F486973

General Info

Members Datasets Scaffolds Average Seq Length
965 356 1930 155

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10336048|Ga0207687_103360482
Length 185
Sequence MKTAMRIKLTLFTRGGEPLTHAARRSTLSHMSAISLKVNGRTHMLDLDPATPLLYALSDDLELRGPKFGCGLGQCGSCTAIVNGTAVRSCVTPVSTVVGKDIVTLEGLGTPEKPHPIQKAFIDEQAAQCGFCLNGVILTAKAFLDKNPKASESEIQQALSGVLCRCFTHVRMQQAIQRYAKAVAK

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 5.28
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10336048 3300025927 Bacteria 1227
2 JGI24743J22301_10011361 3300001991 Bacteria 1603
3 JGI24750J21931_1003575 3300002070 Bacteria 1863
4 JGI24748J21848_1007802 3300002074 Bacteria 1256
5 JGI24738J21930_10007172 3300002075 Bacteria 2583
6 JGI24749J21850_1013147 3300002076 Bacteria 1162
7 JGI24744J21845_10002967 3300002077 Bacteria 3474
8 JGI24034J26672_10004889 3300002239 Bacteria 1909
9 Ga0065704_10098888 3300005289 Bacteria 2334
10 Ga0065704_10205451 3300005289 Bacteria 1129
11 Ga0065715_10005647 3300005293 Bacteria 4677
12 Ga0065715_10727806 3300005293 Bacteria 640
13 Ga0065715_10727857 3300005293 Bacteria 636
14 Ga0065707_10002482 3300005295 Bacteria 8591
15 Ga0065707_10246195 3300005295 Bacteria 1139
16 Ga0065707_10482911 3300005295 Bacteria 772
17 Ga0070676_10359797 3300005328 Bacteria 1003
18 Ga0070683_100003648 3300005329 Bacteria 12542
19 Ga0070683_100094505 3300005329 Bacteria 2810
20 Ga0070683_101256863 3300005329 Bacteria 712
21 Ga0070670_100007003 3300005331 Bacteria 9554
22 Ga0070670_100023624 3300005331 Bacteria 5291
23 Ga0070670_100048236 3300005331 Bacteria 3665
24 Ga0070670_100055058 3300005331 Bacteria 3414
25 Ga0068869_100037520 3300005334 Bacteria 3446
26 Ga0068869_100186003 3300005334 Bacteria 1631
27 Ga0068869_100601594 3300005334 Bacteria 929
28 Ga0068869_100880064 3300005334 Bacteria 774
29 Ga0068869_101077851 3300005334 Bacteria 702
30 Ga0070666_10005780 3300005335 Bacteria 7601
31 Ga0070666_10181488 3300005335 Bacteria 1476
32 Ga0070666_10233322 3300005335 Bacteria 1300
33 Ga0070682_100080773 3300005337 Bacteria 2103
34 Ga0070682_100110649 3300005337 Bacteria 1830
35 Ga0068868_100061736 3300005338 Bacteria 2969
36 Ga0068868_100089007 3300005338 Bacteria 2485
37 Ga0068868_101077290 3300005338 Bacteria 738
38 Ga0070660_100084758 3300005339 Bacteria 2491
39 Ga0070689_100006108 3300005340 Bacteria 8300
40 Ga0070689_100052234 3300005340 Bacteria 3161
41 Ga0070691_10063770 3300005341 Bacteria 1776
42 Ga0070691_10504666 3300005341 Bacteria 700
43 Ga0070687_100020271 3300005343 Bacteria 3106
44 Ga0070687_100049790 3300005343 Bacteria 2161
45 Ga0070687_100406041 3300005343 Bacteria 895
46 Ga0070661_100005776 3300005344 Bacteria 8513
47 Ga0070692_10002304 3300005345 Bacteria 7354
48 Ga0070692_10019608 3300005345 Bacteria 3266
49 Ga0070692_10035915 3300005345 Bacteria 2512
50 Ga0070692_10721997 3300005345 Bacteria 673
51 Ga0070668_100460564 3300005347 Bacteria 1095
52 Ga0070669_100000833 3300005353 Bacteria 22368
53 Ga0070669_100070078 3300005353 Bacteria 2591
54 Ga0070675_100000609 3300005354 Bacteria 24654
55 Ga0070675_100005913 3300005354 Bacteria 9371
56 Ga0070675_100104818 3300005354 Bacteria 2386
57 Ga0070675_100144567 3300005354 Bacteria 2035
58 Ga0070675_100527070 3300005354 Bacteria 1066
59 Ga0070671_100037506 3300005355 Bacteria 4019
60 Ga0070671_100074626 3300005355 Bacteria 2833
61 Ga0070671_100740254 3300005355 Bacteria 854
62 Ga0070674_100295969 3300005356 Bacteria 1288
63 Ga0070674_100902189 3300005356 Bacteria 770
64 Ga0070673_100011573 3300005364 Bacteria 6027
65 Ga0070673_100044170 3300005364 Bacteria 3449
66 Ga0070673_100472539 3300005364 Bacteria 1131
67 Ga0070673_100857731 3300005364 Bacteria 841
68 Ga0070688_100049487 3300005365 Bacteria 2615
69 Ga0070659_100170484 3300005366 Bacteria 1782
70 Ga0070667_100024923 3300005367 Bacteria 4969
71 Ga0070667_100353373 3300005367 Bacteria 1331
72 Ga0070703_10030035 3300005406 Bacteria 1635
73 Ga0070714_100221791 3300005435 Bacteria 1738
74 Ga0070714_100630850 3300005435 Bacteria 1031
75 Ga0070713_100068018 3300005436 Bacteria 3001
76 Ga0070713_100146057 3300005436 Bacteria 2100
77 Ga0070713_100393836 3300005436 Bacteria 1292
78 Ga0070713_100557764 3300005436 Bacteria 1085
79 Ga0070701_10004621 3300005438 Bacteria 5603
80 Ga0070701_10005760 3300005438 Bacteria 5153
81 Ga0070701_10028041 3300005438 Bacteria 2765
82 Ga0070701_10191699 3300005438 Bacteria 1203
83 Ga0070701_10381855 3300005438 Bacteria 888
84 Ga0070711_100025976 3300005439 Bacteria 3835
85 Ga0070705_100017489 3300005440 Bacteria 3743
86 Ga0070705_100068449 3300005440 Bacteria 2137
87 Ga0070705_100096918 3300005440 Bacteria 1852
88 Ga0070700_100034579 3300005441 Bacteria 3053
89 Ga0070700_100265026 3300005441 Bacteria 1239
90 Ga0070700_100438885 3300005441 Bacteria 990
91 Ga0070694_100010451 3300005444 Bacteria 5727
92 Ga0070694_100018066 3300005444 Bacteria 4469
93 Ga0070694_100030344 3300005444 Bacteria 3535
94 Ga0070694_100130780 3300005444 Bacteria 1813
95 Ga0070694_100133034 3300005444 Bacteria 1799
96 Ga0070694_100175000 3300005444 Bacteria 1583
97 Ga0070708_100056693 3300005445 Bacteria 3486
98 Ga0070708_100081314 3300005445 Bacteria 2933
99 Ga0070708_100329970 3300005445 Bacteria 1437
100 Ga0070708_100537228 3300005445 Bacteria 1103
101 Ga0070663_100886730 3300005455 Bacteria 770
102 Ga0070678_100403137 3300005456 Bacteria 1189
103 Ga0070678_100456831 3300005456 Unclassified 1120
104 Ga0070678_100663397 3300005456 Bacteria 937
105 Ga0070678_101185256 3300005456 Unclassified 708
106 Ga0070662_100107626 3300005457 Bacteria 2119
107 Ga0070662_100347711 3300005457 Bacteria 1214
108 Ga0070681_10009310 3300005458 Bacteria 9663
109 Ga0070681_10024462 3300005458 Bacteria 6080
110 Ga0070681_10710553 3300005458 Bacteria 921
111 Ga0070681_10768574 3300005458 Bacteria 880
112 Ga0070681_11055347 3300005458 Bacteria 733
113 Ga0068867_100000156 3300005459 Bacteria 43913
114 Ga0068867_100123668 3300005459 Bacteria 2002
115 Ga0068867_100186611 3300005459 Bacteria 1652
116 Ga0068867_100386555 3300005459 Bacteria 1177
117 Ga0070685_10121017 3300005466 Bacteria 1625
118 Ga0070706_100000006 3300005467 Bacteria 262251
119 Ga0070706_100021716 3300005467 Bacteria 5911
120 Ga0070706_100168199 3300005467 Bacteria 2047
121 Ga0070706_100315408 3300005467 Bacteria 1458
122 Ga0070706_100539001 3300005467 Unclassified 1085
123 Ga0070706_100592467 3300005467 Bacteria 1030
124 Ga0070706_100709004 3300005467 Bacteria 933
125 Ga0070707_100006432 3300005468 Bacteria 10918
126 Ga0070707_100016485 3300005468 Bacteria 6933
127 Ga0070707_100163529 3300005468 Bacteria 2169
128 Ga0070698_100005560 3300005471 Bacteria 13777
129 Ga0070698_100008137 3300005471 Bacteria 11336
130 Ga0070698_100070715 3300005471 Bacteria 3501
131 Ga0070698_100353804 3300005471 Bacteria 1400
132 Ga0070698_100653527 3300005471 Bacteria 993
133 Ga0070699_100007784 3300005518 Bacteria 9312
134 Ga0070699_100019523 3300005518 Bacteria 5838
135 Ga0070699_100037999 3300005518 Bacteria 4168
136 Ga0070699_100131116 3300005518 Bacteria 2210
137 Ga0070699_100160990 3300005518 Bacteria 1986
138 Ga0070699_100222791 3300005518 Bacteria 1681
139 Ga0070699_100255182 3300005518 Bacteria 1567
140 Ga0070699_100975958 3300005518 Unclassified 777
141 Ga0070684_100000593 3300005535 Bacteria 24951
142 Ga0070684_100205027 3300005535 Bacteria 1797
143 Ga0070684_100280532 3300005535 Bacteria 1526
144 Ga0070697_100005622 3300005536 Bacteria 9663
145 Ga0070697_100046992 3300005536 Bacteria 3500
146 Ga0070697_100076269 3300005536 Bacteria 2757
147 Ga0070697_100088380 3300005536 Bacteria 2559
148 Ga0070697_100959519 3300005536 Bacteria 759
149 Ga0068853_100065714 3300005539 Bacteria 3148
150 Ga0070672_100043045 3300005543 Bacteria 3479
151 Ga0070672_100077846 3300005543 Bacteria 2653
152 Ga0070672_100140013 3300005543 Bacteria 1995
153 Ga0070686_100243733 3300005544 Bacteria 1310
154 Ga0070686_100525837 3300005544 Bacteria 922
155 Ga0070686_100669873 3300005544 Bacteria 824
156 Ga0070695_100000076 3300005545 Bacteria 40234
157 Ga0070695_100092972 3300005545 Bacteria 2017
158 Ga0070695_100187772 3300005545 Unclassified 1469
159 Ga0070695_100268582 3300005545 Bacteria 1249
160 Ga0070695_101013655 3300005545 Bacteria 676
161 Ga0070695_101072201 3300005545 Bacteria 658
162 Ga0070696_100011537 3300005546 Bacteria 5920
163 Ga0070696_100088596 3300005546 Bacteria 2200
164 Ga0070696_101139862 3300005546 Bacteria 657
165 Ga0070696_101255631 3300005546 Bacteria 627
166 Ga0070693_100025364 3300005547 Bacteria 3190
167 Ga0070665_100253268 3300005548 Bacteria 1761
168 Ga0070665_100975798 3300005548 Bacteria 860
169 Ga0070704_100000290 3300005549 Bacteria 22046
170 Ga0070704_100033380 3300005549 Bacteria 3479
171 Ga0070704_100103430 3300005549 Bacteria 2151
172 Ga0070704_100133408 3300005549 Bacteria 1928
173 Ga0070704_100140732 3300005549 Bacteria 1884
174 Ga0070704_100617605 3300005549 Bacteria 954
175 Ga0070704_100697619 3300005549 Bacteria 900
