F486990
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 966 | 461 | 1932 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_100077656|Ga0070704_1000776563 |
| Length | 369 |
| Sequence | MVHSAIGAMVEARRGARIMQSSESHPERRGWGAFGAFSLSGDLPWEAPLARIEARIEELCAFAGELSPERLSEVAALRTEWSTGAHRIYSTLKPWETVFVARHPQRPLVTDYIHHIAQDFCELHGDRFFGDDHAMVTGFGTIGDHRVMIVGHNRGKSLNERVACHFGCAHPEGYRKALSKMQLAAKYGRPIVLLIDTPGAFPGMEAEERGIARAIAANLVAMPKLKVPLIAVVIGEGGSGGALGIGISDRMAMLEHSIFSVISPEGCAAILWKTSAQAKEASEALKLRAPDLLRLKLIDEVIPEPLGGAHRNHAETAGSVERFIVKTLDELSGLPVAQLLEQRYTRLRAMGSFYEQVCDEKFPQVRQAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 126 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 246 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 252 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 253 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 254 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 255 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 256 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 257 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 258 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 259 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 262 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 263 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 264 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 265 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 266 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 267 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 268 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 269 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 271 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 274 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 275 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 276 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 277 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 278 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 283 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 321 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 331 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 332 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 333 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 334 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 335 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 336 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 361 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 367 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 368 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 369 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 370 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 371 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 372 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 373 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 379 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 380 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 381 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 382 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 383 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 384 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 385 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 390 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 391 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 394 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 404 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 407 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 409 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 416 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 417 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 418 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 419 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 420 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 421 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 422 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 423 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 424 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 425 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 426 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 427 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 428 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 429 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 430 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 431 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 432 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 433 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 434 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 435 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 436 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 437 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 438 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 439 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 440 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 441 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 442 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 443 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 444 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 445 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 446 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 447 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 448 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 449 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 450 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 451 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 452 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 453 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 454 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 455 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 456 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 457 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 458 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 459 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 460 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 461 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.82 |
| Metatranscriptomes | 0.31 |
| Isolates | 4.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 3.62 |
| Nodule | 0.1 |
| Rhizoplane | 1.97 |
| Rhizosphere | 81.57 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 3.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070704_100077656 | 3300005549 | Bacteria | 2433 |
| 2 | JGI24739J22299_10000196 | 3300001989 | Bacteria | 20012 |
| 3 | JGI24739J22299_10053845 | 3300001989 | Bacteria | 1291 |
| 4 | JGI24744J21845_10002463 | 3300002077 | Bacteria | 3774 |
| 5 | JGI25162J39368_1002234 | 3300002737 | Bacteria | 7913 |
| 6 | JGI25159J45721_1020372 | 3300002987 | Bacteria | 1280 |
| 7 | JGI25151J46595_10000428 | 3300003187 | Bacteria | 41859 |
| 8 | JGI25151J46595_10000467 | 3300003187 | Bacteria | 38656 |
| 9 | rootH2_10009230 | 3300003320 | Bacteria | 4967 |
| 10 | rootH2_10106945 | 3300003320 | Bacteria | 3053 |
| 11 | rootL2_10282228 | 3300003322 | Bacteria | 1283 |
| 12 | rootH1_10055647 | 3300003323 | Bacteria | 19770 |
| 13 | JGI25160J50197_1011072 | 3300003354 | Bacteria | 3221 |
| 14 | JGI25404J52841_10007605 | 3300003659 | Bacteria | 2295 |
| 15 | Ga0058692_1000321 | 3300003856 | Bacteria | 23846 |
| 16 | Ga0058692_1000737 | 3300003856 | Bacteria | 13214 |
| 17 | Ga0058692_1000823 | 3300003856 | Bacteria | 12324 |
| 18 | Ga0058692_1006137 | 3300003856 | Bacteria | 3336 |
| 19 | Ga0058692_1006713 | 3300003856 | Bacteria | 3126 |
| 20 | Ga0065704_10008623 | 3300005289 | Bacteria | 3918 |
| 21 | Ga0065704_10187406 | 3300005289 | Viruses | 1184 |
| 22 | Ga0065712_10159252 | 3300005290 | Bacteria | 1314 |
| 23 | Ga0065715_10177365 | 3300005293 | Unclassified | 1501 |
| 24 | Ga0065707_10017383 | 3300005295 | Bacteria | 2405 |
| 25 | Ga0070658_10002816 | 3300005327 | Bacteria | 14453 |
| 26 | Ga0070658_10008528 | 3300005327 | Bacteria | 8239 |
| 27 | Ga0070658_10049246 | 3300005327 | Bacteria | 3413 |
| 28 | Ga0070658_10056074 | 3300005327 | Bacteria | 3202 |
| 29 | Ga0070676_10045003 | 3300005328 | Bacteria | 2570 |
| 30 | Ga0070690_100000072 | 3300005330 | Bacteria | 48578 |
| 31 | Ga0070690_100000083 | 3300005330 | Bacteria | 46348 |
| 32 | Ga0070690_100068722 | 3300005330 | Bacteria | 2298 |
| 33 | Ga0070690_100111421 | 3300005330 | Bacteria | 1827 |
| 34 | Ga0070670_100001144 | 3300005331 | Bacteria | 21043 |
| 35 | Ga0070670_100007453 | 3300005331 | Bacteria | 9293 |
| 36 | Ga0070670_100170660 | 3300005331 | Bacteria | 1886 |
| 37 | Ga0068869_100001752 | 3300005334 | Bacteria | 12971 |
| 38 | Ga0068869_100088281 | 3300005334 | Bacteria | 2327 |
| 39 | Ga0070666_10006936 | 3300005335 | Bacteria | 6981 |
| 40 | Ga0070666_10020030 | 3300005335 | Bacteria | 4322 |
| 41 | Ga0070680_100033369 | 3300005336 | Bacteria | 4149 |
| 42 | Ga0070680_100088535 | 3300005336 | Bacteria | 2561 |
| 43 | Ga0070680_100247826 | 3300005336 | Bacteria | 1506 |
| 44 | Ga0068868_100009540 | 3300005338 | Bacteria | 6994 |
| 45 | Ga0070660_100120010 | 3300005339 | Bacteria | 2098 |
| 46 | Ga0070689_100000039 | 3300005340 | Bacteria | 81597 |
| 47 | Ga0070689_100016476 | 3300005340 | Bacteria | 5409 |
| 48 | Ga0070689_100149209 | 3300005340 | Bacteria | 1885 |
| 49 | Ga0070689_100205513 | 3300005340 | Unclassified | 1610 |
| 50 | Ga0070691_10042325 | 3300005341 | Bacteria | 2155 |
| 51 | Ga0070687_100040253 | 3300005343 | Bacteria | 2354 |
| 52 | Ga0070668_100004124 | 3300005347 | Bacteria | 10760 |
| 53 | Ga0070668_100004559 | 3300005347 | Bacteria | 10275 |
| 54 | Ga0070669_100012637 | 3300005353 | Bacteria | 5992 |
| 55 | Ga0070675_100014013 | 3300005354 | Bacteria | 6313 |
| 56 | Ga0070675_100228339 | 3300005354 | Bacteria | 1623 |
| 57 | Ga0070671_100002526 | 3300005355 | Bacteria | 14170 |
| 58 | Ga0070671_100011089 | 3300005355 | Bacteria | 7237 |
| 59 | Ga0070673_100008936 | 3300005364 | Bacteria | 6699 |
| 60 | Ga0070673_100030712 | 3300005364 | Bacteria | 4026 |
| 61 | Ga0070688_100000087 | 3300005365 | Bacteria | 46867 |
| 62 | Ga0070688_100040974 | 3300005365 | Unclassified | 2841 |
| 63 | Ga0070667_100008810 | 3300005367 | Bacteria | 8358 |
| 64 | Ga0070713_100011838 | 3300005436 | Bacteria | 6374 |
| 65 | Ga0070710_10055948 | 3300005437 | Bacteria | 2231 |
| 66 | Ga0070701_10000043 | 3300005438 | Bacteria | 32096 |
| 67 | Ga0070701_10001604 | 3300005438 | Bacteria | 8425 |
| 68 | Ga0070711_100218808 | 3300005439 | Bacteria | 1479 |
| 69 | Ga0070705_100082127 | 3300005440 | Bacteria | 1982 |
| 70 | Ga0070700_100000798 | 3300005441 | Bacteria | 15440 |
| 71 | Ga0070700_100016511 | 3300005441 | Bacteria | 4206 |
| 72 | Ga0070694_100019785 | 3300005444 | Bacteria | 4285 |
| 73 | Ga0070694_100111983 | 3300005444 | Bacteria | 1946 |
| 74 | Ga0070708_100448779 | 3300005445 | Bacteria | 1217 |
| 75 | Ga0070662_100063266 | 3300005457 | Bacteria | 2706 |
| 76 | Ga0070662_100102984 | 3300005457 | Bacteria | 2164 |
| 77 | Ga0070681_10009249 | 3300005458 | Bacteria | 9686 |
| 78 | Ga0068867_100000100 | 3300005459 | Bacteria | 55007 |
| 79 | Ga0068867_100017689 | 3300005459 | Bacteria | 5061 |
| 80 | Ga0068867_100031719 | 3300005459 | Bacteria | 3817 |
| 81 | Ga0070685_10000211 | 3300005466 | Bacteria | 38855 |
| 82 | Ga0070685_10228166 | 3300005466 | Bacteria | 1223 |
| 83 | Ga0070706_100000543 | 3300005467 | Bacteria | 43757 |
| 84 | Ga0070706_100001219 | 3300005467 | Bacteria | 27538 |
| 85 | Ga0070706_100003351 | 3300005467 | Bacteria | 15806 |
| 86 | Ga0070706_100090718 | 3300005467 | Bacteria | 2834 |
| 87 | Ga0070706_100424697 | 3300005467 | Bacteria | 1237 |
| 88 | Ga0070707_100000266 | 3300005468 | Bacteria | 51948 |
| 89 | Ga0070707_100087471 | 3300005468 | Bacteria | 3014 |
| 90 | Ga0070707_100116013 | 3300005468 | Bacteria | 2599 |
| 91 | Ga0070707_100151945 | 3300005468 | Bacteria | 2255 |
| 92 | Ga0070698_100001369 | 3300005471 | Bacteria | 27100 |
| 93 | Ga0070698_100009691 | 3300005471 | Bacteria | 10299 |
