga0163162_10892668 | 3300013306 | Bacteria | 1002 |
| 328 | Ga0157372_10473686 | 3300013307 | Bacteria | 1460 |
| 329 | Ga0157375_10007357 | 3300013308 | Bacteria | 9640 |
| 330 | Ga0157375_10052757 | 3300013308 | Bacteria | 3999 |
| 331 | Ga0157375_10094100 | 3300013308 | Bacteria | 3064 |
| 332 | Ga0157375_10465439 | 3300013308 | Bacteria | 1430 |
| 333 | Ga0157375_12095973 | 3300013308 | Bacteria | 673 |
| 334 | Ga0163163_10003787 | 3300014325 | Bacteria | 12882 |
| 335 | Ga0163163_10109595 | 3300014325 | Bacteria | 2788 |
| 336 | Ga0163163_10426054 | 3300014325 | Bacteria | 1386 |
| 337 | Ga0163163_10444905 | 3300014325 | Bacteria | 1356 |
| 338 | Ga0157380_10000110 | 3300014326 | Bacteria | 44612 |
| 339 | Ga0157380_10121662 | 3300014326 | Bacteria | 2212 |
| 340 | Ga0157380_10182007 | 3300014326 | Bacteria | 1847 |
| 341 | Ga0157380_10288471 | 3300014326 | Bacteria | 1505 |
| 342 | Ga0157380_10752052 | 3300014326 | Bacteria | 986 |
| 343 | Ga0157380_11600129 | 3300014326 | Unclassified | 707 |
| 344 | Ga0157377_10289230 | 3300014745 | Bacteria | 1077 |
| 345 | Ga0157377_10686463 | 3300014745 | Bacteria | 742 |
| 346 | Ga0157379_10020721 | 3300014968 | Bacteria | 5818 |
| 347 | Ga0157379_10029861 | 3300014968 | Bacteria | 4848 |
| 348 | Ga0157379_10063423 | 3300014968 | Bacteria | 3304 |
| 349 | Ga0157379_10254981 | 3300014968 | Bacteria | 1593 |
| 350 | Ga0157379_10276329 | 3300014968 | Bacteria | 1528 |
| 351 | Ga0157379_10373013 | 3300014968 | Bacteria | 1308 |
| 352 | Ga0157376_10144586 | 3300014969 | Bacteria | 2137 |
| 353 | Ga0157376_10150207 | 3300014969 | Bacteria | 2100 |
| 354 | Ga0157376_10290937 | 3300014969 | Bacteria | 1542 |
| 355 | Ga0157376_10553980 | 3300014969 | Bacteria | 1138 |
| 356 | Ga0163161_10131136 | 3300017792 | Bacteria | 1891 |
| 357 | Ga0163161_10197194 | 3300017792 | Bacteria | 1550 |
| 358 | Ga0213874_10003273 | 3300021377 | Bacteria | 3575 |
| 359 | Ga0213874_10015214 | 3300021377 | Bacteria | 2026 |
| 360 | Ga0213876_10063757 | 3300021384 | Bacteria | 1946 |
| 361 | Ga0207682_10003425 | 3300025893 | Bacteria | 6901 |
| 362 | Ga0207682_10010135 | 3300025893 | Bacteria | 3698 |
| 363 | Ga0207692_10119187 | 3300025898 | Bacteria | 1475 |
| 364 | Ga0207692_10322806 | 3300025898 | Bacteria | 945 |
| 365 | Ga0207642_10056367 | 3300025899 | Bacteria | 1802 |
| 366 | Ga0207642_10605368 | 3300025899 | Bacteria | 682 |
| 367 | Ga0207710_10000349 | 3300025900 | Bacteria | 33438 |
| 368 | Ga0207710_10039830 | 3300025900 | Bacteria | 2081 |
| 369 | Ga0207688_10073680 | 3300025901 | Bacteria | 1941 |
| 370 | Ga0207680_10009849 | 3300025903 | Bacteria | 4758 |
| 371 | Ga0207680_10024115 | 3300025903 | Bacteria | 3333 |
| 372 | Ga0207680_10036291 | 3300025903 | Bacteria | 2838 |
| 373 | Ga0207680_10315088 | 3300025903 | Bacteria | 1093 |
| 374 | Ga0207685_10010026 | 3300025905 | Bacteria | 2778 |
| 375 | Ga0207699_10017383 | 3300025906 | Bacteria | 3783 |
| 376 | Ga0207699_10067788 | 3300025906 | Bacteria | 2171 |
| 377 | Ga0207699_10094380 | 3300025906 | Bacteria | 1884 |
| 378 | Ga0207699_10122333 | 3300025906 | Bacteria | 1685 |
| 379 | Ga0207699_10279916 | 3300025906 | Bacteria | 1159 |
| 380 | Ga0207645_10054717 | 3300025907 | Bacteria | 2548 |
| 381 | Ga0207645_10063416 | 3300025907 | Bacteria | 2361 |
| 382 | Ga0207645_10716960 | 3300025907 | Bacteria | 680 |
| 383 | Ga0207643_10046737 | 3300025908 | Bacteria | 2447 |
| 384 | Ga0207654_10037130 | 3300025911 | Bacteria | 2725 |
| 385 | Ga0207707_10000122 | 3300025912 | Bacteria | 80159 |
| 386 | Ga0207707_10001614 | 3300025912 | Bacteria | 20779 |
| 387 | Ga0207707_10014611 | 3300025912 | Bacteria | 6840 |
| 388 | Ga0207707_10025599 | 3300025912 | Bacteria | 5161 |
| 389 | Ga0207707_10054459 | 3300025912 | Bacteria | 3482 |
| 390 | Ga0207707_10083736 | 3300025912 | Bacteria | 2785 |
| 391 | Ga0207695_10003540 | 3300025913 | Bacteria | 21874 |
| 392 | Ga0207695_10032858 | 3300025913 | Bacteria | 5672 |
| 393 | Ga0207695_10045635 | 3300025913 | Bacteria | 4650 |
| 394 | Ga0207695_10051308 | 3300025913 | Bacteria | 4332 |
| 395 | Ga0207695_10070636 | 3300025913 | Bacteria | 3568 |
| 396 | Ga0207695_10094832 | 3300025913 | Bacteria | 2990 |
| 397 | Ga0207695_10195446 | 3300025913 | Bacteria | 1939 |
| 398 | Ga0207695_10615611 | 3300025913 | Bacteria | 967 |
| 399 | Ga0207671_10020859 | 3300025914 | Bacteria | 4982 |
| 400 | Ga0207671_10869086 | 3300025914 | Unclassified | 714 |
| 401 | Ga0207693_10000083 | 3300025915 | Bacteria | 84611 |
| 402 | Ga0207693_10045814 | 3300025915 | Bacteria | 3436 |
| 403 | Ga0207663_10036366 | 3300025916 | Bacteria | 2962 |
| 404 | Ga0207663_10365554 | 3300025916 | Bacteria | 1096 |
| 405 | Ga0207660_10001933 | 3300025917 | Bacteria | 13827 |
| 406 | Ga0207660_10024344 | 3300025917 | Bacteria | 4099 |
| 407 | Ga0207660_10131916 | 3300025917 | Bacteria | 1902 |
| 408 | Ga0207660_10169745 | 3300025917 | Bacteria | 1688 |
| 409 | Ga0207662_10003138 | 3300025918 | Bacteria | 8448 |
| 410 | Ga0207662_10039816 | 3300025918 | Bacteria | 2759 |
| 411 | Ga0207662_10172241 | 3300025918 | Bacteria | 1388 |
| 412 | Ga0207662_10331532 | 3300025918 | Bacteria | 1018 |
| 413 | Ga0207657_10286473 | 3300025919 | Bacteria | 1307 |
| 414 | Ga0207649_10098602 | 3300025920 | Bacteria | 1929 |
| 415 | Ga0207649_10376931 | 3300025920 | Bacteria | 1056 |
| 416 | Ga0207649_10934033 | 3300025920 | Bacteria | 681 |
| 417 | Ga0207652_10000613 | 3300025921 | Bacteria | 35518 |
| 418 | Ga0207652_10008803 | 3300025921 | Bacteria | 8128 |
| 419 | Ga0207652_10127330 | 3300025921 | Bacteria | 2269 |
| 420 | Ga0207652_10398702 | 3300025921 | Bacteria | 1241 |
| 421 | Ga0207681_10105768 | 3300025923 | Bacteria | 2038 |
| 422 | Ga0207681_10252197 | 3300025923 | Bacteria | 1378 |
| 423 | Ga0207694_10041971 | 3300025924 | Bacteria | 3527 |
| 424 | Ga0207694_10044756 | 3300025924 | Bacteria | 3417 |
| 425 | Ga0207694_10092589 | 3300025924 | Bacteria | 2386 |
| 426 | Ga0207694_10481610 | 3300025924 | Bacteria | 1038 |
| 427 | Ga0207694_10830833 | 3300025924 | Bacteria | 781 |
| 428 | Ga0207694_10846327 | 3300025924 | Unclassified | 773 |
| 429 | Ga0207650_10446284 | 3300025925 | Bacteria | 1076 |
| 430 | Ga0207650_10478583 | 3300025925 | Bacteria | 1039 |
| 431 | Ga0207659_10006597 | 3300025926 | Bacteria | 7125 |
| 432 | Ga0207659_10128580 | 3300025926 | Bacteria | 1951 |
| 433 | Ga0207659_10545303 | 3300025926 | Bacteria | 985 |
| 434 | Ga0207659_10566304 | 3300025926 | Bacteria | 967 |
| 435 | Ga0207700_10011337 | 3300025928 | Bacteria | 5679 |
| 436 | Ga0207700_10026505 | 3300025928 | Bacteria | 4042 |
| 437 | Ga0207664_10013517 | 3300025929 | Bacteria | 5863 |
| 438 | Ga0207664_10043030 | 3300025929 | Bacteria | 3529 |
| 439 | Ga0207664_10047267 | 3300025929 | Bacteria | 3380 |
| 440 | Ga0207644_10000660 | 3300025931 | Bacteria | 21820 |
| 441 | Ga0207644_10174134 | 3300025931 | Bacteria | 1682 |
| 442 | Ga0207706_10055844 | 3300025933 | Bacteria | 3482 |
| 443 | Ga0207706_10323827 | 3300025933 | Bacteria | 1341 |
| 444 | Ga0207686_10411020 | 3300025934 | Bacteria | 1033 |
| 445 | Ga0207670_10019610 | 3300025936 | Bacteria | 4134 |
| 446 | Ga0207670_10204666 | 3300025936 | Bacteria | 1501 |
| 447 | Ga0207669_10035440 | 3300025937 | Bacteria | 2839 |
| 448 | Ga0207669_10097759 | 3300025937 | Bacteria | 1931 |
| 449 | Ga0207669_10319320 | 3300025937 | Bacteria | 1188 |
| 450 | Ga0207704_10047013 | 3300025938 | Bacteria | 2577 |
| 451 | Ga0207704_10050165 | 3300025938 | Bacteria | 2516 |
| 452 | Ga0207704_10090212 | 3300025938 | Bacteria | 2010 |
| 453 | Ga0207704_10151418 | 3300025938 | Bacteria | 1637 |
| 454 | Ga0207704_10175278 | 3300025938 | Bacteria | 1543 |
| 455 | Ga0207665_10000587 | 3300025939 | Bacteria | 24539 |
| 456 | Ga0207665_10015240 | 3300025939 | Bacteria | 5049 |
| 457 | Ga0207665_10141497 | 3300025939 | Bacteria | 1716 |
| 458 | Ga0207691_10000808 | 3300025940 | Bacteria | 31167 |
| 459 | Ga0207691_10020237 | 3300025940 | Bacteria | 6293 |
| 460 | Ga0207691_10155413 | 3300025940 | Bacteria | 2009 |
| 461 | Ga0207691_10269659 | 3300025940 | Bacteria | 1466 |
| 462 | Ga0207711_10019836 | 3300025941 | Bacteria | 5603 |
| 463 | Ga0207711_10020918 | 3300025941 | Bacteria | 5462 |
| 464 | Ga0207711_10175845 | 3300025941 | Bacteria | 1945 |
| 465 | Ga0207689_10006816 | 3300025942 | Bacteria | 10046 |
| 466 | Ga0207689_10068790 | 3300025942 | Bacteria | 2910 |
| 467 | Ga0207689_10586526 | 3300025942 | Bacteria | 937 |
| 468 | Ga0207661_10393241 | 3300025944 | Bacteria | 1256 |
| 469 | Ga0207661_10967791 | 3300025944 | Unclassified | 784 |
| 470 | Ga0207679_10035222 | 3300025945 | Bacteria | 3539 |
| 471 | Ga0207679_10255264 | 3300025945 | Bacteria | 1493 |
| 472 | Ga0207679_11287257 | 3300025945 | Unclassified | 671 |
| 473 | Ga0207667_10000798 | 3300025949 | Bacteria | 40876 |
| 474 | Ga0207667_10004634 | 3300025949 | Bacteria | 16866 |
| 475 | Ga0207667_10049362 | 3300025949 | Bacteria | 4444 |
| 476 | Ga0207667_10297061 | 3300025949 | Bacteria | 1650 |
| 477 | Ga0207667_10419651 | 3300025949 | Bacteria | 1361 |
| 478 | Ga0207651_10012726 | 3300025960 | Bacteria | 4777 |
| 479 | Ga0207651_10021532 | 3300025960 | Bacteria | 3921 |
| 480 | Ga0207651_10044659 | 3300025960 | Bacteria | 2967 |
| 481 | Ga0207651_10130569 | 3300025960 | Bacteria | 1922 |
| 482 | Ga0207651_10420972 | 3300025960 | Bacteria | 1140 |
| 483 | Ga0207712_10041797 | 3300025961 | Bacteria | 3153 |
| 484 | Ga0207712_10046720 | 3300025961 | Bacteria | 3003 |
| 485 | Ga0207668_10044717 | 3300025972 | Bacteria | 3015 |
| 486 | Ga0207668_10621621 | 3300025972 | Bacteria | 943 |
| 487 | Ga0207658_10435869 | 3300025986 | Bacteria | 1158 |
| 488 | Ga0207658_10768776 | 3300025986 | Bacteria | 873 |
| 489 | Ga0207658_11501410 | 3300025986 | Bacteria | 616 |
| 490 | Ga0207677_10044619 | 3300026023 | Bacteria | 2955 |
| 491 | Ga0207677_10497306 | 3300026023 | Bacteria | 1053 |
| 492 | Ga0207703_10002919 | 3300026035 | Bacteria | 14548 |
| 493 | Ga0207703_10004149 | 3300026035 | Bacteria | 11947 |
| 494 | Ga0207703_10071608 | 3300026035 | Bacteria | 2864 |
| 495 | Ga0207703_10122843 | 3300026035 | Bacteria | 2231 |
| 496 | Ga0207703_10226563 | 3300026035 | Bacteria | 1674 |
| 497 | Ga0207703_10463879 | 3300026035 | Unclassified | 1185 |
| 498 | Ga0207639_10174985 | 3300026041 | Bacteria | 1821 |
| 499 | Ga0207639_10197304 | 3300026041 | Bacteria | 1723 |
| 500 | Ga0207678_10057667 | 3300026067 | Bacteria | 3342 |
| 501 | Ga0207678_10143351 | 3300026067 | Bacteria | 2039 |
| 502 | Ga0207708_10126206 | 3300026075 | Bacteria | 1997 |
| 503 | Ga0207708_10143037 | 3300026075 | Bacteria | 1878 |
| 504 | Ga0207708_10262327 | 3300026075 | Bacteria | 1395 |
| 505 | Ga0207702_10021375 | 3300026078 | Bacteria | 5357 |
| 506 | Ga0207702_10024278 | 3300026078 | Bacteria | 5030 |
| 507 | Ga0207702_10449937 | 3300026078 | Bacteria | 1249 |
| 508 | Ga0207702_11134358 | 3300026078 | Bacteria | 776 |
| 509 | Ga0207641_10000266 | 3300026088 | Bacteria | 66298 |
| 510 | Ga0207641_10004267 | 3300026088 | Bacteria | 12427 |
| 511 | Ga0207641_10072695 | 3300026088 | Bacteria | 2962 |
| 512 | Ga0207641_10078506 | 3300026088 | Bacteria | 2859 |
| 513 | Ga0207648_10011589 | 3300026089 | Bacteria | 8302 |
| 514 | Ga0207648_10307452 | 3300026089 | Bacteria | 1423 |
| 515 | Ga0207648_10420128 | 3300026089 | Bacteria | 1214 |
| 516 | Ga0207648_10538471 | 3300026089 | Bacteria | 1071 |
| 517 | Ga0207648_10550578 | 3300026089 | Bacteria | 1060 |
| 518 | Ga0207676_10000965 | 3300026095 | Bacteria | 22224 |
| 519 | Ga0207674_10045038 | 3300026116 | Bacteria | 4541 |
| 520 | Ga0207674_10324191 | 3300026116 | Bacteria | 1490 |
| 521 | Ga0207675_100001909 | 3300026118 | Bacteria | 20795 |
| 522 | Ga0207675_100017235 | 3300026118 | Bacteria | 6745 |
| 523 | Ga0207675_100021368 | 3300026118 | Bacteria | 6028 |
| 524 | Ga0207675_100108282 | 3300026118 | Bacteria | 2621 |
| 525 | Ga0207675_100262014 | 3300026118 | Bacteria | 1676 |
| 526 | Ga0207683_10002455 | 3300026121 | Bacteria | 16158 |
| 527 | Ga0207683_10012739 | 3300026121 | Bacteria | 7176 |
| 528 | Ga0207683_10418636 | 3300026121 | Bacteria | 1234 |
| 529 | Ga0207683_10988293 | 3300026121 | Bacteria | 781 |
| 530 | Ga0207428_10018642 | 3300027907 | Bacteria | 5924 |
| 531 | Ga0207428_10037638 | 3300027907 | Bacteria | 3935 |
| 532 | Ga0207428_10053868 | 3300027907 | Bacteria | 3206 |
| 533 | Ga0207428_10077052 | 3300027907 | Bacteria | 2610 |
| 534 | Ga0265356_1001033 | 3300028017 | Bacteria | 4386 |
| 535 | Ga0268266_10000159 | 3300028379 | Bacteria | 126969 |
| 536 | Ga0268266_10004018 | 3300028379 | Bacteria | 14227 |
| 537 | Ga0268266_10018604 | 3300028379 | Bacteria | 5921 |
| 538 | Ga0268266_10020525 | 3300028379 | Bacteria | 5631 |
| 539 | Ga0268266_10021131 | 3300028379 | Bacteria | 5545 |
| 540 | Ga0268266_10021707 | 3300028379 | Bacteria | 5471 |
| 541 | Ga0268266_10036776 | 3300028379 | Bacteria | 4170 |
| 542 | Ga0268266_10103250 | 3300028379 | Bacteria | 2515 |
| 543 | Ga0268266_10113600 | 3300028379 | Bacteria | 2402 |
| 544 | Ga0268266_10229263 | 3300028379 | Bacteria | 1710 |
| 545 | Ga0268266_10474874 | 3300028379 | Bacteria | 1191 |
| 546 | Ga0268265_10015831 | 3300028380 | Bacteria | 5170 |
| 547 | Ga0268265_10026933 | 3300028380 | Bacteria | 4096 |
| 548 | Ga0268265_10085663 | 3300028380 | Bacteria | 2502 |
| 549 | Ga0268265_10269110 | 3300028380 | Bacteria | 1519 |
| 550 | Ga0268265_10400670 | 3300028380 | Bacteria | 1268 |
| 551 | Ga0268265_10421531 | 3300028380 | Bacteria | 1239 |
| 552 | Ga0268265_10486922 | 3300028380 | Bacteria | 1160 |
| 553 | Ga0268265_10513957 | 3300028380 | Bacteria | 1131 |
| 554 | Ga0268264_10000047 | 3300028381 | Bacteria | 349944 |
| 555 | Ga0268264_10000140 | 3300028381 | Bacteria | 171592 |