176 Ga0068855_100001557 3300005563 Bacteria 28824
177 Ga0068855_101227947 3300005563 Bacteria 778
178 Ga0070664_100001006 3300005564 Bacteria 22147
179 Ga0070664_100057063 3300005564 Bacteria 3318
180 Ga0070664_100238657 3300005564 Bacteria 1631
181 Ga0070664_100346893 3300005564 Bacteria 1350
182 Ga0068857_100004183 3300005577 Bacteria 12148
183 Ga0068857_100020929 3300005577 Bacteria 5754
184 Ga0068856_100201340 3300005614 Bacteria 2005
185 Ga0068856_100236957 3300005614 Bacteria 1840
186 Ga0068856_100583600 3300005614 Bacteria 1139
187 Ga0068856_100842867 3300005614 Bacteria 936
188 Ga0068856_101045116 3300005614 Bacteria 835
189 Ga0070702_100007457 3300005615 Bacteria 5239
190 Ga0068852_100044420 3300005616 Bacteria 3773
191 Ga0068852_100407829 3300005616 Bacteria 1338
192 Ga0068852_100498714 3300005616 Bacteria 1212
193 Ga0068859_100002969 3300005617 Bacteria 17194
194 Ga0068859_100054432 3300005617 Bacteria 4024
195 Ga0068859_100055535 3300005617 Bacteria 3985
196 Ga0068859_100888731 3300005617 Bacteria 976
197 Ga0068864_100029088 3300005618 Bacteria 4675
198 Ga0068864_100066440 3300005618 Bacteria 3130
199 Ga0068864_100113720 3300005618 Bacteria 2413
200 Ga0068864_100406486 3300005618 Bacteria 1295
201 Ga0068864_100457602 3300005618 Bacteria 1221
202 Ga0068864_101029357 3300005618 Bacteria 817
203 Ga0068866_10019531 3300005718 Bacteria 3087
204 Ga0068861_100002891 3300005719 Bacteria 11317
205 Ga0068861_100099175 3300005719 Bacteria 2313
206 Ga0068851_10189188 3300005834 Bacteria 1144
207 Ga0068870_10023082 3300005840 Bacteria 3064
208 Ga0068870_10091009 3300005840 Bacteria 1705
209 Ga0068870_10143071 3300005840 Bacteria 1401
210 Ga0068870_10507874 3300005840 Bacteria 805
211 Ga0068863_100063192 3300005841 Bacteria 3501
212 Ga0068863_100120259 3300005841 Bacteria 2504
213 Ga0068858_100017104 3300005842 Bacteria 6806
214 Ga0068858_100027876 3300005842 Bacteria 5248
215 Ga0068858_100423333 3300005842 Bacteria 1281
216 Ga0068860_100013106 3300005843 Bacteria 8136
217 Ga0068860_100018719 3300005843 Bacteria 6731
218 Ga0068860_100121854 3300005843 Bacteria 2498
219 Ga0068860_100132207 3300005843 Bacteria 2395
220 Ga0068860_100546898 3300005843 Bacteria 1160
221 Ga0068862_100001535 3300005844 Bacteria 21114
222 Ga0068862_100038147 3300005844 Bacteria 4074
223 Ga0068862_100092126 3300005844 Bacteria 2641
224 Ga0068862_100187686 3300005844 Bacteria 1859
225 Ga0081455_10000226 3300005937 Bacteria 72690
226 Ga0081455_10057182 3300005937 Bacteria 3307
227 Ga0081455_10065788 3300005937 Bacteria 3030
228 Ga0081540_1028604 3300005983 Bacteria 3126
229 Ga0081540_1153816 3300005983 Bacteria 903
230 Ga0070717_10009977 3300006028 Bacteria 7146
231 Ga0075365_10076119 3300006038 Bacteria 2266
232 Ga0075365_10378392 3300006038 Bacteria 999
233 Ga0075368_10288463 3300006042 Bacteria 706
234 Ga0075432_10034783 3300006058 Bacteria 1751
235 Ga0070716_100440109 3300006173 Bacteria 947
236 Ga0070712_101430321 3300006175 Bacteria 604
237 Ga0075362_10095754 3300006177 Bacteria 1382
238 Ga0075362_10377078 3300006177 Bacteria 713
239 Ga0075367_10149424 3300006178 Bacteria 1449
240 Ga0097621_100003859 3300006237 Bacteria 10383
241 Ga0097621_100015822 3300006237 Bacteria 5687
242 Ga0097621_100056795 3300006237 Bacteria 3199
243 Ga0097621_100213726 3300006237 Bacteria 1678
244 Ga0097621_100408523 3300006237 Bacteria 1217
245 Ga0097621_100429022 3300006237 Bacteria 1188
246 Ga0097621_100572561 3300006237 Bacteria 1030
247 Ga0075370_10174715 3300006353 Bacteria 1263
248 Ga0068871_100043381 3300006358 Bacteria 3612
249 Ga0068871_100048016 3300006358 Bacteria 3444
250 Ga0068871_100065352 3300006358 Bacteria 2979
251 Ga0068871_100229011 3300006358 Bacteria 1613
252 Ga0068871_100379425 3300006358 Bacteria 1256
253 Ga0068871_101005510 3300006358 Bacteria 777
254 Ga0075428_100016948 3300006844 Bacteria 8046
255 Ga0075428_100102590 3300006844 Bacteria 3119
256 Ga0075428_100672416 3300006844 Bacteria 1104
257 Ga0075430_100733325 3300006846 Bacteria 815
258 Ga0075431_100107857 3300006847 Bacteria 2874
259 Ga0075431_100830049 3300006847 Bacteria 896
260 Ga0075433_10072556 3300006852 Bacteria 3027
261 Ga0075433_10359297 3300006852 Bacteria 1287
262 Ga0075433_10362326 3300006852 Bacteria 1281
263 Ga0075433_10593956 3300006852 Unclassified 972
264 Ga0075434_100003572 3300006871 Bacteria 13893
265 Ga0075434_100037514 3300006871 Bacteria 4798
266 Ga0075434_100096263 3300006871 Bacteria 2965
267 Ga0075434_100338448 3300006871 Bacteria 1525
268 Ga0075434_100654203 3300006871 Bacteria 1069
269 Ga0075434_100915775 3300006871 Bacteria 891
270 Ga0075434_101129184 3300006871 Bacteria 797
271 Ga0075434_101289100 3300006871 Bacteria 741
272 Ga0075429_100043230 3300006880 Bacteria 3921
273 Ga0075429_100078330 3300006880 Bacteria 2880
274 Ga0068865_100010201 3300006881 Bacteria 5839
275 Ga0068865_100021178 3300006881 Bacteria 4226
276 Ga0068865_100068213 3300006881 Bacteria 2514
277 Ga0068865_101329647 3300006881 Bacteria 640
278 Ga0075436_100667354 3300006914 Bacteria 769
279 Ga0075436_100749045 3300006914 Bacteria 725
280 Ga0097620_100002969 3300006931 Bacteria 17194
281 Ga0097620_100054431 3300006931 Bacteria 4024
282 Ga0097620_100055537 3300006931 Bacteria 3985
283 Ga0097620_100888744 3300006931 Bacteria 976
284 Ga0075435_100185026 3300007076 Bacteria 1761
285 Ga0075435_100207126 3300007076 Bacteria 1663
286 Ga0075435_100214219 3300007076 Bacteria 1635
287 Ga0075435_100251502 3300007076 Bacteria 1504
288 Ga0075435_100453048 3300007076 Bacteria 1106
289 Ga0075435_100809078 3300007076 Bacteria 816
290 Ga0075435_101140303 3300007076 Bacteria 682
291 Ga0099794_10011923 3300007265 Bacteria 3737
292 Ga0099795_10400193 3300007788 Bacteria 624
293 Ga0105250_10073847 3300009092 Bacteria 1379
294 Ga0105240_10001330 3300009093 Bacteria 42531
295 Ga0111539_10203466 3300009094 Bacteria 2308
296 Ga0111539_10250089 3300009094 Bacteria 2064
297 Ga0111539_10295811 3300009094 Bacteria 1884
298 Ga0111539_10781978 3300009094 Bacteria 1111
299 Ga0105245_10053235 3300009098 Bacteria 3632
300 Ga0105245_10077693 3300009098 Bacteria 3027
301 Ga0105245_10171053 3300009098 Bacteria 2069
302 Ga0105245_12472774 3300009098 Bacteria 573
303 Ga0105247_10008977 3300009101 Bacteria 6092
304 Ga0114129_10011440 3300009147 Bacteria 12638
305 Ga0114129_10022153 3300009147 Bacteria 9018
306 Ga0114129_10196805 3300009147 Bacteria 2732
307 Ga0114129_10198157 3300009147 Bacteria 2722
308 Ga0114129_10238507 3300009147 Bacteria 2445
309 Ga0114129_10271801 3300009147 Bacteria 2267
310 Ga0114129_10311992 3300009147 Bacteria 2093
311 Ga0114129_10431959 3300009147 Bacteria 1730
312 Ga0114129_10528208 3300009147 Bacteria 1537
313 Ga0114129_10550738 3300009147 Unclassified 1500
314 Ga0114129_10594414 3300009147 Unclassified 1435
315 Ga0114129_10731549 3300009147 Bacteria 1268
316 Ga0114129_10740298 3300009147 Bacteria 1259
317 Ga0114129_11012391 3300009147 Bacteria 1045
318 Ga0105243_10141993 3300009148 Bacteria 2050
319 Ga0105243_10509341 3300009148 Bacteria 1142
320 Ga0105243_10516184 3300009148 Bacteria 1135
321 Ga0105243_10856486 3300009148 Bacteria 900
322 Ga0105243_11020737 3300009148 Bacteria 831
323 Ga0105241_10059818 3300009174 Bacteria 2930
324 Ga0105241_10092818 3300009174 Bacteria 2384
325 Ga0105241_10144541 3300009174 Bacteria 1940
326 Ga0105242_10009807 3300009176 Bacteria 7340
327 Ga0105242_10016619 3300009176 Bacteria 5723
328 Ga0105242_10049142 3300009176 Bacteria 3431
329 Ga0105242_10090718 3300009176 Bacteria 2571
330 Ga0105242_10104861 3300009176 Bacteria 2400
331 Ga0105242_10488988 3300009176 Bacteria 1168
332 Ga0105242_11639382 3300009176 Bacteria 678
333 Ga0105242_11934323 3300009176 Bacteria 631
334 Ga0105242_12060601 3300009176 Bacteria 614
335 Ga0105248_10024239 3300009177 Bacteria 6746
336 Ga0105248_10025818 3300009177 Bacteria 6533
337 Ga0105248_10036500 3300009177 Bacteria 5497
338 Ga0105248_10112799 3300009177 Bacteria 3066
339 Ga0105248_10253105 3300009177 Bacteria 1982
340 Ga0105248_10536500 3300009177 Bacteria 1320
341 Ga0105248_10979019 3300009177 Bacteria 955
342 Ga0105237_10069357 3300009545 Bacteria 3521
343 Ga0105237_10139161 3300009545 Bacteria 2422
344 Ga0105237_10185851 3300009545 Bacteria 2078
345 Ga0105237_11305299 3300009545 Bacteria 732
346 Ga0105238_10005828 3300009551 Bacteria 12197
347 Ga0105238_10244453 3300009551 Bacteria 1772
348 Ga0105249_10001223 3300009553 Bacteria 22627
349 Ga0105249_11148879 3300009553 Bacteria 847
350 Ga0105239_10565288 3300010375 Bacteria 1296
351 Ga0105246_10175600 3300011119 Bacteria 1645
352 Ga0105246_10420803 3300011119 Bacteria 1115
353 Ga0105246_10504749 3300011119 Bacteria 1028
354 Ga0105246_10534124 3300011119 Bacteria 1002
355 Ga0105246_10546199 3300011119 Bacteria 992
356 Ga0157315_1005180 3300012508 Bacteria 967
357 Ga0157371_10375229 3300013102 Bacteria 1038
358 Ga0157370_10009355 3300013104 Bacteria 10484
359 Ga0157370_10230292 3300013104 Bacteria 1715