| 94 | Ga0070698_100035064 | 3300005471 | Bacteria | 5189 |
| 95 | Ga0070698_100063704 | 3300005471 | Bacteria | 3718 |
| 96 | Ga0070698_100125902 | 3300005471 | Bacteria | 2519 |
| 97 | Ga0070698_100151432 | 3300005471 | Bacteria | 2267 |
| 98 | Ga0070698_100234152 | 3300005471 | Bacteria | 1770 |
| 99 | Ga0070699_100001124 | 3300005518 | Bacteria | 24927 |
| 100 | Ga0070699_100002417 | 3300005518 | Bacteria | 16760 |
| 101 | Ga0070699_100009142 | 3300005518 | Bacteria | 8592 |
| 102 | Ga0070684_100231026 | 3300005535 | Bacteria | 1689 |
| 103 | Ga0070697_100001376 | 3300005536 | Bacteria | 18418 |
| 104 | Ga0070697_100005432 | 3300005536 | Bacteria | 9821 |
| 105 | Ga0070697_100007588 | 3300005536 | Bacteria | 8442 |
| 106 | Ga0070697_100097252 | 3300005536 | Unclassified | 2442 |
| 107 | Ga0068853_100000003 | 3300005539 | Bacteria | 434636 |
| 108 | Ga0068853_100079807 | 3300005539 | Bacteria | 2862 |
| 109 | Ga0070686_100000802 | 3300005544 | Bacteria | 18174 |
| 110 | Ga0070686_100011454 | 3300005544 | Bacteria | 5031 |
| 111 | Ga0070686_100031552 | 3300005544 | Bacteria | 3241 |
| 112 | Ga0070686_100032925 | 3300005544 | Bacteria | 3182 |
| 113 | Ga0070695_100015417 | 3300005545 | Bacteria | 4616 |
| 114 | Ga0070693_100056394 | 3300005547 | Bacteria | 2267 |
| 115 | Ga0070665_100047552 | 3300005548 | Bacteria | 4306 |
| 116 | Ga0070665_100186352 | 3300005548 | Bacteria | 2076 |
| 117 | Ga0070704_100000053 | 3300005549 | Bacteria | 37727 |
| 118 | Ga0070704_100012505 | 3300005549 | Bacteria | 5241 |
| 119 | Ga0070704_100188669 | 3300005549 | Bacteria | 1655 |
| 120 | Ga0068855_100004254 | 3300005563 | Bacteria | 17482 |
| 121 | Ga0068855_100270877 | 3300005563 | Bacteria | 1888 |
| 122 | Ga0070664_100009295 | 3300005564 | Bacteria | 7976 |
| 123 | Ga0070664_100156022 | 3300005564 | Unclassified | 2017 |
| 124 | Ga0068856_100000079 | 3300005614 | Bacteria | 92486 |
| 125 | Ga0068856_100169177 | 3300005614 | Bacteria | 2197 |
| 126 | Ga0070702_100000787 | 3300005615 | Bacteria | 12063 |
| 127 | Ga0068859_100000257 | 3300005617 | Bacteria | 52795 |
| 128 | Ga0068859_100005776 | 3300005617 | Bacteria | 12570 |
| 129 | Ga0068859_100009362 | 3300005617 | Bacteria | 9890 |
| 130 | Ga0068859_100106009 | 3300005617 | Bacteria | 2870 |
| 131 | Ga0068866_10003043 | 3300005718 | Bacteria | 6919 |
| 132 | Ga0068861_100000337 | 3300005719 | Bacteria | 26619 |
| 133 | Ga0068861_100051239 | 3300005719 | Bacteria | 3133 |
| 134 | Ga0068863_100010338 | 3300005841 | Bacteria | 9064 |
| 135 | Ga0068863_100029359 | 3300005841 | Bacteria | 5249 |
| 136 | Ga0068858_100018973 | 3300005842 | Bacteria | 6435 |
| 137 | Ga0068858_100024309 | 3300005842 | Bacteria | 5646 |
| 138 | Ga0068858_100204480 | 3300005842 | Bacteria | 1868 |
| 139 | Ga0068858_100428084 | 3300005842 | Bacteria | 1273 |
| 140 | Ga0068860_100001778 | 3300005843 | Bacteria | 22944 |
| 141 | Ga0068860_100109160 | 3300005843 | Bacteria | 2644 |
| 142 | Ga0068860_100501931 | 3300005843 | Bacteria | 1211 |
| 143 | Ga0068862_100100950 | 3300005844 | Bacteria | 2524 |
| 144 | Ga0068862_100157066 | 3300005844 | Bacteria | 2028 |
| 145 | Ga0068862_100239540 | 3300005844 | Bacteria | 1649 |
| 146 | Ga0068862_100412442 | 3300005844 | Bacteria | 1266 |
| 147 | Ga0081455_10015579 | 3300005937 | Bacteria | 7378 |
| 148 | Ga0081455_10071713 | 3300005937 | Bacteria | 2870 |
| 149 | Ga0081455_10094308 | 3300005937 | Unclassified | 2418 |
| 150 | Ga0081455_10162916 | 3300005937 | Bacteria | 1707 |
| 151 | Ga0081540_1026720 | 3300005983 | Bacteria | 3287 |
| 152 | Ga0081540_1052893 | 3300005983 | Bacteria | 1995 |
| 153 | Ga0075363_100005177 | 3300006048 | Bacteria | 5771 |
| 154 | Ga0075364_10012273 | 3300006051 | Bacteria | 5238 |
| 155 | Ga0075364_10027091 | 3300006051 | Bacteria | 3659 |
| 156 | Ga0070716_100114370 | 3300006173 | Bacteria | 1678 |
| 157 | Ga0070712_100182649 | 3300006175 | Unclassified | 1636 |
| 158 | Ga0070712_100271808 | 3300006175 | Bacteria | 1362 |
| 159 | Ga0075362_10000420 | 3300006177 | Bacteria | 12200 |
| 160 | Ga0075369_10149521 | 3300006186 | Bacteria | 1067 |
| 161 | Ga0075366_10033316 | 3300006195 | Unclassified | 3034 |
| 162 | Ga0075366_10034291 | 3300006195 | Bacteria | 2988 |
| 163 | Ga0097621_100000938 | 3300006237 | Bacteria | 20423 |
| 164 | Ga0097621_100006163 | 3300006237 | Bacteria | 8498 |
| 165 | Ga0097621_100034170 | 3300006237 | Bacteria | 4054 |
| 166 | Ga0097621_100154109 | 3300006237 | Unclassified | 1971 |
| 167 | Ga0075370_10023550 | 3300006353 | Unclassified | 3392 |
| 168 | Ga0068871_100004323 | 3300006358 | Bacteria | 9867 |
| 169 | Ga0068871_100006362 | 3300006358 | Bacteria | 8347 |
| 170 | Ga0068871_100142906 | 3300006358 | Unclassified | 2036 |
| 171 | Ga0068871_100146059 | 3300006358 | Bacteria | 2014 |
| 172 | Ga0075428_100001470 | 3300006844 | Bacteria | 25215 |
| 173 | Ga0075428_100070032 | 3300006844 | Bacteria | 3834 |
| 174 | Ga0075428_100127495 | 3300006844 | Bacteria | 2769 |
| 175 | Ga0075428_100201590 | 3300006844 | Bacteria | 2151 |
| 176 | Ga0075428_100473838 | 3300006844 | Bacteria | 1340 |
| 177 | Ga0075430_100004102 | 3300006846 | Bacteria | 12285 |
| 178 | Ga0075430_100069410 | 3300006846 | Bacteria | 2956 |
| 179 | Ga0075431_100025254 | 3300006847 | Bacteria | 6091 |
| 180 | Ga0075431_100062828 | 3300006847 | Bacteria | 3832 |
| 181 | Ga0075431_100085835 | 3300006847 | Unclassified | 3249 |
| 182 | Ga0075431_100150561 | 3300006847 | Bacteria | 2396 |
| 183 | Ga0075431_100179523 | 3300006847 | Bacteria | 2173 |
| 184 | Ga0075433_10007874 | 3300006852 | Bacteria | 8475 |
| 185 | Ga0075433_10091104 | 3300006852 | Bacteria | 2695 |
| 186 | Ga0075433_10319739 | 3300006852 | Unclassified | 1373 |
| 187 | Ga0075434_100058694 | 3300006871 | Bacteria | 3824 |
| 188 | Ga0075434_100064083 | 3300006871 | Bacteria | 3659 |
| 189 | Ga0075434_100587481 | 3300006871 | Bacteria | 1133 |
| 190 | Ga0075429_100000196 | 3300006880 | Bacteria | 40118 |
| 191 | Ga0075429_100006813 | 3300006880 | Bacteria | 9916 |
| 192 | Ga0075429_100481327 | 3300006880 | Bacteria | 1088 |
| 193 | Ga0068865_100014361 | 3300006881 | Bacteria | 5031 |
| 194 | Ga0068865_100096128 | 3300006881 | Unclassified | 2159 |
| 195 | Ga0097620_100000257 | 3300006931 | Bacteria | 52795 |
| 196 | Ga0097620_100005776 | 3300006931 | Bacteria | 12570 |
| 197 | Ga0097620_100009362 | 3300006931 | Bacteria | 9890 |
| 198 | Ga0097620_100106016 | 3300006931 | Bacteria | 2870 |
| 199 | Ga0099794_10000046 | 3300007265 | Bacteria | 49155 |
| 200 | Ga0105251_10000763 | 3300009011 | Bacteria | 29288 |
| 201 | Ga0105251_10008784 | 3300009011 | Bacteria | 6058 |
| 202 | Ga0105251_10025124 | 3300009011 | Bacteria | 3051 |
| 203 | Ga0105251_10025830 | 3300009011 | Bacteria | 2998 |
| 204 | Ga0105244_10004443 | 3300009036 | Bacteria | 9636 |
| 205 | Ga0105244_10005668 | 3300009036 | Bacteria | 8246 |
| 206 | Ga0105244_10100578 | 3300009036 | Bacteria | 1414 |
| 207 | Ga0105240_10005451 | 3300009093 | Bacteria | 18958 |
| 208 | Ga0105240_10018190 | 3300009093 | Bacteria | 9448 |
| 209 | Ga0111539_10039279 | 3300009094 | Bacteria | 5706 |
| 210 | Ga0111539_10185370 | 3300009094 | Bacteria | 2430 |
| 211 | Ga0105245_10000968 | 3300009098 | Bacteria | 26187 |
| 212 | Ga0114129_10003886 | 3300009147 | Bacteria | 21079 |
| 213 | Ga0105243_10000166 | 3300009148 | Bacteria | 75434 |
| 214 | Ga0105241_10000012 | 3300009174 | Bacteria | 221790 |
| 215 | Ga0105242_10002223 | 3300009176 | Bacteria | 15309 |
| 216 | Ga0105242_10045477 | 3300009176 | Bacteria | 3558 |
| 217 | Ga0105242_10148466 | 3300009176 | Bacteria | 2042 |
| 218 | Ga0105248_10000428 | 3300009177 | Bacteria | 47662 |
| 219 | Ga0105248_10067003 | 3300009177 | Bacteria | 4031 |
| 220 | Ga0105248_10398683 | 3300009177 | Bacteria | 1549 |
| 221 | Ga0105237_10016911 | 3300009545 | Bacteria | 7568 |
| 222 | Ga0105237_10033518 | 3300009545 | Bacteria | 5203 |
| 223 | Ga0105238_10295058 | 3300009551 | Bacteria | 1604 |
| 224 | Ga0105249_10015794 | 3300009553 | Bacteria | 6688 |
| 225 | Ga0099796_10035969 | 3300010159 | Bacteria | 1646 |
| 226 | Ga0105246_10016359 | 3300011119 | Bacteria | 4697 |
| 227 | Ga0105246_10062853 | 3300011119 | Bacteria | 2587 |
| 228 | Ga0105246_10073241 | 3300011119 | Bacteria | 2418 |
| 229 | Ga0157373_10001791 | 3300013100 | Bacteria | 16334 |
| 230 | Ga0157373_10002278 | 3300013100 | Bacteria | 14542 |
| 231 | Ga0157371_10003028 | 3300013102 | Bacteria | 15611 |
| 232 | Ga0157370_10002510 | 3300013104 | Bacteria | 22097 |
| 233 | Ga0157370_10005749 | 3300013104 | Bacteria | 13871 |
| 234 | Ga0157369_10042060 | 3300013105 | Bacteria | 4985 |
| 235 | Ga0157369_10340287 | 3300013105 | Bacteria | 1558 |
| 236 | Ga0157374_10009685 | 3300013296 | Bacteria | 8274 |
| 237 | Ga0157374_10050077 | 3300013296 | Bacteria | 3881 |
| 238 | Ga0157374_10176258 | 3300013296 | Bacteria | 2087 |
| 239 | Ga0157378_10001738 | 3300013297 | Bacteria | 19541 |
| 240 | Ga0157378_10033775 | 3300013297 | Bacteria | 4524 |
| 241 | Ga0157378_10382510 | 3300013297 | Bacteria | 1382 |
| 242 | Ga0163162_10091992 | 3300013306 | Bacteria | 3116 |
| 243 | Ga0163162_10097271 | 3300013306 | Bacteria | 3032 |
| 244 | Ga0163162_10377084 | 3300013306 | Bacteria | 1551 |
| 245 | Ga0157372_10015433 | 3300013307 | Bacteria | 8186 |
| 246 | Ga0157375_10000284 | 3300013308 | Bacteria | 46158 |
| 247 | Ga0157375_10046506 | 3300013308 | Bacteria | 4232 |
| 248 | Ga0157375_10154310 | 3300013308 | Bacteria | 2434 |
| 249 | Ga0157375_10336765 | 3300013308 | Bacteria | 1674 |
| 250 | Ga0163163_10001353 | 3300014325 | Bacteria | 20684 |
| 251 | Ga0163163_10259275 | 3300014325 | Unclassified | 1789 |
| 252 | Ga0157380_10002830 | 3300014326 | Bacteria | 11795 |
| 253 | Ga0157380_10021950 | 3300014326 | Bacteria | 4795 |
| 254 | Ga0157380_10050355 | 3300014326 | Bacteria | 3290 |
| 255 | Ga0182008_10003015 | 3300014497 | Bacteria | 10349 |
| 256 | Ga0157379_10041434 | 3300014968 | Bacteria | 4111 |
| 257 | Ga0157376_10028435 | 3300014969 | Bacteria | 4443 |
| 258 | Ga0157376_10165961 | 3300014969 | Bacteria | 2006 |
| 259 | Ga0157376_10463625 | 3300014969 | Bacteria | 1238 |
| 260 | Ga0182006_1004923 | 3300015261 | Bacteria | 6464 |
| 261 | Ga0182005_1001737 | 3300015265 | Bacteria | 8396 |
| 262 | Ga0163161_10013454 | 3300017792 | Bacteria | 5695 |
| 263 | Ga0213872_10000168 | 3300021361 | Bacteria | 59182 |
| 264 | Ga0213872_10010883 | 3300021361 | Bacteria | 4317 |
| 265 | Ga0213872_10012875 | 3300021361 | Bacteria | 3924 |
| 266 | Ga0213872_10046718 | 3300021361 | Unclassified | 1969 |
| 267 | Ga0213872_10094138 | 3300021361 | Bacteria | 1338 |
| 268 | Ga0213876_10003351 | 3300021384 | Bacteria | 9167 |
| 269 | Ga0213876_10003657 | 3300021384 | Bacteria | 8741 |
| 270 | Ga0213876_10007869 | 3300021384 | Bacteria | 5782 |
| 271 | Ga0213876_10008273 | 3300021384 | Bacteria | 5628 |
| 272 | Ga0213876_10011138 | 3300021384 | Bacteria | 4810 |
| 273 | Ga0213871_10022332 | 3300021441 | Bacteria | 1585 |
| 274 | Ga0209760_104198 | 3300025207 | Bacteria | 1245 |
| 275 | Ga0209437_100063 | 3300025233 | Bacteria | 335477 |
| 276 | Ga0209130_1000490 | 3300025284 | Bacteria | 40620 |
| 277 | Ga0209025_1000138 | 3300025294 | Bacteria | 189551 |
| 278 | Ga0209758_1014951 | 3300025297 | Bacteria | 4067 |
| 279 | Ga0207426_1000281 | 3300025302 | Bacteria | 104133 |
| 280 | Ga0207697_10001318 | 3300025315 | Bacteria | 13647 |
| 281 | Ga0207696_1000387 | 3300025711 | Bacteria | 42108 |
| 282 | Ga0207696_1056604 | 3300025711 | Bacteria | 1110 |
| 283 | Ga0207655_1000024 | 3300025728 | Bacteria | 459774 |
| 284 | Ga0207655_1001132 | 3300025728 | Bacteria | 26007 |
| 285 | Ga0207655_1004658 | 3300025728 | Bacteria | 9620 |
| 286 | Ga0207655_1011411 | 3300025728 | Bacteria | 5294 |
| 287 | Ga0207655_1020279 | 3300025728 | Bacteria | 3423 |
| 288 | Ga0207713_1000007 | 3300025735 | Bacteria | 564979 |
| 289 | Ga0207713_1000054 | 3300025735 | Bacteria | 222042 |
| 290 | Ga0207713_1008116 | 3300025735 | Bacteria | 6088 |
| 291 | Ga0207713_1022317 | 3300025735 | Bacteria | 3008 |
| 292 | Ga0207682_10013720 | 3300025893 | Bacteria | 3155 |
| 293 | Ga0207692_10015276 | 3300025898 | Bacteria | 3375 |
| 294 | Ga0207642_10003168 | 3300025899 | Bacteria | 5162 |
| 295 | Ga0207688_10002677 | 3300025901 | Bacteria | 9644 |