| 556 | Ga0268264_10037266 | 3300028381 | Bacteria | 4009 |
| 557 | Ga0268264_10326291 | 3300028381 | Bacteria | 1453 |
| 558 | Ga0265334_10012381 | 3300028573 | Bacteria | 3585 |
| 559 | Ga0307517_10215405 | 3300028786 | Unclassified | 1176 |
| 560 | Ga0307515_10001652 | 3300028794 | Bacteria | 49628 |
| 561 | Ga0307515_10121290 | 3300028794 | Bacteria | 2958 |
| 562 | Ga0307515_10195041 | 3300028794 | Bacteria | 1921 |
| 563 | Ga0307515_10606956 | 3300028794 | Unclassified | 705 |
| 564 | Ga0307511_10000268 | 3300030521 | Bacteria | 54105 |
| 565 | Ga0307511_10051996 | 3300030521 | Bacteria | 3273 |
| 566 | Ga0265770_1000007 | 3300030878 | Bacteria | 20558 |
| 567 | Ga0265760_10005135 | 3300031090 | Bacteria | 3751 |
| 568 | Ga0265760_10098769 | 3300031090 | Bacteria | 921 |
| 569 | Ga0265340_10275247 | 3300031247 | Bacteria | 748 |
| 570 | Ga0265339_10226767 | 3300031249 | Bacteria | 912 |
| 571 | Ga0265331_10002039 | 3300031250 | Bacteria | 13998 |
| 572 | Ga0307513_10049297 | 3300031456 | Bacteria | 4563 |
| 573 | Ga0307513_10053175 | 3300031456 | Bacteria | 4355 |
| 574 | Ga0307513_10113314 | 3300031456 | Bacteria | 2700 |
| 575 | Ga0307513_10115262 | 3300031456 | Bacteria | 2670 |
| 576 | Ga0307513_10181146 | 3300031456 | Bacteria | 1970 |
| 577 | Ga0307509_10001396 | 3300031507 | Bacteria | 40975 |
| 578 | Ga0307509_10042256 | 3300031507 | Bacteria | 4942 |
| 579 | Ga0307509_10059381 | 3300031507 | Bacteria | 4047 |
| 580 | Ga0307509_10643087 | 3300031507 | Bacteria | 730 |
| 581 | Ga0307408_100134284 | 3300031548 | Bacteria | 1934 |
| 582 | Ga0307508_10207321 | 3300031616 | Bacteria | 1561 |
| 583 | Ga0316576_10051790 | 3300031727 | Bacteria | 2988 |
| 584 | Ga0316576_10068868 | 3300031727 | Bacteria | 2609 |
| 585 | Ga0316576_10096611 | 3300031727 | Bacteria | 2205 |
| 586 | Ga0316576_10201666 | 3300031727 | Bacteria | 1499 |
| 587 | Ga0316578_10431437 | 3300031728 | Bacteria | 780 |
| 588 | Ga0307516_10002208 | 3300031730 | Bacteria | 26358 |
| 589 | Ga0307405_10048178 | 3300031731 | Bacteria | 2627 |
| 590 | Ga0307405_10620416 | 3300031731 | Bacteria | 885 |
| 591 | Ga0307413_10010738 | 3300031824 | Bacteria | 4460 |
| 592 | Ga0307413_10030393 | 3300031824 | Bacteria | 3034 |
| 593 | Ga0307413_10254987 | 3300031824 | Bacteria | 1304 |
| 594 | Ga0307413_10282177 | 3300031824 | Bacteria | 1250 |
| 595 | Ga0307410_10006032 | 3300031852 | Bacteria | 6496 |
| 596 | Ga0307410_10111930 | 3300031852 | Bacteria | 1976 |
| 597 | Ga0307406_10010319 | 3300031901 | Bacteria | 5264 |
| 598 | Ga0307406_10220386 | 3300031901 | Bacteria | 1410 |
| 599 | Ga0307406_10271691 | 3300031901 | Bacteria | 1288 |
| 600 | Ga0307406_10609286 | 3300031901 | Bacteria | 901 |
| 601 | Ga0307406_10859982 | 3300031901 | Bacteria | 769 |
| 602 | Ga0307407_10015668 | 3300031903 | Bacteria | 3756 |
| 603 | Ga0307407_10041476 | 3300031903 | Bacteria | 2574 |
| 604 | Ga0307412_10286848 | 3300031911 | Bacteria | 1295 |
| 605 | Ga0307412_10691078 | 3300031911 | Bacteria | 875 |
| 606 | Ga0307412_11447345 | 3300031911 | Bacteria | 623 |
| 607 | Ga0307409_100189418 | 3300031995 | Bacteria | 1830 |
| 608 | Ga0307409_100427238 | 3300031995 | Bacteria | 1272 |
| 609 | Ga0307409_100677127 | 3300031995 | Bacteria | 1028 |
| 610 | Ga0307416_100192517 | 3300032002 | Bacteria | 1925 |
| 611 | Ga0307416_100368594 | 3300032002 | Bacteria | 1461 |
| 612 | Ga0307416_100458569 | 3300032002 | Bacteria | 1329 |
| 613 | Ga0307416_101119484 | 3300032002 | Bacteria | 892 |
| 614 | Ga0307416_102014556 | 3300032002 | Bacteria | 680 |
| 615 | Ga0307414_10459409 | 3300032004 | Bacteria | 1119 |
| 616 | Ga0307414_11059891 | 3300032004 | Bacteria | 748 |
| 617 | Ga0307411_10014764 | 3300032005 | Bacteria | 4359 |
| 618 | Ga0307411_10078816 | 3300032005 | Bacteria | 2259 |
| 619 | Ga0307411_10160080 | 3300032005 | Bacteria | 1685 |
| 620 | Ga0307411_10272327 | 3300032005 | Bacteria | 1343 |
| 621 | Ga0307411_10399134 | 3300032005 | Bacteria | 1136 |
| 622 | Ga0307411_10544499 | 3300032005 | Bacteria | 989 |
| 623 | Ga0307411_10763428 | 3300032005 | Unclassified | 848 |
| 624 | Ga0307411_11100196 | 3300032005 | Bacteria | 716 |
| 625 | Ga0307411_11380182 | 3300032005 | Bacteria | 644 |
| 626 | Ga0307415_100061002 | 3300032126 | Bacteria | 2609 |
| 627 | Ga0307415_100115502 | 3300032126 | Bacteria | 2001 |
| 628 | Ga0307415_100171048 | 3300032126 | Bacteria | 1694 |
| 629 | Ga0307415_100180680 | 3300032126 | Bacteria | 1655 |
| 630 | Ga0307415_100511231 | 3300032126 | Bacteria | 1052 |
| 631 | Ga0307415_100534046 | 3300032126 | Bacteria | 1032 |
| 632 | Ga0307415_100825375 | 3300032126 | Bacteria | 848 |
| 633 | Ga0307507_10426193 | 3300033179 | Unclassified | 743 |
| 634 | Ga0307510_10005539 | 3300033180 | Bacteria | 15049 |
| 635 | Ga0307510_10256592 | 3300033180 | Bacteria | 1232 |
| 636 | Ga0373923_0009894 | 3300035111 | Bacteria | 3454 |
| 637 | Ga0373923_0077208 | 3300035111 | Bacteria | 1440 |
| 638 | Ga0373936_0013613 | 3300035113 | Bacteria | 3104 |
| 639 | Ga0373945_0211837 | 3300035116 | Bacteria | 808 |
| 640 | Ga0373956_0164325 | 3300035119 | Bacteria | 1047 |
| 641 | Ga0373957_0055727 | 3300035120 | Bacteria | 1521 |
| 642 | Ga0373957_0068871 | 3300035120 | Bacteria | 1381 |
| 643 | Ga0373957_0131475 | 3300035120 | Bacteria | 1019 |
| 644 | Ga0373960_0077475 | 3300035121 | Bacteria | 1040 |
| 645 | Ga0373943_0326457 | 3300035170 | Bacteria | 876 |
| 646 | Ga0373946_0234066 | 3300035171 | Bacteria | 891 |
| 647 | Ga0373955_0009251 | 3300035172 | Bacteria | 4613 |
| 648 | Ga0373955_0069928 | 3300035172 | Bacteria | 1960 |
| 649 | Ga0373961_0016704 | 3300035241 | Bacteria | 1894 |
| 650 | Ga0373962_0115306 | 3300035242 | Bacteria | 852 |
| 651 | Ga0316574_0010344 | 3300035398 | Bacteria | 5269 |
| 652 | Ga0316574_0014494 | 3300035398 | Bacteria | 4557 |
| 653 | Ga0316574_0016384 | 3300035398 | Bacteria | 4319 |
| 654 | Ga0316574_0025283 | 3300035398 | Bacteria | 3563 |
| 655 | Ga0316574_0138730 | 3300035398 | Bacteria | 1566 |
| 656 | Ga0316574_0141004 | 3300035398 | Unclassified | 1553 |
| 657 | Ga0316574_0264702 | 3300035398 | Bacteria | 1097 |
| 658 | Ga0373931_0775174 | 3300035691 | Bacteria | 638 |
| 659 | Ga0373927_0020690 | 3300035695 | Bacteria | 4315 |
| 660 | Ga0373927_0269784 | 3300035695 | Bacteria | 1119 |
| 661 | Ga0373933_0180346 | 3300035724 | Bacteria | 1347 |
| 662 | Ga0373937_0006608 | 3300036401 | Bacteria | 10014 |
| 663 | Ga0373937_0025980 | 3300036401 | Bacteria | 5289 |
| 664 | Ga0373937_0088213 | 3300036401 | Bacteria | 2872 |
| 665 | Ga0373937_0259964 | 3300036401 | Bacteria | 1637 |
| 666 | Ga0316584_0003331 | 3300036712 | Bacteria | 10410 |
| 667 | Ga0316584_0187258 | 3300036712 | Bacteria | 1531 |
| 668 | Ga0436364_1238211 | 3300037853 | Bacteria | 791 |
| 669 | Ga0436365_1772567 | 3300039437 | Bacteria | 10964 |
| 670 | Ga0436365_1859648 | 3300039437 | Bacteria | 1448 |
| 671 | Ga0436360_0066373 | 3300039438 | Bacteria | 2182 |
| 672 | Ga0436360_0659686 | 3300039438 | Bacteria | 2043 |
| 673 | Ga0436360_0995015 | 3300039438 | Bacteria | 3240 |
| 674 | Ga0436361_0066890 | 3300039447 | Bacteria | 3227 |
| 675 | Ga0436361_0251740 | 3300039447 | Bacteria | 1320 |
| 676 | Ga0436363_0461713 | 3300039450 | Bacteria | 4270 |
| 677 | Ga0436363_0641697 | 3300039450 | Bacteria | 6231 |
| 678 | Ga0436363_1646651 | 3300039450 | Bacteria | 6351 |
| 679 | Ga0436362_0815706 | 3300039453 | Bacteria | 796 |
| 680 | Ga0436362_1231019 | 3300039453 | Bacteria | 1153 |
| 681 | Ga0451789_0293465 | 3300041443 | Bacteria | 1492 |
| 682 | Ga0451791_0653772 | 3300041451 | Bacteria | 3342 |
| 683 | Ga0451793_0640635 | 3300041452 | Bacteria | 2133 |
| 684 | Ga0451793_0947639 | 3300041452 | Bacteria | 869 |
| 685 | Ga0451797_0966810 | 3300041453 | Bacteria | 2540 |
| 686 | Ga0451800_0973983 | 3300041459 | Bacteria | 808 |
| 687 | Ga0451800_1658630 | 3300041459 | Unclassified | 1312 |
| 688 | Ga0451802_1934902 | 3300041460 | Bacteria | 1327 |
| 689 | Ga0451802_1935343 | 3300041460 | Bacteria | 2703 |
| 690 | Ga0451807_0065623 | 3300041486 | Bacteria | 5261 |
| 691 | Ga0451807_2246987 | 3300041486 | Bacteria | 4233 |
| 692 | Ga0451807_2285000 | 3300041486 | Unclassified | 892 |
| 693 | Ga0451833_1190085 | 3300041491 | Bacteria | 1016 |
| 694 | Ga0451849_1405876 | 3300041505 | Bacteria | 783 |
| 695 | Ga0451851_1138035 | 3300041507 | Bacteria | 1048 |
| 696 | Ga0439442_023326 | 3300042002 | Bacteria | 1286 |
| 697 | Ga0439448_0113438 | 3300042005 | Bacteria | 927 |
| 698 | Ga0439449_0052926 | 3300042007 | Bacteria | 1501 |
| 699 | Ga0450896_037636 | 3300042133 | Bacteria | 747 |
| 700 | Ga0439444_0024418 | 3300042437 | Bacteria | 1092 |
| 701 | Ga0439459_0093011 | 3300042438 | Bacteria | 728 |
| 702 | Ga0439464_0045734 | 3300042439 | Bacteria | 1257 |
| 703 | Ga0451577_0017859 | 3300042876 | Bacteria | 6544 |
| 704 | Ga0451577_0076774 | 3300042876 | Bacteria | 2978 |
| 705 | Ga0451577_0158358 | 3300042876 | Bacteria | 2038 |
| 706 | Ga0466969_0010650 | 3300044656 | Bacteria | 4872 |
| 707 | Ga0466969_0018694 | 3300044656 | Bacteria | 3608 |
| 708 | Ga0466972_0099651 | 3300044658 | Bacteria | 1375 |
| 709 | Ga0453683_0071396 | 3300044673 | Bacteria | 2172 |
| 710 | Ga0466965_0121950 | 3300044683 | Bacteria | 1347 |
| 711 | Ga0466965_0176878 | 3300044683 | Bacteria | 1125 |
| 712 | Ga0466966_0018782 | 3300044684 | Bacteria | 4554 |
| 713 | Ga0466966_0211198 | 3300044684 | Unclassified | 1173 |
| 714 | Ga0466966_0581404 | 3300044684 | Bacteria | 674 |
| 715 | Ga0466961_0005738 | 3300044693 | Bacteria | 7854 |
| 716 | Ga0466964_0017568 | 3300044706 | Bacteria | 2737 |
| 717 | Ga0453684_0032214 | 3300044712 | Bacteria | 7344 |
| 718 | Ga0453684_0068289 | 3300044712 | Bacteria | 4514 |
| 719 | Ga0453684_0476960 | 3300044712 | Bacteria | 1384 |
| 720 | Ga0453684_0934179 | 3300044712 | Bacteria | 927 |
| 721 | Ga0466971_0000216 | 3300044719 | Bacteria | 22087 |
| 722 | Ga0466970_0002740 | 3300044765 | Bacteria | 8508 |
| 723 | Ga0466957_0001530 | 3300044842 | Bacteria | 12173 |
| 724 | Ga0466960_0061910 | 3300044901 | Bacteria | 1838 |
| 725 | Ga0466959_0002645 | 3300045049 | Bacteria | 11497 |
| 726 | Ga0466959_0010436 | 3300045049 | Bacteria | 6641 |
| 727 | Ga0466959_0014163 | 3300045049 | Bacteria | 5789 |
| 728 | Ga0466959_0100728 | 3300045049 | Bacteria | 2067 |
| 729 | Ga0451576_0023536 | 3300045051 | Bacteria | 6668 |
| 730 | Ga0451576_0215678 | 3300045051 | Bacteria | 2004 |
| 731 | Ga0451576_1038706 | 3300045051 | Bacteria | 858 |
| 732 | Ga0466958_0011057 | 3300045836 | Bacteria | 5074 |
| 733 | Ga0495592_0122645 | 3300046454 | Bacteria | 1826 |
| 734 | Ga0495590_0026392 | 3300046457 | Bacteria | 2039 |
| 735 | Ga0495591_019311 | 3300046458 | Bacteria | 2285 |
| 736 | Ga0495638_0029681 | 3300046460 | Bacteria | 3526 |
| 737 | Ga0495638_0042983 | 3300046460 | Bacteria | 2853 |
| 738 | Ga0495638_0467349 | 3300046460 | Unclassified | 641 |
| 739 | Ga0495580_0002317 | 3300046472 | Bacteria | 16600 |
| 740 | Ga0495580_0011390 | 3300046472 | Bacteria | 6882 |
| 741 | Ga0495580_0038431 | 3300046472 | Bacteria | 3428 |
| 742 | Ga0495580_0250819 | 3300046472 | Bacteria | 1212 |
| 743 | Ga0495580_0745606 | 3300046472 | Bacteria | 638 |
| 744 | Ga0495582_0171548 | 3300046473 | Bacteria | 1235 |
| 745 | Ga0495594_0225796 | 3300046499 | Bacteria | 1068 |
| 746 | Ga0495610_0299294 | 3300046512 | Bacteria | 621 |
| 747 | Ga0495616_0003520 | 3300046513 | Bacteria | 10013 |
| 748 | Ga0495618_0070893 | 3300046514 | Bacteria | 2217 |
| 749 | Ga0495620_0181440 | 3300046515 | Bacteria | 814 |
| 750 | Ga0495632_0030336 | 3300046519 | Bacteria | 2807 |
| 751 | Ga0495632_0030443 | 3300046519 | Bacteria | 2801 |
| 752 | Ga0495632_0319753 | 3300046519 | Bacteria | 686 |
| 753 | Ga0495644_0019850 | 3300046523 | Bacteria | 2566 |
| 754 | Ga0495648_0058796 | 3300046524 | Bacteria | 2297 |
| 755 | Ga0495652_0258438 | 3300046529 | Bacteria | 1287 |
| 756 | Ga0495665_0044595 | 3300046531 | Bacteria | 2356 |
| 757 | Ga0495586_0055117 | 3300046535 | Bacteria | 2155 |
| 758 | Ga0495586_0484897 | 3300046535 | Bacteria | 713 |
| 759 | Ga0495621_0024354 | 3300046539 | Bacteria | 2021 |
| 760 | Ga0495621_0048158 | 3300046539 | Bacteria | 1517 |
| 761 | Ga0495621_0088361 | 3300046539 | Bacteria | 1165 |
| 762 | Ga0495633_0156593 | 3300046558 | Bacteria | 1051 |
| 763 | Ga0495656_0054433 | 3300046615 | Bacteria | 1722 |
| 764 | Ga0495668_0489013 | 3300046616 | Bacteria | 678 |
| 765 | Ga0495625_0004128 | 3300046660 | Bacteria | 13860 |
| 766 | Ga0495625_0056977 | 3300046660 | Bacteria | 2780 |
| 767 | Ga0495625_0084823 | 3300046660 | Bacteria | 2200 |
| 768 | Ga0495625_0150529 | 3300046660 | Bacteria | 1565 |
| 769 | Ga0495625_0277573 | 3300046660 | Bacteria | 1079 |
| 770 | Ga0495659_0160024 | 3300046664 | Bacteria | 908 |
| 771 | Ga0495657_0072326 | 3300046675 | Bacteria | 2249 |
| 772 | Ga0495599_0099033 | 3300046678 | Bacteria | 1817 |
| 773 | Ga0495623_0061473 | 3300046679 | Bacteria | 2356 |
| 774 | Ga0495647_0022229 | 3300046681 | Bacteria | 2290 |
| 775 | Ga0495647_0028574 | 3300046681 | Bacteria | 2057 |
| 776 | Ga0495647_0141218 | 3300046681 | Bacteria | 1027 |
| 777 | Ga0495658_0010043 | 3300046683 | Bacteria | 4728 |
| 778 | Ga0495658_0510274 | 3300046683 | Bacteria | 769 |
| 779 | Ga0495669_0357713 | 3300046684 | Bacteria | 706 |
| 780 | Ga0495649_0070992 | 3300046694 | Bacteria | 1867 |
| 781 | Ga0495581_0149843 | 3300047315 | Bacteria | 1362 |
| 782 | Ga0495604_0031892 | 3300047317 | Bacteria | 4178 |
| 783 | Ga0495674_0449767 | 3300047319 | Unclassified | 1035 |
| 784 | Ga0495672_0063383 | 3300047320 | Bacteria | 2122 |
| 785 | Ga0495681_0037726 | 3300047470 | Bacteria | 2377 |
| 786 | Ga0495686_0068125 | 3300047472 | Bacteria | 2196 |