360 Ga0157369_10631415 3300013105 Bacteria 1105
361 Ga0157374_10062855 3300013296 Bacteria 3481
362 Ga0157374_10073858 3300013296 Bacteria 3219
363 Ga0157374_10301332 3300013296 Bacteria 1586
364 Ga0157378_10082855 3300013297 Bacteria 2901
365 Ga0157378_11073682 3300013297 Bacteria 841
366 Ga0157378_11237611 3300013297 Bacteria 787
367 Ga0163162_10069114 3300013306 Bacteria 3584
368 Ga0163162_10117078 3300013306 Bacteria 2766
369 Ga0163162_10323767 3300013306 Bacteria 1674
370 Ga0163162_10537592 3300013306 Bacteria 1297
371 Ga0163162_11067052 3300013306 Bacteria 915
372 Ga0163162_12011155 3300013306 Bacteria 662
373 Ga0157372_10114885 3300013307 Bacteria 3086
374 Ga0157372_11912900 3300013307 Bacteria 682
375 Ga0157375_10056537 3300013308 Bacteria 3874
376 Ga0157375_10095545 3300013308 Bacteria 3043
377 Ga0157375_10335476 3300013308 Bacteria 1677
378 Ga0157375_10682835 3300013308 Bacteria 1181
379 Ga0157375_11959054 3300013308 Bacteria 696
380 Ga0163163_10027621 3300014325 Bacteria 5438
381 Ga0163163_10120750 3300014325 Bacteria 2655
382 Ga0163163_10156859 3300014325 Bacteria 2320
383 Ga0157380_10078136 3300014326 Bacteria 2699
384 Ga0157380_10551024 3300014326 Bacteria 1131
385 Ga0157377_10006418 3300014745 Bacteria 5610
386 Ga0157379_10007688 3300014968 Bacteria 9333
387 Ga0157379_10067866 3300014968 Bacteria 3188
388 Ga0157379_10983037 3300014968 Bacteria 804
389 Ga0157376_10014139 3300014969 Bacteria 5978
390 Ga0157376_10035926 3300014969 Bacteria 4011
391 Ga0157376_10115121 3300014969 Bacteria 2373
392 Ga0157376_10245593 3300014969 Bacteria 1669
393 Ga0157376_10360050 3300014969 Bacteria 1395
394 Ga0157376_10465284 3300014969 Bacteria 1236
395 Ga0157376_11378782 3300014969 Bacteria 736
396 Ga0163161_10073412 3300017792 Bacteria 2507
397 Ga0163161_10224990 3300017792 Bacteria 1454
398 Ga0224712_10003138 3300022467 Bacteria 4229
399 Ga0207697_10080600 3300025315 Bacteria 1371
400 Ga0207697_10189254 3300025315 Bacteria 903
401 Ga0207656_10183454 3300025321 Bacteria 1005
402 Ga0207653_10111444 3300025885 Bacteria 977
403 Ga0207653_10206557 3300025885 Bacteria 742
404 Ga0207653_10273894 3300025885 Bacteria 650
405 Ga0207682_10017781 3300025893 Bacteria 2775
406 Ga0207692_10808069 3300025898 Bacteria 613
407 Ga0207642_10070945 3300025899 Bacteria 1657
408 Ga0207688_10003055 3300025901 Bacteria 9124
409 Ga0207688_10124807 3300025901 Bacteria 1505
410 Ga0207680_10217513 3300025903 Bacteria 1308
411 Ga0207647_10144210 3300025904 Bacteria 1395
412 Ga0207645_10044683 3300025907 Bacteria 2834
413 Ga0207645_10123370 3300025907 Bacteria 1683
414 Ga0207643_10008496 3300025908 Bacteria 5507
415 Ga0207643_10017500 3300025908 Bacteria 3919
416 Ga0207643_10100937 3300025908 Bacteria 1692
417 Ga0207643_10270825 3300025908 Bacteria 1051
418 Ga0207684_10000004 3300025910 Bacteria 755956
419 Ga0207684_10034857 3300025910 Bacteria 4274
420 Ga0207684_10094665 3300025910 Bacteria 2548
421 Ga0207684_10299980 3300025910 Unclassified 1385
422 Ga0207684_10596054 3300025910 Bacteria 944
423 Ga0207684_11006118 3300025910 Bacteria 697
424 Ga0207684_11011298 3300025910 Bacteria 695
425 Ga0207654_10038891 3300025911 Bacteria 2672
426 Ga0207654_10172793 3300025911 Bacteria 1404
427 Ga0207707_10079898 3300025912 Bacteria 2855
428 Ga0207707_10237013 3300025912 Bacteria 1587
429 Ga0207707_10779401 3300025912 Bacteria 798
430 Ga0207695_10002411 3300025913 Bacteria 27678
431 Ga0207695_10343044 3300025913 Bacteria 1381
432 Ga0207695_10468447 3300025913 Bacteria 1142
433 Ga0207695_11032223 3300025913 Unclassified 702
434 Ga0207671_10115324 3300025914 Bacteria 2048
435 Ga0207671_10390103 3300025914 Unclassified 1107
436 Ga0207671_11032265 3300025914 Bacteria 647
437 Ga0207693_10129071 3300025915 Bacteria 1987
438 Ga0207663_10445217 3300025916 Bacteria 998
439 Ga0207663_10900665 3300025916 Bacteria 707
440 Ga0207660_10040125 3300025917 Bacteria 3276
441 Ga0207660_10136350 3300025917 Bacteria 1873
442 Ga0207660_10794446 3300025917 Bacteria 772
443 Ga0207662_10018473 3300025918 Bacteria 3957
444 Ga0207662_10036843 3300025918 Bacteria 2860
445 Ga0207662_10651175 3300025918 Bacteria 736
446 Ga0207657_10082888 3300025919 Bacteria 2691
447 Ga0207657_10538352 3300025919 Bacteria 913
448 Ga0207649_10008732 3300025920 Bacteria 5533
449 Ga0207649_10399469 3300025920 Bacteria 1028
450 Ga0207649_10407022 3300025920 Bacteria 1019
451 Ga0207649_10547796 3300025920 Bacteria 885
452 Ga0207652_10757141 3300025921 Bacteria 864
453 Ga0207646_10026114 3300025922 Bacteria 5335
454 Ga0207646_10044932 3300025922 Bacteria 3965
455 Ga0207646_10075989 3300025922 Bacteria 3001
456 Ga0207646_10571873 3300025922 Bacteria 1015
457 Ga0207681_10000292 3300025923 Bacteria 37133
458 Ga0207681_10453554 3300025923 Bacteria 1043
459 Ga0207694_10067586 3300025924 Bacteria 2789
460 Ga0207694_10585255 3300025924 Bacteria 938
461 Ga0207650_10005992 3300025925 Bacteria 8294
462 Ga0207650_10012968 3300025925 Bacteria 5762
463 Ga0207650_10669881 3300025925 Bacteria 875
464 Ga0207659_10000931 3300025926 Bacteria 17445
465 Ga0207659_10287240 3300025926 Bacteria 1347
466 Ga0207659_11126087 3300025926 Bacteria 675
467 Ga0207687_10050723 3300025927 Bacteria 2890
468 Ga0207700_10392513 3300025928 Bacteria 1215
469 Ga0207700_10453801 3300025928 Bacteria 1130
470 Ga0207664_10951846 3300025929 Bacteria 770
471 Ga0207644_10028794 3300025931 Bacteria 3849
472 Ga0207644_10042692 3300025931 Bacteria 3215
473 Ga0207644_10321233 3300025931 Bacteria 1252
474 Ga0207644_10659563 3300025931 Bacteria 871
475 Ga0207690_10224951 3300025932 Bacteria 1438
476 Ga0207686_10008069 3300025934 Bacteria 5680
477 Ga0207686_10029951 3300025934 Bacteria 3217
478 Ga0207686_10064624 3300025934 Bacteria 2331
479 Ga0207686_10119533 3300025934 Bacteria 1791
480 Ga0207686_10321383 3300025934 Bacteria 1156
481 Ga0207686_10370605 3300025934 Bacteria 1083
482 Ga0207686_11458307 3300025934 Bacteria 564
483 Ga0207709_10043079 3300025935 Bacteria 2719
484 Ga0207709_10088224 3300025935 Bacteria 2019
485 Ga0207709_10353896 3300025935 Bacteria 1109
486 Ga0207670_10145706 3300025936 Bacteria 1751
487 Ga0207669_10105154 3300025937 Bacteria 1877
488 Ga0207669_10674776 3300025937 Bacteria 847
489 Ga0207704_10028908 3300025938 Bacteria 3083
490 Ga0207704_10039712 3300025938 Bacteria 2744
491 Ga0207691_10009425 3300025940 Bacteria 9377
492 Ga0207691_10048890 3300025940 Bacteria 3876
493 Ga0207691_10091716 3300025940 Bacteria 2722
494 Ga0207691_10748577 3300025940 Bacteria 823
495 Ga0207711_10432753 3300025941 Bacteria 1224
496 Ga0207711_10486297 3300025941 Bacteria 1150
497 Ga0207711_10719115 3300025941 Bacteria 931
498 Ga0207711_11049257 3300025941 Bacteria 755
499 Ga0207711_11087951 3300025941 Bacteria 740
500 Ga0207711_11133077 3300025941 Bacteria 723
501 Ga0207689_10036911 3300025942 Bacteria 4055
502 Ga0207689_10183898 3300025942 Bacteria 1723
503 Ga0207689_10251978 3300025942 Bacteria 1460
504 Ga0207689_10560433 3300025942 Bacteria 960
505 Ga0207661_10285102 3300025944 Bacteria 1477
506 Ga0207679_10040102 3300025945 Bacteria 3349
507 Ga0207679_10179748 3300025945 Bacteria 1749
508 Ga0207679_10394445 3300025945 Bacteria 1216
509 Ga0207667_10045803 3300025949 Bacteria 4631
510 Ga0207667_10231647 3300025949 Bacteria 1891
511 Ga0207651_10049127 3300025960 Bacteria 2856
512 Ga0207651_10161067 3300025960 Bacteria 1759
513 Ga0207651_10226725 3300025960 Bacteria 1514
514 Ga0207651_10265733 3300025960 Bacteria 1411
515 Ga0207712_10003713 3300025961 Bacteria 9633
516 Ga0207712_10352061 3300025961 Bacteria 1225
517 Ga0207668_10005811 3300025972 Bacteria 7270
518 Ga0207668_10113129 3300025972 Bacteria 2040
519 Ga0207668_10436201 3300025972 Bacteria 1115
520 Ga0207640_10931352 3300025981 Bacteria 761
521 Ga0207658_10081375 3300025986 Bacteria 2483
522 Ga0207658_10145076 3300025986 Bacteria 1926
523 Ga0207658_10286393 3300025986 Bacteria 1414
524 Ga0207677_10280726 3300026023 Bacteria 1367
525 Ga0207703_10035190 3300026035 Bacteria 3979
526 Ga0207703_10139824 3300026035 Bacteria 2100
527 Ga0207703_10756484 3300026035 Bacteria 926
528 Ga0207703_10946036 3300026035 Bacteria 826
529 Ga0207639_10065889 3300026041 Bacteria 2813
530 Ga0207639_10185768 3300026041 Bacteria 1772
531 Ga0207639_11158263 3300026041 Bacteria 726
532 Ga0207639_11456189 3300026041 Bacteria 643
533 Ga0207678_10047770 3300026067 Bacteria 3701
534 Ga0207678_10073288 3300026067 Bacteria 2935
535 Ga0207678_11566432 3300026067 Bacteria 581
536 Ga0207708_10035720 3300026075 Bacteria 3782
537 Ga0207708_10052282 3300026075 Bacteria 3112
538 Ga0207708_10334248 3300026075 Bacteria 1239
539 Ga0207702_10173340 3300026078 Bacteria 1980
540 Ga0207702_10378897 3300026078 Bacteria 1360
541 Ga0207702_10952531 3300026078 Bacteria 851
542 Ga0207702_11418863 3300026078 Bacteria 688
543 Ga0207641_10021744 3300026088 Bacteria 5273
544 Ga0207641_10049400 3300026088 Bacteria 3555
545 Ga0207641_10058812 3300026088 Bacteria 3272
546 Ga0207641_10171746 3300026088 Unclassified 1979