| 296 | Ga0207680_10071252 | 3300025903 | Bacteria | 2154 |
| 297 | Ga0207645_10047281 | 3300025907 | Bacteria | 2748 |
| 298 | Ga0207705_10001931 | 3300025909 | Bacteria | 16187 |
| 299 | Ga0207705_10074788 | 3300025909 | Bacteria | 2460 |
| 300 | Ga0207705_10222627 | 3300025909 | Bacteria | 1434 |
| 301 | Ga0207684_10001744 | 3300025910 | Bacteria | 22999 |
| 302 | Ga0207684_10002729 | 3300025910 | Bacteria | 17609 |
| 303 | Ga0207684_10006584 | 3300025910 | Bacteria | 10569 |
| 304 | Ga0207684_10060966 | 3300025910 | Bacteria | 3204 |
| 305 | Ga0207654_10000015 | 3300025911 | Bacteria | 221799 |
| 306 | Ga0207707_10007189 | 3300025912 | Bacteria | 9695 |
| 307 | Ga0207695_10043992 | 3300025913 | Bacteria | 4754 |
| 308 | Ga0207695_10045908 | 3300025913 | Bacteria | 4633 |
| 309 | Ga0207693_10179914 | 3300025915 | Unclassified | 1664 |
| 310 | Ga0207693_10223788 | 3300025915 | Bacteria | 1478 |
| 311 | Ga0207663_10000627 | 3300025916 | Bacteria | 15650 |
| 312 | Ga0207660_10026020 | 3300025917 | Bacteria | 3980 |
| 313 | Ga0207662_10056548 | 3300025918 | Bacteria | 2343 |
| 314 | Ga0207649_10003506 | 3300025920 | Bacteria | 8575 |
| 315 | Ga0207646_10002204 | 3300025922 | Bacteria | 23196 |
| 316 | Ga0207646_10014296 | 3300025922 | Bacteria | 7546 |
| 317 | Ga0207646_10075355 | 3300025922 | Bacteria | 3015 |
| 318 | Ga0207646_10177824 | 3300025922 | Bacteria | 1922 |
| 319 | Ga0207646_10248545 | 3300025922 | Bacteria | 1606 |
| 320 | Ga0207646_10272099 | 3300025922 | Bacteria | 1531 |
| 321 | Ga0207681_10107865 | 3300025923 | Bacteria | 2020 |
| 322 | Ga0207650_10021941 | 3300025925 | Unclassified | 4518 |
| 323 | Ga0207650_10045942 | 3300025925 | Bacteria | 3214 |
| 324 | Ga0207650_10087895 | 3300025925 | Bacteria | 2369 |
| 325 | Ga0207687_10005298 | 3300025927 | Bacteria | 8547 |
| 326 | Ga0207687_10033247 | 3300025927 | Bacteria | 3497 |
| 327 | Ga0207687_10044175 | 3300025927 | Bacteria | 3073 |
| 328 | Ga0207700_10009145 | 3300025928 | Bacteria | 6171 |
| 329 | Ga0207700_10135487 | 3300025928 | Bacteria | 2017 |
| 330 | Ga0207644_10004324 | 3300025931 | Bacteria | 9210 |
| 331 | Ga0207706_10102448 | 3300025933 | Bacteria | 2518 |
| 332 | Ga0207706_10109708 | 3300025933 | Unclassified | 2428 |
| 333 | Ga0207686_10004503 | 3300025934 | Bacteria | 7465 |
| 334 | Ga0207686_10010907 | 3300025934 | Bacteria | 4958 |
| 335 | Ga0207686_10011766 | 3300025934 | Bacteria | 4800 |
| 336 | Ga0207709_10000095 | 3300025935 | Bacteria | 137828 |
| 337 | Ga0207709_10020921 | 3300025935 | Bacteria | 3697 |
| 338 | Ga0207670_10000035 | 3300025936 | Bacteria | 107909 |
| 339 | Ga0207670_10008675 | 3300025936 | Bacteria | 5754 |
| 340 | Ga0207670_10144099 | 3300025936 | Bacteria | 1760 |
| 341 | Ga0207670_10314286 | 3300025936 | Bacteria | 1231 |
| 342 | Ga0207669_10023783 | 3300025937 | Bacteria | 3279 |
| 343 | Ga0207669_10097439 | 3300025937 | Bacteria | 1934 |
| 344 | Ga0207704_10066275 | 3300025938 | Unclassified | 2265 |
| 345 | Ga0207704_10148168 | 3300025938 | Bacteria | 1652 |
| 346 | Ga0207665_10217079 | 3300025939 | Bacteria | 1400 |
| 347 | Ga0207691_10026709 | 3300025940 | Bacteria | 5417 |
| 348 | Ga0207711_10003450 | 3300025941 | Bacteria | 13680 |
| 349 | Ga0207711_10075951 | 3300025941 | Bacteria | 2925 |
| 350 | Ga0207689_10000197 | 3300025942 | Bacteria | 53057 |
| 351 | Ga0207689_10098716 | 3300025942 | Bacteria | 2399 |
| 352 | Ga0207679_10006669 | 3300025945 | Bacteria | 7308 |
| 353 | Ga0207667_10020003 | 3300025949 | Bacteria | 7457 |
| 354 | Ga0207667_10049823 | 3300025949 | Bacteria | 4421 |
| 355 | Ga0207651_10034295 | 3300025960 | Bacteria | 3285 |
| 356 | Ga0207712_10013341 | 3300025961 | Bacteria | 5267 |
| 357 | Ga0207703_10200750 | 3300026035 | Bacteria | 1772 |
| 358 | Ga0207639_10000002 | 3300026041 | Bacteria | 903066 |
| 359 | Ga0207639_10068010 | 3300026041 | Bacteria | 2774 |
| 360 | Ga0207639_10354826 | 3300026041 | Bacteria | 1311 |
| 361 | Ga0207708_10000422 | 3300026075 | Bacteria | 33057 |
| 362 | Ga0207708_10001043 | 3300026075 | Bacteria | 20754 |
| 363 | Ga0207702_10003680 | 3300026078 | Bacteria | 13877 |
| 364 | Ga0207702_10089225 | 3300026078 | Bacteria | 2696 |
| 365 | Ga0207641_10007461 | 3300026088 | Bacteria | 9097 |
| 366 | Ga0207641_10084706 | 3300026088 | Unclassified | 2760 |
| 367 | Ga0207648_10000285 | 3300026089 | Bacteria | 55006 |
| 368 | Ga0207648_10000365 | 3300026089 | Bacteria | 49615 |
| 369 | Ga0207648_10003664 | 3300026089 | Bacteria | 16079 |
| 370 | Ga0207648_10008033 | 3300026089 | Bacteria | 10280 |
| 371 | Ga0207675_100000226 | 3300026118 | Bacteria | 53141 |
| 372 | Ga0207675_100001229 | 3300026118 | Bacteria | 25569 |
| 373 | Ga0207675_100066640 | 3300026118 | Bacteria | 3366 |
| 374 | Ga0207675_100651455 | 3300026118 | Bacteria | 1059 |
| 375 | Ga0209281_1000092 | 3300027111 | Bacteria | 241437 |
| 376 | Ga0209371_1000053 | 3300027312 | Bacteria | 264616 |
| 377 | Ga0209371_1000096 | 3300027312 | Bacteria | 160552 |
| 378 | Ga0209371_1000497 | 3300027312 | Bacteria | 38227 |
| 379 | Ga0209371_1000691 | 3300027312 | Bacteria | 28756 |
| 380 | Ga0209371_1000756 | 3300027312 | Bacteria | 26926 |
| 381 | Ga0209371_1000875 | 3300027312 | Bacteria | 24191 |
| 382 | Ga0209371_1001111 | 3300027312 | Bacteria | 19921 |
| 383 | Ga0209371_1001791 | 3300027312 | Bacteria | 13437 |
| 384 | Ga0209968_1002487 | 3300027526 | Bacteria | 2784 |
| 385 | Ga0209970_1009678 | 3300027614 | Bacteria | 1575 |
| 386 | Ga0209983_1002490 | 3300027665 | Bacteria | 4027 |
| 387 | Ga0209588_1000022 | 3300027671 | Bacteria | 92210 |
| 388 | Ga0209974_10000161 | 3300027876 | Bacteria | 20444 |
| 389 | Ga0209974_10003828 | 3300027876 | Bacteria | 5391 |
| 390 | Ga0209974_10044593 | 3300027876 | Bacteria | 1480 |
| 391 | Ga0268266_10000123 | 3300028379 | Bacteria | 153496 |
| 392 | Ga0268266_10048387 | 3300028379 | Bacteria | 3644 |
| 393 | Ga0268266_10069726 | 3300028379 | Bacteria | 3047 |
| 394 | Ga0268265_10100123 | 3300028380 | Bacteria | 2338 |
| 395 | Ga0268265_10121868 | 3300028380 | Bacteria | 2150 |
| 396 | Ga0268264_10001024 | 3300028381 | Bacteria | 28109 |
| 397 | Ga0265337_1000067 | 3300028556 | Bacteria | 48544 |
| 398 | Ga0265337_1002043 | 3300028556 | Bacteria | 9567 |
| 399 | Ga0265337_1005710 | 3300028556 | Bacteria | 4892 |
| 400 | Ga0265337_1006807 | 3300028556 | Bacteria | 4350 |
| 401 | Ga0265337_1010214 | 3300028556 | Bacteria | 3301 |
| 402 | Ga0265319_1002755 | 3300028563 | Bacteria | 9429 |
| 403 | Ga0265319_1003156 | 3300028563 | Bacteria | 8683 |
| 404 | Ga0265319_1009112 | 3300028563 | Bacteria | 4265 |
| 405 | Ga0265319_1012057 | 3300028563 | Bacteria | 3510 |
| 406 | Ga0265319_1015788 | 3300028563 | Bacteria | 2913 |
| 407 | Ga0265334_10000014 | 3300028573 | Bacteria | 154345 |
| 408 | Ga0265318_10002219 | 3300028577 | Bacteria | 10482 |
| 409 | Ga0265318_10002412 | 3300028577 | Bacteria | 9998 |
| 410 | Ga0265318_10009904 | 3300028577 | Bacteria | 4174 |
| 411 | Ga0265318_10014317 | 3300028577 | Bacteria | 3333 |
| 412 | Ga0265336_10019439 | 3300028666 | Bacteria | 2191 |
| 413 | Ga0265336_10028010 | 3300028666 | Bacteria | 1761 |
| 414 | Ga0307515_10066435 | 3300028794 | Bacteria | 4997 |
| 415 | Ga0265338_10000619 | 3300028800 | Bacteria | 61997 |
| 416 | Ga0265338_10001160 | 3300028800 | Bacteria | 43556 |
| 417 | Ga0265338_10004415 | 3300028800 | Bacteria | 19017 |
| 418 | Ga0265338_10006692 | 3300028800 | Bacteria | 14569 |
| 419 | Ga0265338_10008324 | 3300028800 | Bacteria | 12617 |
| 420 | Ga0265338_10009263 | 3300028800 | Bacteria | 11778 |
| 421 | Ga0265338_10032580 | 3300028800 | Bacteria | 5077 |
| 422 | Ga0265338_10060691 | 3300028800 | Bacteria | 3319 |
| 423 | Ga0265338_10060795 | 3300028800 | Bacteria | 3315 |
| 424 | Ga0265338_10062273 | 3300028800 | Bacteria | 3262 |
| 425 | Ga0265338_10067496 | 3300028800 | Bacteria | 3089 |
| 426 | Ga0265324_10001228 | 3300029957 | Bacteria | 15185 |
| 427 | Ga0265324_10001725 | 3300029957 | Bacteria | 12018 |
| 428 | Ga0265324_10005920 | 3300029957 | Bacteria | 5187 |
| 429 | Ga0265324_10011811 | 3300029957 | Bacteria | 3316 |
| 430 | Ga0268256_1000053 | 3300030500 | Bacteria | 264616 |
| 431 | Ga0268256_1000086 | 3300030500 | Bacteria | 160533 |
| 432 | Ga0268256_1000657 | 3300030500 | Bacteria | 26305 |
| 433 | Ga0268256_1001242 | 3300030500 | Bacteria | 15974 |
| 434 | Ga0268256_1001562 | 3300030500 | Bacteria | 13437 |
| 435 | Ga0268256_1041009 | 3300030500 | Bacteria | 1036 |
| 436 | Ga0316183_1199272 | 3300030742 | Bacteria | 1978 |
| 437 | Ga0265330_10001762 | 3300031235 | Bacteria | 12160 |
| 438 | Ga0265332_10000222 | 3300031238 | Bacteria | 45648 |
| 439 | Ga0265332_10011334 | 3300031238 | Bacteria | 3964 |
| 440 | Ga0265328_10046049 | 3300031239 | Bacteria | 1604 |
| 441 | Ga0265320_10000394 | 3300031240 | Bacteria | 35351 |
| 442 | Ga0265320_10001703 | 3300031240 | Bacteria | 15624 |
| 443 | Ga0265320_10001761 | 3300031240 | Bacteria | 15347 |
| 444 | Ga0265320_10031286 | 3300031240 | Bacteria | 2735 |
| 445 | Ga0265320_10036494 | 3300031240 | Bacteria | 2483 |
| 446 | Ga0265320_10043394 | 3300031240 | Bacteria | 2223 |
| 447 | Ga0265320_10078604 | 3300031240 | Bacteria | 1543 |
| 448 | Ga0265325_10000270 | 3300031241 | Bacteria | 36987 |
| 449 | Ga0265325_10003245 | 3300031241 | Bacteria | 10700 |
| 450 | Ga0265325_10009806 | 3300031241 | Bacteria | 5575 |
| 451 | Ga0265325_10031615 | 3300031241 | Bacteria | 2831 |
| 452 | Ga0265340_10008405 | 3300031247 | Bacteria | 5577 |
| 453 | Ga0265340_10024826 | 3300031247 | Bacteria | 3040 |
| 454 | Ga0265339_10016898 | 3300031249 | Bacteria | 4335 |
| 455 | Ga0265339_10066197 | 3300031249 | Bacteria | 1935 |
| 456 | Ga0265339_10098555 | 3300031249 | Bacteria | 1524 |
| 457 | Ga0265331_10001800 | 3300031250 | Bacteria | 15227 |
| 458 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 459 | Ga0265327_10000460 | 3300031251 | Bacteria | 73013 |
| 460 | Ga0265327_10001286 | 3300031251 | Bacteria | 32988 |
| 461 | Ga0265327_10002819 | 3300031251 | Bacteria | 17551 |
| 462 | Ga0265327_10009964 | 3300031251 | Bacteria | 6763 |
| 463 | Ga0265327_10042399 | 3300031251 | Bacteria | 2443 |
| 464 | Ga0265316_10000084 | 3300031344 | Bacteria | 99744 |
| 465 | Ga0265316_10000107 | 3300031344 | Bacteria | 89406 |
| 466 | Ga0265316_10002363 | 3300031344 | Bacteria | 19648 |
| 467 | Ga0265316_10024451 | 3300031344 | Bacteria | 5062 |
| 468 | Ga0265316_10025535 | 3300031344 | Bacteria | 4928 |
| 469 | Ga0265316_10036809 | 3300031344 | Bacteria | 3956 |
| 470 | Ga0265316_10038928 | 3300031344 | Bacteria | 3824 |
| 471 | Ga0265316_10054395 | 3300031344 | Bacteria | 3134 |
| 472 | Ga0265316_10068061 | 3300031344 | Bacteria | 2752 |
| 473 | Ga0265316_10111741 | 3300031344 | Bacteria | 2069 |
| 474 | Ga0265316_10277157 | 3300031344 | Bacteria | 1226 |
| 475 | Ga0307408_100000110 | 3300031548 | Bacteria | 91157 |
| 476 | Ga0307408_100000216 | 3300031548 | Bacteria | 61491 |
| 477 | Ga0307408_100003420 | 3300031548 | Bacteria | 10883 |
| 478 | Ga0307408_100082149 | 3300031548 | Bacteria | 2411 |
| 479 | Ga0265313_10000294 | 3300031595 | Bacteria | 54470 |
| 480 | Ga0265313_10002132 | 3300031595 | Bacteria | 17585 |
| 481 | Ga0265313_10003273 | 3300031595 | Bacteria | 13305 |
| 482 | Ga0265313_10014538 | 3300031595 | Bacteria | 4644 |
| 483 | Ga0265313_10016629 | 3300031595 | Bacteria | 4221 |
| 484 | Ga0307508_10000129 | 3300031616 | Bacteria | 89267 |
| 485 | Ga0316579_10103425 | 3300031691 | Bacteria | 1365 |
| 486 | Ga0265314_10000076 | 3300031711 | Bacteria | 146266 |
| 487 | Ga0265314_10000444 | 3300031711 | Bacteria | 55347 |
| 488 | Ga0265314_10002029 | 3300031711 | Bacteria | 21461 |
| 489 | Ga0265314_10008024 | 3300031711 | Bacteria | 9100 |
| 490 | Ga0265314_10027223 | 3300031711 | Bacteria | 4283 |
| 491 | Ga0265314_10050561 | 3300031711 | Bacteria | 2901 |
| 492 | Ga0265314_10057477 | 3300031711 | Bacteria | 2671 |
| 493 | Ga0265342_10000147 | 3300031712 | Bacteria | 79849 |
| 494 | Ga0265342_10014381 | 3300031712 | Bacteria | 5255 |
| 495 | Ga0265342_10023804 | 3300031712 | Bacteria | 3870 |
| 496 | Ga0265342_10049845 | 3300031712 | Bacteria | 2503 |
| 497 | Ga0265342_10099761 | 3300031712 | Bacteria | 1656 |