| 787 | Ga0495602_0035047 | 3300048088 | Bacteria | 4685 |
| 788 | Ga0495626_0223542 | 3300048091 | Unclassified | 764 |
| 789 | Ga0496100_0014282 | 3300048903 | Bacteria | 4607 |
| 790 | Ga0496100_0924555 | 3300048903 | Bacteria | 685 |
| 791 | Ga0496101_0002781 | 3300048904 | Bacteria | 10726 |
| 792 | Ga0496101_0058777 | 3300048904 | Bacteria | 2786 |
| 793 | Ga0496102_0004283 | 3300048905 | Bacteria | 12064 |
| 794 | Ga0496102_0015204 | 3300048905 | Bacteria | 6700 |
| 795 | Ga0496102_0025670 | 3300048905 | Bacteria | 5249 |
| 796 | Ga0496102_0239250 | 3300048905 | Bacteria | 1712 |
| 797 | Ga0496103_0054969 | 3300048906 | Bacteria | 2468 |
| 798 | Ga0496103_0157107 | 3300048906 | Bacteria | 1458 |
| 799 | Ga0496104_0166549 | 3300048907 | Bacteria | 2113 |
| 800 | Ga0496104_0183740 | 3300048907 | Bacteria | 2001 |
| 801 | Ga0496104_0205567 | 3300048907 | Bacteria | 1881 |
| 802 | Ga0496105_0038751 | 3300048908 | Bacteria | 3926 |
| 803 | Ga0496106_0023670 | 3300048909 | Bacteria | 4564 |
| 804 | Ga0496106_0092723 | 3300048909 | Bacteria | 2333 |
| 805 | Ga0496106_0131648 | 3300048909 | Bacteria | 1962 |
| 806 | Ga0496106_0232287 | 3300048909 | Bacteria | 1473 |
| 807 | Ga0496106_1019094 | 3300048909 | Bacteria | 651 |
| 808 | Ga0496107_0014224 | 3300048910 | Bacteria | 5572 |
| 809 | Ga0496107_0704523 | 3300048910 | Bacteria | 742 |
| 810 | Ga0496108_0012714 | 3300048911 | Bacteria | 6856 |
| 811 | Ga0496108_0578231 | 3300048911 | Bacteria | 979 |
| 812 | Ga0496110_0000749 | 3300048913 | Bacteria | 22420 |
| 813 | Ga0496110_0352827 | 3300048913 | Bacteria | 1340 |
| 814 | Ga0496111_0007317 | 3300048914 | Bacteria | 7223 |
| 815 | Ga0496112_0005843 | 3300048915 | Bacteria | 10714 |
| 816 | Ga0496112_0149992 | 3300048915 | Bacteria | 2299 |
| 817 | Ga0496113_0024231 | 3300048916 | Bacteria | 4310 |
| 818 | Ga0496113_0034940 | 3300048916 | Bacteria | 3672 |
| 819 | Ga0496114_0001864 | 3300048917 | Bacteria | 15980 |
| 820 | Ga0496114_0031729 | 3300048917 | Bacteria | 4346 |
| 821 | Ga0496114_0139070 | 3300048917 | Bacteria | 2101 |
| 822 | Ga0496114_0546027 | 3300048917 | Bacteria | 1024 |
| 823 | Ga0496115_0019186 | 3300048918 | Bacteria | 5260 |
| 824 | Ga0496115_0255565 | 3300048918 | Bacteria | 1442 |
| 825 | Ga0496116_0009552 | 3300048919 | Bacteria | 8261 |
| 826 | Ga0496117_0000151 | 3300048920 | Bacteria | 148304 |
| 827 | Ga0496117_0365928 | 3300048920 | Bacteria | 739 |
| 828 | Ga0496118_0000016 | 3300048921 | Bacteria | 549586 |
| 829 | Ga0496118_0053120 | 3300048921 | Bacteria | 3084 |
| 830 | Ga0496118_0061427 | 3300048921 | Bacteria | 2783 |
| 831 | Ga0496118_0071775 | 3300048921 | Bacteria | 2491 |
| 832 | Ga0496119_0007663 | 3300048922 | Bacteria | 9669 |
| 833 | Ga0496119_0026068 | 3300048922 | Bacteria | 4063 |
| 834 | Ga0496120_0002631 | 3300048923 | Bacteria | 17782 |
| 835 | Ga0496120_0079655 | 3300048923 | Bacteria | 1777 |
| 836 | Ga0496121_0003216 | 3300048924 | Bacteria | 23498 |
| 837 | Ga0496121_0062952 | 3300048924 | Bacteria | 3035 |
| 838 | Ga0496121_0088943 | 3300048924 | Bacteria | 2419 |
| 839 | Ga0496124_0036662 | 3300048927 | Bacteria | 4274 |
| 840 | Ga0496125_0000759 | 3300048928 | Bacteria | 52858 |
| 841 | Ga0496125_0015343 | 3300048928 | Bacteria | 7416 |
| 842 | Ga0496125_0042383 | 3300048928 | Bacteria | 3877 |
| 843 | Ga0496126_0001875 | 3300048929 | Bacteria | 30586 |
| 844 | Ga0496126_0059047 | 3300048929 | Bacteria | 3455 |
| 845 | Ga0501299_089863 | 3300049522 | Bacteria | 696 |
| 846 | Ga0501031_0108948 | 3300049568 | Bacteria | 1809 |
| 847 | Ga0501031_0189438 | 3300049568 | Bacteria | 1343 |
| 848 | Ga0501032_0198951 | 3300049569 | Bacteria | 1308 |
| 849 | Ga0501033_0125845 | 3300049570 | Bacteria | 1858 |
| 850 | Ga0501033_0331458 | 3300049570 | Bacteria | 1068 |
| 851 | Ga0501034_1339501 | 3300049571 | Bacteria | 592 |
| 852 | Ga0501036_0019918 | 3300049572 | Bacteria | 5632 |
| 853 | Ga0501036_0030927 | 3300049572 | Bacteria | 4524 |
| 854 | Ga0501036_0314169 | 3300049572 | Bacteria | 1310 |
| 855 | Ga0501037_0029609 | 3300049573 | Bacteria | 4045 |
| 856 | Ga0501037_0074819 | 3300049573 | Bacteria | 2460 |
| 857 | Ga0501038_0025407 | 3300049574 | Bacteria | 5280 |
| 858 | Ga0501038_0110786 | 3300049574 | Bacteria | 2274 |
| 859 | Ga0501039_0005021 | 3300049575 | Bacteria | 10042 |
| 860 | Ga0501039_0534782 | 3300049575 | Bacteria | 920 |
| 861 | Ga0501040_0001902 | 3300049576 | Bacteria | 13423 |
| 862 | Ga0501040_0020637 | 3300049576 | Bacteria | 4392 |
| 863 | Ga0501041_0003543 | 3300049577 | Bacteria | 8977 |
| 864 | Ga0501041_0027415 | 3300049577 | Bacteria | 3432 |
| 865 | Ga0501042_0020076 | 3300049578 | Bacteria | 4648 |
| 866 | Ga0501042_0069390 | 3300049578 | Bacteria | 2520 |
| 867 | Ga0501043_0047241 | 3300049579 | Bacteria | 3384 |
| 868 | Ga0501046_0008614 | 3300049580 | Bacteria | 8870 |
| 869 | Ga0501046_0065359 | 3300049580 | Bacteria | 2838 |
| 870 | Ga0501046_0071635 | 3300049580 | Bacteria | 2693 |
| 871 | Ga0501046_0447081 | 3300049580 | Bacteria | 930 |
| 872 | Ga0501048_0031048 | 3300049582 | Bacteria | 3866 |
| 873 | Ga0501048_0122126 | 3300049582 | Bacteria | 1840 |
| 874 | Ga0501068_0039428 | 3300049584 | Bacteria | 2832 |
| 875 | Ga0501068_0040215 | 3300049584 | Bacteria | 2806 |
| 876 | Ga0501069_0069086 | 3300049585 | Bacteria | 1978 |
| 877 | Ga0501070_0235381 | 3300049586 | Bacteria | 1500 |
| 878 | Ga0501071_0000689 | 3300049587 | Bacteria | 17671 |
| 879 | Ga0501071_0050039 | 3300049587 | Bacteria | 3009 |
| 880 | Ga0501072_0002540 | 3300049588 | Bacteria | 13673 |
| 881 | Ga0501072_0027868 | 3300049588 | Bacteria | 4408 |
| 882 | Ga0501072_0785763 | 3300049588 | Bacteria | 746 |
| 883 | Ga0501075_0003894 | 3300049591 | Bacteria | 10047 |
| 884 | Ga0501076_0000782 | 3300049592 | Bacteria | 20500 |
| 885 | Ga0501076_0025012 | 3300049592 | Bacteria | 4618 |
| 886 | Ga0501077_0009125 | 3300049593 | Bacteria | 6158 |
| 887 | Ga0501077_0069821 | 3300049593 | Bacteria | 2226 |
| 888 | Ga0501209_026366 | 3300049656 | Bacteria | 1434 |
| 889 | Ga0501249_007490 | 3300049679 | Bacteria | 2256 |
| 890 | Ga0501257_089169 | 3300049686 | Bacteria | 801 |
| 891 | Ga0501079_0001340 | 3300049741 | Bacteria | 17314 |
| 892 | Ga0501079_0017298 | 3300049741 | Bacteria | 5505 |
| 893 | Ga0501080_0005127 | 3300049742 | Bacteria | 11672 |
| 894 | Ga0501080_0185062 | 3300049742 | Bacteria | 1915 |
| 895 | Ga0501080_0839020 | 3300049742 | Bacteria | 804 |
| 896 | Ga0501081_0010808 | 3300049743 | Bacteria | 5962 |
| 897 | Ga0501081_0051401 | 3300049743 | Bacteria | 2842 |
| 898 | Ga0501081_0544209 | 3300049743 | Bacteria | 867 |
| 899 | Ga0501083_0259029 | 3300049744 | Bacteria | 1132 |
| 900 | Ga0501035_0038912 | 3300049822 | Bacteria | 4306 |
| 901 | Ga0501035_0052512 | 3300049822 | Bacteria | 3647 |
| 902 | Ga0501044_0121003 | 3300049823 | Bacteria | 2619 |
| 903 | Ga0501044_0648569 | 3300049823 | Bacteria | 945 |
| 904 | Ga0501045_0000401 | 3300049824 | Bacteria | 26284 |
| 905 | Ga0501045_0020016 | 3300049824 | Bacteria | 4777 |
| 906 | Ga0501045_0116565 | 3300049824 | Bacteria | 1982 |
| 907 | nmdc:mga05p37_1003701_c1 | 3300050507 | Bacteria | 886 |
| 908 | nmdc:mga09592_139542_c1 | 3300050508 | Bacteria | 2089 |
| 909 | nmdc:mga09592_79156_c1 | 3300050508 | Bacteria | 2798 |
| 910 | nmdc:mga0qj67_105459_c1 | 3300050509 | Bacteria | 2274 |
| 911 | nmdc:mga0qj67_119265_c1 | 3300050509 | Bacteria | 2133 |
| 912 | nmdc:mga0qj67_369301_c1 | 3300050509 | Bacteria | 1159 |
| 913 | nmdc:mga0qj67_441560_c1 | 3300050509 | Bacteria | 1048 |
| 914 | nmdc:mga06r32_12456_c1 | 3300050510 | Bacteria | 7675 |
| 915 | nmdc:mga06r32_140547_c1 | 3300050510 | Bacteria | 2390 |
| 916 | nmdc:mga06r32_24616_c1 | 3300050510 | Bacteria | 5591 |
| 917 | nmdc:mga06r32_259443_c1 | 3300050510 | Bacteria | 1726 |
| 918 | nmdc:mga06r32_87594_c1 | 3300050510 | Bacteria | 3038 |
| 919 | nmdc:mga08y16_1026529_c1 | 3300050511 | Bacteria | 803 |
| 920 | nmdc:mga08y16_117632_c1 | 3300050511 | Bacteria | 2766 |
| 921 | nmdc:mga08y16_1181637_c1 | 3300050511 | Bacteria | 736 |
| 922 | nmdc:mga08y16_2161_c1 | 3300050511 | Bacteria | 20167 |
| 923 | nmdc:mga08y16_24822_c1 | 3300050511 | Bacteria | 6325 |
| 924 | nmdc:mga08y16_508240_c1 | 3300050511 | Bacteria | 1223 |
| 925 | nmdc:mga08y16_66436_c1 | 3300050511 | Bacteria | 3764 |
| 926 | nmdc:mga08y16_920464_c1 | 3300050511 | Bacteria | 859 |
| 927 | nmdc:mga0rr50_297944_c1 | 3300050513 | Bacteria | 1348 |
| 928 | nmdc:mga0rr50_430501_c1 | 3300050513 | Bacteria | 1117 |
| 929 | nmdc:mga0a205_692174_c1 | 3300050515 | Bacteria | 869 |
| 930 | Ga0495612_0160887 | 3300053078 | Bacteria | 980 |
| 931 | Ga0495612_0352621 | 3300053078 | Bacteria | 664 |
| 932 | Ga0500646_0119074 | 3300053090 | Bacteria | 847 |
| 933 | Ga0500583_0051673 | 3300053092 | Bacteria | 1910 |
| 934 | Ga0500583_0068826 | 3300053092 | Bacteria | 1689 |
| 935 | Ga0500651_0187399 | 3300053093 | Bacteria | 1226 |
| 936 | Ga0500641_0348540 | 3300053096 | Bacteria | 596 |
| 937 | Ga0500660_127142 | 3300053100 | Bacteria | 1046 |
| 938 | Ga0500556_0085210 | 3300053104 | Bacteria | 1200 |
| 939 | Ga0500556_0095777 | 3300053104 | Bacteria | 1138 |
| 940 | Ga0500562_080488 | 3300053108 | Bacteria | 881 |
| 941 | Ga0500569_010238 | 3300053109 | Bacteria | 2202 |
| 942 | Ga0500592_025572 | 3300053116 | Bacteria | 953 |
| 943 | Ga0500595_095061 | 3300053119 | Bacteria | 859 |
| 944 | Ga0500652_081380 | 3300053131 | Bacteria | 1348 |
| 945 | Ga0500652_139261 | 3300053131 | Bacteria | 1010 |
| 946 | Ga0500658_0008480 | 3300053134 | Bacteria | 3796 |
| 947 | Ga0500559_0039884 | 3300053136 | Bacteria | 2044 |
| 948 | Ga0500568_0037122 | 3300053139 | Bacteria | 1978 |
| 949 | Ga0500588_0002779 | 3300053146 | Bacteria | 3617 |
| 950 | Ga0500616_0000073 | 3300053153 | Bacteria | 231290 |
| 951 | Ga0500622_0002406 | 3300053156 | Bacteria | 13523 |
| 952 | Ga0500622_0005698 | 3300053156 | Bacteria | 7404 |
| 953 | Ga0500622_0014061 | 3300053156 | Bacteria | 4302 |
| 954 | Ga0500627_0073504 | 3300053158 | Bacteria | 1517 |
| 955 | Ga0500630_043962 | 3300053159 | Bacteria | 2174 |
| 956 | Ga0500633_0092643 | 3300053160 | Bacteria | 1105 |
| 957 | Ga0500633_0133288 | 3300053160 | Bacteria | 928 |
| 958 | Ga0500636_0101843 | 3300053177 | Bacteria | 1632 |
| 959 | Ga0500637_0000126 | 3300053178 | Bacteria | 27714 |
| 960 | Ga0501084_0120250 | 3300054114 | Bacteria | 2208 |
| 961 | Ga0501084_0321710 | 3300054114 | Bacteria | 1306 |
| 962 | Ga0501082_0006995 | 3300060353 | Bacteria | 9738 |
| 963 | Ga0466962_0038104 | 3300061719 | Bacteria | 2302 |
| 964 | Ga0530510_0018068 | 3300061734 | Bacteria | 4998 |
| 965 | Ga0530510_0034834 | 3300061734 | Bacteria | 3627 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041452 | Ga0451793_0947639 | Ga0451793_0947639_119_685 | 171 |
| 2 | 3300005340 | Ga0070689_100641499 | Ga0070689_1006414992 | 178 |
| 3 | 3300005367 | Ga0070667_100022143 | Ga0070667_1000221433 | 178 |
| 4 | 3300005458 | Ga0070681_10001577 | Ga0070681_1000157710 | 180 |
| 5 | 3300005530 | Ga0070679_100116286 | Ga0070679_1001162862 | 180 |
| 6 | 3300005834 | Ga0068851_10179076 | Ga0068851_101790762 | 180 |
| 7 | 3300009174 | Ga0105241_10940212 | Ga0105241_109402122 | 180 |
| 8 | 3300013296 | Ga0157374_10032183 | Ga0157374_100321833 | 180 |
| 9 | 3300025912 | Ga0207707_10054459 | Ga0207707_100544593 | 180 |
| 10 | 3300025921 | Ga0207652_10127330 | Ga0207652_101273302 | 180 |
| 11 | 3300031727 | Ga0316576_10096611 | Ga0316576_100966112 | 180 |
| 12 | 3300031728 | Ga0316578_10431437 | Ga0316578_104314371 | 180 |
| 13 | 3300035398 | Ga0316574_0138730 | Ga0316574_0138730_329_871 | 180 |
| 14 | 3300005458 | Ga0070681_10015379 | Ga0070681_100153795 | 181 |
| 15 | 3300005458 | Ga0070681_10048512 | Ga0070681_100485123 | 181 |
| 16 | 3300005530 | Ga0070679_100000469 | Ga0070679_1000004698 | 181 |
| 17 | 3300005530 | Ga0070679_100155886 | Ga0070679_1001558862 | 181 |
| 18 | 3300005535 | Ga0070684_100513922 | Ga0070684_1005139222 | 181 |
| 19 | 3300005539 | Ga0068853_100286241 | Ga0068853_1002862412 | 181 |
| 20 | 3300005539 | Ga0068853_100526451 | Ga0068853_1005264511 | 181 |
| 21 | 3300005563 | Ga0068855_100001482 | Ga0068855_10000148224 | 181 |
| 22 | 3300005563 | Ga0068855_100094225 | Ga0068855_1000942253 | 181 |
| 23 | 3300005614 | Ga0068856_100529173 | Ga0068856_1005291732 | 181 |
| 24 | 3300009093 | Ga0105240_10002705 | Ga0105240_100027059 | 181 |
| 25 | 3300009093 | Ga0105240_10019061 | Ga0105240_100190613 | 181 |
| 26 | 3300009551 | Ga0105238_10005376 | Ga0105238_100053762 | 181 |
| 27 | 3300009551 | Ga0105238_10406644 | Ga0105238_104066441 | 181 |
| 28 | 3300010375 | Ga0105239_10233748 | Ga0105239_102337482 | 181 |
| 29 | 3300013104 | Ga0157370_10001472 | Ga0157370_100014725 | 181 |
| 30 | 3300013104 | Ga0157370_10263999 | Ga0157370_102639992 | 181 |
| 31 | 3300013105 | Ga0157369_10000841 | Ga0157369_100008415 | 181 |
| 32 | 3300013105 | Ga0157369_10068740 | Ga0157369_100687402 | 181 |
| 33 | 3300025912 | Ga0207707_10000122 | Ga0207707_1000012228 | 181 |
| 34 | 3300025912 | Ga0207707_10014611 | Ga0207707_100146112 | 181 |
| 35 | 3300025913 | Ga0207695_10003540 | Ga0207695_1000354018 | 181 |
| 36 | 3300025913 | Ga0207695_10032858 | Ga0207695_100328582 | 181 |
| 37 | 3300025917 | Ga0207660_10001933 | Ga0207660_1000193311 | 181 |
| 38 | 3300025921 | Ga0207652_10000613 | Ga0207652_1000061321 | 181 |
| 39 | 3300025921 | Ga0207652_10398702 | Ga0207652_103987022 | 181 |
| 40 | 3300025924 | Ga0207694_10044756 | Ga0207694_100447562 | 181 |
| 41 | 3300025949 | Ga0207667_10000798 | Ga0207667_1000079823 | 181 |
| 42 | 3300025949 | Ga0207667_10049362 | Ga0207667_100493622 | 181 |
| 43 | 3300026078 | Ga0207702_10449937 | Ga0207702_104499372 | 181 |