547 Ga0207641_10555416 3300026088 Unclassified 1120
548 Ga0207648_10000938 3300026089 Bacteria 32907
549 Ga0207648_10054113 3300026089 Bacteria 3506
550 Ga0207676_10004720 3300026095 Bacteria 9657
551 Ga0207676_10022478 3300026095 Bacteria 4639
552 Ga0207676_10035799 3300026095 Bacteria 3771
553 Ga0207676_10234985 3300026095 Bacteria 1641
554 Ga0207676_11224240 3300026095 Bacteria 744
555 Ga0207674_10043797 3300026116 Bacteria 4613
556 Ga0207674_11153607 3300026116 Bacteria 744
557 Ga0207675_100001384 3300026118 Bacteria 24327
558 Ga0207675_100003563 3300026118 Bacteria 15160
559 Ga0207675_100334315 3300026118 Bacteria 1482
560 Ga0207675_101557717 3300026118 Bacteria 681
561 Ga0207683_10064073 3300026121 Bacteria 3239
562 Ga0207683_10409672 3300026121 Bacteria 1248
563 Ga0207683_10516020 3300026121 Bacteria 1104
564 Ga0207683_10550786 3300026121 Bacteria 1066
565 Ga0207683_11396317 3300026121 Bacteria 647
566 Ga0207698_10221559 3300026142 Bacteria 1710
567 Ga0207698_10517771 3300026142 Bacteria 1163
568 Ga0210002_1029676 3300027617 Bacteria 906
569 Ga0209588_1028656 3300027671 Bacteria 1773
570 Ga0209966_1034525 3300027695 Bacteria 1035
571 Ga0209974_10056907 3300027876 Bacteria 1320
572 Ga0207428_10000562 3300027907 Bacteria 43846
573 Ga0207428_10990430 3300027907 Bacteria 591
574 Ga0268266_10036665 3300028379 Bacteria 4176
575 Ga0268265_10000103 3300028380 Bacteria 106177
576 Ga0268265_10300765 3300028380 Bacteria 1444
577 Ga0268265_10603622 3300028380 Bacteria 1049
578 Ga0268265_10682639 3300028380 Bacteria 990
579 Ga0268264_10020042 3300028381 Bacteria 5464
580 Ga0268264_10124713 3300028381 Bacteria 2274
581 Ga0268264_10137446 3300028381 Bacteria 2175
582 Ga0268264_10276102 3300028381 Bacteria 1572
583 Ga0268264_10311470 3300028381 Bacteria 1485
584 Ga0268264_10374221 3300028381 Bacteria 1362
585 Ga0265329_10105184 3300031242 Unclassified 900
586 Ga0265339_10136875 3300031249 Unclassified 1249
587 Ga0265327_10106121 3300031251 Bacteria 1349
588 Ga0265314_10001454 3300031711 Bacteria 26457
589 Ga0373959_0054010 3300034820 Bacteria 874
590 Ga0373926_0356464 3300035083 Bacteria 575
591 Ga0373949_0037290 3300035090 Bacteria 1182
592 Ga0373952_0268072 3300035092 Bacteria 522
593 Ga0373936_0200539 3300035113 Bacteria 881
594 Ga0373939_0032575 3300035114 Bacteria 1516
595 Ga0373939_0044667 3300035114 Bacteria 1349
596 Ga0373939_0187369 3300035114 Bacteria 775
597 Ga0373941_0101373 3300035115 Bacteria 1003
598 Ga0373945_0048053 3300035116 Bacteria 1562
599 Ga0373954_0308422 3300035118 Unclassified 781
600 Ga0373954_0361884 3300035118 Bacteria 717
601 Ga0373954_0572893 3300035118 Bacteria 560
602 Ga0373956_0072790 3300035119 Bacteria 1570
603 Ga0373956_0077187 3300035119 Bacteria 1525
604 Ga0373960_0004518 3300035121 Bacteria 3193
605 Ga0373943_0073906 3300035170 Bacteria 1732
606 Ga0373943_0139140 3300035170 Bacteria 1306
607 Ga0373943_0175446 3300035170 Bacteria 1175
608 Ga0373946_0011306 3300035171 Bacteria 3327
609 Ga0373955_0002461 3300035172 Bacteria 8090
610 Ga0373955_0056957 3300035172 Unclassified 2146
611 Ga0373955_0141987 3300035172 Bacteria 1409
612 Ga0373955_0188367 3300035172 Bacteria 1226
613 Ga0373955_0712081 3300035172 Bacteria 616
614 Ga0373924_0012321 3300035410 Bacteria 3193
615 Ga0373924_0014243 3300035410 Bacteria 3003
616 Ga0373931_0021322 3300035691 Bacteria 3250
617 Ga0373935_0024708 3300035692 Unclassified 3701
618 Ga0373935_0341335 3300035692 Bacteria 1066
619 Ga0373935_0435121 3300035692 Bacteria 946
620 Ga0373935_0515391 3300035692 Bacteria 869
621 Ga0373927_0011784 3300035695 Bacteria 5822
622 Ga0373927_0013854 3300035695 Bacteria 5351
623 Ga0373927_0194675 3300035695 Bacteria 1330
624 Ga0373927_0679101 3300035695 Bacteria 680
625 Ga0373927_0757209 3300035695 Bacteria 642
626 Ga0373933_0236551 3300035724 Unclassified 1174
627 Ga0373933_0299634 3300035724 Unclassified 1041
628 Ga0373947_0065523 3300035725 Unclassified 2216
629 Ga0373947_0448756 3300035725 Bacteria 873
630 Ga0373947_0650992 3300035725 Bacteria 718
631 Ga0373947_0840724 3300035725 Bacteria 627
632 Ga0373947_1010188 3300035725 Bacteria 567
633 Ga0373937_0009278 3300036401 Bacteria 8542
634 Ga0373937_0014245 3300036401 Bacteria 7018
635 Ga0373937_0098568 3300036401 Bacteria 2711
636 Ga0373937_0333697 3300036401 Archaea 1435
637 Ga0373937_0688370 3300036401 Bacteria 969
638 Ga0373937_1710923 3300036401 Bacteria 576
639 Ga0373937_1855746 3300036401 Bacteria 549
640 Ga0373925_0026267 3300037068 Bacteria 4261
641 Ga0373925_0056176 3300037068 Bacteria 2949
642 Ga0373925_0082087 3300037068 Unclassified 2452
643 Ga0373925_0307013 3300037068 Bacteria 1282
644 Ga0373925_0452164 3300037068 Bacteria 1052
645 Ga0436361_0314528 3300039447 Bacteria 662
646 Ga0436361_0481279 3300039447 Bacteria 1943
647 Ga0451835_0112714 3300041492 Bacteria 580
648 Ga0451843_0352523 3300041509 Unclassified 754
649 Ga0451577_0788457 3300042876 Bacteria 859
650 Ga0453683_0392434 3300044673 Bacteria 894
651 Ga0451576_0021376 3300045051 Bacteria 7032
652 Ga0451576_0054255 3300045051 Bacteria 4197
653 Ga0451576_0079760 3300045051 Bacteria 3406
654 Ga0495592_0012432 3300046454 Bacteria 6466
655 Ga0495592_0145772 3300046454 Bacteria 1642
656 Ga0495592_0341041 3300046454 Bacteria 963
657 Ga0495603_0012179 3300046455 Bacteria 5208
658 Ga0495603_0033288 3300046455 Bacteria 3101
659 Ga0495603_0354626 3300046455 Bacteria 841
660 Ga0495591_031022 3300046458 Bacteria 1608
661 Ga0495629_0001619 3300046459 Bacteria 17689
662 Ga0495629_0206406 3300046459 Bacteria 1358
663 Ga0495641_0011781 3300046461 Bacteria 4946
664 Ga0495641_0059056 3300046461 Bacteria 1734
665 Ga0495641_0128963 3300046461 Bacteria 1129
666 Ga0495641_0157720 3300046461 Bacteria 1015
667 Ga0495651_0010791 3300046462 Bacteria 7023
668 Ga0495653_0007069 3300046463 Bacteria 9207
669 Ga0495653_0423410 3300046463 Bacteria 842
670 Ga0495580_0282572 3300046472 Archaea 1132
671 Ga0495580_0381500 3300046472 Bacteria 952
672 Ga0495580_0436195 3300046472 Bacteria 880
673 Ga0495580_0648168 3300046472 Unclassified 695
674 Ga0495582_0030627 3300046473 Bacteria 2955
675 Ga0495582_0622721 3300046473 Bacteria 624
676 Ga0495605_0039567 3300046474 Bacteria 2361
677 Ga0495662_0118018 3300046476 Bacteria 1302
678 Ga0495662_0333473 3300046476 Bacteria 746
679 Ga0495664_0055733 3300046477 Bacteria 2352
680 Ga0495664_0421175 3300046477 Unclassified 801
681 Ga0495584_0021570 3300046491 Bacteria 3271
682 Ga0495584_0090238 3300046491 Bacteria 1545
683 Ga0495584_0264785 3300046491 Bacteria 874
684 Ga0495585_0033701 3300046492 Bacteria 2898
685 Ga0495594_0363912 3300046499 Bacteria 823
686 Ga0495608_0019989 3300046511 Bacteria 4605
687 Ga0495608_0021909 3300046511 Bacteria 4382
688 Ga0495608_0039578 3300046511 Bacteria 3159
689 Ga0495608_0077149 3300046511 Bacteria 2169
690 Ga0495618_0074366 3300046514 Unclassified 2164
691 Ga0495618_0096622 3300046514 Bacteria 1889
692 Ga0495618_0131235 3300046514 Bacteria 1603
693 Ga0495618_0593975 3300046514 Bacteria 659
694 Ga0495628_0001354 3300046516 Bacteria 22458
695 Ga0495628_0135498 3300046516 Bacteria 1882
696 Ga0495628_0669244 3300046516 Bacteria 736
697 Ga0495628_1020346 3300046516 Bacteria 568
698 Ga0495630_0024914 3300046517 Bacteria 4423
699 Ga0495630_0121217 3300046517 Bacteria 1984
700 Ga0495630_0315905 3300046517 Bacteria 1194
701 Ga0495630_0980307 3300046517 Bacteria 643
702 Ga0495631_0308298 3300046518 Bacteria 673
703 Ga0495632_0071273 3300046519 Bacteria 1670
704 Ga0495637_0183949 3300046520 Bacteria 774
705 Ga0495644_0115441 3300046523 Bacteria 1020
706 Ga0495663_0168992 3300046525 Bacteria 753
707 Ga0495663_0189248 3300046525 Bacteria 715
708 Ga0495666_0331104 3300046526 Unclassified 687
709 Ga0495642_0006036 3300046528 Bacteria 4653
710 Ga0495642_0134962 3300046528 Bacteria 1064
711 Ga0495652_0040705 3300046529 Bacteria 4016
712 Ga0495652_0209326 3300046529 Bacteria 1474
713 Ga0495652_0292797 3300046529 Bacteria 1187
714 Ga0495652_0398382 3300046529 Bacteria 975
715 Ga0495652_0434933 3300046529 Bacteria 922
716 Ga0495652_0973534 3300046529 Bacteria 556
717 Ga0495652_1059032 3300046529 Bacteria 528
718 Ga0495665_0141141 3300046531 Bacteria 1259
719 Ga0495665_0160666 3300046531 Bacteria 1171
720 Ga0495665_0319687 3300046531 Bacteria 793
721 Ga0495640_0088887 3300046533 Bacteria 2041
722 Ga0495640_0115812 3300046533 Bacteria 1746
723 Ga0495640_0172548 3300046533 Bacteria 1381
724 Ga0495586_0631293 3300046535 Unclassified 619
725 Ga0495587_0005263 3300046536 Bacteria 8457
726 Ga0495598_0026697 3300046537 Bacteria 1585
727 Ga0495609_0023267 3300046538 Bacteria 2849
728 Ga0495621_0000998 3300046539 Bacteria 7250
729 Ga0495621_0017434 3300046539 Bacteria 2322
730 Ga0495621_0035833 3300046539 Bacteria 1719
731 Ga0495621_0203818 3300046539 Bacteria 796
732 Ga0495621_0371963 3300046539 Bacteria 602
733 Ga0495645_0052499 3300046543 Bacteria 2965
734 Ga0495645_0637842 3300046543 Bacteria 652
735 Ga0495622_0263691 3300046557 Bacteria 756