| 498 | Ga0265342_10101738 | 3300031712 | Bacteria | 1636 |
| 499 | Ga0316576_10002208 | 3300031727 | Bacteria | 10990 |
| 500 | Ga0316576_10003580 | 3300031727 | Bacteria | 9153 |
| 501 | Ga0316576_10160663 | 3300031727 | Bacteria | 1695 |
| 502 | Ga0316578_10053606 | 3300031728 | Bacteria | 2363 |
| 503 | Ga0307405_10029614 | 3300031731 | Bacteria | 3201 |
| 504 | Ga0316577_10029430 | 3300031733 | Bacteria | 3065 |
| 505 | Ga0307413_10009859 | 3300031824 | Bacteria | 4596 |
| 506 | Ga0307406_10004940 | 3300031901 | Bacteria | 7265 |
| 507 | Ga0307406_10048889 | 3300031901 | Bacteria | 2674 |
| 508 | Ga0307406_10057683 | 3300031901 | Bacteria | 2491 |
| 509 | Ga0307412_10000040 | 3300031911 | Bacteria | 182923 |
| 510 | Ga0307409_100084283 | 3300031995 | Bacteria | 2580 |
| 511 | Ga0307409_100215949 | 3300031995 | Bacteria | 1727 |
| 512 | Ga0307416_100008182 | 3300032002 | Bacteria | 6723 |
| 513 | Ga0307416_100117904 | 3300032002 | Bacteria | 2358 |
| 514 | Ga0307416_100480431 | 3300032002 | Bacteria | 1302 |
| 515 | Ga0307414_10000033 | 3300032004 | Bacteria | 183814 |
| 516 | Ga0307414_10034977 | 3300032004 | Bacteria | 3338 |
| 517 | Ga0307414_10293063 | 3300032004 | Bacteria | 1372 |
| 518 | Ga0307411_10006743 | 3300032005 | Bacteria | 5775 |
| 519 | Ga0316593_10000238 | 3300032168 | Bacteria | 8912 |
| 520 | Ga0316592_1017191 | 3300033524 | Bacteria | 1516 |
| 521 | Ga0316596_1001161 | 3300033541 | Bacteria | 5163 |
| 522 | Ga0373959_0028439 | 3300034820 | Bacteria | 1116 |
| 523 | Ga0373928_0001007 | 3300035084 | Bacteria | 5529 |
| 524 | Ga0373929_0000917 | 3300035085 | Bacteria | 5739 |
| 525 | Ga0373934_0058420 | 3300035086 | Bacteria | 1535 |
| 526 | Ga0373944_0001890 | 3300035089 | Bacteria | 5298 |
| 527 | Ga0373949_0003389 | 3300035090 | Bacteria | 3818 |
| 528 | Ga0373951_0003990 | 3300035091 | Bacteria | 3544 |
| 529 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 530 | Ga0373953_0071189 | 3300035117 | Bacteria | 1435 |
| 531 | Ga0373962_0000105 | 3300035242 | Bacteria | 18388 |
| 532 | Ga0316574_0008677 | 3300035398 | Bacteria | 5655 |
| 533 | Ga0316574_0022953 | 3300035398 | Bacteria | 3721 |
| 534 | Ga0316574_0023426 | 3300035398 | Bacteria | 3686 |
| 535 | Ga0316574_0056394 | 3300035398 | Bacteria | 2458 |
| 536 | Ga0373931_0000004 | 3300035691 | Bacteria | 535140 |
| 537 | Ga0373927_0086683 | 3300035695 | Bacteria | 2032 |
| 538 | Ga0373933_0051150 | 3300035724 | Bacteria | 2469 |
| 539 | Ga0373933_0091264 | 3300035724 | Bacteria | 1880 |
| 540 | Ga0373933_0143532 | 3300035724 | Bacteria | 1509 |
| 541 | Ga0373933_0164649 | 3300035724 | Bacteria | 1409 |
| 542 | Ga0373947_0055394 | 3300035725 | Bacteria | 2395 |
| 543 | Ga0373947_0104930 | 3300035725 | Bacteria | 1780 |
| 544 | Ga0373937_0014534 | 3300036401 | Bacteria | 6952 |
| 545 | Ga0373937_0084693 | 3300036401 | Bacteria | 2933 |
| 546 | Ga0373937_0095980 | 3300036401 | Bacteria | 2749 |
| 547 | Ga0373937_0252425 | 3300036401 | Bacteria | 1663 |
| 548 | Ga0316582_0020906 | 3300036647 | Bacteria | 3857 |
| 549 | Ga0316582_0122925 | 3300036647 | Bacteria | 1738 |
| 550 | Ga0316582_0157013 | 3300036647 | Bacteria | 1540 |
| 551 | Ga0316584_0014329 | 3300036712 | Bacteria | 5639 |
| 552 | Ga0373925_0000572 | 3300037068 | Bacteria | 35958 |
| 553 | Ga0373925_0096861 | 3300037068 | Bacteria | 2262 |
| 554 | Ga0373925_0169611 | 3300037068 | Bacteria | 1723 |
| 555 | Ga0395899_0292065 | 3300037312 | Bacteria | 1106 |
| 556 | Ga0395898_0005822 | 3300037466 | Bacteria | 13261 |
| 557 | Ga0395905_0261452 | 3300037471 | Bacteria | 1616 |
| 558 | Ga0436364_1107980 | 3300037853 | Bacteria | 1905 |
| 559 | Ga0436364_1265238 | 3300037853 | Bacteria | 2075 |
| 560 | Ga0436364_1284200 | 3300037853 | Bacteria | 100206 |
| 561 | Ga0436364_1512261 | 3300037853 | Bacteria | 7242 |
| 562 | Ga0400484_14496 | 3300038725 | Bacteria | 5886 |
| 563 | Ga0400484_22999 | 3300038725 | Bacteria | 40826 |
| 564 | Ga0400484_30145 | 3300038725 | Bacteria | 11884 |
| 565 | Ga0400484_31956 | 3300038725 | Bacteria | 6692 |
| 566 | Ga0400484_39820 | 3300038725 | Bacteria | 7657 |
| 567 | Ga0400490_03296 | 3300038726 | Bacteria | 55719 |
| 568 | Ga0400490_09621 | 3300038726 | Bacteria | 42351 |
| 569 | Ga0400490_35547 | 3300038726 | Bacteria | 10188 |
| 570 | Ga0400490_55744 | 3300038726 | Bacteria | 86921 |
| 571 | Ga0400491_10338 | 3300038727 | Bacteria | 16726 |
| 572 | Ga0400491_21040 | 3300038727 | Bacteria | 2014 |
| 573 | Ga0400491_26211 | 3300038727 | Bacteria | 1616 |
| 574 | Ga0400485_11431 | 3300038735 | Bacteria | 142174 |
| 575 | Ga0400485_16362 | 3300038735 | Bacteria | 13397 |
| 576 | Ga0400488_31697 | 3300038741 | Bacteria | 2561 |
| 577 | Ga0400488_42417 | 3300038741 | Bacteria | 2419 |
| 578 | Ga0400488_48423 | 3300038741 | Bacteria | 3035 |
| 579 | Ga0400488_48558 | 3300038741 | Bacteria | 11558 |
| 580 | Ga0400488_50866 | 3300038741 | Bacteria | 2816 |
| 581 | Ga0400486_09395 | 3300038742 | Bacteria | 13370 |
| 582 | Ga0400486_10900 | 3300038742 | Bacteria | 16663 |
| 583 | Ga0400486_18012 | 3300038742 | Bacteria | 99609 |
| 584 | Ga0400483_011961 | 3300039062 | Bacteria | 13335 |
| 585 | Ga0400483_016449 | 3300039062 | Bacteria | 3195 |
| 586 | Ga0400483_038707 | 3300039062 | Bacteria | 14414 |
| 587 | Ga0400483_102324 | 3300039062 | Bacteria | 3766 |
| 588 | Ga0400483_105883 | 3300039062 | Bacteria | 2605 |
| 589 | Ga0400483_124202 | 3300039062 | Bacteria | 2070 |
| 590 | Ga0400483_125458 | 3300039062 | Bacteria | 7664 |
| 591 | Ga0400483_141525 | 3300039062 | Bacteria | 6126 |
| 592 | Ga0400483_184941 | 3300039062 | Bacteria | 5618 |
| 593 | Ga0400483_196695 | 3300039062 | Bacteria | 7136 |
| 594 | Ga0400483_200917 | 3300039062 | Bacteria | 14675 |
| 595 | Ga0400483_202172 | 3300039062 | Bacteria | 8691 |
| 596 | Ga0400483_241723 | 3300039062 | Bacteria | 19398 |
| 597 | Ga0400487_03473 | 3300039110 | Bacteria | 4700 |
| 598 | Ga0400487_03760 | 3300039110 | Bacteria | 1899 |
| 599 | Ga0400487_23026 | 3300039110 | Bacteria | 1316 |
| 600 | Ga0400487_29515 | 3300039110 | Bacteria | 15083 |
| 601 | Ga0400487_54961 | 3300039110 | Bacteria | 48611 |
| 602 | Ga0400487_56221 | 3300039110 | Bacteria | 43693 |
| 603 | Ga0400487_58246 | 3300039110 | Bacteria | 34164 |
| 604 | Ga0436365_0449926 | 3300039437 | Bacteria | 19026 |
| 605 | Ga0436365_0704006 | 3300039437 | Unclassified | 2365 |
| 606 | Ga0436365_0779500 | 3300039437 | Bacteria | 1115 |
| 607 | Ga0436365_1112867 | 3300039437 | Bacteria | 50005 |
| 608 | Ga0436365_1225281 | 3300039437 | Bacteria | 1809 |
| 609 | Ga0436365_1457951 | 3300039437 | Bacteria | 43070 |
| 610 | Ga0436365_1621097 | 3300039437 | Bacteria | 6312 |
| 611 | Ga0436360_0023805 | 3300039438 | Unclassified | 1906 |
| 612 | Ga0436360_0091975 | 3300039438 | Bacteria | 6533 |
| 613 | Ga0436360_0166959 | 3300039438 | Bacteria | 1586 |
| 614 | Ga0436360_0264857 | 3300039438 | Bacteria | 1122 |
| 615 | Ga0436360_0598392 | 3300039438 | Unclassified | 908 |
| 616 | Ga0436360_0748890 | 3300039438 | Unclassified | 2445 |
| 617 | Ga0436360_0806145 | 3300039438 | Bacteria | 2724 |
| 618 | Ga0436361_0005955 | 3300039447 | Bacteria | 1618 |
| 619 | Ga0436361_0155125 | 3300039447 | Bacteria | 10559 |
| 620 | Ga0436361_0169046 | 3300039447 | Bacteria | 26611 |
| 621 | Ga0436361_0473752 | 3300039447 | Bacteria | 7583 |
| 622 | Ga0436361_0594389 | 3300039447 | Unclassified | 2427 |
| 623 | Ga0436361_0595657 | 3300039447 | Bacteria | 4720 |
| 624 | Ga0436361_0799034 | 3300039447 | Bacteria | 1127 |
| 625 | Ga0436361_0807183 | 3300039447 | Bacteria | 94852 |
| 626 | Ga0436361_1195567 | 3300039447 | Bacteria | 1470 |
| 627 | Ga0436363_0803061 | 3300039450 | Bacteria | 15961 |
| 628 | Ga0436363_0848729 | 3300039450 | Bacteria | 11384 |
| 629 | Ga0436362_0510036 | 3300039453 | Bacteria | 2205 |
| 630 | Ga0436362_1180629 | 3300039453 | Bacteria | 3254 |
| 631 | Ga0439438_020528 | 3300041405 | Bacteria | 1854 |
| 632 | Ga0439438_027431 | 3300041405 | Bacteria | 1536 |
| 633 | Ga0439453_0000817 | 3300041408 | Bacteria | 3670 |
| 634 | Ga0439461_0002848 | 3300041410 | Bacteria | 2800 |
| 635 | Ga0439466_0000161 | 3300041411 | Bacteria | 26751 |
| 636 | Ga0439466_0008650 | 3300041411 | Bacteria | 3836 |
| 637 | Ga0451791_0673990 | 3300041451 | Bacteria | 1154 |
| 638 | Ga0439431_0016283 | 3300041997 | Bacteria | 1739 |
| 639 | Ga0439433_0020198 | 3300041999 | Bacteria | 1487 |
| 640 | Ga0439432_004728 | 3300042006 | Bacteria | 4954 |
| 641 | Ga0439432_004893 | 3300042006 | Bacteria | 4859 |
| 642 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 643 | Ga0450890_000016 | 3300042127 | Bacteria | 51368 |
| 644 | Ga0450891_003102 | 3300042129 | Bacteria | 1627 |
| 645 | Ga0450892_000519 | 3300042130 | Bacteria | 4437 |
| 646 | Ga0450907_001326 | 3300042146 | Bacteria | 5505 |
| 647 | Ga0439446_0021820 | 3300042156 | Bacteria | 1811 |
| 648 | Ga0451577_0004341 | 3300042876 | Bacteria | 15032 |
| 649 | Ga0451577_0244702 | 3300042876 | Bacteria | 1623 |
| 650 | Ga0451577_0348461 | 3300042876 | Bacteria | 1343 |
| 651 | Ga0453683_0023991 | 3300044673 | Bacteria | 3884 |
| 652 | Ga0466965_0015192 | 3300044683 | Bacteria | 3657 |
| 653 | Ga0453684_0011696 | 3300044712 | Bacteria | 14637 |
| 654 | Ga0453684_0243718 | 3300044712 | Bacteria | 2068 |
| 655 | Ga0466971_0000023 | 3300044719 | Bacteria | 67799 |
| 656 | Ga0466957_0023002 | 3300044842 | Bacteria | 3679 |
| 657 | Ga0451576_0001488 | 3300045051 | Bacteria | 39603 |
| 658 | Ga0451576_0004916 | 3300045051 | Bacteria | 17053 |
| 659 | Ga0451576_0011870 | 3300045051 | Bacteria | 9857 |
| 660 | Ga0451576_0028305 | 3300045051 | Bacteria | 6005 |
| 661 | Ga0451576_0075350 | 3300045051 | Bacteria | 3511 |
| 662 | Ga0466967_0175447 | 3300045976 | Bacteria | 2019 |
| 663 | Ga0495591_000024 | 3300046458 | Bacteria | 191134 |
| 664 | Ga0495591_001549 | 3300046458 | Bacteria | 14060 |
| 665 | Ga0495629_0069106 | 3300046459 | Unclassified | 2465 |
| 666 | Ga0495650_0000377 | 3300046471 | Bacteria | 77543 |
| 667 | Ga0495584_0011509 | 3300046491 | Bacteria | 4532 |
| 668 | Ga0495594_0026368 | 3300046499 | Bacteria | 3126 |
| 669 | Ga0495594_0044293 | 3300046499 | Bacteria | 2441 |
| 670 | Ga0495596_0015033 | 3300046500 | Bacteria | 3251 |
| 671 | Ga0495607_0056632 | 3300046501 | Bacteria | 2250 |
| 672 | Ga0495606_0004074 | 3300046507 | Bacteria | 14872 |
| 673 | Ga0495630_0000171 | 3300046517 | Bacteria | 50810 |
| 674 | Ga0495630_0024658 | 3300046517 | Bacteria | 4445 |
| 675 | Ga0495644_0003920 | 3300046523 | Bacteria | 5854 |
| 676 | Ga0495654_0000061 | 3300046530 | Bacteria | 130939 |
| 677 | Ga0495654_0000163 | 3300046530 | Bacteria | 65805 |
| 678 | Ga0495586_0000157 | 3300046535 | Bacteria | 43987 |
| 679 | Ga0495586_0007676 | 3300046535 | Bacteria | 5750 |
| 680 | Ga0495586_0179240 | 3300046535 | Bacteria | 1198 |
| 681 | Ga0495634_0014669 | 3300046642 | Bacteria | 5642 |
| 682 | Ga0495613_0051685 | 3300046689 | Bacteria | 3028 |
| 683 | Ga0495671_0005382 | 3300046692 | Bacteria | 7502 |
| 684 | Ga0495660_0000158 | 3300046810 | Bacteria | 73369 |
| 685 | Ga0495660_0075408 | 3300046810 | Bacteria | 1779 |
| 686 | Ga0495674_0000893 | 3300047319 | Bacteria | 28550 |
| 687 | Ga0495672_0000029 | 3300047320 | Bacteria | 305231 |
| 688 | Ga0495672_0000054 | 3300047320 | Bacteria | 230777 |
| 689 | Ga0495676_0009765 | 3300047321 | Bacteria | 8718 |
| 690 | Ga0495673_0000092 | 3300047469 | Bacteria | 187963 |
| 691 | Ga0496101_0001295 | 3300048904 | Bacteria | 14951 |
| 692 | Ga0496103_0112862 | 3300048906 | Bacteria | 1727 |
| 693 | Ga0496104_0302815 | 3300048907 | Bacteria | 1511 |
| 694 | Ga0496105_0000139 | 3300048908 | Bacteria | 48427 |
| 695 | Ga0496108_0008867 | 3300048911 | Bacteria | 8150 |
| 696 | Ga0496109_0001851 | 3300048912 | Bacteria | 17521 |
| 697 | Ga0496109_0251261 | 3300048912 | Bacteria | 1665 |
| 698 | Ga0496109_0383401 | 3300048912 | Bacteria | 1328 |
| 699 | Ga0496109_0449158 | 3300048912 | Bacteria | 1218 |
| 700 | Ga0496111_0002711 | 3300048914 | Bacteria | 10754 |
| 701 | Ga0496112_0009493 | 3300048915 | Bacteria | 8771 |
| 702 | Ga0496112_0113156 | 3300048915 | Bacteria | 2685 |
| 703 | Ga0496113_0016580 | 3300048916 | Bacteria | 5092 |
| 704 | Ga0496113_0064403 | 3300048916 | Bacteria | 2772 |