| 44 | 2010549000 | RicEn_C9875 | RicEn_172490 | 182 |
| 45 | 2162886007 | SwRhRL2b_contig_2220656 | SwRhRL2b_0475.00005270 | 182 |
| 46 | 3300003316 | rootH1_10101733 | rootH1_101017333 | 182 |
| 47 | 3300003320 | rootH2_10016870 | rootH2_100168702 | 182 |
| 48 | 3300003323 | rootH1_10033537 | rootH1_100335372 | 182 |
| 49 | 3300005289 | Ga0065704_10011697 | Ga0065704_100116972 | 182 |
| 50 | 3300005290 | Ga0065712_10070294 | Ga0065712_100702945 | 182 |
| 51 | 3300005293 | Ga0065715_10136644 | Ga0065715_101366442 | 182 |
| 52 | 3300005328 | Ga0070676_10111192 | Ga0070676_101111922 | 182 |
| 53 | 3300005329 | Ga0070683_100509493 | Ga0070683_1005094932 | 182 |
| 54 | 3300005330 | Ga0070690_100012452 | Ga0070690_1000124522 | 182 |
| 55 | 3300005330 | Ga0070690_100034482 | Ga0070690_1000344822 | 182 |
| 56 | 3300005330 | Ga0070690_100442761 | Ga0070690_1004427611 | 182 |
| 57 | 3300005330 | Ga0070690_101014645 | Ga0070690_1010146451 | 182 |
| 58 | 3300005331 | Ga0070670_100150538 | Ga0070670_1001505381 | 182 |
| 59 | 3300005331 | Ga0070670_100176738 | Ga0070670_1001767382 | 182 |
| 60 | 3300005333 | Ga0070677_10246646 | Ga0070677_102466462 | 182 |
| 61 | 3300005334 | Ga0068869_100387362 | Ga0068869_1003873622 | 182 |
| 62 | 3300005335 | Ga0070666_10084334 | Ga0070666_100843342 | 182 |
| 63 | 3300005335 | Ga0070666_10160843 | Ga0070666_101608432 | 182 |
| 64 | 3300005336 | Ga0070680_100005497 | Ga0070680_1000054976 | 182 |
| 65 | 3300005336 | Ga0070680_100169769 | Ga0070680_1001697692 | 182 |
| 66 | 3300005336 | Ga0070680_100232785 | Ga0070680_1002327852 | 182 |
| 67 | 3300005337 | Ga0070682_100197138 | Ga0070682_1001971382 | 182 |
| 68 | 3300005337 | Ga0070682_100380023 | Ga0070682_1003800231 | 182 |
| 69 | 3300005337 | Ga0070682_100579687 | Ga0070682_1005796871 | 182 |
| 70 | 3300005338 | Ga0068868_100028250 | Ga0068868_1000282503 | 182 |
| 71 | 3300005340 | Ga0070689_100002266 | Ga0070689_1000022669 | 182 |
| 72 | 3300005340 | Ga0070689_100003597 | Ga0070689_1000035977 | 182 |
| 73 | 3300005341 | Ga0070691_10107204 | Ga0070691_101072042 | 182 |
| 74 | 3300005343 | Ga0070687_100274690 | Ga0070687_1002746901 | 182 |
| 75 | 3300005343 | Ga0070687_100779705 | Ga0070687_1007797051 | 182 |
| 76 | 3300005343 | Ga0070687_100883988 | Ga0070687_1008839881 | 182 |
| 77 | 3300005344 | Ga0070661_100070943 | Ga0070661_1000709432 | 182 |
| 78 | 3300005344 | Ga0070661_100694517 | Ga0070661_1006945172 | 182 |
| 79 | 3300005347 | Ga0070668_100107972 | Ga0070668_1001079722 | 182 |
| 80 | 3300005353 | Ga0070669_100176852 | Ga0070669_1001768522 | 182 |
| 81 | 3300005353 | Ga0070669_100320947 | Ga0070669_1003209472 | 182 |
| 82 | 3300005354 | Ga0070675_100001269 | Ga0070675_10000126918 | 182 |
| 83 | 3300005354 | Ga0070675_100187299 | Ga0070675_1001872992 | 182 |
| 84 | 3300005354 | Ga0070675_100444151 | Ga0070675_1004441511 | 182 |
| 85 | 3300005354 | Ga0070675_100457919 | Ga0070675_1004579192 | 182 |
| 86 | 3300005355 | Ga0070671_100000657 | Ga0070671_1000006579 | 182 |
| 87 | 3300005355 | Ga0070671_100110753 | Ga0070671_1001107532 | 182 |
| 88 | 3300005364 | Ga0070673_100020159 | Ga0070673_1000201594 | 182 |
| 89 | 3300005364 | Ga0070673_100092132 | Ga0070673_1000921322 | 182 |
| 90 | 3300005364 | Ga0070673_100173114 | Ga0070673_1001731142 | 182 |
| 91 | 3300005364 | Ga0070673_100364754 | Ga0070673_1003647542 | 182 |
| 92 | 3300005364 | Ga0070673_100548881 | Ga0070673_1005488812 | 182 |
| 93 | 3300005365 | Ga0070688_100005304 | Ga0070688_1000053047 | 182 |
| 94 | 3300005367 | Ga0070667_100037857 | Ga0070667_1000378574 | 182 |
| 95 | 3300005367 | Ga0070667_100296137 | Ga0070667_1002961372 | 182 |
| 96 | 3300005434 | Ga0070709_10116089 | Ga0070709_101160892 | 182 |
| 97 | 3300005434 | Ga0070709_10156402 | Ga0070709_101564022 | 182 |
| 98 | 3300005434 | Ga0070709_10789025 | Ga0070709_107890252 | 182 |
| 99 | 3300005435 | Ga0070714_100004027 | Ga0070714_1000040276 | 182 |
| 100 | 3300005435 | Ga0070714_100058875 | Ga0070714_1000588752 | 182 |
| 101 | 3300005435 | Ga0070714_100263841 | Ga0070714_1002638412 | 182 |
| 102 | 3300005436 | Ga0070713_100003765 | Ga0070713_1000037653 | 182 |
| 103 | 3300005436 | Ga0070713_100004406 | Ga0070713_10000440610 | 182 |
| 104 | 3300005436 | Ga0070713_100112568 | Ga0070713_1001125681 | 182 |
| 105 | 3300005436 | Ga0070713_100231427 | Ga0070713_1002314271 | 182 |
| 106 | 3300005437 | Ga0070710_10002005 | Ga0070710_100020056 | 182 |
| 107 | 3300005437 | Ga0070710_10102895 | Ga0070710_101028952 | 182 |
| 108 | 3300005437 | Ga0070710_10987364 | Ga0070710_109873641 | 182 |
| 109 | 3300005438 | Ga0070701_10024998 | Ga0070701_100249981 | 182 |
| 110 | 3300005438 | Ga0070701_10205419 | Ga0070701_102054192 | 182 |
| 111 | 3300005438 | Ga0070701_10227177 | Ga0070701_102271771 | 182 |
| 112 | 3300005439 | Ga0070711_100062958 | Ga0070711_1000629583 | 182 |
| 113 | 3300005439 | Ga0070711_100135726 | Ga0070711_1001357261 | 182 |
| 114 | 3300005440 | Ga0070705_100005025 | Ga0070705_1000050254 | 182 |
| 115 | 3300005440 | Ga0070705_100141213 | Ga0070705_1001412132 | 182 |
| 116 | 3300005440 | Ga0070705_101001623 | Ga0070705_1010016231 | 182 |
| 117 | 3300005441 | Ga0070700_100179598 | Ga0070700_1001795982 | 182 |
| 118 | 3300005441 | Ga0070700_100195867 | Ga0070700_1001958672 | 182 |
| 119 | 3300005441 | Ga0070700_100246164 | Ga0070700_1002461642 | 182 |
| 120 | 3300005444 | Ga0070694_100039533 | Ga0070694_1000395333 | 182 |
| 121 | 3300005444 | Ga0070694_100257513 | Ga0070694_1002575132 | 182 |
| 122 | 3300005444 | Ga0070694_100289354 | Ga0070694_1002893542 | 182 |
| 123 | 3300005455 | Ga0070663_100628945 | Ga0070663_1006289451 | 182 |
| 124 | 3300005455 | Ga0070663_100828828 | Ga0070663_1008288282 | 182 |
| 125 | 3300005455 | Ga0070663_101623125 | Ga0070663_1016231251 | 182 |
| 126 | 3300005456 | Ga0070678_100001882 | Ga0070678_1000018827 | 182 |
| 127 | 3300005456 | Ga0070678_101182414 | Ga0070678_1011824141 | 182 |
| 128 | 3300005456 | Ga0070678_101341327 | Ga0070678_1013413271 | 182 |
| 129 | 3300005457 | Ga0070662_100106771 | Ga0070662_1001067712 | 182 |
| 130 | 3300005457 | Ga0070662_100121887 | Ga0070662_1001218872 | 182 |
| 131 | 3300005458 | Ga0070681_10000738 | Ga0070681_1000073812 | 182 |
| 132 | 3300005458 | Ga0070681_10024230 | Ga0070681_100242308 | 182 |
| 133 | 3300005458 | Ga0070681_10049548 | Ga0070681_100495484 | 182 |
| 134 | 3300005458 | Ga0070681_10141489 | Ga0070681_101414892 | 182 |
| 135 | 3300005458 | Ga0070681_10740875 | Ga0070681_107408751 | 182 |
| 136 | 3300005459 | Ga0068867_100012777 | Ga0068867_1000127773 | 182 |
| 137 | 3300005459 | Ga0068867_100047736 | Ga0068867_1000477362 | 182 |
| 138 | 3300005459 | Ga0068867_100179522 | Ga0068867_1001795222 | 182 |
| 139 | 3300005466 | Ga0070685_10002528 | Ga0070685_100025286 | 182 |
| 140 | 3300005466 | Ga0070685_10083125 | Ga0070685_100831252 | 182 |
| 141 | 3300005466 | Ga0070685_10480368 | Ga0070685_104803682 | 182 |
| 142 | 3300005467 | Ga0070706_100293187 | Ga0070706_1002931872 | 182 |
| 143 | 3300005518 | Ga0070699_100022483 | Ga0070699_1000224832 | 182 |
| 144 | 3300005518 | Ga0070699_101116196 | Ga0070699_1011161961 | 182 |
| 145 | 3300005530 | Ga0070679_100005515 | Ga0070679_1000055158 | 182 |
| 146 | 3300005530 | Ga0070679_100087639 | Ga0070679_1000876393 | 182 |
| 147 | 3300005530 | Ga0070679_101525989 | Ga0070679_1015259891 | 182 |
| 148 | 3300005535 | Ga0070684_100575395 | Ga0070684_1005753952 | 182 |
| 149 | 3300005539 | Ga0068853_100250645 | Ga0068853_1002506452 | 182 |
| 150 | 3300005539 | Ga0068853_100570492 | Ga0068853_1005704922 | 182 |
| 151 | 3300005543 | Ga0070672_100027580 | Ga0070672_1000275803 | 182 |
| 152 | 3300005543 | Ga0070672_100029661 | Ga0070672_1000296613 | 182 |
| 153 | 3300005543 | Ga0070672_100054834 | Ga0070672_1000548342 | 182 |
| 154 | 3300005543 | Ga0070672_100167369 | Ga0070672_1001673692 | 182 |
| 155 | 3300005543 | Ga0070672_100530695 | Ga0070672_1005306952 | 182 |
| 156 | 3300005544 | Ga0070686_100002735 | Ga0070686_1000027352 | 182 |
| 157 | 3300005545 | Ga0070695_100009460 | Ga0070695_1000094602 | 182 |
| 158 | 3300005546 | Ga0070696_100020484 | Ga0070696_1000204842 | 182 |
| 159 | 3300005546 | Ga0070696_100092350 | Ga0070696_1000923502 | 182 |
| 160 | 3300005547 | Ga0070693_100040423 | Ga0070693_1000404232 | 182 |
| 161 | 3300005547 | Ga0070693_100287006 | Ga0070693_1002870062 | 182 |
| 162 | 3300005548 | Ga0070665_100000543 | Ga0070665_10000054310 | 182 |
| 163 | 3300005548 | Ga0070665_100006529 | Ga0070665_1000065296 | 182 |
| 164 | 3300005548 | Ga0070665_100009640 | Ga0070665_1000096409 | 182 |
| 165 | 3300005548 | Ga0070665_100029937 | Ga0070665_1000299372 | 182 |
| 166 | 3300005548 | Ga0070665_100032219 | Ga0070665_1000322192 | 182 |
| 167 | 3300005548 | Ga0070665_100053459 | Ga0070665_1000534593 | 182 |
| 168 | 3300005548 | Ga0070665_100107978 | Ga0070665_1001079783 | 182 |
| 169 | 3300005548 | Ga0070665_100341674 | Ga0070665_1003416742 | 182 |
| 170 | 3300005548 | Ga0070665_100391338 | Ga0070665_1003913382 | 182 |
| 171 | 3300005549 | Ga0070704_100053103 | Ga0070704_1000531032 | 182 |
| 172 | 3300005549 | Ga0070704_100405079 | Ga0070704_1004050792 | 182 |
| 173 | 3300005563 | Ga0068855_100001838 | Ga0068855_10000183817 | 182 |
| 174 | 3300005563 | Ga0068855_100169063 | Ga0068855_1001690632 | 182 |
| 175 | 3300005563 | Ga0068855_100318422 | Ga0068855_1003184222 | 182 |
| 176 | 3300005564 | Ga0070664_100276073 | Ga0070664_1002760732 | 182 |
| 177 | 3300005564 | Ga0070664_100966490 | Ga0070664_1009664901 | 182 |
| 178 | 3300005577 | Ga0068857_100035066 | Ga0068857_1000350664 | 182 |
| 179 | 3300005577 | Ga0068857_100154869 | Ga0068857_1001548692 | 182 |
| 180 | 3300005577 | Ga0068857_100223179 | Ga0068857_1002231792 | 182 |
| 181 | 3300005578 | Ga0068854_100446984 | Ga0068854_1004469841 | 182 |
| 182 | 3300005614 | Ga0068856_100004498 | Ga0068856_10000449812 | 182 |
| 183 | 3300005614 | Ga0068856_100546507 | Ga0068856_1005465072 | 182 |
| 184 | 3300005614 | Ga0068856_100626688 | Ga0068856_1006266881 | 182 |
| 185 | 3300005614 | Ga0068856_100832996 | Ga0068856_1008329962 | 182 |
| 186 | 3300005615 | Ga0070702_100006702 | Ga0070702_1000067024 | 182 |
| 187 | 3300005615 | Ga0070702_100009527 | Ga0070702_1000095274 | 182 |
| 188 | 3300005616 | Ga0068852_100366968 | Ga0068852_1003669682 | 182 |
| 189 | 3300005616 | Ga0068852_100439742 | Ga0068852_1004397422 | 182 |
| 190 | 3300005617 | Ga0068859_100000929 | Ga0068859_1000009298 | 182 |
| 191 | 3300005617 | Ga0068859_100009204 | Ga0068859_1000092045 | 182 |
| 192 | 3300005617 | Ga0068859_100125227 | Ga0068859_1001252273 | 182 |
| 193 | 3300005617 | Ga0068859_100228640 | Ga0068859_1002286402 | 182 |
| 194 | 3300005617 | Ga0068859_100354535 | Ga0068859_1003545352 | 182 |
| 195 | 3300005617 | Ga0068859_102080647 | Ga0068859_1020806471 | 182 |
| 196 | 3300005618 | Ga0068864_100004892 | Ga0068864_10000489211 | 182 |
| 197 | 3300005718 | Ga0068866_10137770 | Ga0068866_101377702 | 182 |
| 198 | 3300005719 | Ga0068861_100001663 | Ga0068861_1000016632 | 182 |
| 199 | 3300005719 | Ga0068861_100002156 | Ga0068861_1000021565 | 182 |
| 200 | 3300005719 | Ga0068861_100012276 | Ga0068861_1000122766 | 182 |
| 201 | 3300005719 | Ga0068861_100036200 | Ga0068861_1000362002 | 182 |
| 202 | 3300005719 | Ga0068861_100226488 | Ga0068861_1002264882 | 182 |
| 203 | 3300005719 | Ga0068861_101289985 | Ga0068861_1012899851 | 182 |
| 204 | 3300005840 | Ga0068870_10134943 | Ga0068870_101349432 | 182 |
| 205 | 3300005841 | Ga0068863_100001099 | Ga0068863_10000109921 | 182 |
| 206 | 3300005841 | Ga0068863_100048854 | Ga0068863_1000488541 | 182 |
| 207 | 3300005841 | Ga0068863_100060367 | Ga0068863_1000603673 | 182 |
| 208 | 3300005841 | Ga0068863_100414724 | Ga0068863_1004147242 | 182 |
| 209 | 3300005841 | Ga0068863_100469460 | Ga0068863_1004694601 | 182 |
| 210 | 3300005841 | Ga0068863_100500360 | Ga0068863_1005003601 | 182 |
| 211 | 3300005842 | Ga0068858_100002788 | Ga0068858_1000027882 | 182 |
| 212 | 3300005842 | Ga0068858_100024983 | Ga0068858_1000249834 | 182 |
| 213 | 3300005842 | Ga0068858_100029209 | Ga0068858_1000292092 | 182 |
| 214 | 3300005842 | Ga0068858_100029595 | Ga0068858_1000295955 | 182 |
| 215 | 3300005842 | Ga0068858_100110818 | Ga0068858_1001108183 | 182 |
| 216 | 3300005842 | Ga0068858_100253828 | Ga0068858_1002538282 | 182 |
| 217 | 3300005843 | Ga0068860_100002907 | Ga0068860_10000290711 | 182 |
| 218 | 3300005843 | Ga0068860_100055609 | Ga0068860_1000556093 | 182 |
| 219 | 3300005843 | Ga0068860_100171261 | Ga0068860_1001712612 | 182 |
| 220 | 3300005844 | Ga0068862_100013694 | Ga0068862_1000136944 | 182 |
| 221 | 3300005844 | Ga0068862_100024285 | Ga0068862_1000242855 | 182 |
| 222 | 3300005844 | Ga0068862_100158654 | Ga0068862_1001586542 | 182 |
| 223 | 3300005844 | Ga0068862_100162582 | Ga0068862_1001625822 | 182 |
| 224 | 3300005844 | Ga0068862_101006079 | Ga0068862_1010060791 | 182 |
| 225 | 3300005937 | Ga0081455_10016058 | Ga0081455_100160582 | 182 |
| 226 | 3300005985 | Ga0081539_10000028 | Ga0081539_10000028246 | 182 |
| 227 | 3300006028 | Ga0070717_10044415 | Ga0070717_100444153 | 182 |
| 228 | 3300006058 | Ga0075432_10048877 | Ga0075432_100488772 | 182 |
| 229 | 3300006163 | Ga0070715_10000714 | Ga0070715_100007148 | 182 |
| 230 | 3300006173 | Ga0070716_100007820 | Ga0070716_1000078202 | 182 |
| 231 | 3300006173 | Ga0070716_100342283 | Ga0070716_1003422832 | 182 |
| 232 | 3300006175 | Ga0070712_100000750 | Ga0070712_10000075015 | 182 |
| 233 | 3300006175 | Ga0070712_100082000 | Ga0070712_1000820002 | 182 |
| 234 | 3300006237 | Ga0097621_100072320 | Ga0097621_1000723202 | 182 |
| 235 | 3300006237 | Ga0097621_100114721 | Ga0097621_1001147212 | 182 |
| 236 | 3300006237 | Ga0097621_100126691 | Ga0097621_1001266912 | 182 |