736 Ga0495633_0025927 3300046558 Bacteria 2882
737 Ga0495633_0046916 3300046558 Bacteria 2043
738 Ga0495667_0021607 3300046559 Unclassified 4342
739 Ga0495667_0025835 3300046559 Bacteria 3956
740 Ga0495667_0030689 3300046559 Bacteria 3611
741 Ga0495656_0035345 3300046615 Bacteria 2052
742 Ga0495656_0239086 3300046615 Bacteria 914
743 Ga0495668_0097931 3300046616 Bacteria 1605
744 Ga0495634_0033268 3300046642 Bacteria 3543
745 Ga0495634_0482094 3300046642 Bacteria 729
746 Ga0495634_0648927 3300046642 Bacteria 610
747 Ga0495611_0178484 3300046648 Bacteria 992
748 Ga0495611_0288816 3300046648 Bacteria 757
749 Ga0495625_0505361 3300046660 Bacteria 738
750 Ga0495635_0041719 3300046663 Unclassified 3170
751 Ga0495635_0415040 3300046663 Bacteria 893
752 Ga0495659_0004982 3300046664 Bacteria 4177
753 Ga0495659_0007522 3300046664 Bacteria 3456
754 Ga0495659_0015511 3300046664 Bacteria 2505
755 Ga0495659_0020676 3300046664 Bacteria 2213
756 Ga0495659_0236393 3300046664 Bacteria 758
757 Ga0495659_0335034 3300046664 Bacteria 644
758 Ga0495659_0395922 3300046664 Bacteria 595
759 Ga0495661_0085478 3300046665 Bacteria 1808
760 Ga0495588_0083921 3300046674 Bacteria 1664
761 Ga0495657_0001786 3300046675 Bacteria 18404
762 Ga0495657_0062405 3300046675 Bacteria 2462
763 Ga0495657_0222807 3300046675 Bacteria 1143
764 Ga0495599_0004979 3300046678 Bacteria 7901
765 Ga0495599_0216736 3300046678 Bacteria 1172
766 Ga0495599_0250736 3300046678 Bacteria 1077
767 Ga0495646_0339656 3300046680 Bacteria 788
768 Ga0495646_0400732 3300046680 Bacteria 713
769 Ga0495647_0236460 3300046681 Bacteria 810
770 Ga0495647_0281589 3300046681 Bacteria 746
771 Ga0495658_0028683 3300046683 Bacteria 3007
772 Ga0495658_0042543 3300046683 Bacteria 2537
773 Ga0495658_0045312 3300046683 Bacteria 2468
774 Ga0495658_0133088 3300046683 Bacteria 1515
775 Ga0495658_0190355 3300046683 Bacteria 1275
776 Ga0495658_0235714 3300046683 Bacteria 1148
777 Ga0495669_0041245 3300046684 Bacteria 2049
778 Ga0495669_0131570 3300046684 Bacteria 1178
779 Ga0495613_0000397 3300046689 Bacteria 37243
780 Ga0495613_0052429 3300046689 Bacteria 3005
781 Ga0495613_0086411 3300046689 Bacteria 2274
782 Ga0495613_0211325 3300046689 Bacteria 1364
783 Ga0495613_0279244 3300046689 Archaea 1160
784 Ga0495613_0382967 3300046689 Bacteria 961
785 Ga0495624_0270103 3300046690 Bacteria 1027
786 Ga0495670_0050138 3300046691 Bacteria 2089
787 Ga0495670_0805766 3300046691 Bacteria 513
788 Ga0495671_0314313 3300046692 Bacteria 752
789 Ga0495600_0005852 3300046809 Bacteria 7436
790 Ga0495600_0050520 3300046809 Bacteria 2714
791 Ga0495600_0431272 3300046809 Unclassified 817
792 Ga0495600_0728359 3300046809 Bacteria 595
793 Ga0495660_0099059 3300046810 Bacteria 1503
794 Ga0495581_0032318 3300047315 Bacteria 3031
795 Ga0495581_0065787 3300047315 Bacteria 2096
796 Ga0495581_0070552 3300047315 Bacteria 2021
797 Ga0495581_0679300 3300047315 Bacteria 594
798 Ga0495604_0003278 3300047317 Bacteria 12936
799 Ga0495604_0027344 3300047317 Bacteria 4538
800 Ga0495636_0015384 3300047318 Bacteria 3049
801 Ga0495636_0062273 3300047318 Bacteria 1579
802 Ga0495636_0071921 3300047318 Bacteria 1477
803 Ga0495636_0312481 3300047318 Bacteria 737
804 Ga0495674_0002008 3300047319 Bacteria 20015
805 Ga0495674_0054300 3300047319 Bacteria 3519
806 Ga0495674_0061291 3300047319 Bacteria 3280
807 Ga0495674_0163199 3300047319 Bacteria 1863
808 Ga0495674_0576860 3300047319 Bacteria 893
809 Ga0495674_1464621 3300047319 Unclassified 507
810 Ga0495676_0010821 3300047321 Bacteria 8254
811 Ga0495676_0237402 3300047321 Bacteria 1249
812 Ga0495680_0032767 3300047322 Bacteria 4214
813 Ga0495680_0399851 3300047322 Unclassified 949
814 Ga0495680_0937945 3300047322 Bacteria 557
815 Ga0495683_0081466 3300047323 Bacteria 1578
816 Ga0495675_0002749 3300047444 Bacteria 10537
817 Ga0495675_0199333 3300047444 Unclassified 1219
818 Ga0495675_0738754 3300047444 Unclassified 549
819 Ga0495677_0019265 3300047445 Bacteria 2475
820 Ga0495677_0025693 3300047445 Bacteria 2137
821 Ga0495677_0091357 3300047445 Bacteria 1147
822 Ga0495679_061254 3300047446 Bacteria 1103
823 Ga0495685_076757 3300047447 Bacteria 1115
824 Ga0495673_0110984 3300047469 Bacteria 1097
825 Ga0495684_0000431 3300047471 Bacteria 34259
826 Ga0495684_0049741 3300047471 Bacteria 3202
827 Ga0495684_0067277 3300047471 Unclassified 2725
828 Ga0495684_0114954 3300047471 Bacteria 2029
829 Ga0495684_0165691 3300047471 Archaea 1646
830 Ga0495684_0346958 3300047471 Bacteria 1055
831 Ga0495684_0454716 3300047471 Bacteria 889
832 Ga0495684_0744010 3300047471 Bacteria 646
833 Ga0495686_0067826 3300047472 Bacteria 2202
834 Ga0495686_0084280 3300047472 Bacteria 1937
835 Ga0495593_0028114 3300047673 Bacteria 3090
836 Ga0495593_0266968 3300047673 Bacteria 856
837 Ga0495602_0022172 3300048088 Bacteria 6224
838 Ga0495602_0142743 3300048088 Bacteria 1894
839 Ga0495602_0919688 3300048088 Bacteria 581
840 Ga0495614_0089055 3300048089 Bacteria 1342
841 Ga0495626_0233556 3300048091 Bacteria 742
842 Ga0496100_0051860 3300048903 Bacteria 2665
843 Ga0496100_0147115 3300048903 Bacteria 1676
844 Ga0496101_0014720 3300048904 Bacteria 5263
845 Ga0496101_0134728 3300048904 Bacteria 1878
846 Ga0496101_0201882 3300048904 Bacteria 1537
847 Ga0496101_0490320 3300048904 Bacteria 970
848 Ga0496102_0141525 3300048905 Bacteria 2256
849 Ga0496103_0022195 3300048906 Bacteria 3821
850 Ga0496103_0128291 3300048906 Bacteria 1618
851 Ga0496103_0678130 3300048906 Bacteria 654
852 Ga0496104_0003063 3300048907 Bacteria 14409
853 Ga0496104_0009201 3300048907 Bacteria 8782
854 Ga0496104_0045229 3300048907 Bacteria 4139
855 Ga0496104_0113510 3300048907 Bacteria 2598
856 Ga0496104_0150665 3300048907 Bacteria 2233
857 Ga0496104_1709966 3300048907 Bacteria 531
858 Ga0496105_0008859 3300048908 Bacteria 7839
859 Ga0496105_0041428 3300048908 Bacteria 3796
860 Ga0496105_0136114 3300048908 Bacteria 2024
861 Ga0496105_0144110 3300048908 Bacteria 1960
862 Ga0496105_0307586 3300048908 Bacteria 1273
863 Ga0496105_0484311 3300048908 Bacteria 973
864 Ga0496106_0028179 3300048909 Bacteria 4183
865 Ga0496106_0041843 3300048909 Bacteria 3435
866 Ga0496106_0192272 3300048909 Bacteria 1623
867 Ga0496106_0536135 3300048909 Bacteria 939
868 Ga0496107_0036722 3300048910 Bacteria 3515
869 Ga0496107_0191751 3300048910 Bacteria 1518
870 Ga0496107_0215504 3300048910 Bacteria 1428
871 Ga0496108_0029096 3300048911 Bacteria 4573
872 Ga0496108_0765552 3300048911 Bacteria 834
873 Ga0496109_0004243 3300048912 Bacteria 11968
874 Ga0496109_0030998 3300048912 Bacteria 4794
875 Ga0496109_0229630 3300048912 Bacteria 1746
876 Ga0496110_0015614 3300048913 Bacteria 6324
877 Ga0496110_0030728 3300048913 Bacteria 4631
878 Ga0496110_0182665 3300048913 Bacteria 1905
879 Ga0496110_0494998 3300048913 Bacteria 1113
880 Ga0496110_1095673 3300048913 Bacteria 704
881 Ga0496111_0040436 3300048914 Bacteria 3344
882 Ga0496112_0056354 3300048915 Bacteria 3867
883 Ga0496112_0149860 3300048915 Bacteria 2300
884 Ga0496112_0552791 3300048915 Bacteria 1085
885 Ga0496113_0203985 3300048916 Bacteria 1572
886 Ga0496114_0034306 3300048917 Bacteria 4185
887 Ga0496114_0530816 3300048917 Bacteria 1040
888 Ga0496114_0561175 3300048917 Bacteria 1008
889 Ga0496115_0063455 3300048918 Bacteria 2981
890 Ga0496115_0089709 3300048918 Bacteria 2511
891 Ga0496115_0094720 3300048918 Bacteria 2443
892 Ga0496115_0127180 3300048918 Bacteria 2099
893 Ga0495678_180658 3300049459 Bacteria 662
894 Ga0501033_0344295 3300049570 Bacteria 1045
895 Ga0501047_0362572 3300049581 Bacteria 1285
896 Ga0501069_0060766 3300049585 Bacteria 2110
897 Ga0501077_0337569 3300049593 Bacteria 961
898 Ga0501079_0381439 3300049741 Bacteria 1105
899 Ga0501035_0913295 3300049822 Bacteria 695
900 Ga0501044_0132431 3300049823 Bacteria 2487
901 Ga0501045_0426208 3300049824 Bacteria 987
902 nmdc:mga03683_67014_c1 3300050489 Bacteria 1527
903 nmdc:mga03683_72119_c1 3300050489 Bacteria 1478
904 nmdc:mga00v17_278245_c1 3300050491 Bacteria 1086
905 nmdc:mga00v17_411970_c1 3300050491 Bacteria 878
906 nmdc:mga0yw44_148899_c1 3300050492 Bacteria 1526
907 nmdc:mga0yw44_324843_c1 3300050492 Bacteria 1034
908 nmdc:mga0yw44_54592_c1 3300050492 Bacteria 2429
909 nmdc:mga04h51_105977_c1 3300050495 Bacteria 1030
910 nmdc:mga05p37_133007_c1 3300050507 Bacteria 3051
911 nmdc:mga05p37_1614817_c1 3300050507 Bacteria 638
912 nmdc:mga05p37_162177_c1 3300050507 Bacteria 2730
913 nmdc:mga05p37_166004_c1 3300050507 Bacteria 2694
914 nmdc:mga05p37_18097_c1 3300050507 Bacteria 8511
915 nmdc:mga05p37_266694_c1 3300050507 Bacteria 2047
916 nmdc:mga05p37_297280_c1 3300050507 Bacteria 831
917 nmdc:mga05p37_304676_c1 3300050507 Bacteria 1891
918 nmdc:mga05p37_690598_c1 3300050507 Unclassified 1136
919 nmdc:mga09592_21311_c1 3300050508 Bacteria 5341
920 nmdc:mga09592_483879_c1 3300050508 Unclassified 1066
921 nmdc:mga09592_90167_c1 3300050508 Bacteria 2619
922 nmdc:mga0qj67_181347_c1 3300050509 Bacteria 1710