| 705 | Ga0496115_0008240 | 3300048918 | Bacteria | 7702 |
| 706 | Ga0496116_0001816 | 3300048919 | Bacteria | 23120 |
| 707 | Ga0496116_0001830 | 3300048919 | Bacteria | 23023 |
| 708 | Ga0496116_0042783 | 3300048919 | Bacteria | 3092 |
| 709 | Ga0496116_0067103 | 3300048919 | Bacteria | 2292 |
| 710 | Ga0496117_0000350 | 3300048920 | Bacteria | 81439 |
| 711 | Ga0496117_0000895 | 3300048920 | Bacteria | 45877 |
| 712 | Ga0496117_0001186 | 3300048920 | Bacteria | 39159 |
| 713 | Ga0496118_0001869 | 3300048921 | Bacteria | 30129 |
| 714 | Ga0496118_0004714 | 3300048921 | Bacteria | 15966 |
| 715 | Ga0496118_0006706 | 3300048921 | Bacteria | 12544 |
| 716 | Ga0496119_0001006 | 3300048922 | Bacteria | 36126 |
| 717 | Ga0496119_0003121 | 3300048922 | Bacteria | 17465 |
| 718 | Ga0496119_0012337 | 3300048922 | Bacteria | 6949 |
| 719 | Ga0496119_0138580 | 3300048922 | Bacteria | 1316 |
| 720 | Ga0496120_0000090 | 3300048923 | Bacteria | 150551 |
| 721 | Ga0496120_0000616 | 3300048923 | Bacteria | 53766 |
| 722 | Ga0496120_0002035 | 3300048923 | Bacteria | 21933 |
| 723 | Ga0496120_0002689 | 3300048923 | Bacteria | 17465 |
| 724 | Ga0496120_0126219 | 3300048923 | Bacteria | 1316 |
| 725 | Ga0496121_0001624 | 3300048924 | Bacteria | 37256 |
| 726 | Ga0496121_0167199 | 3300048924 | Bacteria | 1601 |
| 727 | Ga0496122_0022775 | 3300048925 | Bacteria | 5556 |
| 728 | Ga0496123_0007402 | 3300048926 | Bacteria | 10360 |
| 729 | Ga0496123_0010305 | 3300048926 | Bacteria | 8291 |
| 730 | Ga0496124_0000452 | 3300048927 | Bacteria | 72015 |
| 731 | Ga0496124_0002279 | 3300048927 | Bacteria | 25388 |
| 732 | Ga0496124_0024644 | 3300048927 | Bacteria | 5464 |
| 733 | Ga0496124_0228876 | 3300048927 | Bacteria | 1391 |
| 734 | Ga0496124_0251727 | 3300048927 | Bacteria | 1306 |
| 735 | Ga0496125_0000147 | 3300048928 | Bacteria | 154731 |
| 736 | Ga0496125_0157301 | 3300048928 | Bacteria | 1550 |
| 737 | Ga0496125_0267196 | 3300048928 | Bacteria | 1068 |
| 738 | Ga0496126_0074114 | 3300048929 | Bacteria | 3023 |
| 739 | Ga0495678_001808 | 3300049459 | Bacteria | 15743 |
| 740 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 741 | Ga0501290_003773 | 3300049513 | Bacteria | 1897 |
| 742 | Ga0501291_006924 | 3300049514 | Bacteria | 1523 |
| 743 | Ga0501295_000044 | 3300049518 | Bacteria | 12479 |
| 744 | Ga0501296_000008 | 3300049519 | Bacteria | 24240 |
| 745 | Ga0501297_000240 | 3300049520 | Bacteria | 5608 |
| 746 | Ga0501298_000041 | 3300049521 | Bacteria | 13233 |
| 747 | Ga0501299_000082 | 3300049522 | Bacteria | 10607 |
| 748 | Ga0501031_0003827 | 3300049568 | Bacteria | 9681 |
| 749 | Ga0501031_0027787 | 3300049568 | Bacteria | 3688 |
| 750 | Ga0501031_0177707 | 3300049568 | Bacteria | 1391 |
| 751 | Ga0501032_0001360 | 3300049569 | Bacteria | 19452 |
| 752 | Ga0501032_0018401 | 3300049569 | Bacteria | 4896 |
| 753 | Ga0501032_0137672 | 3300049569 | Bacteria | 1609 |
| 754 | Ga0501032_0217104 | 3300049569 | Bacteria | 1245 |
| 755 | Ga0501032_0266215 | 3300049569 | Bacteria | 1111 |
| 756 | Ga0501033_0000127 | 3300049570 | Bacteria | 73521 |
| 757 | Ga0501033_0020015 | 3300049570 | Bacteria | 5058 |
| 758 | Ga0501033_0044104 | 3300049570 | Bacteria | 3320 |
| 759 | Ga0501033_0248328 | 3300049570 | Bacteria | 1262 |
| 760 | Ga0501033_0290849 | 3300049570 | Bacteria | 1152 |
| 761 | Ga0501034_0000078 | 3300049571 | Bacteria | 171437 |
| 762 | Ga0501034_0001344 | 3300049571 | Bacteria | 33205 |
| 763 | Ga0501034_0006529 | 3300049571 | Bacteria | 12537 |
| 764 | Ga0501034_0049978 | 3300049571 | Bacteria | 4218 |
| 765 | Ga0501034_0108846 | 3300049571 | Bacteria | 2762 |
| 766 | Ga0501034_0142665 | 3300049571 | Bacteria | 2374 |
| 767 | Ga0501034_0269718 | 3300049571 | Bacteria | 1643 |
| 768 | Ga0501036_0029587 | 3300049572 | Bacteria | 4626 |
| 769 | Ga0501036_0132707 | 3300049572 | Bacteria | 2102 |
| 770 | Ga0501036_0196001 | 3300049572 | Bacteria | 1699 |
| 771 | Ga0501036_0370093 | 3300049572 | Bacteria | 1196 |
| 772 | Ga0501037_0000020 | 3300049573 | Bacteria | 155468 |
| 773 | Ga0501037_0019718 | 3300049573 | Bacteria | 4974 |
| 774 | Ga0501037_0069512 | 3300049573 | Bacteria | 2563 |
| 775 | Ga0501038_0009853 | 3300049574 | Bacteria | 8745 |
| 776 | Ga0501038_0154538 | 3300049574 | Bacteria | 1869 |
| 777 | Ga0501038_0173209 | 3300049574 | Bacteria | 1745 |
| 778 | Ga0501038_0303623 | 3300049574 | Bacteria | 1252 |
| 779 | Ga0501039_0264449 | 3300049575 | Bacteria | 1352 |
| 780 | Ga0501042_0039154 | 3300049578 | Bacteria | 3368 |
| 781 | Ga0501042_0235038 | 3300049578 | Bacteria | 1322 |
| 782 | Ga0501043_0000156 | 3300049579 | Bacteria | 62295 |
| 783 | Ga0501043_0001277 | 3300049579 | Bacteria | 22097 |
| 784 | Ga0501043_0020811 | 3300049579 | Bacteria | 5145 |
| 785 | Ga0501043_0094529 | 3300049579 | Bacteria | 2350 |
| 786 | Ga0501043_0138992 | 3300049579 | Bacteria | 1903 |
| 787 | Ga0501046_0000216 | 3300049580 | Bacteria | 60174 |
| 788 | Ga0501046_0002988 | 3300049580 | Bacteria | 15633 |
| 789 | Ga0501046_0009370 | 3300049580 | Bacteria | 8467 |
| 790 | Ga0501046_0016796 | 3300049580 | Bacteria | 6119 |
| 791 | Ga0501046_0019992 | 3300049580 | Bacteria | 5544 |
| 792 | Ga0501046_0035288 | 3300049580 | Bacteria | 4031 |
| 793 | Ga0501046_0041590 | 3300049580 | Bacteria | 3667 |
| 794 | Ga0501046_0054137 | 3300049580 | Bacteria | 3158 |
| 795 | Ga0501047_0002610 | 3300049581 | Bacteria | 17160 |
| 796 | Ga0501047_0008802 | 3300049581 | Bacteria | 9522 |
| 797 | Ga0501047_0009498 | 3300049581 | Bacteria | 9190 |
| 798 | Ga0501047_0025015 | 3300049581 | Bacteria | 5735 |
| 799 | Ga0501047_0080459 | 3300049581 | Bacteria | 3131 |
| 800 | Ga0501047_0402137 | 3300049581 | Bacteria | 1202 |
| 801 | Ga0501048_0000706 | 3300049582 | Bacteria | 24366 |
| 802 | Ga0501048_0070920 | 3300049582 | Bacteria | 2460 |
| 803 | Ga0501048_0130577 | 3300049582 | Bacteria | 1776 |
| 804 | Ga0501068_0002884 | 3300049584 | Bacteria | 9147 |
| 805 | Ga0501068_0044839 | 3300049584 | Bacteria | 2664 |
| 806 | Ga0501068_0051275 | 3300049584 | Bacteria | 2496 |
| 807 | Ga0501068_0088441 | 3300049584 | Bacteria | 1909 |
| 808 | Ga0501068_0140346 | 3300049584 | Bacteria | 1515 |
| 809 | Ga0501069_0004113 | 3300049585 | Bacteria | 7507 |
| 810 | Ga0501069_0020529 | 3300049585 | Bacteria | 3580 |
| 811 | Ga0501070_0001390 | 3300049586 | Bacteria | 21673 |
| 812 | Ga0501070_0011429 | 3300049586 | Bacteria | 7500 |
| 813 | Ga0501070_0091041 | 3300049586 | Bacteria | 2524 |
| 814 | Ga0501070_0187498 | 3300049586 | Bacteria | 1701 |
| 815 | Ga0501071_0001077 | 3300049587 | Bacteria | 15145 |
| 816 | Ga0501071_0047816 | 3300049587 | Bacteria | 3074 |
| 817 | Ga0501072_0040812 | 3300049588 | Bacteria | 3644 |
| 818 | Ga0501072_0041212 | 3300049588 | Bacteria | 3626 |
| 819 | Ga0501072_0079584 | 3300049588 | Bacteria | 2595 |
| 820 | Ga0501073_0009536 | 3300049589 | Bacteria | 7163 |
| 821 | Ga0501073_0026271 | 3300049589 | Bacteria | 4171 |
| 822 | Ga0501073_0058326 | 3300049589 | Bacteria | 2698 |
| 823 | Ga0501074_0003495 | 3300049590 | Bacteria | 11156 |
| 824 | Ga0501074_0101507 | 3300049590 | Bacteria | 2059 |
| 825 | Ga0501075_0034269 | 3300049591 | Bacteria | 3780 |
| 826 | Ga0501075_0121054 | 3300049591 | Bacteria | 1992 |
| 827 | Ga0501076_0169192 | 3300049592 | Bacteria | 1781 |
| 828 | Ga0501076_0181924 | 3300049592 | Bacteria | 1714 |
| 829 | Ga0501076_0408712 | 3300049592 | Bacteria | 1116 |
| 830 | Ga0501077_0012120 | 3300049593 | Bacteria | 5397 |
| 831 | Ga0501077_0118291 | 3300049593 | Bacteria | 1679 |
| 832 | Ga0501202_000045 | 3300049652 | Bacteria | 12529 |
| 833 | Ga0501223_002816 | 3300049663 | Bacteria | 3815 |
| 834 | Ga0501227_005037 | 3300049665 | Bacteria | 2837 |
| 835 | Ga0501227_010789 | 3300049665 | Bacteria | 1983 |
| 836 | Ga0501233_000379 | 3300049668 | Bacteria | 7041 |
| 837 | Ga0501235_004776 | 3300049669 | Bacteria | 2934 |
| 838 | Ga0501236_003327 | 3300049670 | Bacteria | 1867 |
| 839 | Ga0501239_003429 | 3300049672 | Bacteria | 1506 |
| 840 | Ga0501243_003633 | 3300049675 | Bacteria | 2298 |
| 841 | Ga0501253_002498 | 3300049683 | Bacteria | 2078 |
| 842 | Ga0501256_000076 | 3300049685 | Bacteria | 5126 |
| 843 | Ga0501261_000321 | 3300049690 | Bacteria | 6488 |
| 844 | Ga0501221_000807 | 3300049704 | Bacteria | 5086 |
| 845 | Ga0501225_0000560 | 3300049705 | Bacteria | 11628 |
| 846 | Ga0501245_018659 | 3300049708 | Bacteria | 1068 |
| 847 | Ga0501079_0141297 | 3300049741 | Bacteria | 1875 |
| 848 | Ga0501080_0020766 | 3300049742 | Bacteria | 6080 |
| 849 | Ga0501080_0044560 | 3300049742 | Bacteria | 4130 |
| 850 | Ga0501080_0086801 | 3300049742 | Bacteria | 2908 |
| 851 | Ga0501080_0152160 | 3300049742 | Bacteria | 2138 |
| 852 | Ga0501080_0348140 | 3300049742 | Bacteria | 1338 |
| 853 | Ga0501081_0123165 | 3300049743 | Bacteria | 1848 |
| 854 | Ga0501083_0000094 | 3300049744 | Bacteria | 60217 |
| 855 | Ga0501083_0049514 | 3300049744 | Bacteria | 2831 |
| 856 | Ga0501264_002502 | 3300049761 | Bacteria | 1708 |
| 857 | Ga0501268_006910 | 3300049765 | Bacteria | 1680 |
| 858 | Ga0501269_001756 | 3300049766 | Bacteria | 2761 |
| 859 | Ga0501274_000796 | 3300049771 | Bacteria | 2321 |
| 860 | Ga0501278_000954 | 3300049774 | Bacteria | 2095 |
| 861 | Ga0501279_000829 | 3300049775 | Bacteria | 4068 |
| 862 | Ga0501282_003159 | 3300049778 | Bacteria | 1780 |
| 863 | Ga0501283_000910 | 3300049779 | Bacteria | 3922 |
| 864 | Ga0501035_0000002 | 3300049822 | Bacteria | 585447 |
| 865 | Ga0501035_0000932 | 3300049822 | Bacteria | 30968 |
| 866 | Ga0501035_0016573 | 3300049822 | Bacteria | 6795 |
| 867 | Ga0501035_0026719 | 3300049822 | Bacteria | 5280 |
| 868 | Ga0501035_0031663 | 3300049822 | Bacteria | 4817 |
| 869 | Ga0501035_0064397 | 3300049822 | Bacteria | 3258 |
| 870 | Ga0501035_0161104 | 3300049822 | Bacteria | 1942 |
| 871 | Ga0501035_0205991 | 3300049822 | Bacteria | 1685 |
| 872 | Ga0501035_0232430 | 3300049822 | Bacteria | 1571 |
| 873 | Ga0501044_0000095 | 3300049823 | Bacteria | 109588 |
| 874 | Ga0501044_0000371 | 3300049823 | Bacteria | 56211 |
| 875 | Ga0501044_0008189 | 3300049823 | Bacteria | 11471 |
| 876 | Ga0501044_0110147 | 3300049823 | Bacteria | 2762 |
| 877 | Ga0501044_0333158 | 3300049823 | Bacteria | 1440 |
| 878 | Ga0501045_0162577 | 3300049824 | Bacteria | 1662 |
| 879 | Ga0501045_0266921 | 3300049824 | Bacteria | 1274 |
| 880 | Ga0501204_000515 | 3300049850 | Bacteria | 3360 |
| 881 | Ga0501226_005391 | 3300049853 | Bacteria | 1460 |
| 882 | nmdc:mga03683_2929_c1 | 3300050489 | Bacteria | 5390 |
| 883 | nmdc:mga00v17_4279_c1 | 3300050491 | Bacteria | 7412 |
| 884 | nmdc:mga0k408_422_c1 | 3300050493 | Bacteria | 23140 |
| 885 | nmdc:mga0k408_519_c1 | 3300050493 | Bacteria | 21203 |
| 886 | nmdc:mga07m45_22744_c1 | 3300050496 | Unclassified | 3424 |
| 887 | nmdc:mga05p37_342413_c1 | 3300050507 | Bacteria | 1763 |
| 888 | nmdc:mga09592_1330_c1 | 3300050508 | Bacteria | 19792 |
| 889 | nmdc:mga09592_333454_c1 | 3300050508 | Bacteria | 1313 |
| 890 | nmdc:mga0qj67_243101_c1 | 3300050509 | Bacteria | 1460 |
| 891 | nmdc:mga0qj67_35397_c1 | 3300050509 | Bacteria | 3903 |
| 892 | nmdc:mga06r32_491449_c1 | 3300050510 | Bacteria | 1205 |
| 893 | nmdc:mga06r32_61343_c1 | 3300050510 | Bacteria | 3132 |
| 894 | nmdc:mga08y16_14483_c1 | 3300050511 | Bacteria | 8296 |
| 895 | nmdc:mga08y16_291697_c1 | 3300050511 | Bacteria | 1682 |
| 896 | nmdc:mga0n895_34642_c1 | 3300050512 | Bacteria | 4862 |
| 897 | nmdc:mga0n895_71872_c1 | 3300050512 | Bacteria | 3431 |
| 898 | nmdc:mga08x19_250391_c1 | 3300050514 | Bacteria | 1223 |
| 899 | nmdc:mga0a205_16924_c1 | 3300050515 | Bacteria | 6826 |
| 900 | nmdc:mga0a205_216833_c1 | 3300050515 | Bacteria | 1800 |
| 901 | nmdc:mga0a205_314959_c1 | 3300050515 | Unclassified | 1436 |
| 902 | nmdc:mga0a205_322316_c1 | 3300050515 | Bacteria | 1416 |
| 903 | nmdc:mga0sz30_77771_c1 | 3300050516 | Bacteria | 1433 |
| 904 | Ga0500555_000022 | 3300053103 | Bacteria | 157445 |
| 905 | Ga0500555_000378 | 3300053103 | Bacteria | 18755 |
| 906 | Ga0500555_028150 | 3300053103 | Bacteria | 1602 |
| 907 | Ga0500556_0000453 | 3300053104 | Bacteria | 29167 |
| 908 | Ga0500556_0008287 | 3300053104 | Bacteria | 2995 |
| 909 | Ga0500621_000006 | 3300053126 | Bacteria | 245480 |
| 910 | Ga0500642_0003869 | 3300053130 | Bacteria | 4601 |