| 237 | 3300006237 | Ga0097621_100141911 | Ga0097621_1001419112 | 182 |
| 238 | 3300006237 | Ga0097621_100564154 | Ga0097621_1005641542 | 182 |
| 239 | 3300006358 | Ga0068871_100062807 | Ga0068871_1000628073 | 182 |
| 240 | 3300006358 | Ga0068871_100094236 | Ga0068871_1000942362 | 182 |
| 241 | 3300006358 | Ga0068871_100415797 | Ga0068871_1004157972 | 182 |
| 242 | 3300006358 | Ga0068871_100544488 | Ga0068871_1005444882 | 182 |
| 243 | 3300006358 | Ga0068871_100654374 | Ga0068871_1006543742 | 182 |
| 244 | 3300006844 | Ga0075428_100002070 | Ga0075428_10000207019 | 182 |
| 245 | 3300006844 | Ga0075428_100004658 | Ga0075428_10000465815 | 182 |
| 246 | 3300006844 | Ga0075428_100012224 | Ga0075428_1000122248 | 182 |
| 247 | 3300006844 | Ga0075428_100038164 | Ga0075428_1000381645 | 182 |
| 248 | 3300006844 | Ga0075428_100380745 | Ga0075428_1003807452 | 182 |
| 249 | 3300006846 | Ga0075430_100075385 | Ga0075430_1000753852 | 182 |
| 250 | 3300006846 | Ga0075430_100336650 | Ga0075430_1003366502 | 182 |
| 251 | 3300006847 | Ga0075431_100000030 | Ga0075431_1000000303 | 182 |
| 252 | 3300006847 | Ga0075431_100018484 | Ga0075431_1000184847 | 182 |
| 253 | 3300006847 | Ga0075431_100256976 | Ga0075431_1002569762 | 182 |
| 254 | 3300006871 | Ga0075434_100551957 | Ga0075434_1005519572 | 182 |
| 255 | 3300006880 | Ga0075429_100006776 | Ga0075429_1000067769 | 182 |
| 256 | 3300006880 | Ga0075429_100100005 | Ga0075429_1001000052 | 182 |
| 257 | 3300006880 | Ga0075429_100107637 | Ga0075429_1001076372 | 182 |
| 258 | 3300006880 | Ga0075429_100679284 | Ga0075429_1006792841 | 182 |
| 259 | 3300006880 | Ga0075429_101278567 | Ga0075429_1012785671 | 182 |
| 260 | 3300006881 | Ga0068865_100005989 | Ga0068865_1000059897 | 182 |
| 261 | 3300006881 | Ga0068865_100032027 | Ga0068865_1000320273 | 182 |
| 262 | 3300006881 | Ga0068865_100154253 | Ga0068865_1001542532 | 182 |
| 263 | 3300006881 | Ga0068865_100256914 | Ga0068865_1002569142 | 182 |
| 264 | 3300006931 | Ga0097620_100000929 | Ga0097620_1000009298 | 182 |
| 265 | 3300006931 | Ga0097620_100009203 | Ga0097620_1000092035 | 182 |
| 266 | 3300006931 | Ga0097620_100125225 | Ga0097620_1001252253 | 182 |
| 267 | 3300006931 | Ga0097620_100228650 | Ga0097620_1002286502 | 182 |
| 268 | 3300006931 | Ga0097620_100354551 | Ga0097620_1003545512 | 182 |
| 269 | 3300006931 | Ga0097620_102080195 | Ga0097620_1020801951 | 182 |
| 270 | 3300007076 | Ga0075435_100389863 | Ga0075435_1003898632 | 182 |
| 271 | 3300007076 | Ga0075435_100609771 | Ga0075435_1006097712 | 182 |
| 272 | 3300007265 | Ga0099794_10011136 | Ga0099794_100111362 | 182 |
| 273 | 3300007265 | Ga0099794_10021256 | Ga0099794_100212562 | 182 |
| 274 | 3300007788 | Ga0099795_10037368 | Ga0099795_100373682 | 182 |
| 275 | 3300009093 | Ga0105240_10002127 | Ga0105240_1000212716 | 182 |
| 276 | 3300009093 | Ga0105240_10009513 | Ga0105240_100095138 | 182 |
| 277 | 3300009093 | Ga0105240_10043180 | Ga0105240_100431802 | 182 |
| 278 | 3300009093 | Ga0105240_10062866 | Ga0105240_100628663 | 182 |
| 279 | 3300009093 | Ga0105240_10268433 | Ga0105240_102684332 | 182 |
| 280 | 3300009093 | Ga0105240_10578905 | Ga0105240_105789052 | 182 |
| 281 | 3300009093 | Ga0105240_10779600 | Ga0105240_107796002 | 182 |
| 282 | 3300009093 | Ga0105240_11130489 | Ga0105240_111304892 | 182 |
| 283 | 3300009094 | Ga0111539_10009762 | Ga0111539_100097628 | 182 |
| 284 | 3300009094 | Ga0111539_10065955 | Ga0111539_100659552 | 182 |
| 285 | 3300009094 | Ga0111539_10168629 | Ga0111539_101686292 | 182 |
| 286 | 3300009094 | Ga0111539_10233281 | Ga0111539_102332812 | 182 |
| 287 | 3300009094 | Ga0111539_10284440 | Ga0111539_102844402 | 182 |
| 288 | 3300009094 | Ga0111539_10498440 | Ga0111539_104984402 | 182 |
| 289 | 3300009094 | Ga0111539_10704175 | Ga0111539_107041752 | 182 |
| 290 | 3300009094 | Ga0111539_11374338 | Ga0111539_113743381 | 182 |
| 291 | 3300009098 | Ga0105245_10019110 | Ga0105245_100191104 | 182 |
| 292 | 3300009098 | Ga0105245_10541684 | Ga0105245_105416843 | 182 |
| 293 | 3300009101 | Ga0105247_10000390 | Ga0105247_1000039035 | 182 |
| 294 | 3300009101 | Ga0105247_10008064 | Ga0105247_100080643 | 182 |
| 295 | 3300009101 | Ga0105247_10065548 | Ga0105247_100655482 | 182 |
| 296 | 3300009101 | Ga0105247_10434298 | Ga0105247_104342982 | 182 |
| 297 | 3300009147 | Ga0114129_10153233 | Ga0114129_101532333 | 182 |
| 298 | 3300009147 | Ga0114129_10272428 | Ga0114129_102724282 | 182 |
| 299 | 3300009147 | Ga0114129_10939058 | Ga0114129_109390582 | 182 |
| 300 | 3300009148 | Ga0105243_10102731 | Ga0105243_101027313 | 182 |
| 301 | 3300009148 | Ga0105243_10168742 | Ga0105243_101687422 | 182 |
| 302 | 3300009148 | Ga0105243_10391033 | Ga0105243_103910331 | 182 |
| 303 | 3300009148 | Ga0105243_11630474 | Ga0105243_116304741 | 182 |
| 304 | 3300009174 | Ga0105241_10034500 | Ga0105241_100345005 | 182 |
| 305 | 3300009174 | Ga0105241_10473736 | Ga0105241_104737362 | 182 |
| 306 | 3300009174 | Ga0105241_10541193 | Ga0105241_105411932 | 182 |
| 307 | 3300009176 | Ga0105242_10006693 | Ga0105242_100066939 | 182 |
| 308 | 3300009176 | Ga0105242_10019979 | Ga0105242_100199793 | 182 |
| 309 | 3300009176 | Ga0105242_10648072 | Ga0105242_106480722 | 182 |
| 310 | 3300009177 | Ga0105248_10001404 | Ga0105248_100014042 | 182 |
| 311 | 3300009177 | Ga0105248_10010920 | Ga0105248_100109206 | 182 |
| 312 | 3300009177 | Ga0105248_10030432 | Ga0105248_100304326 | 182 |
| 313 | 3300009177 | Ga0105248_10075402 | Ga0105248_100754023 | 182 |
| 314 | 3300009177 | Ga0105248_11171076 | Ga0105248_111710762 | 182 |
| 315 | 3300009177 | Ga0105248_11812101 | Ga0105248_118121011 | 182 |
| 316 | 3300009545 | Ga0105237_10007658 | Ga0105237_1000765810 | 182 |
| 317 | 3300009545 | Ga0105237_10162994 | Ga0105237_101629942 | 182 |
| 318 | 3300009545 | Ga0105237_10217056 | Ga0105237_102170562 | 182 |
| 319 | 3300009545 | Ga0105237_10793924 | Ga0105237_107939241 | 182 |
| 320 | 3300009551 | Ga0105238_10078897 | Ga0105238_100788973 | 182 |
| 321 | 3300009551 | Ga0105238_10131609 | Ga0105238_101316091 | 182 |
| 322 | 3300009551 | Ga0105238_10486809 | Ga0105238_104868092 | 182 |
| 323 | 3300009551 | Ga0105238_10947601 | Ga0105238_109476012 | 182 |
| 324 | 3300009553 | Ga0105249_10036444 | Ga0105249_100364442 | 182 |
| 325 | 3300009553 | Ga0105249_10073971 | Ga0105249_100739712 | 182 |
| 326 | 3300009553 | Ga0105249_10186168 | Ga0105249_101861682 | 182 |
| 327 | 3300009553 | Ga0105249_10349425 | Ga0105249_103494252 | 182 |
| 328 | 3300009553 | Ga0105249_10459195 | Ga0105249_104591952 | 182 |
| 329 | 3300009553 | Ga0105249_10559372 | Ga0105249_105593722 | 182 |
| 330 | 3300010159 | Ga0099796_10004014 | Ga0099796_100040142 | 182 |
| 331 | 3300010159 | Ga0099796_10027107 | Ga0099796_100271072 | 182 |
| 332 | 3300010375 | Ga0105239_10019263 | Ga0105239_100192636 | 182 |
| 333 | 3300010375 | Ga0105239_11375874 | Ga0105239_113758741 | 182 |
| 334 | 3300011119 | Ga0105246_10333158 | Ga0105246_103331582 | 182 |
| 335 | 3300011119 | Ga0105246_10836110 | Ga0105246_108361102 | 182 |
| 336 | 3300013105 | Ga0157369_10102450 | Ga0157369_101024502 | 182 |
| 337 | 3300013105 | Ga0157369_11025486 | Ga0157369_110254861 | 182 |
| 338 | 3300013296 | Ga0157374_11018673 | Ga0157374_110186732 | 182 |
| 339 | 3300013296 | Ga0157374_11110920 | Ga0157374_111109202 | 182 |
| 340 | 3300013297 | Ga0157378_10019771 | Ga0157378_100197712 | 182 |
| 341 | 3300013306 | Ga0163162_10080582 | Ga0163162_100805823 | 182 |
| 342 | 3300013306 | Ga0163162_10598608 | Ga0163162_105986081 | 182 |
| 343 | 3300013306 | Ga0163162_10608667 | Ga0163162_106086672 | 182 |
| 344 | 3300013306 | Ga0163162_10892668 | Ga0163162_108926682 | 182 |
| 345 | 3300013307 | Ga0157372_10473686 | Ga0157372_104736862 | 182 |
| 346 | 3300013308 | Ga0157375_10007357 | Ga0157375_100073579 | 182 |
| 347 | 3300013308 | Ga0157375_10052757 | Ga0157375_100527573 | 182 |
| 348 | 3300013308 | Ga0157375_10094100 | Ga0157375_100941003 | 182 |
| 349 | 3300013308 | Ga0157375_10465439 | Ga0157375_104654392 | 182 |
| 350 | 3300013308 | Ga0157375_12095973 | Ga0157375_120959731 | 182 |
| 351 | 3300014325 | Ga0163163_10003787 | Ga0163163_100037875 | 182 |
| 352 | 3300014325 | Ga0163163_10109595 | Ga0163163_101095953 | 182 |
| 353 | 3300014325 | Ga0163163_10426054 | Ga0163163_104260542 | 182 |
| 354 | 3300014325 | Ga0163163_10444905 | Ga0163163_104449052 | 182 |
| 355 | 3300014326 | Ga0157380_10000110 | Ga0157380_1000011018 | 182 |
| 356 | 3300014326 | Ga0157380_10121662 | Ga0157380_101216622 | 182 |
| 357 | 3300014326 | Ga0157380_10182007 | Ga0157380_101820072 | 182 |
| 358 | 3300014326 | Ga0157380_10288471 | Ga0157380_102884712 | 182 |
| 359 | 3300014326 | Ga0157380_10752052 | Ga0157380_107520522 | 182 |
| 360 | 3300014326 | Ga0157380_11600129 | Ga0157380_116001291 | 182 |
| 361 | 3300014745 | Ga0157377_10289230 | Ga0157377_102892302 | 182 |
| 362 | 3300014745 | Ga0157377_10686463 | Ga0157377_106864631 | 182 |
| 363 | 3300014968 | Ga0157379_10020721 | Ga0157379_100207212 | 182 |
| 364 | 3300014968 | Ga0157379_10029861 | Ga0157379_100298612 | 182 |
| 365 | 3300014968 | Ga0157379_10063423 | Ga0157379_100634233 | 182 |
| 366 | 3300014968 | Ga0157379_10254981 | Ga0157379_102549812 | 182 |
| 367 | 3300014968 | Ga0157379_10276329 | Ga0157379_102763291 | 182 |
| 368 | 3300014968 | Ga0157379_10373013 | Ga0157379_103730132 | 182 |
| 369 | 3300014969 | Ga0157376_10144586 | Ga0157376_101445862 | 182 |
| 370 | 3300014969 | Ga0157376_10150207 | Ga0157376_101502072 | 182 |
| 371 | 3300014969 | Ga0157376_10290937 | Ga0157376_102909372 | 182 |
| 372 | 3300014969 | Ga0157376_10553980 | Ga0157376_105539802 | 182 |
| 373 | 3300017792 | Ga0163161_10131136 | Ga0163161_101311361 | 182 |
| 374 | 3300017792 | Ga0163161_10197194 | Ga0163161_101971941 | 182 |
| 375 | 3300021377 | Ga0213874_10003273 | Ga0213874_100032731 | 182 |
| 376 | 3300021377 | Ga0213874_10015214 | Ga0213874_100152142 | 182 |
| 377 | 3300021384 | Ga0213876_10063757 | Ga0213876_100637572 | 182 |
| 378 | 3300025893 | Ga0207682_10003425 | Ga0207682_100034255 | 182 |
| 379 | 3300025893 | Ga0207682_10010135 | Ga0207682_100101352 | 182 |
| 380 | 3300025898 | Ga0207692_10119187 | Ga0207692_101191872 | 182 |
| 381 | 3300025898 | Ga0207692_10322806 | Ga0207692_103228062 | 182 |
| 382 | 3300025899 | Ga0207642_10056367 | Ga0207642_100563672 | 182 |
| 383 | 3300025899 | Ga0207642_10605368 | Ga0207642_106053681 | 182 |
| 384 | 3300025900 | Ga0207710_10000349 | Ga0207710_100003497 | 182 |
| 385 | 3300025900 | Ga0207710_10039830 | Ga0207710_100398302 | 182 |
| 386 | 3300025901 | Ga0207688_10073680 | Ga0207688_100736802 | 182 |
| 387 | 3300025903 | Ga0207680_10009849 | Ga0207680_100098491 | 182 |
| 388 | 3300025903 | Ga0207680_10024115 | Ga0207680_100241155 | 182 |
| 389 | 3300025903 | Ga0207680_10036291 | Ga0207680_100362913 | 182 |
| 390 | 3300025903 | Ga0207680_10315088 | Ga0207680_103150882 | 182 |
| 391 | 3300025905 | Ga0207685_10010026 | Ga0207685_100100262 | 182 |
| 392 | 3300025906 | Ga0207699_10017383 | Ga0207699_100173832 | 182 |
| 393 | 3300025906 | Ga0207699_10067788 | Ga0207699_100677882 | 182 |
| 394 | 3300025906 | Ga0207699_10094380 | Ga0207699_100943802 | 182 |
| 395 | 3300025906 | Ga0207699_10122333 | Ga0207699_101223332 | 182 |
| 396 | 3300025906 | Ga0207699_10279916 | Ga0207699_102799162 | 182 |
| 397 | 3300025907 | Ga0207645_10054717 | Ga0207645_100547172 | 182 |
| 398 | 3300025907 | Ga0207645_10063416 | Ga0207645_100634163 | 182 |
| 399 | 3300025907 | Ga0207645_10716960 | Ga0207645_107169601 | 182 |
| 400 | 3300025908 | Ga0207643_10046737 | Ga0207643_100467372 | 182 |
| 401 | 3300025911 | Ga0207654_10037130 | Ga0207654_100371302 | 182 |
| 402 | 3300025912 | Ga0207707_10001614 | Ga0207707_1000161411 | 182 |
| 403 | 3300025912 | Ga0207707_10025599 | Ga0207707_100255993 | 182 |
| 404 | 3300025912 | Ga0207707_10083736 | Ga0207707_100837362 | 182 |
| 405 | 3300025913 | Ga0207695_10045635 | Ga0207695_100456351 | 182 |
| 406 | 3300025913 | Ga0207695_10051308 | Ga0207695_100513082 | 182 |
| 407 | 3300025913 | Ga0207695_10070636 | Ga0207695_100706363 | 182 |
| 408 | 3300025913 | Ga0207695_10094832 | Ga0207695_100948322 | 182 |
| 409 | 3300025913 | Ga0207695_10195446 | Ga0207695_101954463 | 182 |
| 410 | 3300025913 | Ga0207695_10615611 | Ga0207695_106156112 | 182 |
| 411 | 3300025914 | Ga0207671_10020859 | Ga0207671_100208595 | 182 |
| 412 | 3300025914 | Ga0207671_10869086 | Ga0207671_108690861 | 182 |
| 413 | 3300025915 | Ga0207693_10000083 | Ga0207693_1000008334 | 182 |
| 414 | 3300025915 | Ga0207693_10045814 | Ga0207693_100458142 | 182 |
| 415 | 3300025916 | Ga0207663_10036366 | Ga0207663_100363662 | 182 |
| 416 | 3300025916 | Ga0207663_10365554 | Ga0207663_103655542 | 182 |
| 417 | 3300025917 | Ga0207660_10024344 | Ga0207660_100243443 | 182 |
| 418 | 3300025917 | Ga0207660_10131916 | Ga0207660_101319162 | 182 |
| 419 | 3300025917 | Ga0207660_10169745 | Ga0207660_101697452 | 182 |
| 420 | 3300025918 | Ga0207662_10003138 | Ga0207662_100031388 | 182 |
| 421 | 3300025918 | Ga0207662_10039816 | Ga0207662_100398163 | 182 |
| 422 | 3300025918 | Ga0207662_10172241 | Ga0207662_101722412 | 182 |
| 423 | 3300025918 | Ga0207662_10331532 | Ga0207662_103315322 | 182 |
| 424 | 3300025919 | Ga0207657_10286473 | Ga0207657_102864732 | 182 |
| 425 | 3300025920 | Ga0207649_10098602 | Ga0207649_100986022 | 182 |
| 426 | 3300025920 | Ga0207649_10376931 | Ga0207649_103769312 | 182 |
| 427 | 3300025920 | Ga0207649_10934033 | Ga0207649_109340331 | 182 |
| 428 | 3300025921 | Ga0207652_10008803 | Ga0207652_100088038 | 182 |
| 429 | 3300025923 | Ga0207681_10105768 | Ga0207681_101057682 | 182 |
| 430 | 3300025923 | Ga0207681_10252197 | Ga0207681_102521972 | 182 |
| 431 | 3300025924 | Ga0207694_10041971 | Ga0207694_100419712 | 182 |
| 432 | 3300025924 | Ga0207694_10092589 | Ga0207694_100925893 | 182 |