923 nmdc:mga0qj67_551623_c1 3300050509 Bacteria 924
924 nmdc:mga06r32_427885_c1 3300050510 Bacteria 1305
925 nmdc:mga06r32_74553_c1 3300050510 Bacteria 3290
926 nmdc:mga08y16_1204_c1 3300050511 Bacteria 25555
927 nmdc:mga08y16_230785_c1 3300050511 Bacteria 1914
928 nmdc:mga08y16_293757_c1 3300050511 Bacteria 1675
929 nmdc:mga08y16_372888_c1 3300050511 Bacteria 1464
930 nmdc:mga08y16_802366_c1 3300050511 Bacteria 934
931 nmdc:mga08y16_917282_c1 3300050511 Bacteria 861
932 nmdc:mga0n895_1009795_c1 3300050512 Bacteria 813
933 nmdc:mga0n895_140796_c1 3300050512 Bacteria 2441
934 nmdc:mga0n895_14463_c1 3300050512 Bacteria 7168
935 nmdc:mga0n895_180357_c1 3300050512 Bacteria 2143
936 nmdc:mga0n895_236091_c1 3300050512 Bacteria 1856
937 nmdc:mga0n895_500844_c1 3300050512 Bacteria 1224
938 nmdc:mga0n895_732268_c1 3300050512 Bacteria 983
939 nmdc:mga0n895_75340_c1 3300050512 Bacteria 3354
940 nmdc:mga0rr50_39643_c1 3300050513 Bacteria 3418
941 nmdc:mga0rr50_855086_c1 3300050513 Bacteria 776
942 nmdc:mga08x19_375248_c1 3300050514 Bacteria 996
943 nmdc:mga08x19_47150_c1 3300050514 Bacteria 2757
944 nmdc:mga08x19_958886_c1 3300050514 Unclassified 608
945 nmdc:mga0a205_198749_c1 3300050515 Bacteria 1896
946 nmdc:mga0a205_235148_c1 3300050515 Bacteria 1714
947 nmdc:mga0a205_359156_c1 3300050515 Bacteria 1323
948 nmdc:mga0a205_463163_c1 3300050515 Bacteria 1127
949 nmdc:mga0a205_47295_c1 3300050515 Bacteria 4150
950 nmdc:mga0a205_78530_c1 3300050515 Bacteria 3189
951 nmdc:mga0a205_94729_c1 3300050515 Bacteria 2885
952 nmdc:mga0a205_959868_c1 3300050515 Bacteria 702
953 Ga0495601_0010275 3300053077 Bacteria 5567
954 Ga0495601_0025087 3300053077 Bacteria 3675
955 Ga0495601_0461116 3300053077 Bacteria 821
956 Ga0495612_0113192 3300053078 Unclassified 1163
957 Ga0495612_0544750 3300053078 Bacteria 534
958 Ga0495655_0047399 3300053083 Bacteria 1124
959 Ga0495595_0479171 3300053084 Bacteria 633
960 Ga0495619_0005559 3300053085 Bacteria 7999
961 Ga0495619_0009832 3300053085 Bacteria 6029
962 Ga0495619_0080455 3300053085 Unclassified 2193
963 Ga0495619_0081089 3300053085 Bacteria 2184
964 Ga0495619_0462316 3300053085 Bacteria 874
965 Ga0530510_0733527 3300061734 Unclassified 753
966 Ga0207687_10336048
967 JGI24743J22301_10011361
968 JGI24750J21931_1003575
969 JGI24748J21848_1007802
970 JGI24738J21930_10007172
971 JGI24749J21850_1013147
972 JGI24744J21845_10002967
973 JGI24034J26672_10004889
974 Ga0065704_10098888
975 Ga0065704_10205451
976 Ga0065715_10005647
977 Ga0065715_10727806
978 Ga0065715_10727857
979 Ga0065707_10002482
980 Ga0065707_10246195
981 Ga0065707_10482911
982 Ga0070676_10359797
983 Ga0070683_100003648
984 Ga0070683_100094505
985 Ga0070683_101256863
986 Ga0070670_100007003
987 Ga0070670_100023624
988 Ga0070670_100048236
989 Ga0070670_100055058
990 Ga0068869_100037520
991 Ga0068869_100186003
992 Ga0068869_100601594
993 Ga0068869_100880064
994 Ga0068869_101077851
995 Ga0070666_10005780
996 Ga0070666_10181488
997 Ga0070666_10233322
998 Ga0070682_100080773
999 Ga0070682_100110649
1000 Ga0068868_100061736
1001 Ga0068868_100089007
1002 Ga0068868_101077290
1003 Ga0070660_100084758
1004 Ga0070689_100006108
1005 Ga0070689_100052234
1006 Ga0070691_10063770
1007 Ga0070691_10504666
1008 Ga0070687_100020271
1009 Ga0070687_100049790
1010 Ga0070687_100406041
1011 Ga0070661_100005776
1012 Ga0070692_10002304
1013 Ga0070692_10019608
1014 Ga0070692_10035915
1015 Ga0070692_10721997
1016 Ga0070668_100460564
1017 Ga0070669_100000833
1018 Ga0070669_100070078
1019 Ga0070675_100000609
1020 Ga0070675_100005913
1021 Ga0070675_100104818
1022 Ga0070675_100144567
1023 Ga0070675_100527070
1024 Ga0070671_100037506
1025 Ga0070671_100074626
1026 Ga0070671_100740254
1027 Ga0070674_100295969
1028 Ga0070674_100902189
1029 Ga0070673_100011573
1030 Ga0070673_100044170
1031 Ga0070673_100472539
1032 Ga0070673_100857731
1033 Ga0070688_100049487
1034 Ga0070659_100170484
1035 Ga0070667_100024923
1036 Ga0070667_100353373
1037 Ga0070703_10030035
1038 Ga0070714_100221791
1039 Ga0070714_100630850
1040 Ga0070713_100068018
1041 Ga0070713_100146057
1042 Ga0070713_100393836
1043 Ga0070713_100557764
1044 Ga0070701_10004621
1045 Ga0070701_10005760
1046 Ga0070701_10028041
1047 Ga0070701_10191699
1048 Ga0070701_10381855
1049 Ga0070711_100025976
1050 Ga0070705_100017489
1051 Ga0070705_100068449
1052 Ga0070705_100096918
1053 Ga0070700_100034579
1054 Ga0070700_100265026
1055 Ga0070700_100438885
1056 Ga0070694_100010451
1057 Ga0070694_100018066
1058 Ga0070694_100030344
1059 Ga0070694_100130780
1060 Ga0070694_100133034
1061 Ga0070694_100175000
1062 Ga0070708_100056693
1063 Ga0070708_100081314
1064 Ga0070708_100329970
1065 Ga0070708_100537228
1066 Ga0070663_100886730
1067 Ga0070678_100403137
1068 Ga0070678_100456831
1069 Ga0070678_100663397
1070 Ga0070678_101185256
1071 Ga0070662_100107626
1072 Ga0070662_100347711
1073 Ga0070681_10009310
1074 Ga0070681_10024462
1075 Ga0070681_10710553
1076 Ga0070681_10768574
1077 Ga0070681_11055347
1078 Ga0068867_100000156
1079 Ga0068867_100123668
1080 Ga0068867_100186611
1081 Ga0068867_100386555
1082 Ga0070685_10121017
1083 Ga0070706_100000006
1084 Ga0070706_100021716
1085 Ga0070706_100168199
1086 Ga0070706_100315408
1087 Ga0070706_100539001
1088 Ga0070706_100592467
1089 Ga0070706_100709004
1090 Ga0070707_100006432
1091 Ga0070707_100016485
1092 Ga0070707_100163529
1093 Ga0070698_100005560
1094 Ga0070698_100008137
1095 Ga0070698_100070715
1096 Ga0070698_100353804
1097 Ga0070698_100653527
1098 Ga0070699_100007784
1099 Ga0070699_100019523
1100 Ga0070699_100037999
1101 Ga0070699_100131116
1102 Ga0070699_100160990
1103 Ga0070699_100222791
1104 Ga0070699_100255182
1105 Ga0070699_100975958
1106 Ga0070684_100000593
1107 Ga0070684_100205027
1108 Ga0070684_100280532
1109 Ga0070697_100005622
1110 Ga0070697_100046992
1111 Ga0070697_100076269
1112 Ga0070697_100088380
1113 Ga0070697_100959519
1114 Ga0068853_100065714
1115 Ga0070672_100043045
1116 Ga0070672_100077846
1117 Ga0070672_100140013
1118 Ga0070686_100243733
1119 Ga0070686_100525837
1120 Ga0070686_100669873
1121 Ga0070695_100000076
1122 Ga0070695_100092972
1123 Ga0070695_100187772
1124 Ga0070695_100268582
1125 Ga0070695_101013655
1126 Ga0070695_101072201
1127 Ga0070696_100011537
1128 Ga0070696_100088596
1129 Ga0070696_101139862
1130 Ga0070696_101255631
1131 Ga0070693_100025364
1132 Ga0070665_100253268
1133 Ga0070665_100975798
1134 Ga0070704_100000290
1135 Ga0070704_100033380
1136 Ga0070704_100103430
1137 Ga0070704_100133408
1138 Ga0070704_100140732
1139 Ga0070704_100617605
1140 Ga0070704_100697619
1141 Ga0068855_100001557
1142 Ga0068855_101227947
1143 Ga0070664_100001006
1144 Ga0070664_100057063
1145 Ga0070664_100238657
1146 Ga0070664_100346893
1147 Ga0068857_100004183
1148 Ga0068857_100020929
1149 Ga0068856_100201340
1150 Ga0068856_100236957
1151 Ga0068856_100583600
1152 Ga0068856_100842867
1153 Ga0068856_101045116
1154 Ga0070702_100007457
1155 Ga0068852_100044420
1156 Ga0068852_100407829
1157 Ga0068852_100498714
1158 Ga0068859_100002969
1159 Ga0068859_100054432
1160 Ga0068859_100055535
1161 Ga0068859_100888731
1162 Ga0068864_100029088
1163 Ga0068864_100066440
1164 Ga0068864_100113720
1165 Ga0068864_100406486
1166 Ga0068864_100457602
1167 Ga0068864_101029357
1168 Ga0068866_10019531
1169 Ga0068861_100002891
1170 Ga0068861_100099175
1171 Ga0068851_10189188
1172 Ga0068870_10023082
1173 Ga0068870_10091009
1174 Ga0068870_10143071
1175 Ga0068870_10507874
1176 Ga0068863_100063192
1177 Ga0068863_100120259
1178 Ga0068858_100017104
1179 Ga0068858_100027876
1180 Ga0068858_100423333
1181 Ga0068860_100013106
1182 Ga0068860_100018719
1183 Ga0068860_100121854
1184 Ga0068860_100132207
1185 Ga0068860_100546898
1186 Ga0068862_100001535
1187 Ga0068862_100038147
1188 Ga0068862_100092126
1189 Ga0068862_100187686
1190 Ga0081455_10000226
1191 Ga0081455_10057182
1192 Ga0081455_10065788
1193 Ga0081540_1028604
1194 Ga0081540_1153816
1195 Ga0070717_10009977
1196 Ga0075365_10076119
1197 Ga0075365_10378392
1198 Ga0075368_10288463
1199 Ga0075432_10034783
1200 Ga0070716_100440109
1201 Ga0070712_101430321
1202 Ga0075362_10095754
1203 Ga0075362_10377078
1204 Ga0075367_10149424
1205 Ga0097621_100003859
1206 Ga0097621_100015822
1207 Ga0097621_100056795
1208 Ga0097621_100213726
1209 Ga0097621_100408523
1210 Ga0097621_100429022
1211 Ga0097621_100572561
1212 Ga0075370_10174715
1213 Ga0068871_100043381
1214 Ga0068871_100048016
1215 Ga0068871_100065352
1216 Ga0068871_100229011
1217 Ga0068871_100379425
1218 Ga0068871_101005510
1219 Ga0075428_100016948
1220 Ga0075428_100102590
1221 Ga0075428_100672416
1222 Ga0075430_100733325
1223 Ga0075431_100107857
1224 Ga0075431_100830049
1225 Ga0075433_10072556
1226 Ga0075433_10359297
1227 Ga0075433_10362326
1228 Ga0075433_10593956
1229 Ga0075434_100003572
1230 Ga0075434_100037514
1231 Ga0075434_100096263
1232 Ga0075434_100338448
1233 Ga0075434_100654203
1234 Ga0075434_100915775
1235 Ga0075434_101129184
1236 Ga0075434_101289100
1237 Ga0075429_100043230