| 911 | Ga0500559_0000600 | 3300053136 | Bacteria | 24530 |
| 912 | Ga0500616_0002666 | 3300053153 | Bacteria | 14516 |
| 913 | Ga0500645_075198 | 3300053730 | Unclassified | 967 |
| 914 | Ga0501084_0121882 | 3300054114 | Bacteria | 2192 |
| 915 | Ga0501084_0130132 | 3300054114 | Bacteria | 2119 |
| 916 | Ga0590071_006726 | 3300059421 | Bacteria | 2728 |
| 917 | Ga0501082_0006480 | 3300060353 | Bacteria | 10150 |
| 918 | Ga0501082_0014004 | 3300060353 | Bacteria | 6897 |
| 919 | Ga0466962_0000993 | 3300061719 | Bacteria | 12947 |
| 920 | 2511381753 | 2511231025 | Bacteria | 5324661 |
| 921 | 2511437722 | 2511231035 | Bacteria | 5341610 |
| 922 | 2512034398 | 2511231221 | Bacteria | 6846400 |
| 923 | 2566035587 | 2565956521 | Bacteria | 4468993 |
| 924 | 2599105182 | 2597490356 | Bacteria | 7030811 |
| 925 | 2599928300 | 2599185299 | Bacteria | 4854625 |
| 926 | 2608670362 | 2608642108 | Bacteria | 4104624 |
| 927 | 2649121633 | 2648501241 | Bacteria | 5312320 |
| 928 | 2650900043 | 2648501693 | Bacteria | 5069560 |
| 929 | 2652973988 | 2651869818 | Bacteria | 5864031 |
| 930 | 2686354282 | 2684622997 | Bacteria | 4624240 |
| 931 | 2688068131 | 2687453257 | Bacteria | 6784659 |
| 932 | 2688394609 | 2687453341 | Bacteria | 6534136 |
| 933 | 2738715438 | 2738541276 | Bacteria | 4690596 |
| 934 | 2787507541 | 2786546548 | Bacteria | 4745694 |
| 935 | 2791924396 | 2791354903 | Bacteria | 4937680 |
| 936 | 2809124429 | 2808606414 | Bacteria | 4917181 |
| 937 | 2821451006 | 2821443989 | Bacteria | 7658172 |
| 938 | 2836162118 | 2836160341 | Unclassified | 5867367 |
| 939 | 2844532437 | 2844528606 | Bacteria | 4733806 |
| 940 | 2844538642 | 2844533157 | Bacteria | 7517899 |
| 941 | 2846955139 | 2846952575 | Bacteria | 6587527 |
| 942 | 2847801132 | 2847797336 | Bacteria | 5176640 |
| 943 | 2848858567 | 2848858292 | Bacteria | 7391279 |
| 944 | 2854605416 | 2854601825 | Bacteria | 4797592 |
| 945 | 2865018446 | 2865014394 | Bacteria | 4764573 |
| 946 | 2876605579 | 2876601092 | Bacteria | 5114497 |
| 947 | 2881612711 | 2881609920 | Bacteria | 4405319 |
| 948 | 2888376944 | 2888373701 | Bacteria | 5098052 |
| 949 | 2889420471 | 2889415604 | Bacteria | 8048700 |
| 950 | 2897803897 | 2897803580 | Bacteria | 7000062 |
| 951 | 2908673310 | 2908669403 | Bacteria | 5740494 |
| 952 | 2919496701 | 2919493220 | Bacteria | 4598500 |
| 953 | 2919546860 | 2919543075 | Bacteria | 4728703 |
| 954 | 2920113223 | 2920107658 | Bacteria | 10042636 |
| 955 | 2923529513 | 2923525760 | Bacteria | 4472324 |
| 956 | 2939605306 | 2939602548 | Bacteria | 4950493 |
| 957 | 2939674504 | 2939669807 | Bacteria | 5028511 |
| 958 | 2945954165 | 2945951305 | Bacteria | 4918162 |
| 959 | 2978976647 | 2978975091 | Bacteria | 4704313 |
| 960 | 2984497959 | 2984494565 | Bacteria | 5000175 |
| 961 | 2990264525 | 2990261002 | Bacteria | 4919493 |
| 962 | 8004593190 | 8004592986 | Bacteria | 5122074 |
| 963 | 8015396936 | 8015394850 | Bacteria | 5064660 |
| 964 | 8019502315 | 8019499862 | Bacteria | 5169538 |
| 965 | 8054004125 | 8054002106 | Bacteria | 7987183 |
| 966 | 8055093650 | 8055092621 | Bacteria | 4873875 |
| 967 | Ga0070704_100077656 | |||
| 968 | JGI24739J22299_10000196 | |||
| 969 | JGI24739J22299_10053845 | |||
| 970 | JGI24744J21845_10002463 | |||
| 971 | JGI25162J39368_1002234 | |||
| 972 | JGI25159J45721_1020372 | |||
| 973 | JGI25151J46595_10000428 | |||
| 974 | JGI25151J46595_10000467 | |||
| 975 | rootH2_10009230 | |||
| 976 | rootH2_10106945 | |||
| 977 | rootL2_10282228 | |||
| 978 | rootH1_10055647 | |||
| 979 | JGI25160J50197_1011072 | |||
| 980 | JGI25404J52841_10007605 | |||
| 981 | Ga0058692_1000321 | |||
| 982 | Ga0058692_1000737 | |||
| 983 | Ga0058692_1000823 | |||
| 984 | Ga0058692_1006137 | |||
| 985 | Ga0058692_1006713 | |||
| 986 | Ga0065704_10008623 | |||
| 987 | Ga0065704_10187406 | |||
| 988 | Ga0065712_10159252 | |||
| 989 | Ga0065715_10177365 | |||
| 990 | Ga0065707_10017383 | |||
| 991 | Ga0070658_10002816 | |||
| 992 | Ga0070658_10008528 | |||
| 993 | Ga0070658_10049246 | |||
| 994 | Ga0070658_10056074 | |||
| 995 | Ga0070676_10045003 | |||
| 996 | Ga0070690_100000072 | |||
| 997 | Ga0070690_100000083 | |||
| 998 | Ga0070690_100068722 | |||
| 999 | Ga0070690_100111421 | |||
| 1000 | Ga0070670_100001144 | |||
| 1001 | Ga0070670_100007453 | |||
| 1002 | Ga0070670_100170660 | |||
| 1003 | Ga0068869_100001752 | |||
| 1004 | Ga0068869_100088281 | |||
| 1005 | Ga0070666_10006936 | |||
| 1006 | Ga0070666_10020030 | |||
| 1007 | Ga0070680_100033369 | |||
| 1008 | Ga0070680_100088535 | |||
| 1009 | Ga0070680_100247826 | |||
| 1010 | Ga0068868_100009540 | |||
| 1011 | Ga0070660_100120010 | |||
| 1012 | Ga0070689_100000039 | |||
| 1013 | Ga0070689_100016476 | |||
| 1014 | Ga0070689_100149209 | |||
| 1015 | Ga0070689_100205513 | |||
| 1016 | Ga0070691_10042325 | |||
| 1017 | Ga0070687_100040253 | |||
| 1018 | Ga0070668_100004124 | |||
| 1019 | Ga0070668_100004559 | |||
| 1020 | Ga0070669_100012637 | |||
| 1021 | Ga0070675_100014013 | |||
| 1022 | Ga0070675_100228339 | |||
| 1023 | Ga0070671_100002526 | |||
| 1024 | Ga0070671_100011089 | |||
| 1025 | Ga0070673_100008936 | |||
| 1026 | Ga0070673_100030712 | |||
| 1027 | Ga0070688_100000087 | |||
| 1028 | Ga0070688_100040974 | |||
| 1029 | Ga0070667_100008810 | |||
| 1030 | Ga0070713_100011838 | |||
| 1031 | Ga0070710_10055948 | |||
| 1032 | Ga0070701_10000043 | |||
| 1033 | Ga0070701_10001604 | |||
| 1034 | Ga0070711_100218808 | |||
| 1035 | Ga0070705_100082127 | |||
| 1036 | Ga0070700_100000798 | |||
| 1037 | Ga0070700_100016511 | |||
| 1038 | Ga0070694_100019785 | |||
| 1039 | Ga0070694_100111983 | |||
| 1040 | Ga0070708_100448779 | |||
| 1041 | Ga0070662_100063266 | |||
| 1042 | Ga0070662_100102984 | |||
| 1043 | Ga0070681_10009249 | |||
| 1044 | Ga0068867_100000100 | |||
| 1045 | Ga0068867_100017689 | |||
| 1046 | Ga0068867_100031719 | |||
| 1047 | Ga0070685_10000211 | |||
| 1048 | Ga0070685_10228166 | |||
| 1049 | Ga0070706_100000543 | |||
| 1050 | Ga0070706_100001219 | |||
| 1051 | Ga0070706_100003351 | |||
| 1052 | Ga0070706_100090718 | |||
| 1053 | Ga0070706_100424697 | |||
| 1054 | Ga0070707_100000266 | |||
| 1055 | Ga0070707_100087471 | |||
| 1056 | Ga0070707_100116013 | |||
| 1057 | Ga0070707_100151945 | |||
| 1058 | Ga0070698_100001369 | |||
| 1059 | Ga0070698_100009691 | |||
| 1060 | Ga0070698_100035064 | |||
| 1061 | Ga0070698_100063704 | |||
| 1062 | Ga0070698_100125902 | |||
| 1063 | Ga0070698_100151432 | |||
| 1064 | Ga0070698_100234152 | |||
| 1065 | Ga0070699_100001124 | |||
| 1066 | Ga0070699_100002417 | |||
| 1067 | Ga0070699_100009142 | |||
| 1068 | Ga0070684_100231026 | |||
| 1069 | Ga0070697_100001376 | |||
| 1070 | Ga0070697_100005432 | |||
| 1071 | Ga0070697_100007588 | |||
| 1072 | Ga0070697_100097252 | |||
| 1073 | Ga0068853_100000003 | |||
| 1074 | Ga0068853_100079807 | |||
| 1075 | Ga0070686_100000802 | |||
| 1076 | Ga0070686_100011454 | |||
| 1077 | Ga0070686_100031552 | |||
| 1078 | Ga0070686_100032925 | |||
| 1079 | Ga0070695_100015417 | |||
| 1080 | Ga0070693_100056394 | |||
| 1081 | Ga0070665_100047552 | |||
| 1082 | Ga0070665_100186352 | |||
| 1083 | Ga0070704_100000053 | |||
| 1084 | Ga0070704_100012505 | |||
| 1085 | Ga0070704_100188669 | |||
| 1086 | Ga0068855_100004254 | |||
| 1087 | Ga0068855_100270877 | |||
| 1088 | Ga0070664_100009295 | |||
| 1089 | Ga0070664_100156022 | |||
| 1090 | Ga0068856_100000079 | |||
| 1091 | Ga0068856_100169177 | |||
| 1092 | Ga0070702_100000787 | |||
| 1093 | Ga0068859_100000257 | |||
| 1094 | Ga0068859_100005776 | |||
| 1095 | Ga0068859_100009362 | |||
| 1096 | Ga0068859_100106009 | |||
| 1097 | Ga0068866_10003043 | |||
| 1098 | Ga0068861_100000337 | |||
| 1099 | Ga0068861_100051239 | |||
| 1100 | Ga0068863_100010338 | |||
| 1101 | Ga0068863_100029359 | |||
| 1102 | Ga0068858_100018973 | |||
| 1103 | Ga0068858_100024309 | |||
| 1104 | Ga0068858_100204480 | |||
| 1105 | Ga0068858_100428084 | |||
| 1106 | Ga0068860_100001778 | |||
| 1107 | Ga0068860_100109160 | |||
| 1108 | Ga0068860_100501931 | |||
| 1109 | Ga0068862_100100950 | |||
| 1110 | Ga0068862_100157066 | |||
| 1111 | Ga0068862_100239540 | |||
| 1112 | Ga0068862_100412442 | |||
| 1113 | Ga0081455_10015579 | |||
| 1114 | Ga0081455_10071713 | |||
| 1115 | Ga0081455_10094308 | |||
| 1116 | Ga0081455_10162916 | |||
| 1117 | Ga0081540_1026720 | |||
| 1118 | Ga0081540_1052893 | |||
| 1119 | Ga0075363_100005177 | |||
| 1120 | Ga0075364_10012273 | |||
| 1121 | Ga0075364_10027091 | |||
| 1122 | Ga0070716_100114370 | |||
| 1123 | Ga0070712_100182649 | |||
| 1124 | Ga0070712_100271808 | |||
| 1125 | Ga0075362_10000420 | |||
| 1126 | Ga0075369_10149521 | |||
| 1127 | Ga0075366_10033316 | |||
| 1128 | Ga0075366_10034291 | |||
| 1129 | Ga0097621_100000938 | |||
| 1130 | Ga0097621_100006163 | |||
| 1131 | Ga0097621_100034170 | |||
| 1132 | Ga0097621_100154109 | |||
| 1133 | Ga0075370_10023550 | |||
| 1134 | Ga0068871_100004323 | |||
| 1135 | Ga0068871_100006362 | |||
| 1136 | Ga0068871_100142906 | |||
| 1137 | Ga0068871_100146059 | |||
| 1138 | Ga0075428_100001470 | |||
| 1139 | Ga0075428_100070032 | |||
| 1140 | Ga0075428_100127495 | |||
| 1141 | Ga0075428_100201590 | |||
| 1142 | Ga0075428_100473838 | |||
| 1143 | Ga0075430_100004102 | |||
| 1144 | Ga0075430_100069410 | |||
| 1145 | Ga0075431_100025254 | |||
| 1146 | Ga0075431_100062828 | |||
| 1147 | Ga0075431_100085835 | |||
| 1148 | Ga0075431_100150561 | |||
| 1149 | Ga0075431_100179523 | |||
| 1150 | Ga0075433_10007874 | |||
| 1151 | Ga0075433_10091104 | |||
| 1152 | Ga0075433_10319739 | |||
| 1153 | Ga0075434_100058694 | |||
| 1154 | Ga0075434_100064083 | |||
| 1155 | Ga0075434_100587481 | |||
| 1156 | Ga0075429_100000196 | |||
| 1157 | Ga0075429_100006813 | |||
| 1158 | Ga0075429_100481327 | |||
| 1159 | Ga0068865_100014361 | |||
| 1160 | Ga0068865_100096128 | |||
| 1161 | Ga0097620_100000257 | |||
| 1162 | Ga0097620_100005776 | |||
| 1163 | Ga0097620_100009362 | |||
| 1164 | Ga0097620_100106016 | |||
| 1165 | Ga0099794_10000046 | |||
| 1166 | Ga0105251_10000763 | |||
| 1167 | Ga0105251_10008784 | |||
| 1168 | Ga0105251_10025124 | |||
| 1169 | Ga0105251_10025830 | |||
| 1170 | Ga0105244_10004443 | |||
| 1171 | Ga0105244_10005668 | |||
| 1172 | Ga0105244_10100578 | |||
| 1173 | Ga0105240_10005451 | |||
| 1174 | Ga0105240_10018190 | |||
| 1175 | Ga0111539_10039279 | |||
| 1176 | Ga0111539_10185370 | |||
| 1177 | Ga0105245_10000968 | |||
| 1178 | Ga0114129_10003886 | |||
| 1179 | Ga0105243_10000166 | |||
| 1180 | Ga0105241_10000012 | |||
| 1181 | Ga0105242_10002223 | |||
| 1182 | Ga0105242_10045477 | |||
| 1183 | Ga0105242_10148466 | |||
| 1184 | Ga0105248_10000428 | |||
| 1185 | Ga0105248_10067003 | |||
| 1186 | Ga0105248_10398683 | |||
| 1187 | Ga0105237_10016911 | |||
| 1188 | Ga0105237_10033518 | |||
| 1189 | Ga0105238_10295058 | |||
| 1190 | Ga0105249_10015794 | |||
| 1191 | Ga0099796_10035969 | |||
| 1192 | Ga0105246_10016359 | |||
| 1193 | Ga0105246_10062853 | |||
| 1194 | Ga0105246_10073241 | |||
| 1195 | Ga0157373_10001791 | |||
| 1196 | Ga0157373_10002278 | |||
| 1197 | Ga0157371_10003028 | |||
| 1198 | Ga0157370_10002510 | |||
| 1199 | Ga0157370_10005749 | |||
| 1200 | Ga0157369_10042060 | |||
| 1201 | Ga0157369_10340287 | |||
| 1202 | Ga0157374_10009685 | |||
| 1203 | Ga0157374_10050077 | |||
| 1204 | Ga0157374_10176258 | |||
| 1205 | Ga0157378_10001738 | |||
| 1206 | Ga0157378_10033775 | |||
| 1207 | Ga0157378_10382510 | |||
| 1208 | Ga0163162_10091992 | |||
| 1209 | Ga0163162_10097271 | |||
| 1210 | Ga0163162_10377084 | |||
| 1211 | Ga0157372_10015433 | |||
| 1212 | Ga0157375_10000284 | |||
| 1213 | Ga0157375_10046506 | |||
| 1214 | Ga0157375_10154310 | |||
| 1215 | Ga0157375_10336765 | |||
| 1216 | Ga0163163_10001353 | |||
| 1217 | Ga0163163_10259275 | |||
| 1218 | Ga0157380_10002830 | |||
| 1219 | Ga0157380_10021950 | |||
| 1220 | Ga0157380_10050355 | |||
| 1221 | Ga0182008_10003015 | |||
| 1222 | Ga0157379_10041434 | |||
| 1223 | Ga0157376_10028435 | |||
| 1224 | Ga0157376_10165961 | |||
| 1225 | Ga0157376_10463625 | |||
| 1226 | Ga0182006_1004923 | |||
| 1227 | Ga0182005_1001737 | |||
| 1228 | Ga0163161_10013454 | |||
| 1229 | Ga0213872_10000168 | |||
| 1230 | Ga0213872_10010883 | |||
| 1231 | Ga0213872_10012875 | |||
| 1232 | Ga0213872_10046718 | |||
| 1233 | Ga0213872_10094138 | |||
| 1234 | Ga0213876_10003351 | |||
| 1235 | Ga0213876_10003657 | |||
| 1236 | Ga0213876_10007869 | |||
| 1237 | Ga0213876_10008273 | |||
| 1238 | Ga0213876_10011138 | |||
| 1239 | Ga0213871_10022332 | |||
| 1240 | Ga0209760_104198 | |||
| 1241 | Ga0209437_100063 | |||
| 1242 | Ga0209130_1000490 | |||
| 1243 | Ga0209025_1000138 | |||
| 1244 | Ga0209758_1014951 | |||
| 1245 | Ga0207426_1000281 | |||
| 1246 | Ga0207697_10001318 | |||
| 1247 | Ga0207696_1000387 | |||
| 1248 | Ga0207696_1056604 | |||
| 1249 | Ga0207655_1000024 | |||
| 1250 | Ga0207655_1001132 | |||
| 1251 | Ga0207655_1004658 | |||
| 1252 | Ga0207655_1011411 | |||
| 1253 | Ga0207655_1020279 | |||
| 1254 | Ga0207713_1000007 | |||
| 1255 | Ga0207713_1000054 | |||
| 1256 | Ga0207713_1008116 | |||
| 1257 | Ga0207713_1022317 | |||
| 1258 | Ga0207682_10013720 | |||
| 1259 | Ga0207692_10015276 | |||
| 1260 | Ga0207642_10003168 | |||
| 1261 | Ga0207688_10002677 | |||
| 1262 | Ga0207680_10071252 | |||
| 1263 | Ga0207645_10047281 | |||
| 1264 | Ga0207705_10001931 | |||
| 1265 | Ga0207705_10074788 | |||
| 1266 | Ga0207705_10222627 | |||
| 1267 | Ga0207684_10001744 | |||
| 1268 | Ga0207684_10002729 | |||
| 1269 | Ga0207684_10006584 | |||
| 1270 | Ga0207684_10060966 | |||
| 1271 | Ga0207654_10000015 | |||
| 1272 | Ga0207707_10007189 | |||
| 1273 | Ga0207695_10043992 | |||
| 1274 | Ga0207695_10045908 | |||
| 1275 | Ga0207693_10179914 | |||
| 1276 | Ga0207693_10223788 | |||
| 1277 | Ga0207663_10000627 | |||
| 1278 | Ga0207660_10026020 | |||
| 1279 | Ga0207662_10056548 | |||
| 1280 | Ga0207649_10003506 | |||
| 1281 | Ga0207646_10002204 | |||
| 1282 | Ga0207646_10014296 | |||
| 1283 | Ga0207646_10075355 | |||
| 1284 | Ga0207646_10177824 | |||
| 1285 | Ga0207646_10248545 | |||
| 1286 | Ga0207646_10272099 | |||
| 1287 | Ga0207681_10107865 | |||
| 1288 | Ga0207650_10021941 | |||
| 1289 | Ga0207650_10045942 | |||
| 1290 | Ga0207650_10087895 | |||
| 1291 | Ga0207687_10005298 | |||
| 1292 | Ga0207687_10033247 | |||
| 1293 | Ga0207687_10044175 | |||
| 1294 | Ga0207700_10009145 | |||
| 1295 | Ga0207700_10135487 | |||
| 1296 | Ga0207644_10004324 | |||
| 1297 | Ga0207706_10102448 | |||
| 1298 | Ga0207706_10109708 | |||
| 1299 | Ga0207686_10004503 | |||
| 1300 | Ga0207686_10010907 | |||
| 1301 | Ga0207686_10011766 | |||
| 1302 | Ga0207709_10000095 | |||
| 1303 | Ga0207709_10020921 | |||
| 1304 | Ga0207670_10000035 | |||
| 1305 | Ga0207670_10008675 | |||
| 1306 | Ga0207670_10144099 | |||
| 1307 | Ga0207670_10314286 | |||
| 1308 | Ga0207669_10023783 | |||
| 1309 | Ga0207669_10097439 | |||
| 1310 | Ga0207704_10066275 | |||
| 1311 | Ga0207704_10148168 | |||
| 1312 | Ga0207665_10217079 | |||
| 1313 | Ga0207691_10026709 | |||
| 1314 | Ga0207711_10003450 | |||
| 1315 | Ga0207711_10075951 | |||
| 1316 | Ga0207689_10000197 | |||
| 1317 | Ga0207689_10098716 | |||
| 1318 | Ga0207679_10006669 | |||
| 1319 | Ga0207667_10020003 | |||
| 1320 | Ga0207667_10049823 | |||
| 1321 | Ga0207651_10034295 | |||
| 1322 | Ga0207712_10013341 | |||
| 1323 | Ga0207703_10200750 | |||
| 1324 | Ga0207639_10000002 | |||
| 1325 | Ga0207639_10068010 | |||
| 1326 | Ga0207639_10354826 | |||
| 1327 | Ga0207708_10000422 | |||
| 1328 | Ga0207708_10001043 | |||
| 1329 | Ga0207702_10003680 | |||
| 1330 | Ga0207702_10089225 | |||
| 1331 | Ga0207641_10007461 | |||
| 1332 | Ga0207641_10084706 | |||
| 1333 | Ga0207648_10000285 | |||
| 1334 | Ga0207648_10000365 | |||
| 1335 | Ga0207648_10003664 | |||
| 1336 | Ga0207648_10008033 | |||
| 1337 | Ga0207675_100000226 | |||
| 1338 | Ga0207675_100001229 | |||
| 1339 | Ga0207675_100066640 | |||
| 1340 | Ga0207675_100651455 | |||
| 1341 | Ga0209281_1000092 | |||
| 1342 | Ga0209371_1000053 | |||
| 1343 | Ga0209371_1000096 | |||
| 1344 | Ga0209371_1000497 | |||
| 1345 | Ga0209371_1000691 | |||
| 1346 | Ga0209371_1000756 | |||
| 1347 | Ga0209371_1000875 | |||
| 1348 | Ga0209371_1001111 | |||
| 1349 | Ga0209371_1001791 | |||
| 1350 | Ga0209968_1002487 | |||
| 1351 | Ga0209970_1009678 | |||
| 1352 | Ga0209983_1002490 | |||
| 1353 | Ga0209588_1000022 | |||
| 1354 | Ga0209974_10000161 | |||
| 1355 | Ga0209974_10003828 | |||
| 1356 | Ga0209974_10044593 | |||
| 1357 | Ga0268266_10000123 | |||
| 1358 | Ga0268266_10048387 | |||
| 1359 | Ga0268266_10069726 | |||
| 1360 | Ga0268265_10100123 | |||
| 1361 | Ga0268265_10121868 | |||
| 1362 | Ga0268264_10001024 | |||
| 1363 | Ga0265337_1000067 | |||
| 1364 | Ga0265337_1002043 | |||
| 1365 | Ga0265337_1005710 | |||
| 1366 | Ga0265337_1006807 | |||
| 1367 | Ga0265337_1010214 | |||
| 1368 | Ga0265319_1002755 | |||
| 1369 | Ga0265319_1003156 | |||
| 1370 | Ga0265319_1009112 | |||
| 1371 | Ga0265319_1012057 | |||
| 1372 | Ga0265319_1015788 | |||
| 1373 | Ga0265334_10000014 | |||
| 1374 | Ga0265318_10002219 | |||
| 1375 | Ga0265318_10002412 | |||
| 1376 | Ga0265318_10009904 | |||
| 1377 | Ga0265318_10014317 | |||
| 1378 | Ga0265336_10019439 | |||
| 1379 | Ga0265336_10028010 | |||
| 1380 | Ga0307515_10066435 | |||
| 1381 | Ga0265338_10000619 | |||
| 1382 | Ga0265338_10001160 | |||
| 1383 | Ga0265338_10004415 | |||
| 1384 | Ga0265338_10006692 | |||
| 1385 | Ga0265338_10008324 | |||
| 1386 | Ga0265338_10009263 | |||
| 1387 | Ga0265338_10032580 | |||
| 1388 | Ga0265338_10060691 | |||
| 1389 | Ga0265338_10060795 | |||
| 1390 | Ga0265338_10062273 | |||
| 1391 | Ga0265338_10067496 | |||
| 1392 | Ga0265324_10001228 | |||
| 1393 | Ga0265324_10001725 | |||
| 1394 | Ga0265324_10005920 | |||
| 1395 | Ga0265324_10011811 | |||
| 1396 | Ga0268256_1000053 | |||
| 1397 | Ga0268256_1000086 | |||
| 1398 | Ga0268256_1000657 | |||
| 1399 | Ga0268256_1001242 | |||
| 1400 | Ga0268256_1001562 | |||
| 1401 | Ga0268256_1041009 | |||
| 1402 | Ga0316183_1199272 | |||
| 1403 | Ga0265330_10001762 | |||
| 1404 | Ga0265332_10000222 | |||
| 1405 | Ga0265332_10011334 | |||
| 1406 | Ga0265328_10046049 | |||
| 1407 | Ga0265320_10000394 | |||
| 1408 | Ga0265320_10001703 | |||
| 1409 | Ga0265320_10001761 | |||
| 1410 | Ga0265320_10031286 | |||
| 1411 | Ga0265320_10036494 | |||
| 1412 | Ga0265320_10043394 | |||
| 1413 | Ga0265320_10078604 | |||
| 1414 | Ga0265325_10000270 | |||
| 1415 | Ga0265325_10003245 | |||
| 1416 | Ga0265325_10009806 | |||
| 1417 | Ga0265325_10031615 | |||
| 1418 | Ga0265340_10008405 | |||
| 1419 | Ga0265340_10024826 | |||
| 1420 | Ga0265339_10016898 | |||
| 1421 | Ga0265339_10066197 | |||
| 1422 | Ga0265339_10098555 | |||
| 1423 | Ga0265331_10001800 | |||
| 1424 | Ga0265327_10000014 | |||
| 1425 | Ga0265327_10000460 | |||
| 1426 | Ga0265327_10001286 | |||
| 1427 | Ga0265327_10002819 | |||
| 1428 | Ga0265327_10009964 | |||
| 1429 | Ga0265327_10042399 | |||
| 1430 | Ga0265316_10000084 | |||
| 1431 | Ga0265316_10000107 | |||
| 1432 | Ga0265316_10002363 | |||
| 1433 | Ga0265316_10024451 | |||
| 1434 | Ga0265316_10025535 | |||
| 1435 | Ga0265316_10036809 | |||
| 1436 | Ga0265316_10038928 | |||
| 1437 | Ga0265316_10054395 | |||
| 1438 | Ga0265316_10068061 | |||
| 1439 | Ga0265316_10111741 | |||
| 1440 | Ga0265316_10277157 | |||
| 1441 | Ga0307408_100000110 | |||
| 1442 | Ga0307408_100000216 | |||
| 1443 | Ga0307408_100003420 | |||
| 1444 | Ga0307408_100082149 | |||
| 1445 | Ga0265313_10000294 | |||
| 1446 | Ga0265313_10002132 | |||
| 1447 | Ga0265313_10003273 | |||
| 1448 | Ga0265313_10014538 | |||
| 1449 | Ga0265313_10016629 | |||
| 1450 | Ga0307508_10000129 | |||
| 1451 | Ga0316579_10103425 | |||
| 1452 | Ga0265314_10000076 | |||
| 1453 | Ga0265314_10000444 | |||
| 1454 | Ga0265314_10002029 | |||
| 1455 | Ga0265314_10008024 | |||
| 1456 | Ga0265314_10027223 | |||
| 1457 | Ga0265314_10050561 | |||
| 1458 | Ga0265314_10057477 | |||
| 1459 | Ga0265342_10000147 | |||
| 1460 | Ga0265342_10014381 | |||
| 1461 | Ga0265342_10023804 | |||
| 1462 | Ga0265342_10049845 | |||
| 1463 | Ga0265342_10099761 | |||
| 1464 | Ga0265342_10101738 | |||
| 1465 | Ga0316576_10002208 | |||
| 1466 | Ga0316576_10003580 | |||
| 1467 | Ga0316576_10160663 | |||
| 1468 | Ga0316578_10053606 | |||
| 1469 | Ga0307405_10029614 | |||
| 1470 | Ga0316577_10029430 | |||
| 1471 | Ga0307413_10009859 | |||
| 1472 | Ga0307406_10004940 | |||
| 1473 | Ga0307406_10048889 | |||
| 1474 | Ga0307406_10057683 | |||
| 1475 | Ga0307412_10000040 | |||
| 1476 | Ga0307409_100084283 | |||
| 1477 | Ga0307409_100215949 | |||
| 1478 | Ga0307416_100008182 | |||
| 1479 | Ga0307416_100117904 | |||
| 1480 | Ga0307416_100480431 | |||
| 1481 | Ga0307414_10000033 | |||
| 1482 | Ga0307414_10034977 | |||
| 1483 | Ga0307414_10293063 | |||
| 1484 | Ga0307411_10006743 | |||
| 1485 | Ga0316593_10000238 | |||
| 1486 | Ga0316592_1017191 | |||
| 1487 | Ga0316596_1001161 | |||
| 1488 | Ga0373959_0028439 | |||
| 1489 | Ga0373928_0001007 | |||
| 1490 | Ga0373929_0000917 | |||
| 1491 | Ga0373934_0058420 | |||
| 1492 | Ga0373944_0001890 | |||
| 1493 | Ga0373949_0003389 | |||
| 1494 | Ga0373951_0003990 | |||
| 1495 | Ga0373932_0000001 | |||
| 1496 | Ga0373953_0071189 | |||
| 1497 | Ga0373962_0000105 | |||
| 1498 | Ga0316574_0008677 | |||
| 1499 | Ga0316574_0022953 | |||
| 1500 | Ga0316574_0023426 | |||
| 1501 | Ga0316574_0056394 | |||
| 1502 | Ga0373931_0000004 | |||
| 1503 | Ga0373927_0086683 | |||
| 1504 | Ga0373933_0051150 | |||
| 1505 | Ga0373933_0091264 | |||
| 1506 | Ga0373933_0143532 | |||
| 1507 | Ga0373933_0164649 | |||
| 1508 | Ga0373947_0055394 | |||
| 1509 | Ga0373947_0104930 | |||
| 1510 | Ga0373937_0014534 | |||
| 1511 | Ga0373937_0084693 | |||
| 1512 | Ga0373937_0095980 | |||
| 1513 | Ga0373937_0252425 | |||
| 1514 | Ga0316582_0020906 | |||
| 1515 | Ga0316582_0122925 | |||
| 1516 | Ga0316582_0157013 | |||
| 1517 | Ga0316584_0014329 | |||
| 1518 | Ga0373925_0000572 | |||
| 1519 | Ga0373925_0096861 | |||
| 1520 | Ga0373925_0169611 | |||
| 1521 | Ga0395899_0292065 | |||
| 1522 | Ga0395898_0005822 | |||
| 1523 | Ga0395905_0261452 | |||
| 1524 | Ga0436364_1107980 | |||
| 1525 | Ga0436364_1265238 | |||
| 1526 | Ga0436364_1284200 | |||
| 1527 | Ga0436364_1512261 | |||
| 1528 | Ga0400484_14496 | |||
| 1529 | Ga0400484_22999 | |||
| 1530 | Ga0400484_30145 | |||
| 1531 | Ga0400484_31956 | |||
| 1532 | Ga0400484_39820 | |||
| 1533 | Ga0400490_03296 | |||
| 1534 | Ga0400490_09621 | |||
| 1535 | Ga0400490_35547 | |||
| 1536 | Ga0400490_55744 | |||
| 1537 | Ga0400491_10338 | |||
| 1538 | Ga0400491_21040 | |||
| 1539 | Ga0400491_26211 | |||
| 1540 | Ga0400485_11431 | |||
| 1541 | Ga0400485_16362 | |||
| 1542 | Ga0400488_31697 | |||
| 1543 | Ga0400488_42417 | |||
| 1544 | Ga0400488_48423 | |||
| 1545 | Ga0400488_48558 | |||
| 1546 | Ga0400488_50866 | |||
| 1547 | Ga0400486_09395 | |||
| 1548 | Ga0400486_10900 | |||
| 1549 | Ga0400486_18012 | |||
| 1550 | Ga0400483_011961 | |||
| 1551 | Ga0400483_016449 | |||
| 1552 | Ga0400483_038707 | |||
| 1553 | Ga0400483_102324 | |||
| 1554 | Ga0400483_105883 | |||
| 1555 | Ga0400483_124202 | |||
| 1556 | Ga0400483_125458 | |||
| 1557 | Ga0400483_141525 | |||
| 1558 | Ga0400483_184941 | |||
| 1559 | Ga0400483_196695 | |||
| 1560 | Ga0400483_200917 | |||
| 1561 | Ga0400483_202172 | |||
| 1562 | Ga0400483_241723 | |||
| 1563 | Ga0400487_03473 | |||
| 1564 | Ga0400487_03760 | |||
| 1565 | Ga0400487_23026 | |||
| 1566 | Ga0400487_29515 | |||
| 1567 | Ga0400487_54961 | |||
| 1568 | Ga0400487_56221 | |||
| 1569 | Ga0400487_58246 | |||
| 1570 | Ga0436365_0449926 | |||
| 1571 | Ga0436365_0704006 | |||
| 1572 | Ga0436365_0779500 | |||
| 1573 | Ga0436365_1112867 | |||
| 1574 | Ga0436365_1225281 | |||
| 1575 | Ga0436365_1457951 | |||
| 1576 | Ga0436365_1621097 | |||
| 1577 | Ga0436360_0023805 | |||
| 1578 | Ga0436360_0091975 | |||
| 1579 | Ga0436360_0166959 | |||
| 1580 | Ga0436360_0264857 | |||
| 1581 | Ga0436360_0598392 | |||
| 1582 | Ga0436360_0748890 | |||
| 1583 | Ga0436360_0806145 | |||
| 1584 | Ga0436361_0005955 | |||
| 1585 | Ga0436361_0155125 | |||
| 1586 | Ga0436361_0169046 | |||
| 1587 | Ga0436361_0473752 | |||
| 1588 | Ga0436361_0594389 | |||
| 1589 | Ga0436361_0595657 | |||
| 1590 | Ga0436361_0799034 | |||
| 1591 | Ga0436361_0807183 | |||
| 1592 | Ga0436361_1195567 | |||
| 1593 | Ga0436363_0803061 | |||
| 1594 | Ga0436363_0848729 | |||
| 1595 | Ga0436362_0510036 | |||
| 1596 | Ga0436362_1180629 | |||
| 1597 | Ga0439438_020528 | |||
| 1598 | Ga0439438_027431 | |||
| 1599 | Ga0439453_0000817 | |||
| 1600 | Ga0439461_0002848 | |||
| 1601 | Ga0439466_0000161 | |||
| 1602 | Ga0439466_0008650 | |||
| 1603 | Ga0451791_0673990 | |||
| 1604 | Ga0439431_0016283 | |||
| 1605 | Ga0439433_0020198 | |||
| 1606 | Ga0439432_004728 | |||
| 1607 | Ga0439432_004893 | |||
| 1608 | Ga0439452_000004 | |||
| 1609 | Ga0450890_000016 | |||
| 1610 | Ga0450891_003102 | |||
| 1611 | Ga0450892_000519 | |||
| 1612 | Ga0450907_001326 | |||
| 1613 | Ga0439446_0021820 | |||
| 1614 | Ga0451577_0004341 | |||
| 1615 | Ga0451577_0244702 | |||
| 1616 | Ga0451577_0348461 | |||
| 1617 | Ga0453683_0023991 | |||
| 1618 | Ga0466965_0015192 | |||
| 1619 | Ga0453684_0011696 | |||
| 1620 | Ga0453684_0243718 | |||
| 1621 | Ga0466971_0000023 | |||
| 1622 | Ga0466957_0023002 | |||
| 1623 | Ga0451576_0001488 | |||
| 1624 | Ga0451576_0004916 | |||
| 1625 | Ga0451576_0011870 | |||
| 1626 | Ga0451576_0028305 | |||
| 1627 | Ga0451576_0075350 | |||
| 1628 | Ga0466967_0175447 | |||
| 1629 | Ga0495591_000024 | |||
| 1630 | Ga0495591_001549 | |||
| 1631 | Ga0495629_0069106 | |||
| 1632 | Ga0495650_0000377 | |||
| 1633 | Ga0495584_0011509 | |||
| 1634 | Ga0495594_0026368 | |||
| 1635 | Ga0495594_0044293 | |||
| 1636 | Ga0495596_0015033 | |||
| 1637 | Ga0495607_0056632 | |||
| 1638 | Ga0495606_0004074 | |||
| 1639 | Ga0495630_0000171 | |||
| 1640 | Ga0495630_0024658 | |||
| 1641 | Ga0495644_0003920 | |||
| 1642 | Ga0495654_0000061 | |||
| 1643 | Ga0495654_0000163 | |||
| 1644 | Ga0495586_0000157 | |||
| 1645 | Ga0495586_0007676 | |||
| 1646 | Ga0495586_0179240 | |||
| 1647 | Ga0495634_0014669 | |||
| 1648 | Ga0495613_0051685 | |||
| 1649 | Ga0495671_0005382 | |||
| 1650 | Ga0495660_0000158 | |||
| 1651 | Ga0495660_0075408 | |||
| 1652 | Ga0495674_0000893 | |||
| 1653 | Ga0495672_0000029 | |||
| 1654 | Ga0495672_0000054 | |||
| 1655 | Ga0495676_0009765 | |||
| 1656 | Ga0495673_0000092 | |||
| 1657 | Ga0496101_0001295 | |||
| 1658 | Ga0496103_0112862 | |||
| 1659 | Ga0496104_0302815 | |||
| 1660 | Ga0496105_0000139 | |||
| 1661 | Ga0496108_0008867 | |||
| 1662 | Ga0496109_0001851 | |||
| 1663 | Ga0496109_0251261 | |||
| 1664 | Ga0496109_0383401 | |||
| 1665 | Ga0496109_0449158 | |||
| 1666 | Ga0496111_0002711 | |||
| 1667 | Ga0496112_0009493 | |||
| 1668 | Ga0496112_0113156 | |||
| 1669 | Ga0496113_0016580 | |||
| 1670 | Ga0496113_0064403 | |||
| 1671 | Ga0496115_0008240 | |||
| 1672 | Ga0496116_0001816 | |||
| 1673 | Ga0496116_0001830 | |||
| 1674 | Ga0496116_0042783 | |||
| 1675 | Ga0496116_0067103 | |||
| 1676 | Ga0496117_0000350 | |||
| 1677 | Ga0496117_0000895 | |||
| 1678 | Ga0496117_0001186 | |||
| 1679 | Ga0496118_0001869 | |||
| 1680 | Ga0496118_0004714 | |||
| 1681 | Ga0496118_0006706 | |||
| 1682 | Ga0496119_0001006 | |||
| 1683 | Ga0496119_0003121 | |||
| 1684 | Ga0496119_0012337 | |||
| 1685 | Ga0496119_0138580 | |||
| 1686 | Ga0496120_0000090 | |||
| 1687 | Ga0496120_0000616 | |||
| 1688 | Ga0496120_0002035 | |||
| 1689 | Ga0496120_0002689 | |||
| 1690 | Ga0496120_0126219 | |||
| 1691 | Ga0496121_0001624 | |||
| 1692 | Ga0496121_0167199 | |||
| 1693 | Ga0496122_0022775 | |||
| 1694 | Ga0496123_0007402 | |||
| 1695 | Ga0496123_0010305 | |||
| 1696 | Ga0496124_0000452 | |||
| 1697 | Ga0496124_0002279 | |||
| 1698 | Ga0496124_0024644 | |||
| 1699 | Ga0496124_0228876 | |||
| 1700 | Ga0496124_0251727 | |||
| 1701 | Ga0496125_0000147 | |||
| 1702 | Ga0496125_0157301 | |||
| 1703 | Ga0496125_0267196 | |||
| 1704 | Ga0496126_0074114 | |||
| 1705 | Ga0495678_001808 | |||
| 1706 | Ga0495682_0000003 | |||
| 1707 | Ga0501290_003773 | |||
| 1708 | Ga0501291_006924 | |||
| 1709 | Ga0501295_000044 | |||
| 1710 | Ga0501296_000008 | |||
| 1711 | Ga0501297_000240 | |||
| 1712 | Ga0501298_000041 | |||
| 1713 | Ga0501299_000082 | |||
| 1714 | Ga0501031_0003827 | |||
| 1715 | Ga0501031_0027787 | |||
| 1716 | Ga0501031_0177707 | |||
| 1717 | Ga0501032_0001360 | |||
| 1718 | Ga0501032_0018401 | |||
| 1719 | Ga0501032_0137672 | |||
| 1720 | Ga0501032_0217104 | |||
| 1721 | Ga0501032_0266215 | |||
| 1722 | Ga0501033_0000127 | |||
| 1723 | Ga0501033_0020015 | |||
| 1724 | Ga0501033_0044104 | |||
| 1725 | Ga0501033_0248328 | |||
| 1726 | Ga0501033_0290849 | |||
| 1727 | Ga0501034_0000078 | |||
| 1728 | Ga0501034_0001344 | |||
| 1729 | Ga0501034_0006529 | |||
| 1730 | Ga0501034_0049978 | |||
| 1731 | Ga0501034_0108846 | |||
| 1732 | Ga0501034_0142665 | |||
| 1733 | Ga0501034_0269718 | |||
| 1734 | Ga0501036_0029587 | |||
| 1735 | Ga0501036_0132707 | |||
| 1736 | Ga0501036_0196001 | |||
| 1737 | Ga0501036_0370093 | |||
| 1738 | Ga0501037_0000020 | |||
| 1739 | Ga0501037_0019718 | |||
| 1740 | Ga0501037_0069512 | |||
| 1741 | Ga0501038_0009853 | |||
| 1742 | Ga0501038_0154538 | |||
| 1743 | Ga0501038_0173209 | |||
| 1744 | Ga0501038_0303623 | |||
| 1745 | Ga0501039_0264449 | |||
| 1746 | Ga0501042_0039154 | |||
| 1747 | Ga0501042_0235038 | |||
| 1748 | Ga0501043_0000156 | |||
| 1749 | Ga0501043_0001277 | |||
| 1750 | Ga0501043_0020811 | |||
| 1751 | Ga0501043_0094529 | |||
| 1752 | Ga0501043_0138992 | |||
| 1753 | Ga0501046_0000216 | |||
| 1754 | Ga0501046_0002988 | |||
| 1755 | Ga0501046_0009370 | |||
| 1756 | Ga0501046_0016796 | |||
| 1757 | Ga0501046_0019992 | |||
| 1758 | Ga0501046_0035288 | |||
| 1759 | Ga0501046_0041590 | |||
| 1760 | Ga0501046_0054137 | |||
| 1761 | Ga0501047_0002610 | |||
| 1762 | Ga0501047_0008802 | |||
| 1763 | Ga0501047_0009498 | |||
| 1764 | Ga0501047_0025015 | |||
| 1765 | Ga0501047_0080459 | |||
| 1766 | Ga0501047_0402137 | |||
| 1767 | Ga0501048_0000706 | |||
| 1768 | Ga0501048_0070920 | |||
| 1769 | Ga0501048_0130577 | |||
| 1770 | Ga0501068_0002884 | |||
| 1771 | Ga0501068_0044839 | |||
| 1772 | Ga0501068_0051275 | |||
| 1773 | Ga0501068_0088441 | |||
| 1774 | Ga0501068_0140346 | |||
| 1775 | Ga0501069_0004113 | |||
| 1776 | Ga0501069_0020529 | |||
| 1777 | Ga0501070_0001390 | |||
| 1778 | Ga0501070_0011429 | |||
| 1779 | Ga0501070_0091041 | |||
| 1780 | Ga0501070_0187498 | |||
| 1781 | Ga0501071_0001077 | |||
| 1782 | Ga0501071_0047816 | |||
| 1783 | Ga0501072_0040812 | |||
| 1784 | Ga0501072_0041212 | |||
| 1785 | Ga0501072_0079584 | |||
| 1786 | Ga0501073_0009536 | |||
| 1787 | Ga0501073_0026271 | |||
| 1788 | Ga0501073_0058326 | |||
| 1789 | Ga0501074_0003495 | |||
| 1790 | Ga0501074_0101507 | |||
| 1791 | Ga0501075_0034269 | |||
| 1792 | Ga0501075_0121054 | |||
| 1793 | Ga0501076_0169192 | |||
| 1794 | Ga0501076_0181924 | |||
| 1795 | Ga0501076_0408712 | |||
| 1796 | Ga0501077_0012120 | |||
| 1797 | Ga0501077_0118291 | |||
| 1798 | Ga0501202_000045 | |||
| 1799 | Ga0501223_002816 | |||
| 1800 | Ga0501227_005037 | |||
| 1801 | Ga0501227_010789 | |||
| 1802 | Ga0501233_000379 | |||
| 1803 | Ga0501235_004776 | |||
| 1804 | Ga0501236_003327 | |||
| 1805 | Ga0501239_003429 | |||
| 1806 | Ga0501243_003633 | |||
| 1807 | Ga0501253_002498 | |||
| 1808 | Ga0501256_000076 | |||
| 1809 | Ga0501261_000321 | |||
| 1810 | Ga0501221_000807 | |||
| 1811 | Ga0501225_0000560 | |||
| 1812 | Ga0501245_018659 | |||
| 1813 | Ga0501079_0141297 | |||
| 1814 | Ga0501080_0020766 | |||
| 1815 | Ga0501080_0044560 | |||
| 1816 | Ga0501080_0086801 | |||
| 1817 | Ga0501080_0152160 | |||
| 1818 | Ga0501080_0348140 | |||
| 1819 | Ga0501081_0123165 | |||
| 1820 | Ga0501083_0000094 | |||
| 1821 | Ga0501083_0049514 | |||
| 1822 | Ga0501264_002502 | |||
| 1823 | Ga0501268_006910 | |||
| 1824 | Ga0501269_001756 | |||
| 1825 | Ga0501274_000796 | |||
| 1826 | Ga0501278_000954 | |||
| 1827 | Ga0501279_000829 | |||
| 1828 | Ga0501282_003159 | |||
| 1829 | Ga0501283_000910 | |||
| 1830 | Ga0501035_0000002 | |||
| 1831 | Ga0501035_0000932 | |||
| 1832 | Ga0501035_0016573 | |||
| 1833 | Ga0501035_0026719 | |||
| 1834 | Ga0501035_0031663 | |||
| 1835 | Ga0501035_0064397 | |||
| 1836 | Ga0501035_0161104 | |||
| 1837 | Ga0501035_0205991 | |||
| 1838 | Ga0501035_0232430 | |||
| 1839 | Ga0501044_0000095 | |||
| 1840 | Ga0501044_0000371 | |||
| 1841 | Ga0501044_0008189 | |||
| 1842 | Ga0501044_0110147 | |||
| 1843 | Ga0501044_0333158 | |||
| 1844 | Ga0501045_0162577 | |||
| 1845 | Ga0501045_0266921 | |||
| 1846 | Ga0501204_000515 | |||
| 1847 | Ga0501226_005391 | |||
| 1848 | nmdc:mga03683_2929_c1 | |||
| 1849 | nmdc:mga00v17_4279_c1 | |||
| 1850 | nmdc:mga0k408_422_c1 | |||
| 1851 | nmdc:mga0k408_519_c1 | |||
| 1852 | nmdc:mga07m45_22744_c1 | |||
| 1853 | nmdc:mga05p37_342413_c1 | |||
| 1854 | nmdc:mga09592_1330_c1 | |||
| 1855 | nmdc:mga09592_333454_c1 | |||
| 1856 | nmdc:mga0qj67_243101_c1 | |||
| 1857 | nmdc:mga0qj67_35397_c1 | |||
| 1858 | nmdc:mga06r32_491449_c1 | |||
| 1859 | nmdc:mga06r32_61343_c1 | |||
| 1860 | nmdc:mga08y16_14483_c1 | |||
| 1861 | nmdc:mga08y16_291697_c1 | |||
| 1862 | nmdc:mga0n895_34642_c1 | |||
| 1863 | nmdc:mga0n895_71872_c1 | |||
| 1864 | nmdc:mga08x19_250391_c1 | |||
| 1865 | nmdc:mga0a205_16924_c1 | |||
| 1866 | nmdc:mga0a205_216833_c1 | |||
| 1867 | nmdc:mga0a205_314959_c1 | |||
| 1868 | nmdc:mga0a205_322316_c1 | |||
| 1869 | nmdc:mga0sz30_77771_c1 | |||
| 1870 | Ga0500555_000022 | |||
| 1871 | Ga0500555_000378 | |||
| 1872 | Ga0500555_028150 | |||
| 1873 | Ga0500556_0000453 | |||
| 1874 | Ga0500556_0008287 | |||
| 1875 | Ga0500621_000006 | |||
| 1876 | Ga0500642_0003869 | |||
| 1877 | Ga0500559_0000600 | |||
| 1878 | Ga0500616_0002666 | |||
| 1879 | Ga0500645_075198 | |||
| 1880 | Ga0501084_0121882 | |||
| 1881 | Ga0501084_0130132 | |||
| 1882 | Ga0590071_006726 | |||
| 1883 | Ga0501082_0006480 | |||
| 1884 | Ga0501082_0014004 | |||
| 1885 | Ga0466962_0000993 | |||
| 1886 | 2511381753 | |||
| 1887 | 2511437722 | |||
| 1888 | 2512034398 | |||
| 1889 | 2566035587 | |||
| 1890 | 2599105182 | |||
| 1891 | 2599928300 | |||
| 1892 | 2608670362 | |||
| 1893 | 2649121633 | |||
| 1894 | 2650900043 | |||
| 1895 | 2652973988 | |||
| 1896 | 2686354282 | |||
| 1897 | 2688068131 | |||
| 1898 | 2688394609 | |||
| 1899 | 2738715438 | |||
| 1900 | 2787507541 | |||
| 1901 | 2791924396 | |||
| 1902 | 2809124429 | |||
| 1903 | 2821451006 | |||
| 1904 | 2836162118 | |||
| 1905 | 2844532437 | |||
| 1906 | 2844538642 | |||
| 1907 | 2846955139 | |||
| 1908 | 2847801132 | |||
| 1909 | 2848858567 | |||
| 1910 | 2854605416 | |||
| 1911 | 2865018446 | |||
| 1912 | 2876605579 | |||
| 1913 | 2881612711 | |||
| 1914 | 2888376944 | |||
| 1915 | 2889420471 | |||
| 1916 | 2897803897 | |||
| 1917 | 2908673310 | |||
| 1918 | 2919496701 | |||
| 1919 | 2919546860 | |||
| 1920 | 2920113223 | |||
| 1921 | 2923529513 | |||
| 1922 | 2939605306 | |||
| 1923 | 2939674504 | |||
| 1924 | 2945954165 | |||
| 1925 | 2978976647 | |||
| 1926 | 2984497959 | |||
| 1927 | 2990264525 | |||
| 1928 | 8004593190 | |||
| 1929 | 8015396936 | |||
| 1930 | 8019502315 | |||
| 1931 | 8054004125 | |||
| 1932 | 8055093650 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9y-assembly1.cif.gz_A-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9758 | 4 | 318 |
| 2f9y-assembly1.cif.gz_A-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9726 | 4 | 318 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9488 | 5 | 318 |
| 5kdr-assembly1.cif.gz_A-2 | the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. | 0.943 | 6 | 318 |
| 2f9i-assembly1.cif.gz_A | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9426 | 5 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9485 | 5 | 318 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9452 | 56 | 313 | 3.90.226.10 |
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9398 | 5 | 318 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9237 | 56 | 313 | 3.90.226.10 |
| af_A0A1D6HPV4_261_342_1.20.58.860 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8688 | 8 | 55 | 1.20.58.860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A080K7Q6-F1-model_v4 | deleted | 0.9953 | 193 | 283 |
|
| AF-A0A8B4PGA1-F1-model_v4 | deleted | 0.9949 | 133 | 318 |
|
| AF-A0A3S4IKJ5-F1-model_v4 | acetyl-CoA carboxytransferase (EC 2.1.3.15) | 0.9943 | 113 | 299 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A2N4YQW4-F1-model_v4 | acetyl-CoA carboxytransferase (EC 2.1.3.15) | 0.9939 | 165 | 318 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A2S6DHJ7-F1-model_v4 | deleted | 0.9931 | 135 | 254 |
|