| 433 | 3300025924 | Ga0207694_10481610 | Ga0207694_104816102 | 182 |
| 434 | 3300025924 | Ga0207694_10830833 | Ga0207694_108308331 | 182 |
| 435 | 3300025924 | Ga0207694_10846327 | Ga0207694_108463272 | 182 |
| 436 | 3300025925 | Ga0207650_10446284 | Ga0207650_104462842 | 182 |
| 437 | 3300025925 | Ga0207650_10478583 | Ga0207650_104785832 | 182 |
| 438 | 3300025926 | Ga0207659_10006597 | Ga0207659_100065976 | 182 |
| 439 | 3300025926 | Ga0207659_10128580 | Ga0207659_101285802 | 182 |
| 440 | 3300025926 | Ga0207659_10545303 | Ga0207659_105453032 | 182 |
| 441 | 3300025926 | Ga0207659_10566304 | Ga0207659_105663042 | 182 |
| 442 | 3300025928 | Ga0207700_10011337 | Ga0207700_100113375 | 182 |
| 443 | 3300025928 | Ga0207700_10026505 | Ga0207700_100265052 | 182 |
| 444 | 3300025929 | Ga0207664_10013517 | Ga0207664_100135173 | 182 |
| 445 | 3300025929 | Ga0207664_10043030 | Ga0207664_100430302 | 182 |
| 446 | 3300025929 | Ga0207664_10047267 | Ga0207664_100472675 | 182 |
| 447 | 3300025931 | Ga0207644_10000660 | Ga0207644_100006603 | 182 |
| 448 | 3300025931 | Ga0207644_10174134 | Ga0207644_101741342 | 182 |
| 449 | 3300025933 | Ga0207706_10055844 | Ga0207706_100558443 | 182 |
| 450 | 3300025933 | Ga0207706_10323827 | Ga0207706_103238272 | 182 |
| 451 | 3300025934 | Ga0207686_10411020 | Ga0207686_104110202 | 182 |
| 452 | 3300025936 | Ga0207670_10019610 | Ga0207670_100196102 | 182 |
| 453 | 3300025936 | Ga0207670_10204666 | Ga0207670_102046662 | 182 |
| 454 | 3300025937 | Ga0207669_10035440 | Ga0207669_100354403 | 182 |
| 455 | 3300025937 | Ga0207669_10097759 | Ga0207669_100977592 | 182 |
| 456 | 3300025937 | Ga0207669_10319320 | Ga0207669_103193201 | 182 |
| 457 | 3300025938 | Ga0207704_10047013 | Ga0207704_100470133 | 182 |
| 458 | 3300025938 | Ga0207704_10050165 | Ga0207704_100501653 | 182 |
| 459 | 3300025938 | Ga0207704_10090212 | Ga0207704_100902122 | 182 |
| 460 | 3300025938 | Ga0207704_10151418 | Ga0207704_101514182 | 182 |
| 461 | 3300025938 | Ga0207704_10175278 | Ga0207704_101752782 | 182 |
| 462 | 3300025939 | Ga0207665_10000587 | Ga0207665_100005877 | 182 |
| 463 | 3300025939 | Ga0207665_10015240 | Ga0207665_100152402 | 182 |
| 464 | 3300025939 | Ga0207665_10141497 | Ga0207665_101414972 | 182 |
| 465 | 3300025940 | Ga0207691_10000808 | Ga0207691_1000080820 | 182 |
| 466 | 3300025940 | Ga0207691_10020237 | Ga0207691_100202373 | 182 |
| 467 | 3300025940 | Ga0207691_10155413 | Ga0207691_101554132 | 182 |
| 468 | 3300025940 | Ga0207691_10269659 | Ga0207691_102696592 | 182 |
| 469 | 3300025941 | Ga0207711_10019836 | Ga0207711_100198362 | 182 |
| 470 | 3300025941 | Ga0207711_10020918 | Ga0207711_100209186 | 182 |
| 471 | 3300025941 | Ga0207711_10175845 | Ga0207711_101758452 | 182 |
| 472 | 3300025942 | Ga0207689_10006816 | Ga0207689_100068165 | 182 |
| 473 | 3300025942 | Ga0207689_10068790 | Ga0207689_100687902 | 182 |
| 474 | 3300025942 | Ga0207689_10586526 | Ga0207689_105865262 | 182 |
| 475 | 3300025944 | Ga0207661_10393241 | Ga0207661_103932411 | 182 |
| 476 | 3300025944 | Ga0207661_10967791 | Ga0207661_109677911 | 182 |
| 477 | 3300025945 | Ga0207679_10035222 | Ga0207679_100352223 | 182 |
| 478 | 3300025945 | Ga0207679_10255264 | Ga0207679_102552642 | 182 |
| 479 | 3300025945 | Ga0207679_11287257 | Ga0207679_112872571 | 182 |
| 480 | 3300025949 | Ga0207667_10004634 | Ga0207667_1000463413 | 182 |
| 481 | 3300025949 | Ga0207667_10297061 | Ga0207667_102970612 | 182 |
| 482 | 3300025949 | Ga0207667_10419651 | Ga0207667_104196512 | 182 |
| 483 | 3300025960 | Ga0207651_10012726 | Ga0207651_100127263 | 182 |
| 484 | 3300025960 | Ga0207651_10021532 | Ga0207651_100215322 | 182 |
| 485 | 3300025960 | Ga0207651_10044659 | Ga0207651_100446592 | 182 |
| 486 | 3300025960 | Ga0207651_10130569 | Ga0207651_101305692 | 182 |
| 487 | 3300025960 | Ga0207651_10420972 | Ga0207651_104209722 | 182 |
| 488 | 3300025961 | Ga0207712_10041797 | Ga0207712_100417972 | 182 |
| 489 | 3300025961 | Ga0207712_10046720 | Ga0207712_100467202 | 182 |
| 490 | 3300025972 | Ga0207668_10044717 | Ga0207668_100447173 | 182 |
| 491 | 3300025972 | Ga0207668_10621621 | Ga0207668_106216212 | 182 |
| 492 | 3300025986 | Ga0207658_10435869 | Ga0207658_104358692 | 182 |
| 493 | 3300025986 | Ga0207658_10768776 | Ga0207658_107687761 | 182 |
| 494 | 3300025986 | Ga0207658_11501410 | Ga0207658_115014101 | 182 |
| 495 | 3300026023 | Ga0207677_10044619 | Ga0207677_100446193 | 182 |
| 496 | 3300026023 | Ga0207677_10497306 | Ga0207677_104973062 | 182 |
| 497 | 3300026035 | Ga0207703_10002919 | Ga0207703_100029193 | 182 |
| 498 | 3300026035 | Ga0207703_10004149 | Ga0207703_100041492 | 182 |
| 499 | 3300026035 | Ga0207703_10071608 | Ga0207703_100716082 | 182 |
| 500 | 3300026035 | Ga0207703_10122843 | Ga0207703_101228432 | 182 |
| 501 | 3300026035 | Ga0207703_10226563 | Ga0207703_102265632 | 182 |
| 502 | 3300026035 | Ga0207703_10463879 | Ga0207703_104638792 | 182 |
| 503 | 3300026041 | Ga0207639_10174985 | Ga0207639_101749852 | 182 |
| 504 | 3300026041 | Ga0207639_10197304 | Ga0207639_101973042 | 182 |
| 505 | 3300026067 | Ga0207678_10057667 | Ga0207678_100576673 | 182 |
| 506 | 3300026067 | Ga0207678_10143351 | Ga0207678_101433512 | 182 |
| 507 | 3300026075 | Ga0207708_10126206 | Ga0207708_101262062 | 182 |
| 508 | 3300026075 | Ga0207708_10143037 | Ga0207708_101430372 | 182 |
| 509 | 3300026075 | Ga0207708_10262327 | Ga0207708_102623272 | 182 |
| 510 | 3300026078 | Ga0207702_10021375 | Ga0207702_100213752 | 182 |
| 511 | 3300026078 | Ga0207702_10024278 | Ga0207702_100242783 | 182 |
| 512 | 3300026078 | Ga0207702_11134358 | Ga0207702_111343582 | 182 |
| 513 | 3300026088 | Ga0207641_10000266 | Ga0207641_1000026663 | 182 |
| 514 | 3300026088 | Ga0207641_10004267 | Ga0207641_100042672 | 182 |
| 515 | 3300026088 | Ga0207641_10072695 | Ga0207641_100726952 | 182 |
| 516 | 3300026088 | Ga0207641_10078506 | Ga0207641_100785062 | 182 |
| 517 | 3300026089 | Ga0207648_10011589 | Ga0207648_100115898 | 182 |
| 518 | 3300026089 | Ga0207648_10307452 | Ga0207648_103074522 | 182 |
| 519 | 3300026089 | Ga0207648_10420128 | Ga0207648_104201282 | 182 |
| 520 | 3300026089 | Ga0207648_10538471 | Ga0207648_105384712 | 182 |
| 521 | 3300026089 | Ga0207648_10550578 | Ga0207648_105505782 | 182 |
| 522 | 3300026095 | Ga0207676_10000965 | Ga0207676_100009656 | 182 |
| 523 | 3300026116 | Ga0207674_10045038 | Ga0207674_100450384 | 182 |
| 524 | 3300026116 | Ga0207674_10324191 | Ga0207674_103241912 | 182 |
| 525 | 3300026118 | Ga0207675_100001909 | Ga0207675_1000019094 | 182 |
| 526 | 3300026118 | Ga0207675_100017235 | Ga0207675_1000172353 | 182 |
| 527 | 3300026118 | Ga0207675_100021368 | Ga0207675_1000213682 | 182 |
| 528 | 3300026118 | Ga0207675_100108282 | Ga0207675_1001082822 | 182 |
| 529 | 3300026118 | Ga0207675_100262014 | Ga0207675_1002620142 | 182 |
| 530 | 3300026121 | Ga0207683_10002455 | Ga0207683_100024556 | 182 |
| 531 | 3300026121 | Ga0207683_10012739 | Ga0207683_100127397 | 182 |
| 532 | 3300026121 | Ga0207683_10418636 | Ga0207683_104186362 | 182 |
| 533 | 3300026121 | Ga0207683_10988293 | Ga0207683_109882932 | 182 |
| 534 | 3300027907 | Ga0207428_10018642 | Ga0207428_100186421 | 182 |
| 535 | 3300027907 | Ga0207428_10037638 | Ga0207428_100376383 | 182 |
| 536 | 3300027907 | Ga0207428_10053868 | Ga0207428_100538683 | 182 |
| 537 | 3300027907 | Ga0207428_10077052 | Ga0207428_100770523 | 182 |
| 538 | 3300028017 | Ga0265356_1001033 | Ga0265356_10010334 | 182 |
| 539 | 3300028379 | Ga0268266_10000159 | Ga0268266_10000159112 | 182 |
| 540 | 3300028379 | Ga0268266_10004018 | Ga0268266_100040185 | 182 |
| 541 | 3300028379 | Ga0268266_10018604 | Ga0268266_100186042 | 182 |
| 542 | 3300028379 | Ga0268266_10020525 | Ga0268266_100205258 | 182 |
| 543 | 3300028379 | Ga0268266_10021131 | Ga0268266_100211313 | 182 |
| 544 | 3300028379 | Ga0268266_10021707 | Ga0268266_100217075 | 182 |
| 545 | 3300028379 | Ga0268266_10036776 | Ga0268266_100367762 | 182 |
| 546 | 3300028379 | Ga0268266_10103250 | Ga0268266_101032502 | 182 |
| 547 | 3300028379 | Ga0268266_10113600 | Ga0268266_101136002 | 182 |
| 548 | 3300028379 | Ga0268266_10229263 | Ga0268266_102292632 | 182 |
| 549 | 3300028379 | Ga0268266_10474874 | Ga0268266_104748742 | 182 |
| 550 | 3300028380 | Ga0268265_10015831 | Ga0268265_100158315 | 182 |
| 551 | 3300028380 | Ga0268265_10026933 | Ga0268265_100269334 | 182 |
| 552 | 3300028380 | Ga0268265_10085663 | Ga0268265_100856632 | 182 |
| 553 | 3300028380 | Ga0268265_10269110 | Ga0268265_102691102 | 182 |
| 554 | 3300028380 | Ga0268265_10400670 | Ga0268265_104006702 | 182 |
| 555 | 3300028380 | Ga0268265_10421531 | Ga0268265_104215312 | 182 |
| 556 | 3300028380 | Ga0268265_10486922 | Ga0268265_104869222 | 182 |
| 557 | 3300028380 | Ga0268265_10513957 | Ga0268265_105139572 | 182 |
| 558 | 3300028381 | Ga0268264_10000047 | Ga0268264_1000004721 | 182 |
| 559 | 3300028381 | Ga0268264_10000140 | Ga0268264_1000014020 | 182 |
| 560 | 3300028381 | Ga0268264_10037266 | Ga0268264_100372664 | 182 |
| 561 | 3300028381 | Ga0268264_10326291 | Ga0268264_103262912 | 182 |
| 562 | 3300028573 | Ga0265334_10012381 | Ga0265334_100123813 | 182 |
| 563 | 3300028786 | Ga0307517_10215405 | Ga0307517_102154052 | 182 |
| 564 | 3300028794 | Ga0307515_10001652 | Ga0307515_1000165230 | 182 |
| 565 | 3300028794 | Ga0307515_10121290 | Ga0307515_101212902 | 182 |
| 566 | 3300028794 | Ga0307515_10195041 | Ga0307515_101950412 | 182 |
| 567 | 3300028794 | Ga0307515_10606956 | Ga0307515_106069561 | 182 |
| 568 | 3300030521 | Ga0307511_10000268 | Ga0307511_1000026819 | 182 |
| 569 | 3300030521 | Ga0307511_10051996 | Ga0307511_100519962 | 182 |
| 570 | 3300030878 | Ga0265770_1000007 | Ga0265770_100000716 | 182 |
| 571 | 3300031090 | Ga0265760_10005135 | Ga0265760_100051352 | 182 |
| 572 | 3300031090 | Ga0265760_10098769 | Ga0265760_100987691 | 182 |
| 573 | 3300031247 | Ga0265340_10275247 | Ga0265340_102752471 | 182 |
| 574 | 3300031249 | Ga0265339_10226767 | Ga0265339_102267671 | 182 |
| 575 | 3300031250 | Ga0265331_10002039 | Ga0265331_100020399 | 182 |
| 576 | 3300031456 | Ga0307513_10049297 | Ga0307513_100492974 | 182 |
| 577 | 3300031456 | Ga0307513_10053175 | Ga0307513_100531754 | 182 |
| 578 | 3300031456 | Ga0307513_10113314 | Ga0307513_101133142 | 182 |
| 579 | 3300031456 | Ga0307513_10115262 | Ga0307513_101152622 | 182 |
| 580 | 3300031456 | Ga0307513_10181146 | Ga0307513_101811461 | 182 |
| 581 | 3300031507 | Ga0307509_10001396 | Ga0307509_1000139625 | 182 |
| 582 | 3300031507 | Ga0307509_10042256 | Ga0307509_100422562 | 182 |
| 583 | 3300031507 | Ga0307509_10059381 | Ga0307509_100593813 | 182 |
| 584 | 3300031507 | Ga0307509_10643087 | Ga0307509_106430872 | 182 |
| 585 | 3300031548 | Ga0307408_100134284 | Ga0307408_1001342842 | 182 |
| 586 | 3300031616 | Ga0307508_10207321 | Ga0307508_102073212 | 182 |
| 587 | 3300031727 | Ga0316576_10051790 | Ga0316576_100517902 | 182 |
| 588 | 3300031727 | Ga0316576_10068868 | Ga0316576_100688682 | 182 |
| 589 | 3300031727 | Ga0316576_10201666 | Ga0316576_102016662 | 182 |
| 590 | 3300031730 | Ga0307516_10002208 | Ga0307516_1000220817 | 182 |
| 591 | 3300031731 | Ga0307405_10048178 | Ga0307405_100481782 | 182 |
| 592 | 3300031731 | Ga0307405_10620416 | Ga0307405_106204162 | 182 |
| 593 | 3300031824 | Ga0307413_10010738 | Ga0307413_100107384 | 182 |
| 594 | 3300031824 | Ga0307413_10030393 | Ga0307413_100303932 | 182 |
| 595 | 3300031824 | Ga0307413_10254987 | Ga0307413_102549872 | 182 |
| 596 | 3300031824 | Ga0307413_10282177 | Ga0307413_102821771 | 182 |
| 597 | 3300031852 | Ga0307410_10006032 | Ga0307410_100060324 | 182 |
| 598 | 3300031852 | Ga0307410_10111930 | Ga0307410_101119302 | 182 |
| 599 | 3300031901 | Ga0307406_10010319 | Ga0307406_100103192 | 182 |
| 600 | 3300031901 | Ga0307406_10220386 | Ga0307406_102203862 | 182 |
| 601 | 3300031901 | Ga0307406_10271691 | Ga0307406_102716912 | 182 |
| 602 | 3300031901 | Ga0307406_10609286 | Ga0307406_106092862 | 182 |
| 603 | 3300031901 | Ga0307406_10859982 | Ga0307406_108599821 | 182 |
| 604 | 3300031903 | Ga0307407_10015668 | Ga0307407_100156683 | 182 |
| 605 | 3300031903 | Ga0307407_10041476 | Ga0307407_100414762 | 182 |
| 606 | 3300031911 | Ga0307412_10286848 | Ga0307412_102868481 | 182 |
| 607 | 3300031911 | Ga0307412_10691078 | Ga0307412_106910781 | 182 |
| 608 | 3300031911 | Ga0307412_11447345 | Ga0307412_114473451 | 182 |
| 609 | 3300031995 | Ga0307409_100189418 | Ga0307409_1001894182 | 182 |
| 610 | 3300031995 | Ga0307409_100427238 | Ga0307409_1004272382 | 182 |
| 611 | 3300031995 | Ga0307409_100677127 | Ga0307409_1006771272 | 182 |
| 612 | 3300032002 | Ga0307416_100192517 | Ga0307416_1001925172 | 182 |
| 613 | 3300032002 | Ga0307416_100368594 | Ga0307416_1003685942 | 182 |
| 614 | 3300032002 | Ga0307416_100458569 | Ga0307416_1004585692 | 182 |
| 615 | 3300032002 | Ga0307416_101119484 | Ga0307416_1011194842 | 182 |
| 616 | 3300032002 | Ga0307416_102014556 | Ga0307416_1020145561 | 182 |
| 617 | 3300032004 | Ga0307414_10459409 | Ga0307414_104594092 | 182 |
| 618 | 3300032004 | Ga0307414_11059891 | Ga0307414_110598911 | 182 |
| 619 | 3300032005 | Ga0307411_10014764 | Ga0307411_100147643 | 182 |
| 620 | 3300032005 | Ga0307411_10078816 | Ga0307411_100788162 | 182 |
| 621 | 3300032005 | Ga0307411_10160080 | Ga0307411_101600802 | 182 |
| 622 | 3300032005 | Ga0307411_10272327 | Ga0307411_102723271 | 182 |
| 623 | 3300032005 | Ga0307411_10399134 | Ga0307411_103991341 | 182 |
| 624 | 3300032005 | Ga0307411_10544499 | Ga0307411_105444991 | 182 |
| 625 | 3300032005 | Ga0307411_10763428 | Ga0307411_107634281 | 182 |
| 626 | 3300032005 | Ga0307411_11100196 | Ga0307411_111001962 | 182 |
| 627 | 3300032005 | Ga0307411_11380182 | Ga0307411_113801821 | 182 |