1238 Ga0075429_100078330
1239 Ga0068865_100010201
1240 Ga0068865_100021178
1241 Ga0068865_100068213
1242 Ga0068865_101329647
1243 Ga0075436_100667354
1244 Ga0075436_100749045
1245 Ga0097620_100002969
1246 Ga0097620_100054431
1247 Ga0097620_100055537
1248 Ga0097620_100888744
1249 Ga0075435_100185026
1250 Ga0075435_100207126
1251 Ga0075435_100214219
1252 Ga0075435_100251502
1253 Ga0075435_100453048
1254 Ga0075435_100809078
1255 Ga0075435_101140303
1256 Ga0099794_10011923
1257 Ga0099795_10400193
1258 Ga0105250_10073847
1259 Ga0105240_10001330
1260 Ga0111539_10203466
1261 Ga0111539_10250089
1262 Ga0111539_10295811
1263 Ga0111539_10781978
1264 Ga0105245_10053235
1265 Ga0105245_10077693
1266 Ga0105245_10171053
1267 Ga0105245_12472774
1268 Ga0105247_10008977
1269 Ga0114129_10011440
1270 Ga0114129_10022153
1271 Ga0114129_10196805
1272 Ga0114129_10198157
1273 Ga0114129_10238507
1274 Ga0114129_10271801
1275 Ga0114129_10311992
1276 Ga0114129_10431959
1277 Ga0114129_10528208
1278 Ga0114129_10550738
1279 Ga0114129_10594414
1280 Ga0114129_10731549
1281 Ga0114129_10740298
1282 Ga0114129_11012391
1283 Ga0105243_10141993
1284 Ga0105243_10509341
1285 Ga0105243_10516184
1286 Ga0105243_10856486
1287 Ga0105243_11020737
1288 Ga0105241_10059818
1289 Ga0105241_10092818
1290 Ga0105241_10144541
1291 Ga0105242_10009807
1292 Ga0105242_10016619
1293 Ga0105242_10049142
1294 Ga0105242_10090718
1295 Ga0105242_10104861
1296 Ga0105242_10488988
1297 Ga0105242_11639382
1298 Ga0105242_11934323
1299 Ga0105242_12060601
1300 Ga0105248_10024239
1301 Ga0105248_10025818
1302 Ga0105248_10036500
1303 Ga0105248_10112799
1304 Ga0105248_10253105
1305 Ga0105248_10536500
1306 Ga0105248_10979019
1307 Ga0105237_10069357
1308 Ga0105237_10139161
1309 Ga0105237_10185851
1310 Ga0105237_11305299
1311 Ga0105238_10005828
1312 Ga0105238_10244453
1313 Ga0105249_10001223
1314 Ga0105249_11148879
1315 Ga0105239_10565288
1316 Ga0105246_10175600
1317 Ga0105246_10420803
1318 Ga0105246_10504749
1319 Ga0105246_10534124
1320 Ga0105246_10546199
1321 Ga0157315_1005180
1322 Ga0157371_10375229
1323 Ga0157370_10009355
1324 Ga0157370_10230292
1325 Ga0157369_10631415
1326 Ga0157374_10062855
1327 Ga0157374_10073858
1328 Ga0157374_10301332
1329 Ga0157378_10082855
1330 Ga0157378_11073682
1331 Ga0157378_11237611
1332 Ga0163162_10069114
1333 Ga0163162_10117078
1334 Ga0163162_10323767
1335 Ga0163162_10537592
1336 Ga0163162_11067052
1337 Ga0163162_12011155
1338 Ga0157372_10114885
1339 Ga0157372_11912900
1340 Ga0157375_10056537
1341 Ga0157375_10095545
1342 Ga0157375_10335476
1343 Ga0157375_10682835
1344 Ga0157375_11959054
1345 Ga0163163_10027621
1346 Ga0163163_10120750
1347 Ga0163163_10156859
1348 Ga0157380_10078136
1349 Ga0157380_10551024
1350 Ga0157377_10006418
1351 Ga0157379_10007688
1352 Ga0157379_10067866
1353 Ga0157379_10983037
1354 Ga0157376_10014139
1355 Ga0157376_10035926
1356 Ga0157376_10115121
1357 Ga0157376_10245593
1358 Ga0157376_10360050
1359 Ga0157376_10465284
1360 Ga0157376_11378782
1361 Ga0163161_10073412
1362 Ga0163161_10224990
1363 Ga0224712_10003138
1364 Ga0207697_10080600
1365 Ga0207697_10189254
1366 Ga0207656_10183454
1367 Ga0207653_10111444
1368 Ga0207653_10206557
1369 Ga0207653_10273894
1370 Ga0207682_10017781
1371 Ga0207692_10808069
1372 Ga0207642_10070945
1373 Ga0207688_10003055
1374 Ga0207688_10124807
1375 Ga0207680_10217513
1376 Ga0207647_10144210
1377 Ga0207645_10044683
1378 Ga0207645_10123370
1379 Ga0207643_10008496
1380 Ga0207643_10017500
1381 Ga0207643_10100937
1382 Ga0207643_10270825
1383 Ga0207684_10000004
1384 Ga0207684_10034857
1385 Ga0207684_10094665
1386 Ga0207684_10299980
1387 Ga0207684_10596054
1388 Ga0207684_11006118
1389 Ga0207684_11011298
1390 Ga0207654_10038891
1391 Ga0207654_10172793
1392 Ga0207707_10079898
1393 Ga0207707_10237013
1394 Ga0207707_10779401
1395 Ga0207695_10002411
1396 Ga0207695_10343044
1397 Ga0207695_10468447
1398 Ga0207695_11032223
1399 Ga0207671_10115324
1400 Ga0207671_10390103
1401 Ga0207671_11032265
1402 Ga0207693_10129071
1403 Ga0207663_10445217
1404 Ga0207663_10900665
1405 Ga0207660_10040125
1406 Ga0207660_10136350
1407 Ga0207660_10794446
1408 Ga0207662_10018473
1409 Ga0207662_10036843
1410 Ga0207662_10651175
1411 Ga0207657_10082888
1412 Ga0207657_10538352
1413 Ga0207649_10008732
1414 Ga0207649_10399469
1415 Ga0207649_10407022
1416 Ga0207649_10547796
1417 Ga0207652_10757141
1418 Ga0207646_10026114
1419 Ga0207646_10044932
1420 Ga0207646_10075989
1421 Ga0207646_10571873
1422 Ga0207681_10000292
1423 Ga0207681_10453554
1424 Ga0207694_10067586
1425 Ga0207694_10585255
1426 Ga0207650_10005992
1427 Ga0207650_10012968
1428 Ga0207650_10669881
1429 Ga0207659_10000931
1430 Ga0207659_10287240
1431 Ga0207659_11126087
1432 Ga0207687_10050723
1433 Ga0207700_10392513
1434 Ga0207700_10453801
1435 Ga0207664_10951846
1436 Ga0207644_10028794
1437 Ga0207644_10042692
1438 Ga0207644_10321233
1439 Ga0207644_10659563
1440 Ga0207690_10224951
1441 Ga0207686_10008069
1442 Ga0207686_10029951
1443 Ga0207686_10064624
1444 Ga0207686_10119533
1445 Ga0207686_10321383
1446 Ga0207686_10370605
1447 Ga0207686_11458307
1448 Ga0207709_10043079
1449 Ga0207709_10088224
1450 Ga0207709_10353896
1451 Ga0207670_10145706
1452 Ga0207669_10105154
1453 Ga0207669_10674776
1454 Ga0207704_10028908
1455 Ga0207704_10039712
1456 Ga0207691_10009425
1457 Ga0207691_10048890
1458 Ga0207691_10091716
1459 Ga0207691_10748577
1460 Ga0207711_10432753
1461 Ga0207711_10486297
1462 Ga0207711_10719115
1463 Ga0207711_11049257
1464 Ga0207711_11087951
1465 Ga0207711_11133077
1466 Ga0207689_10036911
1467 Ga0207689_10183898
1468 Ga0207689_10251978
1469 Ga0207689_10560433
1470 Ga0207661_10285102
1471 Ga0207679_10040102
1472 Ga0207679_10179748
1473 Ga0207679_10394445
1474 Ga0207667_10045803
1475 Ga0207667_10231647
1476 Ga0207651_10049127
1477 Ga0207651_10161067
1478 Ga0207651_10226725
1479 Ga0207651_10265733
1480 Ga0207712_10003713
1481 Ga0207712_10352061
1482 Ga0207668_10005811
1483 Ga0207668_10113129
1484 Ga0207668_10436201
1485 Ga0207640_10931352
1486 Ga0207658_10081375
1487 Ga0207658_10145076
1488 Ga0207658_10286393
1489 Ga0207677_10280726
1490 Ga0207703_10035190
1491 Ga0207703_10139824
1492 Ga0207703_10756484
1493 Ga0207703_10946036
1494 Ga0207639_10065889
1495 Ga0207639_10185768
1496 Ga0207639_11158263
1497 Ga0207639_11456189
1498 Ga0207678_10047770
1499 Ga0207678_10073288
1500 Ga0207678_11566432
1501 Ga0207708_10035720
1502 Ga0207708_10052282
1503 Ga0207708_10334248
1504 Ga0207702_10173340
1505 Ga0207702_10378897
1506 Ga0207702_10952531
1507 Ga0207702_11418863
1508 Ga0207641_10021744
1509 Ga0207641_10049400
1510 Ga0207641_10058812
1511 Ga0207641_10171746
1512 Ga0207641_10555416
1513 Ga0207648_10000938
1514 Ga0207648_10054113
1515 Ga0207676_10004720
1516 Ga0207676_10022478
1517 Ga0207676_10035799
1518 Ga0207676_10234985
1519 Ga0207676_11224240
1520 Ga0207674_10043797
1521 Ga0207674_11153607
1522 Ga0207675_100001384
1523 Ga0207675_100003563
1524 Ga0207675_100334315
1525 Ga0207675_101557717
1526 Ga0207683_10064073
1527 Ga0207683_10409672
1528 Ga0207683_10516020
1529 Ga0207683_10550786
1530 Ga0207683_11396317
1531 Ga0207698_10221559
1532 Ga0207698_10517771
1533 Ga0210002_1029676
1534 Ga0209588_1028656
1535 Ga0209966_1034525
1536 Ga0209974_10056907
1537 Ga0207428_10000562
1538 Ga0207428_10990430
1539 Ga0268266_10036665
1540 Ga0268265_10000103
1541 Ga0268265_10300765
1542 Ga0268265_10603622
1543 Ga0268265_10682639
1544 Ga0268264_10020042
1545 Ga0268264_10124713
1546 Ga0268264_10137446
1547 Ga0268264_10276102
1548 Ga0268264_10311470
1549 Ga0268264_10374221
1550 Ga0265329_10105184
1551 Ga0265339_10136875
1552 Ga0265327_10106121
1553 Ga0265314_10001454
1554 Ga0373959_0054010
1555 Ga0373926_0356464
1556 Ga0373949_0037290
1557 Ga0373952_0268072
1558 Ga0373936_0200539
1559 Ga0373939_0032575
1560 Ga0373939_0044667
1561 Ga0373939_0187369
1562 Ga0373941_0101373
1563 Ga0373945_0048053
1564 Ga0373954_0308422
1565 Ga0373954_0361884
1566 Ga0373954_0572893
1567 Ga0373956_0072790
1568 Ga0373956_0077187
1569 Ga0373960_0004518
1570 Ga0373943_0073906
1571 Ga0373943_0139140
1572 Ga0373943_0175446
1573 Ga0373946_0011306
1574 Ga0373955_0002461
1575 Ga0373955_0056957
1576 Ga0373955_0141987
1577 Ga0373955_0188367
1578 Ga0373955_0712081
1579 Ga0373924_0012321
1580 Ga0373924_0014243
1581 Ga0373931_0021322
1582 Ga0373935_0024708
1583 Ga0373935_0341335
1584 Ga0373935_0435121
1585 Ga0373935_0515391
1586 Ga0373927_0011784
1587 Ga0373927_0013854
1588 Ga0373927_0194675
1589 Ga0373927_0679101
1590 Ga0373927_0757209
1591 Ga0373933_0236551
1592 Ga0373933_0299634
1593 Ga0373947_0065523
1594 Ga0373947_0448756
1595 Ga0373947_0650992
1596 Ga0373947_0840724
1597 Ga0373947_1010188
1598 Ga0373937_0009278
1599 Ga0373937_0014245
1600 Ga0373937_0098568
1601 Ga0373937_0333697
1602 Ga0373937_0688370
1603 Ga0373937_1710923
1604 Ga0373937_1855746
1605 Ga0373925_0026267
1606 Ga0373925_0056176
1607 Ga0373925_0082087
1608 Ga0373925_0307013
1609 Ga0373925_0452164
1610 Ga0436361_0314528
1611 Ga0436361_0481279