| 628 | 3300032126 | Ga0307415_100061002 | Ga0307415_1000610021 | 182 |
| 629 | 3300032126 | Ga0307415_100115502 | Ga0307415_1001155022 | 182 |
| 630 | 3300032126 | Ga0307415_100171048 | Ga0307415_1001710482 | 182 |
| 631 | 3300032126 | Ga0307415_100180680 | Ga0307415_1001806802 | 182 |
| 632 | 3300032126 | Ga0307415_100511231 | Ga0307415_1005112311 | 182 |
| 633 | 3300032126 | Ga0307415_100534046 | Ga0307415_1005340461 | 182 |
| 634 | 3300032126 | Ga0307415_100825375 | Ga0307415_1008253752 | 182 |
| 635 | 3300033179 | Ga0307507_10426193 | Ga0307507_104261931 | 182 |
| 636 | 3300033180 | Ga0307510_10005539 | Ga0307510_1000553917 | 182 |
| 637 | 3300033180 | Ga0307510_10256592 | Ga0307510_102565922 | 182 |
| 638 | 3300035111 | Ga0373923_0009894 | Ga0373923_0009894_2144_2692 | 182 |
| 639 | 3300035111 | Ga0373923_0077208 | Ga0373923_0077208_222_770 | 182 |
| 640 | 3300035113 | Ga0373936_0013613 | Ga0373936_0013613_1804_2352 | 182 |
| 641 | 3300035116 | Ga0373945_0211837 | Ga0373945_0211837_230_778 | 182 |
| 642 | 3300035119 | Ga0373956_0164325 | Ga0373956_0164325_253_801 | 182 |
| 643 | 3300035120 | Ga0373957_0055727 | Ga0373957_0055727_288_836 | 182 |
| 644 | 3300035120 | Ga0373957_0068871 | Ga0373957_0068871_308_856 | 182 |
| 645 | 3300035120 | Ga0373957_0131475 | Ga0373957_0131475_86_634 | 182 |
| 646 | 3300035121 | Ga0373960_0077475 | Ga0373960_0077475_247_795 | 182 |
| 647 | 3300035170 | Ga0373943_0326457 | Ga0373943_0326457_267_815 | 182 |
| 648 | 3300035171 | Ga0373946_0234066 | Ga0373946_0234066_277_825 | 182 |
| 649 | 3300035172 | Ga0373955_0009251 | Ga0373955_0009251_193_741 | 182 |
| 650 | 3300035172 | Ga0373955_0069928 | Ga0373955_0069928_97_645 | 182 |
| 651 | 3300035241 | Ga0373961_0016704 | Ga0373961_0016704_1328_1879 | 182 |
| 652 | 3300035242 | Ga0373962_0115306 | Ga0373962_0115306_233_781 | 182 |
| 653 | 3300035398 | Ga0316574_0010344 | Ga0316574_0010344_396_944 | 182 |
| 654 | 3300035398 | Ga0316574_0014494 | Ga0316574_0014494_3724_4353 | 182 |
| 655 | 3300035398 | Ga0316574_0016384 | Ga0316574_0016384_333_881 | 182 |
| 656 | 3300035398 | Ga0316574_0025283 | Ga0316574_0025283_668_1216 | 182 |
| 657 | 3300035398 | Ga0316574_0141004 | Ga0316574_0141004_764_1312 | 182 |
| 658 | 3300035398 | Ga0316574_0264702 | Ga0316574_0264702_363_911 | 182 |
| 659 | 3300035691 | Ga0373931_0775174 | Ga0373931_0775174_37_585 | 182 |
| 660 | 3300035695 | Ga0373927_0020690 | Ga0373927_0020690_630_1178 | 182 |
| 661 | 3300035695 | Ga0373927_0269784 | Ga0373927_0269784_244_792 | 182 |
| 662 | 3300035724 | Ga0373933_0180346 | Ga0373933_0180346_93_641 | 182 |
| 663 | 3300036401 | Ga0373937_0006608 | Ga0373937_0006608_6422_6970 | 182 |
| 664 | 3300036401 | Ga0373937_0025980 | Ga0373937_0025980_1886_2434 | 182 |
| 665 | 3300036401 | Ga0373937_0088213 | Ga0373937_0088213_2240_2812 | 182 |
| 666 | 3300036401 | Ga0373937_0259964 | Ga0373937_0259964_1024_1572 | 182 |
| 667 | 3300036712 | Ga0316584_0003331 | Ga0316584_0003331_8429_9058 | 182 |
| 668 | 3300036712 | Ga0316584_0187258 | Ga0316584_0187258_945_1493 | 182 |
| 669 | 3300037853 | Ga0436364_1238211 | Ga0436364_1238211_29_577 | 182 |
| 670 | 3300039437 | Ga0436365_1772567 | Ga0436365_1772567_9799_10350 | 182 |
| 671 | 3300039437 | Ga0436365_1859648 | Ga0436365_1859648_412_960 | 182 |
| 672 | 3300039438 | Ga0436360_0066373 | Ga0436360_0066373_1506_2063 | 182 |
| 673 | 3300039438 | Ga0436360_0659686 | Ga0436360_0659686_688_1236 | 182 |
| 674 | 3300039438 | Ga0436360_0995015 | Ga0436360_0995015_898_1446 | 182 |
| 675 | 3300039447 | Ga0436361_0066890 | Ga0436361_0066890_1785_2333 | 182 |
| 676 | 3300039447 | Ga0436361_0251740 | Ga0436361_0251740_317_865 | 182 |
| 677 | 3300039450 | Ga0436363_0461713 | Ga0436363_0461713_2957_3505 | 182 |
| 678 | 3300039450 | Ga0436363_0641697 | Ga0436363_0641697_2966_3517 | 182 |
| 679 | 3300039450 | Ga0436363_1646651 | Ga0436363_1646651_2680_3228 | 182 |
| 680 | 3300039453 | Ga0436362_0815706 | Ga0436362_0815706_79_627 | 182 |
| 681 | 3300039453 | Ga0436362_1231019 | Ga0436362_1231019_436_984 | 182 |
| 682 | 3300041443 | Ga0451789_0293465 | Ga0451789_0293465_297_845 | 182 |
| 683 | 3300041451 | Ga0451791_0653772 | Ga0451791_0653772_1784_2332 | 182 |
| 684 | 3300041452 | Ga0451793_0640635 | Ga0451793_0640635_1215_1763 | 182 |
| 685 | 3300041453 | Ga0451797_0966810 | Ga0451797_0966810_496_1044 | 182 |
| 686 | 3300041459 | Ga0451800_0973983 | Ga0451800_0973983_112_660 | 182 |
| 687 | 3300041459 | Ga0451800_1658630 | Ga0451800_1658630_119_667 | 182 |
| 688 | 3300041460 | Ga0451802_1934902 | Ga0451802_1934902_626_1174 | 182 |
| 689 | 3300041460 | Ga0451802_1935343 | Ga0451802_1935343_509_1057 | 182 |
| 690 | 3300041486 | Ga0451807_0065623 | Ga0451807_0065623_4440_4988 | 182 |
| 691 | 3300041486 | Ga0451807_2246987 | Ga0451807_2246987_3417_3965 | 182 |
| 692 | 3300041486 | Ga0451807_2285000 | Ga0451807_2285000_75_623 | 182 |
| 693 | 3300041491 | Ga0451833_1190085 | Ga0451833_1190085_404_952 | 182 |
| 694 | 3300041505 | Ga0451849_1405876 | Ga0451849_1405876_94_642 | 182 |
| 695 | 3300041507 | Ga0451851_1138035 | Ga0451851_1138035_427_975 | 182 |
| 696 | 3300042002 | Ga0439442_023326 | Ga0439442_023326_139_687 | 182 |
| 697 | 3300042005 | Ga0439448_0113438 | Ga0439448_0113438_60_608 | 182 |
| 698 | 3300042007 | Ga0439449_0052926 | Ga0439449_0052926_864_1412 | 182 |
| 699 | 3300042133 | Ga0450896_037636 | Ga0450896_037636_69_617 | 182 |
| 700 | 3300042437 | Ga0439444_0024418 | Ga0439444_0024418_155_709 | 182 |
| 701 | 3300042438 | Ga0439459_0093011 | Ga0439459_0093011_149_697 | 182 |
| 702 | 3300042439 | Ga0439464_0045734 | Ga0439464_0045734_216_764 | 182 |
| 703 | 3300042876 | Ga0451577_0017859 | Ga0451577_0017859_3471_4049 | 182 |
| 704 | 3300042876 | Ga0451577_0076774 | Ga0451577_0076774_430_1008 | 182 |
| 705 | 3300042876 | Ga0451577_0158358 | Ga0451577_0158358_1134_1712 | 182 |
| 706 | 3300044656 | Ga0466969_0010650 | Ga0466969_0010650_3778_4326 | 182 |
| 707 | 3300044656 | Ga0466969_0018694 | Ga0466969_0018694_1377_1925 | 182 |
| 708 | 3300044658 | Ga0466972_0099651 | Ga0466972_0099651_513_1061 | 182 |
| 709 | 3300044673 | Ga0453683_0071396 | Ga0453683_0071396_1422_2036 | 182 |
| 710 | 3300044683 | Ga0466965_0121950 | Ga0466965_0121950_684_1232 | 182 |
| 711 | 3300044683 | Ga0466965_0176878 | Ga0466965_0176878_172_720 | 182 |
| 712 | 3300044684 | Ga0466966_0018782 | Ga0466966_0018782_2224_2772 | 182 |
| 713 | 3300044684 | Ga0466966_0211198 | Ga0466966_0211198_539_1087 | 182 |
| 714 | 3300044684 | Ga0466966_0581404 | Ga0466966_0581404_19_567 | 182 |
| 715 | 3300044693 | Ga0466961_0005738 | Ga0466961_0005738_5173_5721 | 182 |
| 716 | 3300044706 | Ga0466964_0017568 | Ga0466964_0017568_2008_2556 | 182 |
| 717 | 3300044712 | Ga0453684_0032214 | Ga0453684_0032214_3747_4325 | 182 |
| 718 | 3300044712 | Ga0453684_0068289 | Ga0453684_0068289_1086_1700 | 182 |
| 719 | 3300044712 | Ga0453684_0476960 | Ga0453684_0476960_366_944 | 182 |
| 720 | 3300044712 | Ga0453684_0934179 | Ga0453684_0934179_66_695 | 182 |
| 721 | 3300044719 | Ga0466971_0000216 | Ga0466971_0000216_20477_21025 | 182 |
| 722 | 3300044765 | Ga0466970_0002740 | Ga0466970_0002740_4003_4551 | 182 |
| 723 | 3300044842 | Ga0466957_0001530 | Ga0466957_0001530_10104_10652 | 182 |
| 724 | 3300044901 | Ga0466960_0061910 | Ga0466960_0061910_293_841 | 182 |
| 725 | 3300045049 | Ga0466959_0002645 | Ga0466959_0002645_1935_2483 | 182 |
| 726 | 3300045049 | Ga0466959_0010436 | Ga0466959_0010436_4717_5265 | 182 |
| 727 | 3300045049 | Ga0466959_0014163 | Ga0466959_0014163_3870_4418 | 182 |
| 728 | 3300045049 | Ga0466959_0100728 | Ga0466959_0100728_1294_1842 | 182 |
| 729 | 3300045051 | Ga0451576_0023536 | Ga0451576_0023536_2207_2755 | 182 |
| 730 | 3300045051 | Ga0451576_0215678 | Ga0451576_0215678_617_1231 | 182 |
| 731 | 3300045051 | Ga0451576_1038706 | Ga0451576_1038706_129_677 | 182 |
| 732 | 3300045836 | Ga0466958_0011057 | Ga0466958_0011057_892_1440 | 182 |
| 733 | 3300046454 | Ga0495592_0122645 | Ga0495592_0122645_611_1159 | 182 |
| 734 | 3300046457 | Ga0495590_0026392 | Ga0495590_0026392_1312_1860 | 182 |
| 735 | 3300046458 | Ga0495591_019311 | Ga0495591_019311_636_1208 | 182 |
| 736 | 3300046460 | Ga0495638_0029681 | Ga0495638_0029681_157_705 | 182 |
| 737 | 3300046460 | Ga0495638_0042983 | Ga0495638_0042983_1961_2509 | 182 |
| 738 | 3300046460 | Ga0495638_0467349 | Ga0495638_0467349_52_600 | 182 |
| 739 | 3300046472 | Ga0495580_0002317 | Ga0495580_0002317_2126_2674 | 182 |
| 740 | 3300046472 | Ga0495580_0011390 | Ga0495580_0011390_1311_1859 | 182 |
| 741 | 3300046472 | Ga0495580_0038431 | Ga0495580_0038431_2272_2820 | 182 |
| 742 | 3300046472 | Ga0495580_0250819 | Ga0495580_0250819_281_853 | 182 |
| 743 | 3300046472 | Ga0495580_0745606 | Ga0495580_0745606_53_601 | 182 |
| 744 | 3300046473 | Ga0495582_0171548 | Ga0495582_0171548_130_678 | 182 |
| 745 | 3300046499 | Ga0495594_0225796 | Ga0495594_0225796_264_836 | 182 |
| 746 | 3300046512 | Ga0495610_0299294 | Ga0495610_0299294_51_599 | 182 |
| 747 | 3300046513 | Ga0495616_0003520 | Ga0495616_0003520_749_1297 | 182 |
| 748 | 3300046514 | Ga0495618_0070893 | Ga0495618_0070893_41_589 | 182 |
| 749 | 3300046515 | Ga0495620_0181440 | Ga0495620_0181440_188_736 | 182 |
| 750 | 3300046519 | Ga0495632_0030336 | Ga0495632_0030336_2028_2576 | 182 |
| 751 | 3300046519 | Ga0495632_0030443 | Ga0495632_0030443_826_1374 | 182 |
| 752 | 3300046519 | Ga0495632_0319753 | Ga0495632_0319753_57_605 | 182 |
| 753 | 3300046523 | Ga0495644_0019850 | Ga0495644_0019850_511_1083 | 182 |
| 754 | 3300046524 | Ga0495648_0058796 | Ga0495648_0058796_1088_1720 | 182 |
| 755 | 3300046529 | Ga0495652_0258438 | Ga0495652_0258438_445_993 | 182 |
| 756 | 3300046531 | Ga0495665_0044595 | Ga0495665_0044595_505_1053 | 182 |
| 757 | 3300046535 | Ga0495586_0055117 | Ga0495586_0055117_369_917 | 182 |
| 758 | 3300046535 | Ga0495586_0484897 | Ga0495586_0484897_38_610 | 182 |
| 759 | 3300046539 | Ga0495621_0024354 | Ga0495621_0024354_48_620 | 182 |
| 760 | 3300046539 | Ga0495621_0048158 | Ga0495621_0048158_168_716 | 182 |
| 761 | 3300046539 | Ga0495621_0088361 | Ga0495621_0088361_490_1047 | 182 |
| 762 | 3300046558 | Ga0495633_0156593 | Ga0495633_0156593_47_619 | 182 |
| 763 | 3300046615 | Ga0495656_0054433 | Ga0495656_0054433_309_857 | 182 |
| 764 | 3300046616 | Ga0495668_0489013 | Ga0495668_0489013_26_574 | 182 |
| 765 | 3300046660 | Ga0495625_0004128 | Ga0495625_0004128_5461_6069 | 182 |
| 766 | 3300046660 | Ga0495625_0056977 | Ga0495625_0056977_1031_1579 | 182 |
| 767 | 3300046660 | Ga0495625_0084823 | Ga0495625_0084823_405_953 | 182 |
| 768 | 3300046660 | Ga0495625_0150529 | Ga0495625_0150529_1006_1554 | 182 |
| 769 | 3300046660 | Ga0495625_0277573 | Ga0495625_0277573_253_801 | 182 |
| 770 | 3300046664 | Ga0495659_0160024 | Ga0495659_0160024_93_641 | 182 |
| 771 | 3300046675 | Ga0495657_0072326 | Ga0495657_0072326_1067_1615 | 182 |
| 772 | 3300046678 | Ga0495599_0099033 | Ga0495599_0099033_629_1177 | 182 |
| 773 | 3300046679 | Ga0495623_0061473 | Ga0495623_0061473_268_816 | 182 |
| 774 | 3300046681 | Ga0495647_0022229 | Ga0495647_0022229_299_871 | 182 |
| 775 | 3300046681 | Ga0495647_0028574 | Ga0495647_0028574_1453_2001 | 182 |
| 776 | 3300046681 | Ga0495647_0141218 | Ga0495647_0141218_367_939 | 182 |
| 777 | 3300046683 | Ga0495658_0010043 | Ga0495658_0010043_1587_2159 | 182 |
| 778 | 3300046683 | Ga0495658_0510274 | Ga0495658_0510274_12_560 | 182 |
| 779 | 3300046684 | Ga0495669_0357713 | Ga0495669_0357713_65_616 | 182 |
| 780 | 3300046694 | Ga0495649_0070992 | Ga0495649_0070992_864_1496 | 182 |
| 781 | 3300047315 | Ga0495581_0149843 | Ga0495581_0149843_757_1305 | 182 |
| 782 | 3300047317 | Ga0495604_0031892 | Ga0495604_0031892_3070_3618 | 182 |
| 783 | 3300047319 | Ga0495674_0449767 | Ga0495674_0449767_185_733 | 182 |
| 784 | 3300047320 | Ga0495672_0063383 | Ga0495672_0063383_1144_1692 | 182 |
| 785 | 3300047470 | Ga0495681_0037726 | Ga0495681_0037726_1463_2035 | 182 |
| 786 | 3300047472 | Ga0495686_0068125 | Ga0495686_0068125_1227_1775 | 182 |
| 787 | 3300048088 | Ga0495602_0035047 | Ga0495602_0035047_2588_3136 | 182 |
| 788 | 3300048091 | Ga0495626_0223542 | Ga0495626_0223542_82_630 | 182 |
| 789 | 3300048903 | Ga0496100_0014282 | Ga0496100_0014282_1818_2366 | 182 |
| 790 | 3300048903 | Ga0496100_0924555 | Ga0496100_0924555_31_579 | 182 |
| 791 | 3300048904 | Ga0496101_0002781 | Ga0496101_0002781_1325_1873 | 182 |
| 792 | 3300048904 | Ga0496101_0058777 | Ga0496101_0058777_1859_2407 | 182 |
| 793 | 3300048905 | Ga0496102_0004283 | Ga0496102_0004283_4121_4669 | 182 |
| 794 | 3300048905 | Ga0496102_0015204 | Ga0496102_0015204_2568_3116 | 182 |
| 795 | 3300048905 | Ga0496102_0025670 | Ga0496102_0025670_2520_3068 | 182 |
| 796 | 3300048905 | Ga0496102_0239250 | Ga0496102_0239250_1011_1559 | 182 |
| 797 | 3300048906 | Ga0496103_0054969 | Ga0496103_0054969_1427_1975 | 182 |
| 798 | 3300048906 | Ga0496103_0157107 | Ga0496103_0157107_504_1052 | 182 |
| 799 | 3300048907 | Ga0496104_0166549 | Ga0496104_0166549_506_1054 | 182 |
| 800 | 3300048907 | Ga0496104_0183740 | Ga0496104_0183740_630_1178 | 182 |
| 801 | 3300048907 | Ga0496104_0205567 | Ga0496104_0205567_1115_1738 | 182 |
| 802 | 3300048908 | Ga0496105_0038751 | Ga0496105_0038751_746_1294 | 182 |
| 803 | 3300048909 | Ga0496106_0023670 | Ga0496106_0023670_1797_2345 | 182 |
| 804 | 3300048909 | Ga0496106_0092723 | Ga0496106_0092723_601_1149 | 182 |
| 805 | 3300048909 | Ga0496106_0131648 | Ga0496106_0131648_197_745 | 182 |
| 806 | 3300048909 | Ga0496106_0232287 | Ga0496106_0232287_82_630 | 182 |
| 807 | 3300048909 | Ga0496106_1019094 | Ga0496106_1019094_16_573 | 182 |
| 808 | 3300048910 | Ga0496107_0014224 | Ga0496107_0014224_2794_3342 | 182 |
| 809 | 3300048910 | Ga0496107_0704523 | Ga0496107_0704523_182_730 | 182 |