1612 Ga0451835_0112714
1613 Ga0451843_0352523
1614 Ga0451577_0788457
1615 Ga0453683_0392434
1616 Ga0451576_0021376
1617 Ga0451576_0054255
1618 Ga0451576_0079760
1619 Ga0495592_0012432
1620 Ga0495592_0145772
1621 Ga0495592_0341041
1622 Ga0495603_0012179
1623 Ga0495603_0033288
1624 Ga0495603_0354626
1625 Ga0495591_031022
1626 Ga0495629_0001619
1627 Ga0495629_0206406
1628 Ga0495641_0011781
1629 Ga0495641_0059056
1630 Ga0495641_0128963
1631 Ga0495641_0157720
1632 Ga0495651_0010791
1633 Ga0495653_0007069
1634 Ga0495653_0423410
1635 Ga0495580_0282572
1636 Ga0495580_0381500
1637 Ga0495580_0436195
1638 Ga0495580_0648168
1639 Ga0495582_0030627
1640 Ga0495582_0622721
1641 Ga0495605_0039567
1642 Ga0495662_0118018
1643 Ga0495662_0333473
1644 Ga0495664_0055733
1645 Ga0495664_0421175
1646 Ga0495584_0021570
1647 Ga0495584_0090238
1648 Ga0495584_0264785
1649 Ga0495585_0033701
1650 Ga0495594_0363912
1651 Ga0495608_0019989
1652 Ga0495608_0021909
1653 Ga0495608_0039578
1654 Ga0495608_0077149
1655 Ga0495618_0074366
1656 Ga0495618_0096622
1657 Ga0495618_0131235
1658 Ga0495618_0593975
1659 Ga0495628_0001354
1660 Ga0495628_0135498
1661 Ga0495628_0669244
1662 Ga0495628_1020346
1663 Ga0495630_0024914
1664 Ga0495630_0121217
1665 Ga0495630_0315905
1666 Ga0495630_0980307
1667 Ga0495631_0308298
1668 Ga0495632_0071273
1669 Ga0495637_0183949
1670 Ga0495644_0115441
1671 Ga0495663_0168992
1672 Ga0495663_0189248
1673 Ga0495666_0331104
1674 Ga0495642_0006036
1675 Ga0495642_0134962
1676 Ga0495652_0040705
1677 Ga0495652_0209326
1678 Ga0495652_0292797
1679 Ga0495652_0398382
1680 Ga0495652_0434933
1681 Ga0495652_0973534
1682 Ga0495652_1059032
1683 Ga0495665_0141141
1684 Ga0495665_0160666
1685 Ga0495665_0319687
1686 Ga0495640_0088887
1687 Ga0495640_0115812
1688 Ga0495640_0172548
1689 Ga0495586_0631293
1690 Ga0495587_0005263
1691 Ga0495598_0026697
1692 Ga0495609_0023267
1693 Ga0495621_0000998
1694 Ga0495621_0017434
1695 Ga0495621_0035833
1696 Ga0495621_0203818
1697 Ga0495621_0371963
1698 Ga0495645_0052499
1699 Ga0495645_0637842
1700 Ga0495622_0263691
1701 Ga0495633_0025927
1702 Ga0495633_0046916
1703 Ga0495667_0021607
1704 Ga0495667_0025835
1705 Ga0495667_0030689
1706 Ga0495656_0035345
1707 Ga0495656_0239086
1708 Ga0495668_0097931
1709 Ga0495634_0033268
1710 Ga0495634_0482094
1711 Ga0495634_0648927
1712 Ga0495611_0178484
1713 Ga0495611_0288816
1714 Ga0495625_0505361
1715 Ga0495635_0041719
1716 Ga0495635_0415040
1717 Ga0495659_0004982
1718 Ga0495659_0007522
1719 Ga0495659_0015511
1720 Ga0495659_0020676
1721 Ga0495659_0236393
1722 Ga0495659_0335034
1723 Ga0495659_0395922
1724 Ga0495661_0085478
1725 Ga0495588_0083921
1726 Ga0495657_0001786
1727 Ga0495657_0062405
1728 Ga0495657_0222807
1729 Ga0495599_0004979
1730 Ga0495599_0216736
1731 Ga0495599_0250736
1732 Ga0495646_0339656
1733 Ga0495646_0400732
1734 Ga0495647_0236460
1735 Ga0495647_0281589
1736 Ga0495658_0028683
1737 Ga0495658_0042543
1738 Ga0495658_0045312
1739 Ga0495658_0133088
1740 Ga0495658_0190355
1741 Ga0495658_0235714
1742 Ga0495669_0041245
1743 Ga0495669_0131570
1744 Ga0495613_0000397
1745 Ga0495613_0052429
1746 Ga0495613_0086411
1747 Ga0495613_0211325
1748 Ga0495613_0279244
1749 Ga0495613_0382967
1750 Ga0495624_0270103
1751 Ga0495670_0050138
1752 Ga0495670_0805766
1753 Ga0495671_0314313
1754 Ga0495600_0005852
1755 Ga0495600_0050520
1756 Ga0495600_0431272
1757 Ga0495600_0728359
1758 Ga0495660_0099059
1759 Ga0495581_0032318
1760 Ga0495581_0065787
1761 Ga0495581_0070552
1762 Ga0495581_0679300
1763 Ga0495604_0003278
1764 Ga0495604_0027344
1765 Ga0495636_0015384
1766 Ga0495636_0062273
1767 Ga0495636_0071921
1768 Ga0495636_0312481
1769 Ga0495674_0002008
1770 Ga0495674_0054300
1771 Ga0495674_0061291
1772 Ga0495674_0163199
1773 Ga0495674_0576860
1774 Ga0495674_1464621
1775 Ga0495676_0010821
1776 Ga0495676_0237402
1777 Ga0495680_0032767
1778 Ga0495680_0399851
1779 Ga0495680_0937945
1780 Ga0495683_0081466
1781 Ga0495675_0002749
1782 Ga0495675_0199333
1783 Ga0495675_0738754
1784 Ga0495677_0019265
1785 Ga0495677_0025693
1786 Ga0495677_0091357
1787 Ga0495679_061254
1788 Ga0495685_076757
1789 Ga0495673_0110984
1790 Ga0495684_0000431
1791 Ga0495684_0049741
1792 Ga0495684_0067277
1793 Ga0495684_0114954
1794 Ga0495684_0165691
1795 Ga0495684_0346958
1796 Ga0495684_0454716
1797 Ga0495684_0744010
1798 Ga0495686_0067826
1799 Ga0495686_0084280
1800 Ga0495593_0028114
1801 Ga0495593_0266968
1802 Ga0495602_0022172
1803 Ga0495602_0142743
1804 Ga0495602_0919688
1805 Ga0495614_0089055
1806 Ga0495626_0233556
1807 Ga0496100_0051860
1808 Ga0496100_0147115
1809 Ga0496101_0014720
1810 Ga0496101_0134728
1811 Ga0496101_0201882
1812 Ga0496101_0490320
1813 Ga0496102_0141525
1814 Ga0496103_0022195
1815 Ga0496103_0128291
1816 Ga0496103_0678130
1817 Ga0496104_0003063
1818 Ga0496104_0009201
1819 Ga0496104_0045229
1820 Ga0496104_0113510
1821 Ga0496104_0150665
1822 Ga0496104_1709966
1823 Ga0496105_0008859
1824 Ga0496105_0041428
1825 Ga0496105_0136114
1826 Ga0496105_0144110
1827 Ga0496105_0307586
1828 Ga0496105_0484311
1829 Ga0496106_0028179
1830 Ga0496106_0041843
1831 Ga0496106_0192272
1832 Ga0496106_0536135
1833 Ga0496107_0036722
1834 Ga0496107_0191751
1835 Ga0496107_0215504
1836 Ga0496108_0029096
1837 Ga0496108_0765552
1838 Ga0496109_0004243
1839 Ga0496109_0030998
1840 Ga0496109_0229630
1841 Ga0496110_0015614
1842 Ga0496110_0030728
1843 Ga0496110_0182665
1844 Ga0496110_0494998
1845 Ga0496110_1095673
1846 Ga0496111_0040436
1847 Ga0496112_0056354
1848 Ga0496112_0149860
1849 Ga0496112_0552791
1850 Ga0496113_0203985
1851 Ga0496114_0034306
1852 Ga0496114_0530816
1853 Ga0496114_0561175
1854 Ga0496115_0063455
1855 Ga0496115_0089709
1856 Ga0496115_0094720
1857 Ga0496115_0127180
1858 Ga0495678_180658
1859 Ga0501033_0344295
1860 Ga0501047_0362572
1861 Ga0501069_0060766
1862 Ga0501077_0337569
1863 Ga0501079_0381439
1864 Ga0501035_0913295
1865 Ga0501044_0132431
1866 Ga0501045_0426208
1867 nmdc:mga03683_67014_c1
1868 nmdc:mga03683_72119_c1
1869 nmdc:mga00v17_278245_c1
1870 nmdc:mga00v17_411970_c1
1871 nmdc:mga0yw44_148899_c1
1872 nmdc:mga0yw44_324843_c1
1873 nmdc:mga0yw44_54592_c1
1874 nmdc:mga04h51_105977_c1
1875 nmdc:mga05p37_133007_c1
1876 nmdc:mga05p37_1614817_c1
1877 nmdc:mga05p37_162177_c1
1878 nmdc:mga05p37_166004_c1
1879 nmdc:mga05p37_18097_c1
1880 nmdc:mga05p37_266694_c1
1881 nmdc:mga05p37_297280_c1
1882 nmdc:mga05p37_304676_c1
1883 nmdc:mga05p37_690598_c1
1884 nmdc:mga09592_21311_c1
1885 nmdc:mga09592_483879_c1
1886 nmdc:mga09592_90167_c1
1887 nmdc:mga0qj67_181347_c1
1888 nmdc:mga0qj67_551623_c1
1889 nmdc:mga06r32_427885_c1
1890 nmdc:mga06r32_74553_c1
1891 nmdc:mga08y16_1204_c1
1892 nmdc:mga08y16_230785_c1
1893 nmdc:mga08y16_293757_c1
1894 nmdc:mga08y16_372888_c1
1895 nmdc:mga08y16_802366_c1
1896 nmdc:mga08y16_917282_c1
1897 nmdc:mga0n895_1009795_c1
1898 nmdc:mga0n895_140796_c1
1899 nmdc:mga0n895_14463_c1
1900 nmdc:mga0n895_180357_c1
1901 nmdc:mga0n895_236091_c1
1902 nmdc:mga0n895_500844_c1
1903 nmdc:mga0n895_732268_c1
1904 nmdc:mga0n895_75340_c1
1905 nmdc:mga0rr50_39643_c1
1906 nmdc:mga0rr50_855086_c1
1907 nmdc:mga08x19_375248_c1
1908 nmdc:mga08x19_47150_c1
1909 nmdc:mga08x19_958886_c1
1910 nmdc:mga0a205_198749_c1
1911 nmdc:mga0a205_235148_c1
1912 nmdc:mga0a205_359156_c1
1913 nmdc:mga0a205_463163_c1
1914 nmdc:mga0a205_47295_c1
1915 nmdc:mga0a205_78530_c1
1916 nmdc:mga0a205_94729_c1
1917 nmdc:mga0a205_959868_c1
1918 Ga0495601_0010275
1919 Ga0495601_0025087
1920 Ga0495601_0461116
1921 Ga0495612_0113192
1922 Ga0495612_0544750
1923 Ga0495655_0047399
1924 Ga0495595_0479171
1925 Ga0495619_0005559
1926 Ga0495619_0009832
1927 Ga0495619_0080455
1928 Ga0495619_0081089
1929 Ga0495619_0462316
1930 Ga0530510_0733527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

104

177

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

36

102

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9292 2 153
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9277 1 153
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9195 2 153
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9189 1 153
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9163 1 153
ID Description Score Start End Superfamily
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9342 74 153 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.923 78 154 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9207 78 154 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.91 79 152 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9096 78 154 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A386E6B5-F1-model_v4 deleted 0.9471 2 153
AF-A0A7W8XAD6-F1-model_v4 Nicotinate dehydrogenase subunit A (EC 1.17.2.1) 0.9453 2 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A537UGU9-F1-model_v4 (2Fe-2S)-binding protein 0.9449 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A807CKA1-F1-model_v4 deleted 0.9447 6 153
AF-A0A537JTT9-F1-model_v4 (2Fe-2S)-binding protein 0.9445 1 154 GO:0016491
GO:0046872
GO:0051537

Map