| 810 | 3300048911 | Ga0496108_0012714 | Ga0496108_0012714_2242_2790 | 182 |
| 811 | 3300048911 | Ga0496108_0578231 | Ga0496108_0578231_370_918 | 182 |
| 812 | 3300048913 | Ga0496110_0000749 | Ga0496110_0000749_1332_1880 | 182 |
| 813 | 3300048913 | Ga0496110_0352827 | Ga0496110_0352827_735_1283 | 182 |
| 814 | 3300048914 | Ga0496111_0007317 | Ga0496111_0007317_2220_2768 | 182 |
| 815 | 3300048915 | Ga0496112_0005843 | Ga0496112_0005843_10015_10563 | 182 |
| 816 | 3300048915 | Ga0496112_0149992 | Ga0496112_0149992_1500_2048 | 182 |
| 817 | 3300048916 | Ga0496113_0024231 | Ga0496113_0024231_3707_4255 | 182 |
| 818 | 3300048916 | Ga0496113_0034940 | Ga0496113_0034940_500_1048 | 182 |
| 819 | 3300048917 | Ga0496114_0001864 | Ga0496114_0001864_7249_7797 | 182 |
| 820 | 3300048917 | Ga0496114_0031729 | Ga0496114_0031729_1316_1864 | 182 |
| 821 | 3300048917 | Ga0496114_0139070 | Ga0496114_0139070_185_733 | 182 |
| 822 | 3300048917 | Ga0496114_0546027 | Ga0496114_0546027_191_739 | 182 |
| 823 | 3300048918 | Ga0496115_0019186 | Ga0496115_0019186_843_1391 | 182 |
| 824 | 3300048918 | Ga0496115_0255565 | Ga0496115_0255565_290_838 | 182 |
| 825 | 3300048919 | Ga0496116_0009552 | Ga0496116_0009552_6073_6621 | 182 |
| 826 | 3300048920 | Ga0496117_0000151 | Ga0496117_0000151_97290_97838 | 182 |
| 827 | 3300048920 | Ga0496117_0365928 | Ga0496117_0365928_107_655 | 182 |
| 828 | 3300048921 | Ga0496118_0000016 | Ga0496118_0000016_22359_22907 | 182 |
| 829 | 3300048921 | Ga0496118_0053120 | Ga0496118_0053120_64_612 | 182 |
| 830 | 3300048921 | Ga0496118_0061427 | Ga0496118_0061427_1500_2048 | 182 |
| 831 | 3300048921 | Ga0496118_0071775 | Ga0496118_0071775_1831_2439 | 182 |
| 832 | 3300048922 | Ga0496119_0007663 | Ga0496119_0007663_7190_7738 | 182 |
| 833 | 3300048922 | Ga0496119_0026068 | Ga0496119_0026068_3413_4045 | 182 |
| 834 | 3300048923 | Ga0496120_0002631 | Ga0496120_0002631_3413_4045 | 182 |
| 835 | 3300048923 | Ga0496120_0079655 | Ga0496120_0079655_1089_1637 | 182 |
| 836 | 3300048924 | Ga0496121_0003216 | Ga0496121_0003216_17594_18142 | 182 |
| 837 | 3300048924 | Ga0496121_0062952 | Ga0496121_0062952_2415_2963 | 182 |
| 838 | 3300048924 | Ga0496121_0088943 | Ga0496121_0088943_1439_1987 | 182 |
| 839 | 3300048927 | Ga0496124_0036662 | Ga0496124_0036662_333_881 | 182 |
| 840 | 3300048928 | Ga0496125_0000759 | Ga0496125_0000759_1316_1864 | 182 |
| 841 | 3300048928 | Ga0496125_0015343 | Ga0496125_0015343_2813_3361 | 182 |
| 842 | 3300048928 | Ga0496125_0042383 | Ga0496125_0042383_1287_1835 | 182 |
| 843 | 3300048929 | Ga0496126_0001875 | Ga0496126_0001875_6776_7324 | 182 |
| 844 | 3300048929 | Ga0496126_0059047 | Ga0496126_0059047_2846_3394 | 182 |
| 845 | 3300049522 | Ga0501299_089863 | Ga0501299_089863_30_578 | 182 |
| 846 | 3300049568 | Ga0501031_0108948 | Ga0501031_0108948_222_770 | 182 |
| 847 | 3300049568 | Ga0501031_0189438 | Ga0501031_0189438_731_1279 | 182 |
| 848 | 3300049569 | Ga0501032_0198951 | Ga0501032_0198951_262_810 | 182 |
| 849 | 3300049570 | Ga0501033_0125845 | Ga0501033_0125845_1188_1736 | 182 |
| 850 | 3300049570 | Ga0501033_0331458 | Ga0501033_0331458_343_891 | 182 |
| 851 | 3300049571 | Ga0501034_1339501 | Ga0501034_1339501_13_561 | 182 |
| 852 | 3300049572 | Ga0501036_0019918 | Ga0501036_0019918_4823_5371 | 182 |
| 853 | 3300049572 | Ga0501036_0030927 | Ga0501036_0030927_2066_2614 | 182 |
| 854 | 3300049572 | Ga0501036_0314169 | Ga0501036_0314169_692_1240 | 182 |
| 855 | 3300049573 | Ga0501037_0029609 | Ga0501037_0029609_1340_1888 | 182 |
| 856 | 3300049573 | Ga0501037_0074819 | Ga0501037_0074819_1278_1826 | 182 |
| 857 | 3300049574 | Ga0501038_0025407 | Ga0501038_0025407_2034_2582 | 182 |
| 858 | 3300049574 | Ga0501038_0110786 | Ga0501038_0110786_690_1238 | 182 |
| 859 | 3300049575 | Ga0501039_0005021 | Ga0501039_0005021_1675_2223 | 182 |
| 860 | 3300049575 | Ga0501039_0534782 | Ga0501039_0534782_71_625 | 182 |
| 861 | 3300049576 | Ga0501040_0001902 | Ga0501040_0001902_11332_11880 | 182 |
| 862 | 3300049576 | Ga0501040_0020637 | Ga0501040_0020637_1482_2030 | 182 |
| 863 | 3300049577 | Ga0501041_0003543 | Ga0501041_0003543_2148_2696 | 182 |
| 864 | 3300049577 | Ga0501041_0027415 | Ga0501041_0027415_1656_2204 | 182 |
| 865 | 3300049578 | Ga0501042_0020076 | Ga0501042_0020076_2551_3099 | 182 |
| 866 | 3300049578 | Ga0501042_0069390 | Ga0501042_0069390_1126_1674 | 182 |
| 867 | 3300049579 | Ga0501043_0047241 | Ga0501043_0047241_1031_1579 | 182 |
| 868 | 3300049580 | Ga0501046_0008614 | Ga0501046_0008614_1749_2297 | 182 |
| 869 | 3300049580 | Ga0501046_0065359 | Ga0501046_0065359_259_807 | 182 |
| 870 | 3300049580 | Ga0501046_0071635 | Ga0501046_0071635_647_1195 | 182 |
| 871 | 3300049580 | Ga0501046_0447081 | Ga0501046_0447081_61_609 | 182 |
| 872 | 3300049582 | Ga0501048_0031048 | Ga0501048_0031048_1526_2074 | 182 |
| 873 | 3300049582 | Ga0501048_0122126 | Ga0501048_0122126_100_648 | 182 |
| 874 | 3300049584 | Ga0501068_0039428 | Ga0501068_0039428_395_943 | 182 |
| 875 | 3300049584 | Ga0501068_0040215 | Ga0501068_0040215_440_988 | 182 |
| 876 | 3300049585 | Ga0501069_0069086 | Ga0501069_0069086_422_970 | 182 |
| 877 | 3300049586 | Ga0501070_0235381 | Ga0501070_0235381_687_1235 | 182 |
| 878 | 3300049587 | Ga0501071_0000689 | Ga0501071_0000689_1693_2241 | 182 |
| 879 | 3300049587 | Ga0501071_0050039 | Ga0501071_0050039_1482_2030 | 182 |
| 880 | 3300049588 | Ga0501072_0002540 | Ga0501072_0002540_4676_5224 | 182 |
| 881 | 3300049588 | Ga0501072_0027868 | Ga0501072_0027868_1824_2372 | 182 |
| 882 | 3300049588 | Ga0501072_0785763 | Ga0501072_0785763_44_598 | 182 |
| 883 | 3300049591 | Ga0501075_0003894 | Ga0501075_0003894_7639_8187 | 182 |
| 884 | 3300049592 | Ga0501076_0000782 | Ga0501076_0000782_7825_8373 | 182 |
| 885 | 3300049592 | Ga0501076_0025012 | Ga0501076_0025012_1543_2091 | 182 |
| 886 | 3300049593 | Ga0501077_0009125 | Ga0501077_0009125_1656_2204 | 182 |
| 887 | 3300049593 | Ga0501077_0069821 | Ga0501077_0069821_1480_2028 | 182 |
| 888 | 3300049656 | Ga0501209_026366 | Ga0501209_026366_703_1251 | 182 |
| 889 | 3300049679 | Ga0501249_007490 | Ga0501249_007490_1169_1717 | 182 |
| 890 | 3300049686 | Ga0501257_089169 | Ga0501257_089169_210_758 | 182 |
| 891 | 3300049741 | Ga0501079_0001340 | Ga0501079_0001340_1097_1645 | 182 |
| 892 | 3300049741 | Ga0501079_0017298 | Ga0501079_0017298_3265_3813 | 182 |
| 893 | 3300049742 | Ga0501080_0005127 | Ga0501080_0005127_6964_7512 | 182 |
| 894 | 3300049742 | Ga0501080_0185062 | Ga0501080_0185062_858_1406 | 182 |
| 895 | 3300049742 | Ga0501080_0839020 | Ga0501080_0839020_128_676 | 182 |
| 896 | 3300049743 | Ga0501081_0010808 | Ga0501081_0010808_744_1292 | 182 |
| 897 | 3300049743 | Ga0501081_0051401 | Ga0501081_0051401_596_1144 | 182 |
| 898 | 3300049743 | Ga0501081_0544209 | Ga0501081_0544209_132_680 | 182 |
| 899 | 3300049744 | Ga0501083_0259029 | Ga0501083_0259029_218_766 | 182 |
| 900 | 3300049822 | Ga0501035_0038912 | Ga0501035_0038912_2212_2760 | 182 |
| 901 | 3300049822 | Ga0501035_0052512 | Ga0501035_0052512_2532_3080 | 182 |
| 902 | 3300049823 | Ga0501044_0121003 | Ga0501044_0121003_2023_2571 | 182 |
| 903 | 3300049823 | Ga0501044_0648569 | Ga0501044_0648569_66_614 | 182 |
| 904 | 3300049824 | Ga0501045_0000401 | Ga0501045_0000401_24557_25105 | 182 |
| 905 | 3300049824 | Ga0501045_0020016 | Ga0501045_0020016_1575_2123 | 182 |
| 906 | 3300049824 | Ga0501045_0116565 | Ga0501045_0116565_1249_1803 | 182 |
| 907 | 3300050507 | nmdc:mga05p37_1003701_c1 | nmdc:mga05p37_1003701_c1_60_608 | 182 |
| 908 | 3300050508 | nmdc:mga09592_139542_c1 | nmdc:mga09592_139542_c1_355_903 | 182 |
| 909 | 3300050508 | nmdc:mga09592_79156_c1 | nmdc:mga09592_79156_c1_281_829 | 182 |
| 910 | 3300050509 | nmdc:mga0qj67_105459_c1 | nmdc:mga0qj67_105459_c1_1147_1695 | 182 |
| 911 | 3300050509 | nmdc:mga0qj67_119265_c1 | nmdc:mga0qj67_119265_c1_160_708 | 182 |
| 912 | 3300050509 | nmdc:mga0qj67_369301_c1 | nmdc:mga0qj67_369301_c1_245_793 | 182 |
| 913 | 3300050509 | nmdc:mga0qj67_441560_c1 | nmdc:mga0qj67_441560_c1_240_788 | 182 |
| 914 | 3300050510 | nmdc:mga06r32_12456_c1 | nmdc:mga06r32_12456_c1_2316_2864 | 182 |
| 915 | 3300050510 | nmdc:mga06r32_140547_c1 | nmdc:mga06r32_140547_c1_1288_1836 | 182 |
| 916 | 3300050510 | nmdc:mga06r32_24616_c1 | nmdc:mga06r32_24616_c1_4772_5320 | 182 |
| 917 | 3300050510 | nmdc:mga06r32_259443_c1 | nmdc:mga06r32_259443_c1_1093_1641 | 182 |
| 918 | 3300050510 | nmdc:mga06r32_87594_c1 | nmdc:mga06r32_87594_c1_538_1086 | 182 |
| 919 | 3300050511 | nmdc:mga08y16_1026529_c1 | nmdc:mga08y16_1026529_c1_154_702 | 182 |
| 920 | 3300050511 | nmdc:mga08y16_117632_c1 | nmdc:mga08y16_117632_c1_1264_1812 | 182 |
| 921 | 3300050511 | nmdc:mga08y16_1181637_c1 | nmdc:mga08y16_1181637_c1_153_701 | 182 |
| 922 | 3300050511 | nmdc:mga08y16_2161_c1 | nmdc:mga08y16_2161_c1_18952_19500 | 182 |
| 923 | 3300050511 | nmdc:mga08y16_24822_c1 | nmdc:mga08y16_24822_c1_132_680 | 182 |
| 924 | 3300050511 | nmdc:mga08y16_508240_c1 | nmdc:mga08y16_508240_c1_192_740 | 182 |
| 925 | 3300050511 | nmdc:mga08y16_66436_c1 | nmdc:mga08y16_66436_c1_1874_2422 | 182 |
| 926 | 3300050511 | nmdc:mga08y16_920464_c1 | nmdc:mga08y16_920464_c1_275_823 | 182 |
| 927 | 3300050513 | nmdc:mga0rr50_297944_c1 | nmdc:mga0rr50_297944_c1_279_827 | 182 |
| 928 | 3300050513 | nmdc:mga0rr50_430501_c1 | nmdc:mga0rr50_430501_c1_278_826 | 182 |
| 929 | 3300050515 | nmdc:mga0a205_692174_c1 | nmdc:mga0a205_692174_c1_67_615 | 182 |
| 930 | 3300053078 | Ga0495612_0160887 | Ga0495612_0160887_344_892 | 182 |
| 931 | 3300053078 | Ga0495612_0352621 | Ga0495612_0352621_88_636 | 182 |
| 932 | 3300053090 | Ga0500646_0119074 | Ga0500646_0119074_94_642 | 182 |
| 933 | 3300053092 | Ga0500583_0051673 | Ga0500583_0051673_1077_1625 | 182 |
| 934 | 3300053092 | Ga0500583_0068826 | Ga0500583_0068826_682_1230 | 182 |
| 935 | 3300053093 | Ga0500651_0187399 | Ga0500651_0187399_235_783 | 182 |
| 936 | 3300053096 | Ga0500641_0348540 | Ga0500641_0348540_15_563 | 182 |
| 937 | 3300053100 | Ga0500660_127142 | Ga0500660_127142_455_1003 | 182 |
| 938 | 3300053104 | Ga0500556_0085210 | Ga0500556_0085210_303_851 | 182 |
| 939 | 3300053104 | Ga0500556_0095777 | Ga0500556_0095777_422_970 | 182 |
| 940 | 3300053108 | Ga0500562_080488 | Ga0500562_080488_171_719 | 182 |
| 941 | 3300053109 | Ga0500569_010238 | Ga0500569_010238_971_1519 | 182 |
| 942 | 3300053116 | Ga0500592_025572 | Ga0500592_025572_55_603 | 182 |
| 943 | 3300053119 | Ga0500595_095061 | Ga0500595_095061_176_724 | 182 |
| 944 | 3300053131 | Ga0500652_081380 | Ga0500652_081380_76_624 | 182 |
| 945 | 3300053131 | Ga0500652_139261 | Ga0500652_139261_160_708 | 182 |
| 946 | 3300053134 | Ga0500658_0008480 | Ga0500658_0008480_1467_2015 | 182 |
| 947 | 3300053136 | Ga0500559_0039884 | Ga0500559_0039884_53_601 | 182 |
| 948 | 3300053139 | Ga0500568_0037122 | Ga0500568_0037122_535_1083 | 182 |
| 949 | 3300053146 | Ga0500588_0002779 | Ga0500588_0002779_1591_2139 | 182 |
| 950 | 3300053153 | Ga0500616_0000073 | Ga0500616_0000073_21864_22412 | 182 |
| 951 | 3300053156 | Ga0500622_0002406 | Ga0500622_0002406_1849_2397 | 182 |
| 952 | 3300053156 | Ga0500622_0005698 | Ga0500622_0005698_5963_6511 | 182 |
| 953 | 3300053156 | Ga0500622_0014061 | Ga0500622_0014061_830_1378 | 182 |
| 954 | 3300053158 | Ga0500627_0073504 | Ga0500627_0073504_554_1102 | 182 |
| 955 | 3300053159 | Ga0500630_043962 | Ga0500630_043962_1249_1797 | 182 |
| 956 | 3300053160 | Ga0500633_0092643 | Ga0500633_0092643_303_851 | 182 |
| 957 | 3300053160 | Ga0500633_0133288 | Ga0500633_0133288_154_783 | 182 |
| 958 | 3300053177 | Ga0500636_0101843 | Ga0500636_0101843_321_869 | 182 |
| 959 | 3300053178 | Ga0500637_0000126 | Ga0500637_0000126_11281_11829 | 182 |
| 960 | 3300054114 | Ga0501084_0120250 | Ga0501084_0120250_921_1469 | 182 |
| 961 | 3300054114 | Ga0501084_0321710 | Ga0501084_0321710_355_903 | 182 |
| 962 | 3300060353 | Ga0501082_0006995 | Ga0501082_0006995_2717_3265 | 182 |
| 963 | 3300061719 | Ga0466962_0038104 | Ga0466962_0038104_1174_1722 | 182 |
| 964 | 3300061734 | Ga0530510_0018068 | Ga0530510_0018068_2438_2986 | 182 |
| 965 | 3300061734 | Ga0530510_0034834 | Ga0530510_0034834_1229_1777 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2b5a-assembly1.cif.gz_A | c.bcli, control element of the bcli restriction-modification system | 0.9565 | 4 | 65 |
| 3clc-assembly1.cif.gz_D | crystal structure of the restriction-modification controller protein c.esp1396i tetramer in complex with its natural 35 base-pair operator | 0.9513 | 4 | 65 |
| 2xcj-assembly1.cif.gz_B | crystal structure of p2 c, the immunity repressor of temperate e. coli phage p2 | 0.9421 | 5 | 55 |
| 6rnz-assembly2.cif.gz_B | crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) | 0.9418 | 5 | 64 |
| 4i6t-assembly1.cif.gz_A | crystal structure of a t36a mutant of the restriction-modification controller protein c.esp1396i | 0.9399 | 4 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2b5aC00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9624 | 4 | 65 | 1.10.260.40 |
| 2b5aA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9565 | 4 | 65 | 1.10.260.40 |
| 4x4bA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9534 | 4 | 65 | 1.10.260.40 |
| 2b5aB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9524 | 4 | 65 | 1.10.260.40 |
| 3clcD00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9513 | 4 | 65 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M3JZX3-F1-model_v4 | deleted | 0.9821 | 75 | 182 |
|
| AF-A0A3M3JZX3-F1-model_v4 | deleted | 0.9644 | 75 | 182 |
|
| AF-A0A7W2GSC8-F1-model_v4 | Cupin domain-containing protein | 0.964 | 75 | 182 |
|
| AF-A0A3T1DYX9-F1-model_v4 | deleted | 0.9598 | 66 | 180 |
|
| AF-A0A7Y2URT1-F1-model_v4 | Cupin domain-containing protein | 0.9569 | 80 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar