F486997
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 966 | 382 | 1932 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300033527|Ga0316586_1033341|Ga0316586_10333412 |
| Length | 137 |
| Sequence | MPASVRPWRGTSWKNSNRLWVKVEYMPQIIFLPHEEICPEGAVIEANSGISICDAALSNGIEIEHACEKSCACTTCHVVVREGFDSLPEADETEEDLLDKAWGLEPESRLSCQALVGEEDLVIEIPKYTINMVSENH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 198 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 199 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 200 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 210 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 211 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 212 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 238 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 242 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 243 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 244 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 245 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 246 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 247 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 248 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 249 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 250 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 253 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 254 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 255 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 256 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 257 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 258 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 259 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 260 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 357 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 360 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 361 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 362 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 363 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 364 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 369 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.38 |
| Metatranscriptomes | 3.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.55 |
| Nodule | 1.76 |
| Rhizoplane | 1.45 |
| Rhizosphere | 80.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316586_1033341 | 3300033527 | Bacteria | 888 |
| 2 | RicEn_C1984 | 2010549000 | Bacteria | 2592 |
| 3 | SwRhRL2b_contig_2515474 | 2162886007 | Bacteria | 1433 |
| 4 | SwRhRL2b_contig_3243000 | 2162886007 | Bacteria | 3417 |
| 5 | JGI24739J22299_10003976 | 3300001989 | Bacteria | 5657 |
| 6 | JGI24735J21928_10036514 | 3300002067 | Bacteria | 1441 |
| 7 | JGI24738J21930_10008726 | 3300002075 | Bacteria | 2300 |
| 8 | JGI25156J39149_1001614 | 3300002705 | Bacteria | 9217 |
| 9 | JGI25165J46597_1002430 | 3300003214 | Bacteria | 6025 |
| 10 | rootH1_10308890 | 3300003323 | Bacteria | 1272 |
| 11 | Ga0055533_1000300 | 3300003756 | Bacteria | 24900 |
| 12 | Ga0055533_1006544 | 3300003756 | Bacteria | 1703 |
| 13 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 14 | Ga0055527_1000002 | 3300003760 | Bacteria | 830488 |
| 15 | Ga0055527_1001325 | 3300003760 | Bacteria | 5345 |
| 16 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 17 | Ga0055535_1002900 | 3300003761 | Bacteria | 5345 |
| 18 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 19 | Ga0055529_1000001 | 3300003763 | Bacteria | 826680 |
| 20 | Ga0055529_1005550 | 3300003763 | Bacteria | 1815 |
| 21 | Ga0058692_1006038 | 3300003856 | Bacteria | 3377 |
| 22 | Ga0058692_1061626 | 3300003856 | Bacteria | 590 |
| 23 | Ga0065704_10000456 | 3300005289 | Bacteria | 20216 |
| 24 | Ga0065704_10073661 | 3300005289 | Bacteria | 6913 |
| 25 | Ga0065704_10084188 | 3300005289 | Bacteria | 3367 |
| 26 | Ga0065704_10120659 | 3300005289 | Bacteria | 1779 |
| 27 | Ga0065712_10113238 | 3300005290 | Bacteria | 1786 |
| 28 | Ga0070658_10125382 | 3300005327 | Bacteria | 2137 |
| 29 | Ga0070658_10348780 | 3300005327 | Bacteria | 1267 |
| 30 | Ga0070658_10464939 | 3300005327 | Bacteria | 1091 |
| 31 | Ga0070690_100060000 | 3300005330 | Bacteria | 2447 |
| 32 | Ga0070690_101137090 | 3300005330 | Bacteria | 621 |
| 33 | Ga0070670_100121801 | 3300005331 | Bacteria | 2250 |
| 34 | Ga0070677_10739912 | 3300005333 | Bacteria | 557 |
| 35 | Ga0068869_100142867 | 3300005334 | Bacteria | 1850 |
| 36 | Ga0068869_101085959 | 3300005334 | Bacteria | 700 |
| 37 | Ga0068868_100114481 | 3300005338 | Bacteria | 2194 |
| 38 | Ga0068868_100134560 | 3300005338 | Bacteria | 2025 |
| 39 | Ga0068868_101963374 | 3300005338 | Bacteria | 555 |
| 40 | Ga0070660_100298819 | 3300005339 | Bacteria | 1320 |
| 41 | Ga0070660_100510107 | 3300005339 | Bacteria | 1001 |
| 42 | Ga0070660_100849105 | 3300005339 | Bacteria | 769 |
| 43 | Ga0070689_100129868 | 3300005340 | Bacteria | 2020 |
| 44 | Ga0070689_100181428 | 3300005340 | Bacteria | 1710 |
| 45 | Ga0070689_100524344 | 3300005340 | Bacteria | 1018 |
| 46 | Ga0070689_100785076 | 3300005340 | Bacteria | 837 |
| 47 | Ga0070687_100128442 | 3300005343 | Bacteria | 1460 |
| 48 | Ga0070687_100580583 | 3300005343 | Bacteria | 767 |
| 49 | Ga0070661_100206043 | 3300005344 | Bacteria | 1504 |
| 50 | Ga0070661_100597518 | 3300005344 | Bacteria | 892 |
| 51 | Ga0070692_11133852 | 3300005345 | Bacteria | 554 |
| 52 | Ga0070669_100443346 | 3300005353 | Bacteria | 1069 |
| 53 | Ga0070675_100063736 | 3300005354 | Bacteria | 3047 |
| 54 | Ga0070674_100688727 | 3300005356 | Bacteria | 873 |
| 55 | Ga0070673_100452017 | 3300005364 | Bacteria | 1156 |
| 56 | Ga0070709_10596502 | 3300005434 | Bacteria | 850 |
| 57 | Ga0070713_100040111 | 3300005436 | Bacteria | 3805 |
| 58 | Ga0070701_10175363 | 3300005438 | Bacteria | 1251 |
| 59 | Ga0070711_100129730 | 3300005439 | Bacteria | 1876 |
| 60 | Ga0070711_100664273 | 3300005439 | Bacteria | 875 |
| 61 | Ga0070700_101315065 | 3300005441 | Bacteria | 608 |
| 62 | Ga0070694_100570890 | 3300005444 | Bacteria | 908 |
| 63 | Ga0070694_101131353 | 3300005444 | Bacteria | 654 |
| 64 | Ga0070663_100239123 | 3300005455 | Bacteria | 1433 |
| 65 | Ga0070678_100470936 | 3300005456 | Bacteria | 1104 |
| 66 | Ga0070678_100652866 | 3300005456 | Bacteria | 944 |
| 67 | Ga0070681_10088625 | 3300005458 | Bacteria | 3046 |
| 68 | Ga0070681_10627559 | 3300005458 | Bacteria | 989 |
| 69 | Ga0070681_10702598 | 3300005458 | Bacteria | 927 |
| 70 | Ga0068867_100057812 | 3300005459 | Bacteria | 2873 |
| 71 | Ga0068867_100301413 | 3300005459 | Bacteria | 1321 |
| 72 | Ga0070685_10475463 | 3300005466 | Bacteria | 880 |
| 73 | Ga0070707_102141001 | 3300005468 | Bacteria | 527 |
| 74 | Ga0070698_101617732 | 3300005471 | Bacteria | 600 |
| 75 | Ga0070679_100462873 | 3300005530 | Bacteria | 1213 |
| 76 | Ga0068853_100558689 | 3300005539 | Bacteria | 1085 |
| 77 | Ga0070686_100520399 | 3300005544 | Bacteria | 926 |
| 78 | Ga0070695_100195237 | 3300005545 | Bacteria | 1443 |
| 79 | Ga0070695_100976294 | 3300005545 | Bacteria | 688 |
| 80 | Ga0070696_100887507 | 3300005546 | Bacteria | 739 |
| 81 | Ga0070693_100005048 | 3300005547 | Bacteria | 6304 |
| 82 | Ga0070693_100357871 | 3300005547 | Bacteria | 1001 |
| 83 | Ga0070693_100699790 | 3300005547 | Bacteria | 742 |
| 84 | Ga0070665_100001059 | 3300005548 | Bacteria | 34416 |
| 85 | Ga0070665_100091129 | 3300005548 | Bacteria | 3054 |
| 86 | Ga0070704_100018129 | 3300005549 | Bacteria | 4492 |
| 87 | Ga0070704_100128921 | 3300005549 | Bacteria | 1957 |
| 88 | Ga0070704_100244230 | 3300005549 | Bacteria | 1471 |
| 89 | Ga0068855_100008249 | 3300005563 | Bacteria | 12592 |
| 90 | Ga0070664_100808020 | 3300005564 | Bacteria | 877 |
| 91 | Ga0070664_101224579 | 3300005564 | Bacteria | 708 |
| 92 | Ga0068854_100132290 | 3300005578 | Bacteria | 1906 |
| 93 | Ga0068854_100211793 | 3300005578 | Bacteria | 1529 |
| 94 | Ga0068852_100002208 | 3300005616 | Bacteria | 13359 |
| 95 | Ga0068852_101632820 | 3300005616 | Bacteria | 667 |
| 96 | Ga0068859_100337700 | 3300005617 | Bacteria | 1601 |
| 97 | Ga0068864_100625080 | 3300005618 | Bacteria | 1047 |
| 98 | Ga0068861_100282436 | 3300005719 | Bacteria | 1430 |
| 99 | Ga0068861_101868485 | 3300005719 | Bacteria | 597 |
| 100 | Ga0068851_10018416 | 3300005834 | Bacteria | 3362 |
| 101 | Ga0068858_100012301 | 3300005842 | Bacteria | 8071 |
| 102 | Ga0068858_100159203 | 3300005842 | Bacteria | 2126 |
| 103 | Ga0068858_101025234 | 3300005842 | Bacteria | 809 |
| 104 | Ga0068860_101435092 | 3300005843 | Bacteria | 711 |
| 105 | Ga0068862_101633005 | 3300005844 | Bacteria | 652 |
| 106 | Ga0068862_102011803 | 3300005844 | Bacteria | 588 |
| 107 | Ga0081539_10378110 | 3300005985 | Bacteria | 591 |
| 108 | Ga0075364_10002445 | 3300006051 | Bacteria | 10404 |
| 109 | Ga0075364_10004592 | 3300006051 | Bacteria | 7954 |
| 110 | Ga0075364_10007007 | 3300006051 | Bacteria | 6659 |
| 111 | Ga0075364_10109884 | 3300006051 | Bacteria | 1839 |
| 112 | Ga0070715_10094362 | 3300006163 | Bacteria | 1383 |
| 113 | Ga0070716_100009989 | 3300006173 | Bacteria | 4747 |
| 114 | Ga0070716_100359235 | 3300006173 | Bacteria | 1034 |
| 115 | Ga0075367_10346117 | 3300006178 | Bacteria | 938 |
| 116 | Ga0075369_10147689 | 3300006186 | Bacteria | 1074 |
| 117 | Ga0075366_10116574 | 3300006195 | Bacteria | 1608 |
| 118 | Ga0097621_100007616 | 3300006237 | Bacteria | 7759 |
| 119 | Ga0097621_100009054 | 3300006237 | Bacteria | 7213 |
| 120 | Ga0097621_100086881 | 3300006237 | Bacteria | 2611 |
| 121 | Ga0068871_100006498 | 3300006358 | Bacteria | 8277 |
| 122 | Ga0068871_100072587 | 3300006358 | Bacteria | 2835 |
| 123 | Ga0068871_100124948 | 3300006358 | Bacteria | 2177 |
| 124 | Ga0068871_100335359 | 3300006358 | Bacteria | 1334 |
| 125 | Ga0075428_100006503 | 3300006844 | Bacteria | 12990 |
| 126 | Ga0075433_10674742 | 3300006852 | Bacteria | 906 |
| 127 | Ga0075433_10948002 | 3300006852 | Bacteria | 750 |
| 128 | Ga0075434_100047404 | 3300006871 | Bacteria | 4265 |
| 129 | Ga0075434_100119458 | 3300006871 | Bacteria | 2650 |
| 130 | Ga0075434_101562038 | 3300006871 | Bacteria | 669 |
| 131 | Ga0075429_100100535 | 3300006880 | Bacteria | 2524 |
| 132 | Ga0068865_100073079 | 3300006881 | Bacteria | 2438 |
| 133 | Ga0068865_100681850 | 3300006881 | Bacteria | 876 |
| 134 | Ga0068865_100724343 | 3300006881 | Bacteria | 852 |
| 135 | Ga0068865_101795990 | 3300006881 | Bacteria | 554 |
| 136 | Ga0075436_100184107 | 3300006914 | Bacteria | 1477 |
| 137 | Ga0075436_100275520 | 3300006914 | Bacteria | 1202 |
| 138 | Ga0097620_101474986 | 3300006931 | Bacteria | 751 |
| 139 | Ga0079104_1000075 | 3300006946 | Bacteria | 148544 |
| 140 | Ga0079104_1000201 | 3300006946 | Bacteria | 83853 |
| 141 | Ga0079104_1000365 | 3300006946 | Bacteria | 53914 |
| 142 | Ga0079104_1000393 | 3300006946 | Bacteria | 50644 |
| 143 | Ga0079104_1000633 | 3300006946 | Bacteria | 34240 |
| 144 | Ga0079104_1004575 | 3300006946 | Bacteria | 5844 |
| 145 | Ga0079104_1014486 | 3300006946 | Bacteria | 2376 |
| 146 | Ga0079104_1093474 | 3300006946 | Bacteria | 607 |
| 147 | Ga0079104_1109260 | 3300006946 | Bacteria | 548 |
| 148 | Ga0075435_100745732 | 3300007076 | Bacteria | 852 |
| 149 | Ga0099794_10007400 | 3300007265 | Bacteria | 4509 |
| 150 | Ga0099794_10048093 | 3300007265 | Bacteria | 2047 |
| 151 | Ga0105251_10000059 | 3300009011 | Bacteria | 103346 |
| 152 | Ga0105251_10000095 | 3300009011 | Bacteria | 85705 |
| 153 | Ga0105251_10001934 | 3300009011 | Bacteria | 16959 |
| 154 | Ga0105251_10002308 | 3300009011 | Bacteria | 15120 |
| 155 | Ga0105251_10004319 | 3300009011 | Bacteria | 9735 |
| 156 | Ga0105251_10013853 | 3300009011 | Bacteria | 4486 |
| 157 | Ga0105251_10039845 | 3300009011 | Bacteria | 2293 |
| 158 | Ga0105244_10000492 | 3300009036 | Bacteria | 35654 |
| 159 | Ga0105244_10009735 | 3300009036 | Bacteria | 5877 |
| 160 | Ga0105244_10016161 | 3300009036 | Bacteria | 4259 |
| 161 | Ga0105244_10023125 | 3300009036 | Bacteria | 3413 |
| 162 | Ga0105244_10179570 | 3300009036 | Bacteria | 1004 |
| 163 | Ga0105250_10001437 | 3300009092 | Bacteria | 12849 |
| 164 | Ga0105250_10003023 | 3300009092 | Bacteria | 8134 |
| 165 | Ga0105250_10003263 | 3300009092 | Bacteria | 7723 |
| 166 | Ga0105250_10014289 | 3300009092 | Bacteria | 3265 |
| 167 | Ga0105250_10064963 | 3300009092 | Bacteria | 1471 |
| 168 | Ga0105250_10406285 | 3300009092 | Bacteria | 605 |
| 169 | Ga0105240_10603666 | 3300009093 | Bacteria | 1208 |
| 170 | Ga0105240_12058803 | 3300009093 | Bacteria | 593 |
| 171 | Ga0111539_10001926 | 3300009094 | Bacteria | 27651 |
| 172 | Ga0105245_10063400 | 3300009098 | Bacteria | 3337 |
| 173 | Ga0105245_10346774 | 3300009098 | Bacteria | 1470 |
| 174 | Ga0105247_10000048 | 3300009101 | Bacteria | 150745 |
| 175 | Ga0114129_12086825 | 3300009147 | Bacteria | 684 |
| 176 | Ga0105243_10390554 | 3300009148 | Bacteria | 1290 |
| 177 | Ga0105243_10461327 | 3300009148 | Bacteria | 1194 |
| 178 | Ga0105243_10834870 | 3300009148 | Bacteria | 911 |
| 179 | Ga0105241_10000011 | 3300009174 | Bacteria | 243033 |
| 180 | Ga0105241_10485221 | 3300009174 | Bacteria | 1099 |
| 181 | Ga0105241_10705625 | 3300009174 | Bacteria | 921 |
| 182 | Ga0105241_11987294 | 3300009174 | Bacteria | 572 |
| 183 | Ga0105242_10004829 | 3300009176 | Bacteria | 10435 |
| 184 | Ga0105242_10058987 | 3300009176 | Bacteria | 3148 |
| 185 | Ga0105242_10079008 | 3300009176 | Bacteria | 2747 |
| 186 | Ga0105242_10275254 | 3300009176 | Bacteria | 1526 |
| 187 | Ga0105242_10421353 | 3300009176 | Bacteria | 1251 |
| 188 | Ga0105242_10717925 | 3300009176 | Bacteria | 980 |
| 189 | Ga0105242_11110735 | 3300009176 | Bacteria | 805 |
| 190 | Ga0105242_12175794 | 3300009176 | Bacteria | 599 |
| 191 | Ga0105248_10017686 | 3300009177 | Bacteria | 7862 |
| 192 | Ga0105248_10571757 | 3300009177 | Bacteria | 1275 |
| 193 | Ga0105248_10834109 | 3300009177 | Bacteria | 1040 |
| 194 | Ga0105238_10298441 | 3300009551 | Bacteria | 1594 |
| 195 | Ga0105238_10382073 | 3300009551 | Bacteria | 1400 |
| 196 | Ga0105147_105402 | 3300009982 | Bacteria | 1073 |
| 197 | Ga0105239_10782256 | 3300010375 | Bacteria | 1093 |
| 198 | Ga0157373_10081290 | 3300013100 | Bacteria | 2284 |
| 199 | Ga0157373_10081315 | 3300013100 | Bacteria | 2284 |
| 200 | Ga0157371_10145974 | 3300013102 | Bacteria | 1686 |
| 201 | Ga0157371_11189844 | 3300013102 | Bacteria | 587 |
| 202 | Ga0157370_10036610 | 3300013104 | Bacteria | 4760 |
| 203 | Ga0157370_10860115 | 3300013104 | Bacteria | 824 |
| 204 | Ga0157370_11011251 | 3300013104 | Bacteria | 752 |
| 205 | Ga0157369_10117752 | 3300013105 | Bacteria | 2820 |
| 206 | Ga0157369_10182804 | 3300013105 | Bacteria | 2206 |
| 207 | Ga0157374_10000104 | 3300013296 | Bacteria | 78523 |
| 208 | Ga0157374_10293378 | 3300013296 | Bacteria | 1608 |
| 209 | Ga0157374_11071054 | 3300013296 | Bacteria | 826 |
| 210 | Ga0157378_10044245 | 3300013297 | Bacteria | 3953 |
| 211 | Ga0157378_10180762 | 3300013297 | Bacteria | 1984 |
| 212 | Ga0157378_11332658 | 3300013297 | Bacteria | 759 |
| 213 | Ga0163162_10120065 | 3300013306 | Bacteria | 2732 |
| 214 | Ga0163162_10167337 | 3300013306 | Bacteria | 2322 |
| 215 | Ga0163162_10790689 | 3300013306 | Bacteria | 1066 |
| 216 | Ga0157372_10002107 | 3300013307 | Bacteria | 21623 |
| 217 | Ga0157372_10082577 | 3300013307 | Bacteria | 3638 |
| 218 | Ga0157372_10186523 | 3300013307 | Bacteria | 2402 |
| 219 | Ga0157372_12952868 | 3300013307 | Bacteria | 544 |
| 220 | Ga0157375_10025335 | 3300013308 | Bacteria | 5509 |
| 221 | Ga0157375_11815739 | 3300013308 | Bacteria | 723 |
| 222 | Ga0163163_11904632 | 3300014325 | Bacteria | 655 |
| 223 | Ga0157380_11008574 | 3300014326 | Bacteria | 866 |
| 224 | Ga0157380_12342514 | 3300014326 | Bacteria | 599 |
| 225 | Ga0182008_10005391 | 3300014497 | Bacteria | 7295 |
| 226 | Ga0182008_10039474 | 3300014497 | Bacteria | 2359 |
| 227 | Ga0157379_10022492 | 3300014968 | Bacteria | 5584 |
| 228 | Ga0157379_10057239 | 3300014968 | Bacteria | 3484 |
| 229 | Ga0157376_10063556 | 3300014969 | Bacteria | 3110 |
| 230 | Ga0157376_10098142 | 3300014969 | Bacteria | 2553 |
| 231 | Ga0157376_10098918 | 3300014969 | Bacteria | 2544 |
| 232 | Ga0157376_10373060 | 3300014969 | Bacteria | 1372 |
| 233 | Ga0157376_10388863 | 3300014969 | Bacteria | 1346 |
| 234 | Ga0157376_10486419 | 3300014969 | Bacteria | 1210 |
| 235 | Ga0182006_1000024 | 3300015261 | Bacteria | 257431 |
| 236 | Ga0182006_1027678 | 3300015261 | Bacteria | 2311 |
| 237 | Ga0182006_1052496 | 3300015261 | Bacteria | 1566 |
| 238 | Ga0182007_10003840 | 3300015262 | Bacteria | 6985 |
| 239 | Ga0182005_1011700 | 3300015265 | Bacteria | 2496 |
| 240 | Ga0183361_10006 | 3300016635 | Bacteria | 368532 |
| 241 | Ga0163161_10000005 | 3300017792 | Bacteria | 327860 |
| 242 | Ga0163161_11324204 | 3300017792 | Bacteria | 627 |
| 243 | Ga0163161_12100340 | 3300017792 | Bacteria | 502 |
| 244 | Ga0213872_10107994 | 3300021361 | Bacteria | 1237 |
| 245 | Ga0213876_10000065 | 3300021384 | Bacteria | 128435 |
| 246 | Ga0213876_10096216 | 3300021384 | Bacteria | 1569 |
| 247 | Ga0209435_101932 | 3300025206 | Bacteria | 2495 |
| 248 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 249 | Ga0209674_100240 | 3300025226 | Bacteria | 46653 |
| 250 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 251 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 252 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 253 | Ga0209147_100127 | 3300025229 | Bacteria | 123986 |
| 254 | Ga0209563_102559 | 3300025230 | Bacteria | 4073 |
| 255 | Ga0207427_102173 | 3300025231 | Bacteria | 5590 |
| 256 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 257 | Ga0209258_100134 | 3300025242 | Bacteria | 174683 |
| 258 | Ga0207425_1008165 | 3300025245 | Bacteria | 2703 |
| 259 | Ga0209677_112110 | 3300025253 | Bacteria | 1300 |
| 260 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 261 | Ga0209759_1000152 | 3300025256 | Bacteria | 119866 |
| 262 | Ga0209759_1000405 | 3300025256 | Bacteria | 53243 |
| 263 | Ga0209129_1000104 | 3300025258 | Bacteria | 161264 |
| 264 | Ga0209233_1000016 | 3300025261 | Bacteria | 907830 |
| 265 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 266 | Ga0209455_1011566 | 3300025272 | Bacteria | 2165 |
| 267 | Ga0207656_10016168 | 3300025321 | Bacteria | 2901 |
| 268 | Ga0207696_1000039 | 3300025711 | Bacteria | 324954 |
| 269 | Ga0207696_1000166 | 3300025711 | Bacteria | 104368 |
| 270 | Ga0207696_1001162 | 3300025711 | Bacteria | 15076 |
| 271 | Ga0207696_1003316 | 3300025711 | Bacteria | 7404 |
| 272 | Ga0207696_1011571 | 3300025711 | Bacteria | 3168 |
| 273 | Ga0207655_1000062 | 3300025728 | Bacteria | 258054 |
| 274 | Ga0207655_1000078 | 3300025728 | Bacteria | 219360 |
| 275 | Ga0207655_1000199 | 3300025728 | Bacteria | 105047 |
| 276 | Ga0207655_1020086 | 3300025728 | Bacteria | 3456 |
| 277 | Ga0207713_1000069 | 3300025735 | Bacteria | 191229 |
| 278 | Ga0207713_1000086 | 3300025735 | Bacteria | 157106 |
| 279 | Ga0207713_1000180 | 3300025735 | Bacteria | 91168 |
| 280 | Ga0207713_1000202 | 3300025735 | Bacteria | 81787 |
| 281 | Ga0207713_1004002 | 3300025735 | Bacteria | 9759 |
| 282 | Ga0207713_1012628 | 3300025735 | Bacteria | 4500 |
| 283 | Ga0207713_1027207 | 3300025735 | Bacteria | 2603 |
| 284 | Ga0207713_1035423 | 3300025735 | Bacteria | 2154 |
| 285 | Ga0207682_10077951 | 3300025893 | Bacteria | 1415 |
| 286 | Ga0207642_10167385 | 3300025899 | Bacteria | 1186 |
| 287 | Ga0207710_10000026 | 3300025900 | Bacteria | 307644 |
| 288 | Ga0207647_10066910 | 3300025904 | Bacteria | 2178 |
| 289 | Ga0207685_10019276 | 3300025905 | Bacteria | 2245 |
| 290 | Ga0207699_10472355 | 3300025906 | Bacteria | 902 |
| 291 | Ga0207705_10133856 | 3300025909 | Bacteria | 1846 |
| 292 | Ga0207705_10430727 | 3300025909 | Bacteria | 1022 |
| 293 | Ga0207654_10000012 | 3300025911 | Bacteria | 243044 |
| 294 | Ga0207654_10357299 | 3300025911 | Bacteria | 1007 |
| 295 | Ga0207654_10455448 | 3300025911 | Bacteria | 898 |
| 296 | Ga0207707_10773859 | 3300025912 | Bacteria | 801 |
| 297 | Ga0207693_10292339 | 3300025915 | Bacteria | 1277 |
| 298 | Ga0207663_10554751 | 3300025916 | Bacteria | 899 |
| 299 | Ga0207662_10091371 | 3300025918 | Bacteria | 1873 |
| 300 | Ga0207662_10145402 | 3300025918 | Bacteria | 1504 |
| 301 | Ga0207657_10060755 | 3300025919 | Bacteria | 3243 |
| 302 | Ga0207649_10123796 | 3300025920 | Bacteria | 1747 |
| 303 | Ga0207650_10321606 | 3300025925 | Bacteria | 1267 |
| 304 | Ga0207659_10351592 | 3300025926 | Bacteria | 1223 |
| 305 | Ga0207659_10361840 | 3300025926 | Bacteria | 1206 |
| 306 | Ga0207687_10137966 | 3300025927 | Bacteria | 1847 |
| 307 | Ga0207687_10184419 | 3300025927 | Bacteria | 1619 |
| 308 | Ga0207700_10009038 | 3300025928 | Bacteria | 6203 |
| 309 | Ga0207690_10732823 | 3300025932 | Bacteria | 814 |
| 310 | Ga0207690_11004835 | 3300025932 | Bacteria | 694 |
| 311 | Ga0207686_10042151 | 3300025934 | Bacteria | 2788 |
| 312 | Ga0207686_10112937 | 3300025934 | Bacteria | 1836 |
| 313 | Ga0207686_10328903 | 3300025934 | Bacteria | 1144 |
| 314 | Ga0207686_10334785 | 3300025934 | Bacteria | 1135 |
| 315 | Ga0207686_10704913 | 3300025934 | Bacteria | 803 |
| 316 | Ga0207686_11291665 | 3300025934 | Bacteria | 599 |
| 317 | Ga0207709_10337687 | 3300025935 | Bacteria | 1133 |
| 318 | Ga0207670_10091382 | 3300025936 | Bacteria | 2153 |
| 319 | Ga0207670_10279859 | 3300025936 | Bacteria | 1300 |
| 320 | Ga0207669_10619505 | 3300025937 | Bacteria | 882 |
| 321 | Ga0207704_10442878 | 3300025938 | Bacteria | 1035 |
| 322 | Ga0207704_10670219 | 3300025938 | Bacteria | 856 |
| 323 | Ga0207665_10035734 | 3300025939 | Bacteria | 3300 |
| 324 | Ga0207665_10225755 | 3300025939 | Bacteria | 1374 |
| 325 | Ga0207711_10064825 | 3300025941 | Bacteria | 3156 |
| 326 | Ga0207689_10224307 | 3300025942 | Bacteria | 1553 |
| 327 | Ga0207689_10939978 | 3300025942 | Bacteria | 729 |
| 328 | Ga0207679_10787968 | 3300025945 | Bacteria | 866 |
| 329 | Ga0207679_11807383 | 3300025945 | Bacteria | 558 |
| 330 | Ga0207667_10137351 | 3300025949 | Bacteria | 2517 |
| 331 | Ga0207651_10093143 | 3300025960 | Bacteria | 2212 |
| 332 | Ga0207712_11306774 | 3300025961 | Bacteria | 648 |
| 333 | Ga0207712_12133835 | 3300025961 | Bacteria | 501 |
| 334 | Ga0207640_10139703 | 3300025981 | Bacteria | 1764 |
| 335 | Ga0207658_10098859 | 3300025986 | Bacteria | 2281 |
| 336 | Ga0207677_10019019 | 3300026023 | Bacteria | 4137 |
| 337 | Ga0207677_10273496 | 3300026023 | Bacteria | 1383 |
| 338 | Ga0207677_10654926 | 3300026023 | Bacteria | 927 |
| 339 | Ga0207677_11577365 | 3300026023 | Bacteria | 607 |
| 340 | Ga0207703_10015754 | 3300026035 | Bacteria | 5897 |
| 341 | Ga0207703_10599650 | 3300026035 | Bacteria | 1042 |
| 342 | Ga0207639_10879783 | 3300026041 | Bacteria | 837 |
| 343 | Ga0207678_10072141 | 3300026067 | Bacteria | 2959 |
| 344 | Ga0207708_10182101 | 3300026075 | Bacteria | 1668 |
| 345 | Ga0207641_11644932 | 3300026088 | Bacteria | 644 |
| 346 | Ga0207648_10025902 | 3300026089 | Bacteria | 5218 |
| 347 | Ga0207648_11599736 | 3300026089 | Bacteria | 612 |
| 348 | Ga0207648_11675424 | 3300026089 | Bacteria | 597 |
| 349 | Ga0207676_10901227 | 3300026095 | Bacteria | 867 |
| 350 | Ga0207675_100419074 | 3300026118 | Bacteria | 1322 |
| 351 | Ga0207675_100997021 | 3300026118 | Bacteria | 856 |
| 352 | Ga0207675_101339691 | 3300026118 | Bacteria | 736 |
| 353 | Ga0207683_10174639 | 3300026121 | Bacteria | 1947 |
| 354 | Ga0207683_10693029 | 3300026121 | Bacteria | 944 |
| 355 | Ga0207698_10001058 | 3300026142 | Bacteria | 15993 |
| 356 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 357 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 358 | Ga0209281_1000079 | 3300027111 | Bacteria | 261444 |
| 359 | Ga0209281_1000142 | 3300027111 | Bacteria | 174280 |
| 360 | Ga0209281_1000171 | 3300027111 | Bacteria | 153284 |
| 361 | Ga0209281_1000184 | 3300027111 | Bacteria | 144981 |
| 362 | Ga0209281_1000901 | 3300027111 | Bacteria | 24924 |
| 363 | Ga0209281_1001407 | 3300027111 | Bacteria | 14472 |
| 364 | Ga0209371_1000015 | 3300027312 | Bacteria | 659640 |
| 365 | Ga0209371_1000221 | 3300027312 | Bacteria | 75566 |
| 366 | Ga0209371_1000867 | 3300027312 | Bacteria | 24388 |
| 367 | Ga0209371_1001808 | 3300027312 | Bacteria | 13349 |
| 368 | Ga0209371_1006483 | 3300027312 | Bacteria | 4323 |
| 369 | Ga0209371_1020569 | 3300027312 | Bacteria | 1622 |
| 370 | Ga0209371_1022855 | 3300027312 | Bacteria | 1486 |
| 371 | Ga0209588_1001752 | 3300027671 | Bacteria | 5750 |
| 372 | Ga0209966_1011073 | 3300027695 | Bacteria | 1638 |
| 373 | Ga0207428_10010038 | 3300027907 | Bacteria | 8474 |
| 374 | Ga0268266_10000213 | 3300028379 | Bacteria | 100912 |
| 375 | Ga0268266_10052108 | 3300028379 | Bacteria | 3514 |
| 376 | Ga0268266_10443332 | 3300028379 | Bacteria | 1233 |
| 377 | Ga0268265_12113213 | 3300028380 | Bacteria | 570 |
| 378 | Ga0268265_12350815 | 3300028380 | Bacteria | 540 |
| 379 | Ga0268264_10346609 | 3300028381 | Bacteria | 1412 |
| 380 | Ga0265338_10000437 | 3300028800 | Bacteria | 74941 |
| 381 | Ga0268256_1000018 | 3300030500 | Bacteria | 594572 |
| 382 | Ga0268256_1000296 | 3300030500 | Bacteria | 50031 |
| 383 | Ga0268256_1000482 | 3300030500 | Bacteria | 34168 |
| 384 | Ga0268256_1009140 | 3300030500 | Bacteria | 3326 |
| 385 | Ga0268256_1025000 | 3300030500 | Bacteria | 1524 |
| 386 | Ga0268256_1025802 | 3300030500 | Bacteria | 1487 |
| 387 | Ga0265332_10015178 | 3300031238 | Bacteria | 3402 |
| 388 | Ga0265331_10025255 | 3300031250 | Bacteria | 3001 |
| 389 | Ga0265327_10034490 | 3300031251 | Bacteria | 2808 |
| 390 | Ga0307408_100016005 | 3300031548 | Bacteria | 5001 |
| 391 | Ga0307408_100234393 | 3300031548 | Bacteria | 1505 |
| 392 | Ga0307408_101438142 | 3300031548 | Bacteria | 650 |
| 393 | Ga0307408_101522855 | 3300031548 | Bacteria | 633 |
| 394 | Ga0316575_10003170 | 3300031665 | Bacteria | 5628 |
| 395 | Ga0316575_10073313 | 3300031665 | Bacteria | 1377 |
| 396 | Ga0316575_10083176 | 3300031665 | Bacteria | 1292 |
| 397 | Ga0316575_10383102 | 3300031665 | Bacteria | 602 |
| 398 | Ga0316575_10424041 | 3300031665 | Bacteria | 572 |
| 399 | Ga0316579_10000166 | 3300031691 | Bacteria | 19057 |
| 400 | Ga0316579_10001592 | 3300031691 | Bacteria | 8297 |
| 401 | Ga0316579_10008011 | 3300031691 | Bacteria | 4388 |
| 402 | Ga0316579_10071113 | 3300031691 | Bacteria | 1649 |
| 403 | Ga0316576_10002247 | 3300031727 | Bacteria | 10925 |
| 404 | Ga0316576_10020056 | 3300031727 | Bacteria | 4591 |
| 405 | Ga0316576_10047234 | 3300031727 | Bacteria | 3119 |
| 406 | Ga0316576_10150233 | 3300031727 | Bacteria | 1755 |
| 407 | Ga0316576_10539590 | 3300031727 | Bacteria | 855 |
| 408 | Ga0316578_10007566 | 3300031728 | Bacteria | 5457 |
| 409 | Ga0316578_10010365 | 3300031728 | Bacteria | 4836 |
| 410 | Ga0316578_10011211 | 3300031728 | Bacteria | 4679 |
| 411 | Ga0316578_10188720 | 3300031728 | Bacteria | 1242 |
| 412 | Ga0316578_10203799 | 3300031728 | Bacteria | 1190 |
| 413 | Ga0316578_10331464 | 3300031728 | Bacteria | 907 |
| 414 | Ga0316578_10404389 | 3300031728 | Bacteria | 809 |
| 415 | Ga0316578_10450724 | 3300031728 | Bacteria | 760 |
| 416 | Ga0316578_10788372 | 3300031728 | Bacteria | 551 |
| 417 | Ga0307405_10415799 | 3300031731 | Bacteria | 1057 |
| 418 | Ga0316577_10007349 | 3300031733 | Bacteria | 5876 |
| 419 | Ga0316577_10025632 | 3300031733 | Bacteria | 3279 |
| 420 | Ga0316577_10085194 | 3300031733 | Bacteria | 1768 |
| 421 | Ga0316577_10090512 | 3300031733 | Bacteria | 1713 |
| 422 | Ga0316577_10126628 | 3300031733 | Bacteria | 1436 |
| 423 | Ga0316577_10156907 | 3300031733 | Bacteria | 1283 |
| 424 | Ga0316577_10189202 | 3300031733 | Bacteria | 1163 |
| 425 | Ga0316577_10208269 | 3300031733 | Bacteria | 1105 |
| 426 | Ga0316577_10244551 | 3300031733 | Bacteria | 1015 |
| 427 | Ga0316577_10333796 | 3300031733 | Bacteria | 860 |
| 428 | Ga0316577_10631675 | 3300031733 | Bacteria | 609 |
| 429 | Ga0307413_10185902 | 3300031824 | Bacteria | 1487 |
| 430 | Ga0307410_10839006 | 3300031852 | Bacteria | 784 |
| 431 | Ga0307406_11736058 | 3300031901 | Bacteria | 554 |
| 432 | Ga0307412_10000008 | 3300031911 | Bacteria | 461034 |
| 433 | Ga0307412_10797864 | 3300031911 | Bacteria | 819 |
| 434 | Ga0307412_10975572 | 3300031911 | Bacteria | 747 |
| 435 | Ga0307409_100253454 | 3300031995 | Bacteria | 1610 |
| 436 | Ga0307409_101303169 | 3300031995 | Bacteria | 751 |
| 437 | Ga0307416_100068522 | 3300032002 | Bacteria | 2932 |
| 438 | Ga0307416_100716091 | 3300032002 | Bacteria | 1091 |
| 439 | Ga0307416_100873333 | 3300032002 | Bacteria | 998 |
| 440 | Ga0316583_10002671 | 3300032133 | Bacteria | 6231 |
| 441 | Ga0316583_10003546 | 3300032133 | Bacteria | 5505 |
| 442 | Ga0316583_10003976 | 3300032133 | Bacteria | 5253 |
| 443 | Ga0316583_10027667 | 3300032133 | Bacteria | 2024 |
| 444 | Ga0316583_10069160 | 3300032133 | Bacteria | 1235 |
| 445 | Ga0316583_10075684 | 3300032133 | Bacteria | 1177 |
| 446 | Ga0316583_10077462 | 3300032133 | Bacteria | 1162 |
| 447 | Ga0316583_10176418 | 3300032133 | Bacteria | 743 |
| 448 | Ga0316585_10000025 | 3300032137 | Bacteria | 22134 |
| 449 | Ga0316585_10041606 | 3300032137 | Bacteria | 1464 |
| 450 | Ga0316585_10117994 | 3300032137 | Bacteria | 873 |
| 451 | Ga0316580_10001116 | 3300032139 | Bacteria | 6785 |
| 452 | Ga0316580_10010848 | 3300032139 | Bacteria | 2761 |
| 453 | Ga0316580_10036841 | 3300032139 | Bacteria | 1513 |
| 454 | Ga0316580_10082323 | 3300032139 | Bacteria | 984 |
| 455 | Ga0316580_10282659 | 3300032139 | Bacteria | 515 |
| 456 | Ga0316593_10000022 | 3300032168 | Bacteria | 15802 |
| 457 | Ga0316593_10000063 | 3300032168 | Bacteria | 12542 |
| 458 | Ga0316593_10000189 | 3300032168 | Bacteria | 9417 |
| 459 | Ga0316593_10000373 | 3300032168 | Bacteria | 7941 |
| 460 | Ga0316593_10000378 | 3300032168 | Bacteria | 7925 |
| 461 | Ga0316593_10000410 | 3300032168 | Bacteria | 7748 |
| 462 | Ga0316593_10000534 | 3300032168 | Bacteria | 7077 |
| 463 | Ga0316593_10000536 | 3300032168 | Bacteria | 7070 |
| 464 | Ga0316593_10000714 | 3300032168 | Bacteria | 6508 |
| 465 | Ga0316593_10000847 | 3300032168 | Bacteria | 6190 |
| 466 | Ga0316593_10006179 | 3300032168 | Bacteria | 3219 |
| 467 | Ga0316593_10009179 | 3300032168 | Bacteria | 2785 |
| 468 | Ga0316593_10010401 | 3300032168 | Bacteria | 2667 |
| 469 | Ga0316593_10011638 | 3300032168 | Bacteria | 2562 |
| 470 | Ga0316593_10011695 | 3300032168 | Bacteria | 2558 |
| 471 | Ga0316593_10015438 | 3300032168 | Bacteria | 2298 |
| 472 | Ga0316593_10031057 | 3300032168 | Bacteria | 1738 |
| 473 | Ga0316593_10039047 | 3300032168 | Bacteria | 1574 |
| 474 | Ga0316593_10046365 | 3300032168 | Bacteria | 1459 |
| 475 | Ga0316593_10073690 | 3300032168 | Bacteria | 1183 |
| 476 | Ga0316593_10173446 | 3300032168 | Bacteria | 791 |
| 477 | Ga0316593_10316729 | 3300032168 | Bacteria | 592 |
| 478 | Ga0316593_10322666 | 3300032168 | Bacteria | 587 |
| 479 | Ga0316592_1155182 | 3300033524 | Bacteria | 541 |
| 480 | Ga0316586_1075717 | 3300033527 | Bacteria | 624 |
| 481 | Ga0316596_1000357 | 3300033541 | Bacteria | 7472 |
| 482 | Ga0316596_1011271 | 3300033541 | Bacteria | 2181 |
| 483 | Ga0316596_1013554 | 3300033541 | Bacteria | 2015 |
| 484 | Ga0316596_1027389 | 3300033541 | Bacteria | 1471 |
| 485 | Ga0316596_1029345 | 3300033541 | Bacteria | 1423 |
| 486 | Ga0316596_1038833 | 3300033541 | Bacteria | 1248 |
| 487 | Ga0316596_1074651 | 3300033541 | Bacteria | 909 |
| 488 | Ga0316596_1133759 | 3300033541 | Bacteria | 678 |
| 489 | Ga0316596_1207472 | 3300033541 | Bacteria | 546 |
| 490 | Ga0373930_0094254 | 3300034816 | Bacteria | 705 |
| 491 | Ga0373938_0079650 | 3300034957 | Bacteria | 796 |
| 492 | Ga0373934_0026886 | 3300035086 | Bacteria | 2233 |
| 493 | Ga0373934_0061966 | 3300035086 | Bacteria | 1490 |
| 494 | Ga0373951_0175613 | 3300035091 | Bacteria | 613 |
| 495 | Ga0373923_0041195 | 3300035111 | Bacteria | 1903 |
| 496 | Ga0373932_0292692 | 3300035112 | Bacteria | 605 |
| 497 | Ga0373936_0263778 | 3300035113 | Bacteria | 771 |
| 498 | Ga0373936_0476353 | 3300035113 | Bacteria | 579 |
| 499 | Ga0373953_0068844 | 3300035117 | Bacteria | 1457 |
| 500 | Ga0373954_0196606 | 3300035118 | Bacteria | 990 |
| 501 | Ga0373956_0000024 | 3300035119 | Bacteria | 47805 |
| 502 | Ga0373956_0017108 | 3300035119 | Bacteria | 3053 |
| 503 | Ga0373943_0366924 | 3300035170 | Bacteria | 827 |
| 504 | Ga0373943_0389702 | 3300035170 | Bacteria | 803 |
| 505 | Ga0373946_0080067 | 3300035171 | Bacteria | 1428 |
| 506 | Ga0373946_0456464 | 3300035171 | Bacteria | 651 |
| 507 | Ga0373946_0750237 | 3300035171 | Bacteria | 512 |
| 508 | Ga0373955_0016875 | 3300035172 | Bacteria | 3601 |
| 509 | Ga0373955_0394464 | 3300035172 | Bacteria | 840 |
| 510 | Ga0373955_0675983 | 3300035172 | Bacteria | 633 |
| 511 | Ga0373962_0121263 | 3300035242 | Bacteria | 834 |
| 512 | Ga0316574_0000748 | 3300035398 | Bacteria | 13973 |
| 513 | Ga0316574_0001967 | 3300035398 | Bacteria | 10086 |
| 514 | Ga0316574_0004868 | 3300035398 | Bacteria | 7112 |
| 515 | Ga0316574_0006357 | 3300035398 | Bacteria | 6381 |
| 516 | Ga0316574_0019010 | 3300035398 | Bacteria | 4048 |
| 517 | Ga0316574_0026509 | 3300035398 | Bacteria | 3486 |
| 518 | Ga0316574_0072040 | 3300035398 | Bacteria | 2183 |
| 519 | Ga0316574_0096801 | 3300035398 | Bacteria | 1886 |
| 520 | Ga0316574_0112688 | 3300035398 | Bacteria | 1744 |
| 521 | Ga0316574_0117769 | 3300035398 | Bacteria | 1704 |
| 522 | Ga0316574_0149683 | 3300035398 | Bacteria | 1504 |
| 523 | Ga0316574_0171803 | 3300035398 | Bacteria | 1395 |
| 524 | Ga0316574_0223115 | 3300035398 | Bacteria | 1207 |
| 525 | Ga0316574_0229180 | 3300035398 | Bacteria | 1189 |
| 526 | Ga0316574_0353425 | 3300035398 | Bacteria | 929 |
| 527 | Ga0316574_0354581 | 3300035398 | Bacteria | 928 |
| 528 | Ga0316574_0387049 | 3300035398 | Bacteria | 882 |
| 529 | Ga0316574_0651368 | 3300035398 | Bacteria | 648 |
| 530 | Ga0316574_0672537 | 3300035398 | Bacteria | 636 |
| 531 | Ga0373924_0011697 | 3300035410 | Bacteria | 3264 |
| 532 | Ga0373931_0154429 | 3300035691 | Bacteria | 1340 |
| 533 | Ga0373931_0171989 | 3300035691 | Bacteria | 1277 |
| 534 | Ga0373931_0649595 | 3300035691 | Bacteria | 693 |
| 535 | Ga0373935_0403092 | 3300035692 | Bacteria | 982 |
| 536 | Ga0373935_0872395 | 3300035692 | Bacteria | 666 |
| 537 | Ga0373935_1372708 | 3300035692 | Bacteria | 528 |
| 538 | Ga0373927_0095027 | 3300035695 | Bacteria | 1937 |
| 539 | Ga0373933_0001797 | 3300035724 | Bacteria | 12425 |
| 540 | Ga0373933_0625137 | 3300035724 | Bacteria | 707 |
| 541 | Ga0373947_0133470 | 3300035725 | Bacteria | 1587 |
| 542 | Ga0373947_0555010 | 3300035725 | Bacteria | 782 |
| 543 | Ga0373937_0071339 | 3300036401 | Bacteria | 3203 |
| 544 | Ga0373937_0538608 | 3300036401 | Bacteria | 1109 |
| 545 | Ga0373937_0549442 | 3300036401 | Bacteria | 1097 |
| 546 | Ga0373937_0833286 | 3300036401 | Bacteria | 870 |
| 547 | Ga0316582_0000356 | 3300036647 | Bacteria | 16270 |
| 548 | Ga0316582_0001138 | 3300036647 | Bacteria | 11320 |
| 549 | Ga0316582_0003304 | 3300036647 | Bacteria | 7870 |
| 550 | Ga0316582_0003393 | 3300036647 | Bacteria | 7806 |
| 551 | Ga0316582_0008678 | 3300036647 | Bacteria | 5470 |
| 552 | Ga0316582_0037790 | 3300036647 | Bacteria | 2996 |
| 553 | Ga0316582_0040423 | 3300036647 | Bacteria | 2910 |
| 554 | Ga0316582_0066343 | 3300036647 | Bacteria | 2326 |
| 555 | Ga0316582_0088588 | 3300036647 | Bacteria | 2033 |
| 556 | Ga0316582_0092240 | 3300036647 | Bacteria | 1995 |
| 557 | Ga0316582_0116838 | 3300036647 | Bacteria | 1781 |
| 558 | Ga0316582_0145162 | 3300036647 | Bacteria | 1601 |
| 559 | Ga0316582_0154190 | 3300036647 | Bacteria | 1554 |
| 560 | Ga0316582_0211340 | 3300036647 | Bacteria | 1325 |
| 561 | Ga0316582_0237126 | 3300036647 | Bacteria | 1249 |
| 562 | Ga0316582_0276998 | 3300036647 | Bacteria | 1151 |
| 563 | Ga0316582_0434745 | 3300036647 | Bacteria | 904 |
| 564 | Ga0316582_0443962 | 3300036647 | Bacteria | 894 |
| 565 | Ga0316582_0651361 | 3300036647 | Bacteria | 724 |
| 566 | Ga0316582_0741101 | 3300036647 | Bacteria | 674 |
| 567 | Ga0316584_0003189 | 3300036712 | Bacteria | 10613 |
| 568 | Ga0316584_0003517 | 3300036712 | Bacteria | 10214 |
| 569 | Ga0316584_0005698 | 3300036712 | Bacteria | 8383 |
| 570 | Ga0316584_0005825 | 3300036712 | Bacteria | 8316 |
| 571 | Ga0316584_0022402 | 3300036712 | Bacteria | 4607 |
| 572 | Ga0316584_0076465 | 3300036712 | Bacteria | 2509 |
| 573 | Ga0316584_0094405 | 3300036712 | Bacteria | 2240 |
| 574 | Ga0316584_0138016 | 3300036712 | Bacteria | 1819 |
| 575 | Ga0316584_0585754 | 3300036712 | Bacteria | 775 |
| 576 | Ga0316584_0965838 | 3300036712 | Bacteria | 570 |
| 577 | Ga0316584_1146010 | 3300036712 | Bacteria | 515 |
| 578 | Ga0316584_1200895 | 3300036712 | Bacteria | 500 |
| 579 | Ga0373925_0086034 | 3300037068 | Bacteria | 2397 |
| 580 | Ga0373925_0211615 | 3300037068 | Bacteria | 1544 |
| 581 | Ga0395905_0000050 | 3300037471 | Bacteria | 223801 |
| 582 | Ga0316581_0029303 | 3300037588 | Bacteria | 1652 |
| 583 | Ga0316581_0031542 | 3300037588 | Bacteria | 1597 |
| 584 | Ga0316581_0143840 | 3300037588 | Bacteria | 735 |
| 585 | Ga0400484_24412 | 3300038725 | Bacteria | 11780 |
| 586 | Ga0400484_38179 | 3300038725 | Bacteria | 1192 |
| 587 | Ga0400490_11517 | 3300038726 | Bacteria | 2941 |
| 588 | Ga0400490_13120 | 3300038726 | Bacteria | 11388 |
| 589 | Ga0400490_18522 | 3300038726 | Bacteria | 2509 |
| 590 | Ga0400490_22126 | 3300038726 | Bacteria | 6709 |
| 591 | Ga0400490_23950 | 3300038726 | Bacteria | 14629 |
| 592 | Ga0400490_30842 | 3300038726 | Bacteria | 4132 |
| 593 | Ga0400490_48844 | 3300038726 | Bacteria | 4879 |
| 594 | Ga0400491_01922 | 3300038727 | Bacteria | 1251 |
| 595 | Ga0400491_24888 | 3300038727 | Bacteria | 2019 |
| 596 | Ga0400485_14652 | 3300038735 | Bacteria | 151508 |
| 597 | Ga0400485_17084 | 3300038735 | Bacteria | 1085 |
| 598 | Ga0400485_19195 | 3300038735 | Bacteria | 9706 |
| 599 | Ga0400488_17899 | 3300038741 | Bacteria | 4212 |
| 600 | Ga0400488_18723 | 3300038741 | Bacteria | 3676 |
| 601 | Ga0400488_34854 | 3300038741 | Bacteria | 17853 |
| 602 | Ga0400488_45757 | 3300038741 | Bacteria | 1781 |
| 603 | Ga0400488_48988 | 3300038741 | Bacteria | 2734 |
| 604 | Ga0400488_62546 | 3300038741 | Bacteria | 4072 |
| 605 | Ga0400486_01330 | 3300038742 | Bacteria | 81885 |
| 606 | Ga0400486_08001 | 3300038742 | Bacteria | 1816 |
| 607 | Ga0400486_26876 | 3300038742 | Bacteria | 1130 |
| 608 | Ga0400486_31436 | 3300038742 | Bacteria | 10731 |
| 609 | Ga0400483_023047 | 3300039062 | Bacteria | 3525 |
| 610 | Ga0400483_023048 | 3300039062 | Bacteria | 3956 |
| 611 | Ga0400483_068582 | 3300039062 | Bacteria | 10539 |
| 612 | Ga0400483_068705 | 3300039062 | Bacteria | 4495 |
| 613 | Ga0400483_075161 | 3300039062 | Bacteria | 103046 |
| 614 | Ga0400483_076132 | 3300039062 | Bacteria | 2565 |
| 615 | Ga0400483_093628 | 3300039062 | Bacteria | 14526 |
| 616 | Ga0400483_105262 | 3300039062 | Bacteria | 6746 |
| 617 | Ga0400483_130844 | 3300039062 | Bacteria | 10521 |
| 618 | Ga0400483_152590 | 3300039062 | Bacteria | 7611 |
| 619 | Ga0400483_164381 | 3300039062 | Bacteria | 3885 |
| 620 | Ga0400483_171387 | 3300039062 | Bacteria | 1127 |
| 621 | Ga0400483_187275 | 3300039062 | Bacteria | 48736 |
| 622 | Ga0400483_218008 | 3300039062 | Bacteria | 3602 |
| 623 | Ga0400483_220571 | 3300039062 | Bacteria | 6251 |
| 624 | Ga0400483_239456 | 3300039062 | Bacteria | 7377 |
| 625 | Ga0400483_249287 | 3300039062 | Bacteria | 4354 |
| 626 | Ga0400483_289306 | 3300039062 | Bacteria | 4070 |
| 627 | Ga0400483_291627 | 3300039062 | Bacteria | 1094 |
| 628 | Ga0400489_46000 | 3300039093 | Bacteria | 4389 |
| 629 | Ga0400487_02579 | 3300039110 | Bacteria | 6502 |
| 630 | Ga0400487_23468 | 3300039110 | Bacteria | 5660 |
| 631 | Ga0400487_34970 | 3300039110 | Bacteria | 222491 |
| 632 | Ga0400487_64287 | 3300039110 | Bacteria | 4533 |
| 633 | Ga0400487_65366 | 3300039110 | Bacteria | 123063 |
| 634 | Ga0436365_1585837 | 3300039437 | Bacteria | 2279 |
| 635 | Ga0436365_1613017 | 3300039437 | Bacteria | 128504 |
| 636 | Ga0439438_003058 | 3300041405 | Bacteria | 6878 |
| 637 | Ga0439438_019507 | 3300041405 | Bacteria | 1915 |
| 638 | Ga0439439_0107193 | 3300041406 | Bacteria | 772 |
| 639 | Ga0439447_159608 | 3300041407 | Bacteria | 519 |
| 640 | Ga0439466_0042115 | 3300041411 | Bacteria | 1521 |
| 641 | Ga0451851_0919370 | 3300041507 | Bacteria | 906 |
| 642 | Ga0451853_1858486 | 3300041512 | Bacteria | 5832 |
| 643 | Ga0439432_007984 | 3300042006 | Bacteria | 3732 |
| 644 | Ga0439432_018173 | 3300042006 | Bacteria | 2353 |
| 645 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 646 | Ga0439452_000036 | 3300042010 | Bacteria | 158675 |
| 647 | Ga0439452_000270 | 3300042010 | Bacteria | 34501 |
| 648 | Ga0450900_006194 | 3300042136 | Bacteria | 1440 |
| 649 | Ga0439464_0013001 | 3300042439 | Bacteria | 2223 |
| 650 | Ga0439464_0016542 | 3300042439 | Bacteria | 1995 |
| 651 | Ga0451577_0101028 | 3300042876 | Bacteria | 2577 |
| 652 | Ga0451577_0246453 | 3300042876 | Bacteria | 1617 |
| 653 | Ga0451577_0251020 | 3300042876 | Bacteria | 1601 |
| 654 | Ga0451577_0531454 | 3300042876 | Bacteria | 1068 |
| 655 | Ga0451577_0538398 | 3300042876 | Bacteria | 1060 |
| 656 | Ga0453683_0145204 | 3300044673 | Bacteria | 1498 |
| 657 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 658 | Ga0453684_0007382 | 3300044712 | Bacteria | 20255 |
| 659 | Ga0453684_0264256 | 3300044712 | Bacteria | 1970 |
| 660 | Ga0453684_0540007 | 3300044712 | Bacteria | 1286 |
| 661 | Ga0453684_1033249 | 3300044712 | Bacteria | 872 |
| 662 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 663 | Ga0451576_0000461 | 3300045051 | Bacteria | 92083 |
| 664 | Ga0451576_0066240 | 3300045051 | Bacteria | 3760 |
| 665 | Ga0451576_0134068 | 3300045051 | Bacteria | 2582 |
| 666 | Ga0451576_0171590 | 3300045051 | Bacteria | 2264 |
| 667 | Ga0451576_0566285 | 3300045051 | Bacteria | 1194 |
| 668 | Ga0451576_0864672 | 3300045051 | Bacteria | 949 |
| 669 | Ga0451576_0909564 | 3300045051 | Bacteria | 923 |
| 670 | Ga0495627_000433 | 3300046453 | Bacteria | 36340 |
| 671 | Ga0495592_0001313 | 3300046454 | Bacteria | 17257 |
| 672 | Ga0495592_0035700 | 3300046454 | Bacteria | 3745 |
| 673 | Ga0495592_0076229 | 3300046454 | Bacteria | 2433 |
| 674 | Ga0495592_0087719 | 3300046454 | Bacteria | 2237 |
| 675 | Ga0495603_0051535 | 3300046455 | Bacteria | 2445 |
| 676 | Ga0495590_0005690 | 3300046457 | Bacteria | 4901 |
| 677 | Ga0495591_000066 | 3300046458 | Bacteria | 121317 |
| 678 | Ga0495591_005751 | 3300046458 | Bacteria | 5651 |
| 679 | Ga0495629_0008262 | 3300046459 | Bacteria | 7654 |
| 680 | Ga0495629_0009715 | 3300046459 | Bacteria | 7025 |
| 681 | Ga0495629_0099939 | 3300046459 | Bacteria | 2024 |
| 682 | Ga0495638_0005497 | 3300046460 | Bacteria | 9420 |
| 683 | Ga0495641_0019820 | 3300046461 | Bacteria | 3429 |
| 684 | Ga0495641_0024414 | 3300046461 | Bacteria | 2984 |
| 685 | Ga0495651_0001164 | 3300046462 | Bacteria | 20299 |
| 686 | Ga0495651_0003321 | 3300046462 | Bacteria | 12354 |
| 687 | Ga0495651_0221737 | 3300046462 | Bacteria | 1308 |
| 688 | Ga0495651_0435522 | 3300046462 | Bacteria | 850 |
| 689 | Ga0495651_0899396 | 3300046462 | Bacteria | 541 |
| 690 | Ga0495653_0001712 | 3300046463 | Bacteria | 17277 |
| 691 | Ga0495653_0045461 | 3300046463 | Bacteria | 3404 |
| 692 | Ga0495653_0064843 | 3300046463 | Bacteria | 2751 |
| 693 | Ga0495653_0069955 | 3300046463 | Bacteria | 2627 |
| 694 | Ga0495650_0000326 | 3300046471 | Bacteria | 85267 |
| 695 | Ga0495650_0009064 | 3300046471 | Bacteria | 5708 |
| 696 | Ga0495650_0013790 | 3300046471 | Bacteria | 4251 |
| 697 | Ga0495580_0001745 | 3300046472 | Bacteria | 19125 |
| 698 | Ga0495580_0044244 | 3300046472 | Bacteria | 3167 |
| 699 | Ga0495580_0088429 | 3300046472 | Bacteria | 2157 |
| 700 | Ga0495582_0005561 | 3300046473 | Bacteria | 7017 |
| 701 | Ga0495582_0144212 | 3300046473 | Bacteria | 1350 |
| 702 | Ga0495605_0007456 | 3300046474 | Bacteria | 6208 |
| 703 | Ga0495639_0055350 | 3300046475 | Bacteria | 1809 |
| 704 | Ga0495662_0036737 | 3300046476 | Bacteria | 2364 |
| 705 | Ga0495662_0044605 | 3300046476 | Bacteria | 2140 |
| 706 | Ga0495662_0060251 | 3300046476 | Bacteria | 1833 |
| 707 | Ga0495662_0093033 | 3300046476 | Bacteria | 1471 |
| 708 | Ga0495664_0003770 | 3300046477 | Bacteria | 8269 |
| 709 | Ga0495664_0070366 | 3300046477 | Bacteria | 2089 |
| 710 | Ga0495664_0106516 | 3300046477 | Bacteria | 1690 |
| 711 | Ga0495664_0522093 | 3300046477 | Bacteria | 708 |
| 712 | Ga0495594_0085091 | 3300046499 | Bacteria | 1769 |
| 713 | Ga0495594_0085339 | 3300046499 | Bacteria | 1766 |
| 714 | Ga0495596_0009887 | 3300046500 | Bacteria | 4180 |
| 715 | Ga0495596_0032104 | 3300046500 | Bacteria | 2095 |
| 716 | Ga0495606_0002813 | 3300046507 | Bacteria | 19352 |
| 717 | Ga0495606_0019929 | 3300046507 | Bacteria | 4966 |
| 718 | Ga0495606_0028739 | 3300046507 | Bacteria | 3916 |
| 719 | Ga0495608_0004176 | 3300046511 | Bacteria | 10359 |
| 720 | Ga0495608_0026692 | 3300046511 | Bacteria | 3935 |
| 721 | Ga0495608_0026754 | 3300046511 | Bacteria | 3931 |
| 722 | Ga0495608_0084657 | 3300046511 | Bacteria | 2056 |
| 723 | Ga0495610_0014021 | 3300046512 | Bacteria | 4733 |
| 724 | Ga0495618_0020240 | 3300046514 | Bacteria | 4097 |
| 725 | Ga0495618_0106945 | 3300046514 | Bacteria | 1791 |
| 726 | Ga0495618_0256069 | 3300046514 | Bacteria | 1097 |
| 727 | Ga0495620_0019454 | 3300046515 | Bacteria | 3338 |
| 728 | Ga0495628_0011513 | 3300046516 | Bacteria | 7477 |
| 729 | Ga0495628_0029916 | 3300046516 | Bacteria | 4412 |
| 730 | Ga0495628_0033225 | 3300046516 | Bacteria | 4159 |
| 731 | Ga0495628_0065873 | 3300046516 | Bacteria | 2832 |
| 732 | Ga0495628_0124454 | 3300046516 | Bacteria | 1976 |
| 733 | Ga0495628_0367357 | 3300046516 | Bacteria | 1055 |
| 734 | Ga0495630_0018171 | 3300046517 | Bacteria | 5163 |
| 735 | Ga0495630_0053365 | 3300046517 | Bacteria | 3026 |
| 736 | Ga0495630_0053406 | 3300046517 | Bacteria | 3025 |
| 737 | Ga0495630_0263267 | 3300046517 | Bacteria | 1317 |
| 738 | Ga0495630_0686498 | 3300046517 | Bacteria | 783 |
| 739 | Ga0495643_0107211 | 3300046522 | Bacteria | 1425 |
| 740 | Ga0495643_0126123 | 3300046522 | Bacteria | 1289 |
| 741 | Ga0495648_0033444 | 3300046524 | Bacteria | 3356 |
| 742 | Ga0495648_0036486 | 3300046524 | Bacteria | 3170 |
| 743 | Ga0495663_0317091 | 3300046525 | Bacteria | 564 |
| 744 | Ga0495666_0001724 | 3300046526 | Bacteria | 10786 |
| 745 | Ga0495666_0004045 | 3300046526 | Bacteria | 7413 |
| 746 | Ga0495666_0014527 | 3300046526 | Bacteria | 3921 |
| 747 | Ga0495666_0031606 | 3300046526 | Bacteria | 2593 |
| 748 | Ga0495652_0019979 | 3300046529 | Bacteria | 5957 |
| 749 | Ga0495652_0087237 | 3300046529 | Bacteria | 2559 |
| 750 | Ga0495652_0092003 | 3300046529 | Bacteria | 2478 |
| 751 | Ga0495652_0259508 | 3300046529 | Bacteria | 1283 |
| 752 | Ga0495652_1122335 | 3300046529 | Bacteria | 510 |
| 753 | Ga0495654_0000964 | 3300046530 | Bacteria | 21224 |
| 754 | Ga0495654_0016345 | 3300046530 | Bacteria | 3926 |
| 755 | Ga0495665_0005305 | 3300046531 | Bacteria | 6945 |
| 756 | Ga0495665_0006059 | 3300046531 | Bacteria | 6522 |
| 757 | Ga0495665_0009459 | 3300046531 | Bacteria | 5275 |
| 758 | Ga0495665_0063494 | 3300046531 | Bacteria | 1949 |
| 759 | Ga0495640_0007608 | 3300046533 | Bacteria | 8513 |
| 760 | Ga0495640_0010353 | 3300046533 | Bacteria | 7209 |
| 761 | Ga0495640_0394283 | 3300046533 | Bacteria | 850 |
| 762 | Ga0495586_0004361 | 3300046535 | Bacteria | 7563 |
| 763 | Ga0495586_0052836 | 3300046535 | Bacteria | 2200 |
| 764 | Ga0495586_0151331 | 3300046535 | Bacteria | 1305 |
| 765 | Ga0495587_0000845 | 3300046536 | Bacteria | 20252 |
| 766 | Ga0495587_0022745 | 3300046536 | Bacteria | 3857 |
| 767 | Ga0495587_0053763 | 3300046536 | Bacteria | 2373 |
| 768 | Ga0495621_0021458 | 3300046539 | Bacteria | 2129 |
| 769 | Ga0495597_0001266 | 3300046542 | Bacteria | 18625 |
| 770 | Ga0495597_0111126 | 3300046542 | Bacteria | 1149 |
| 771 | Ga0495645_0005078 | 3300046543 | Bacteria | 9021 |
| 772 | Ga0495645_0060781 | 3300046543 | Bacteria | 2738 |
| 773 | Ga0495645_0600156 | 3300046543 | Bacteria | 677 |
| 774 | Ga0495645_0694729 | 3300046543 | Bacteria | 618 |
| 775 | Ga0495622_0087462 | 3300046557 | Bacteria | 1433 |
| 776 | Ga0495633_0360525 | 3300046558 | Bacteria | 658 |
| 777 | Ga0495667_0047368 | 3300046559 | Bacteria | 2841 |
| 778 | Ga0495667_0389617 | 3300046559 | Bacteria | 878 |
| 779 | Ga0495634_0005222 | 3300046642 | Bacteria | 10032 |
| 780 | Ga0495634_0010809 | 3300046642 | Bacteria | 6677 |
| 781 | Ga0495634_0014642 | 3300046642 | Bacteria | 5649 |
| 782 | Ga0495634_0130899 | 3300046642 | Bacteria | 1599 |
| 783 | Ga0495625_0002671 | 3300046660 | Bacteria | 18973 |
| 784 | Ga0495635_0020425 | 3300046663 | Bacteria | 4613 |
| 785 | Ga0495635_0023389 | 3300046663 | Bacteria | 4306 |
| 786 | Ga0495635_0042769 | 3300046663 | Bacteria | 3127 |
| 787 | Ga0495635_0170115 | 3300046663 | Bacteria | 1482 |
| 788 | Ga0495661_0017977 | 3300046665 | Bacteria | 4658 |
| 789 | Ga0495661_0032063 | 3300046665 | Bacteria | 3325 |
| 790 | Ga0495588_0029013 | 3300046674 | Bacteria | 2773 |
| 791 | Ga0495588_0103118 | 3300046674 | Bacteria | 1500 |
| 792 | Ga0495657_0011839 | 3300046675 | Bacteria | 6502 |
| 793 | Ga0495657_0130660 | 3300046675 | Bacteria | 1573 |
| 794 | Ga0495657_0319775 | 3300046675 | Bacteria | 922 |
| 795 | Ga0495599_0018741 | 3300046678 | Bacteria | 4313 |
| 796 | Ga0495599_0026148 | 3300046678 | Bacteria | 3657 |
| 797 | Ga0495599_0045972 | 3300046678 | Bacteria | 2738 |
| 798 | Ga0495599_0058244 | 3300046678 | Bacteria | 2417 |
| 799 | Ga0495599_0546512 | 3300046678 | Bacteria | 678 |
| 800 | Ga0495623_0071830 | 3300046679 | Bacteria | 2152 |
| 801 | Ga0495623_0216904 | 3300046679 | Bacteria | 1092 |
| 802 | Ga0495646_0004507 | 3300046680 | Bacteria | 8768 |
| 803 | Ga0495646_0021509 | 3300046680 | Bacteria | 4073 |
| 804 | Ga0495646_0096810 | 3300046680 | Bacteria | 1696 |
| 805 | Ga0495647_0028969 | 3300046681 | Bacteria | 2044 |
| 806 | Ga0495658_0176625 | 3300046683 | Bacteria | 1323 |
| 807 | Ga0495669_0126951 | 3300046684 | Bacteria | 1199 |
| 808 | Ga0495613_0015752 | 3300046689 | Bacteria | 5627 |
| 809 | Ga0495613_0020692 | 3300046689 | Bacteria | 4905 |
| 810 | Ga0495613_0516682 | 3300046689 | Bacteria | 802 |
| 811 | Ga0495624_0020183 | 3300046690 | Bacteria | 4438 |
| 812 | Ga0495624_0088756 | 3300046690 | Bacteria | 1908 |
| 813 | Ga0495624_0118496 | 3300046690 | Bacteria | 1626 |
| 814 | Ga0495624_0130548 | 3300046690 | Bacteria | 1540 |
| 815 | Ga0495624_0544477 | 3300046690 | Bacteria | 693 |
| 816 | Ga0495670_0353466 | 3300046691 | Bacteria | 791 |
| 817 | Ga0495649_0001045 | 3300046694 | Bacteria | 21720 |
| 818 | Ga0495649_0001390 | 3300046694 | Bacteria | 18291 |
| 819 | Ga0495649_0006282 | 3300046694 | Bacteria | 7395 |
| 820 | Ga0495649_0136022 | 3300046694 | Bacteria | 1295 |
| 821 | Ga0495649_0325329 | 3300046694 | Bacteria | 780 |
| 822 | Ga0495589_0000032 | 3300046794 | Bacteria | 167736 |
| 823 | Ga0495589_0022934 | 3300046794 | Bacteria | 3181 |
| 824 | Ga0495589_0296103 | 3300046794 | Bacteria | 750 |
| 825 | Ga0495600_0015117 | 3300046809 | Bacteria | 4875 |
| 826 | Ga0495600_0078879 | 3300046809 | Bacteria | 2150 |
| 827 | Ga0495600_0109577 | 3300046809 | Bacteria | 1798 |
| 828 | Ga0495660_0046599 | 3300046810 | Bacteria | 2377 |
| 829 | Ga0495581_0001049 | 3300047315 | Bacteria | 14962 |
| 830 | Ga0495581_0018271 | 3300047315 | Bacteria | 4072 |
| 831 | Ga0495604_0001474 | 3300047317 | Bacteria | 19379 |
| 832 | Ga0495604_0018792 | 3300047317 | Bacteria | 5534 |
| 833 | Ga0495604_0028929 | 3300047317 | Bacteria | 4408 |
| 834 | Ga0495604_0046393 | 3300047317 | Bacteria | 3387 |
| 835 | Ga0495604_0410842 | 3300047317 | Bacteria | 890 |
| 836 | Ga0495674_0032854 | 3300047319 | Bacteria | 4703 |
| 837 | Ga0495674_0046785 | 3300047319 | Bacteria | 3839 |
| 838 | Ga0495674_0058935 | 3300047319 | Bacteria | 3354 |
| 839 | Ga0495674_0092710 | 3300047319 | Bacteria | 2578 |
| 840 | Ga0495674_0338292 | 3300047319 | Bacteria | 1223 |
| 841 | Ga0495674_1420440 | 3300047319 | Bacteria | 516 |
| 842 | Ga0495672_0000156 | 3300047320 | Bacteria | 98712 |
| 843 | Ga0495672_0139772 | 3300047320 | Bacteria | 1266 |
| 844 | Ga0495676_0045713 | 3300047321 | Bacteria | 3560 |
| 845 | Ga0495676_0048592 | 3300047321 | Bacteria | 3419 |
| 846 | Ga0495676_0057991 | 3300047321 | Bacteria | 3050 |
| 847 | Ga0495680_0006154 | 3300047322 | Bacteria | 11193 |
| 848 | Ga0495680_0017184 | 3300047322 | Bacteria | 6187 |
| 849 | Ga0495680_0068306 | 3300047322 | Bacteria | 2715 |
| 850 | Ga0495680_0112126 | 3300047322 | Bacteria | 2020 |
| 851 | Ga0495683_0006981 | 3300047323 | Bacteria | 6132 |
| 852 | Ga0495687_019977 | 3300047443 | Bacteria | 3274 |
| 853 | Ga0495675_0010643 | 3300047444 | Bacteria | 5751 |
| 854 | Ga0495675_0020929 | 3300047444 | Bacteria | 4163 |
| 855 | Ga0495675_0036406 | 3300047444 | Bacteria | 3139 |
| 856 | Ga0495679_000195 | 3300047446 | Bacteria | 53965 |
| 857 | Ga0495679_001999 | 3300047446 | Bacteria | 10815 |
| 858 | Ga0495679_002765 | 3300047446 | Bacteria | 8729 |
| 859 | Ga0495679_006165 | 3300047446 | Bacteria | 5214 |
| 860 | Ga0495681_0131001 | 3300047470 | Bacteria | 1067 |
| 861 | Ga0495681_0209986 | 3300047470 | Bacteria | 785 |
| 862 | Ga0495684_0156547 | 3300047471 | Bacteria | 1701 |
| 863 | Ga0495684_0458328 | 3300047471 | Bacteria | 884 |
| 864 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 865 | Ga0495686_0433351 | 3300047472 | Bacteria | 701 |
| 866 | Ga0495593_0008398 | 3300047673 | Bacteria | 6005 |
| 867 | Ga0495593_0012038 | 3300047673 | Bacteria | 4958 |
| 868 | Ga0495602_0011608 | 3300048088 | Bacteria | 9101 |
| 869 | Ga0495602_0044036 | 3300048088 | Bacteria | 4051 |
| 870 | Ga0495602_0070335 | 3300048088 | Bacteria | 2995 |
| 871 | Ga0495602_0083251 | 3300048088 | Bacteria | 2681 |
| 872 | Ga0495614_0000826 | 3300048089 | Bacteria | 13085 |
| 873 | Ga0495614_0003464 | 3300048089 | Bacteria | 7057 |
| 874 | Ga0495614_0262032 | 3300048089 | Bacteria | 793 |
| 875 | Ga0495626_0087058 | 3300048091 | Bacteria | 1379 |
| 876 | Ga0496100_0494036 | 3300048903 | Bacteria | 942 |
| 877 | Ga0496101_1025543 | 3300048904 | Bacteria | 649 |
| 878 | Ga0496102_0069517 | 3300048905 | Bacteria | 3232 |
| 879 | Ga0496102_1572291 | 3300048905 | Bacteria | 576 |
| 880 | Ga0496103_0021032 | 3300048906 | Bacteria | 3924 |
| 881 | Ga0496103_0133620 | 3300048906 | Bacteria | 1585 |
| 882 | Ga0496104_0764620 | 3300048907 | Bacteria | 873 |
| 883 | Ga0496105_0799561 | 3300048908 | Bacteria | 717 |
| 884 | Ga0496106_0000023 | 3300048909 | Bacteria | 165457 |
| 885 | Ga0496110_0177508 | 3300048913 | Bacteria | 1934 |
| 886 | Ga0496111_0167246 | 3300048914 | Bacteria | 1633 |
| 887 | Ga0496112_0501198 | 3300048915 | Bacteria | 1150 |
| 888 | Ga0496113_0531412 | 3300048916 | Bacteria | 944 |
| 889 | Ga0496115_0457801 | 3300048918 | Bacteria | 1030 |
| 890 | Ga0496116_0000007 | 3300048919 | Bacteria | 795464 |
| 891 | Ga0496116_0003553 | 3300048919 | Bacteria | 15330 |
| 892 | Ga0496116_0012961 | 3300048919 | Bacteria | 6763 |
| 893 | Ga0496117_0003271 | 3300048920 | Bacteria | 19041 |
| 894 | Ga0496117_0003856 | 3300048920 | Bacteria | 17063 |
| 895 | Ga0496117_0019314 | 3300048920 | Bacteria | 5603 |
| 896 | Ga0496117_0040958 | 3300048920 | Bacteria | 3400 |
| 897 | Ga0496117_0075288 | 3300048920 | Bacteria | 2243 |
| 898 | Ga0496117_0111359 | 3300048920 | Bacteria | 1704 |
| 899 | Ga0496117_0164340 | 3300048920 | Bacteria | 1296 |
| 900 | Ga0496118_0001700 | 3300048921 | Bacteria | 32185 |
| 901 | Ga0496118_0001781 | 3300048921 | Bacteria | 31089 |
| 902 | Ga0496118_0010415 | 3300048921 | Bacteria | 9214 |
| 903 | Ga0496118_0021027 | 3300048921 | Bacteria | 5761 |
| 904 | Ga0496118_0030452 | 3300048921 | Bacteria | 4502 |
| 905 | Ga0496118_0053651 | 3300048921 | Bacteria | 3061 |
| 906 | Ga0496119_0000013 | 3300048922 | Bacteria | 323820 |
| 907 | Ga0496119_0001881 | 3300048922 | Bacteria | 24207 |
| 908 | Ga0496119_0090294 | 3300048922 | Bacteria | 1742 |
| 909 | Ga0496120_0003642 | 3300048923 | Bacteria | 13815 |
| 910 | Ga0496120_0007320 | 3300048923 | Bacteria | 8236 |
| 911 | Ga0496120_0020001 | 3300048923 | Bacteria | 4267 |
| 912 | Ga0496121_0004540 | 3300048924 | Bacteria | 18565 |
| 913 | Ga0496121_0005179 | 3300048924 | Bacteria | 16904 |
| 914 | Ga0496121_0012769 | 3300048924 | Bacteria | 9097 |
| 915 | Ga0496121_0066801 | 3300048924 | Bacteria | 2917 |
| 916 | Ga0496122_0000619 | 3300048925 | Bacteria | 72800 |
| 917 | Ga0496122_0000849 | 3300048925 | Bacteria | 57536 |
| 918 | Ga0496122_0001669 | 3300048925 | Bacteria | 34423 |
| 919 | Ga0496122_0123695 | 3300048925 | Bacteria | 1661 |
| 920 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 921 | Ga0496123_0001359 | 3300048926 | Bacteria | 34451 |
| 922 | Ga0496123_0001875 | 3300048926 | Bacteria | 27530 |
| 923 | Ga0496123_0112664 | 3300048926 | Bacteria | 1551 |
| 924 | Ga0496123_0254332 | 3300048926 | Bacteria | 864 |
| 925 | Ga0496124_0000049 | 3300048927 | Bacteria | 269753 |
| 926 | Ga0496124_0001722 | 3300048927 | Bacteria | 30829 |
| 927 | Ga0496124_0028242 | 3300048927 | Bacteria | 5021 |
| 928 | Ga0496124_0088620 | 3300048927 | Bacteria | 2529 |
| 929 | Ga0496124_0467276 | 3300048927 | Bacteria | 855 |
| 930 | Ga0496124_0567361 | 3300048927 | Bacteria | 745 |
| 931 | Ga0496124_0839208 | 3300048927 | Bacteria | 564 |
| 932 | Ga0496125_0000405 | 3300048928 | Bacteria | 80765 |
| 933 | Ga0496125_0046818 | 3300048928 | Bacteria | 3624 |
| 934 | Ga0496125_0084257 | 3300048928 | Bacteria | 2414 |
| 935 | Ga0496126_0000031 | 3300048929 | Bacteria | 373371 |
| 936 | Ga0496126_0034302 | 3300048929 | Bacteria | 4766 |
| 937 | Ga0496126_0078886 | 3300048929 | Bacteria | 2916 |
| 938 | Ga0496126_0372232 | 3300048929 | Bacteria | 1164 |
| 939 | Ga0496126_1304420 | 3300048929 | Bacteria | 528 |
| 940 | Ga0501261_041006 | 3300049690 | Bacteria | 731 |
| 941 | Ga0501280_004384 | 3300049776 | Bacteria | 2077 |
| 942 | nmdc:mga00v17_14683_c1 | 3300050491 | Bacteria | 4380 |
| 943 | nmdc:mga00v17_2036_c1 | 3300050491 | Bacteria | 10407 |
| 944 | nmdc:mga00v17_316684_c1 | 3300050491 | Bacteria | 1014 |
| 945 | nmdc:mga00v17_689621_c1 | 3300050491 | Bacteria | 655 |
| 946 | nmdc:mga00v17_920272_c1 | 3300050491 | Bacteria | 553 |
| 947 | nmdc:mga0k408_834066_c1 | 3300050493 | Bacteria | 536 |
| 948 | nmdc:mga0k408_9476_c1 | 3300050493 | Bacteria | 3352 |
| 949 | nmdc:mga05p37_1685756_c1 | 3300050507 | Bacteria | 619 |
| 950 | nmdc:mga09592_887527_c1 | 3300050508 | Bacteria | 750 |
| 951 | nmdc:mga0qj67_440290_c1 | 3300050509 | Bacteria | 1050 |
| 952 | nmdc:mga08y16_101458_c1 | 3300050511 | Bacteria | 2996 |
| 953 | nmdc:mga08y16_1567005_c1 | 3300050511 | Bacteria | 617 |
| 954 | nmdc:mga0n895_431777_c1 | 3300050512 | Bacteria | 1331 |
| 955 | nmdc:mga0n895_668864_c1 | 3300050512 | Bacteria | 1036 |
| 956 | nmdc:mga0n895_771058_c1 | 3300050512 | Bacteria | 954 |
| 957 | nmdc:mga0a205_543073_c1 | 3300050515 | Bacteria | 1018 |
| 958 | nmdc:mga0sz30_116226_c1 | 3300050516 | Bacteria | 1174 |
| 959 | Ga0495601_0007759 | 3300053077 | Bacteria | 6309 |
| 960 | Ga0495601_0053564 | 3300053077 | Bacteria | 2550 |
| 961 | Ga0495601_0146949 | 3300053077 | Bacteria | 1539 |
| 962 | Ga0495612_0049590 | 3300053078 | Bacteria | 1723 |
| 963 | Ga0495595_0021725 | 3300053084 | Bacteria | 2807 |
| 964 | Ga0495595_0073949 | 3300053084 | Bacteria | 1614 |
| 965 | Ga0495619_0262169 | 3300053085 | Bacteria | 1197 |
| 966 | Ga0466962_0428647 | 3300061719 | Bacteria | 664 |
| 967 | Ga0316586_1033341 | |||
| 968 | RicEn_C1984 | |||
| 969 | SwRhRL2b_contig_2515474 | |||
| 970 | SwRhRL2b_contig_3243000 | |||
| 971 | JGI24739J22299_10003976 | |||
| 972 | JGI24735J21928_10036514 | |||
| 973 | JGI24738J21930_10008726 | |||
| 974 | JGI25156J39149_1001614 | |||
| 975 | JGI25165J46597_1002430 | |||
| 976 | rootH1_10308890 | |||
| 977 | Ga0055533_1000300 | |||
| 978 | Ga0055533_1006544 | |||
| 979 | Ga0055532_1000001 | |||
| 980 | Ga0055527_1000002 | |||
| 981 | Ga0055527_1001325 | |||
| 982 | Ga0055535_1000001 | |||
| 983 | Ga0055535_1002900 | |||
| 984 | Ga0055542_1000001 | |||
| 985 | Ga0055529_1000001 | |||
| 986 | Ga0055529_1005550 | |||
| 987 | Ga0058692_1006038 | |||
| 988 | Ga0058692_1061626 | |||
| 989 | Ga0065704_10000456 | |||
| 990 | Ga0065704_10073661 | |||
| 991 | Ga0065704_10084188 | |||
| 992 | Ga0065704_10120659 | |||
| 993 | Ga0065712_10113238 | |||
| 994 | Ga0070658_10125382 | |||
| 995 | Ga0070658_10348780 | |||
| 996 | Ga0070658_10464939 | |||
| 997 | Ga0070690_100060000 | |||
| 998 | Ga0070690_101137090 | |||
| 999 | Ga0070670_100121801 | |||
| 1000 | Ga0070677_10739912 | |||
| 1001 | Ga0068869_100142867 | |||
| 1002 | Ga0068869_101085959 | |||
| 1003 | Ga0068868_100114481 | |||
| 1004 | Ga0068868_100134560 | |||
| 1005 | Ga0068868_101963374 | |||
| 1006 | Ga0070660_100298819 | |||
| 1007 | Ga0070660_100510107 | |||
| 1008 | Ga0070660_100849105 | |||
| 1009 | Ga0070689_100129868 | |||
| 1010 | Ga0070689_100181428 | |||
| 1011 | Ga0070689_100524344 | |||
| 1012 | Ga0070689_100785076 | |||
| 1013 | Ga0070687_100128442 | |||
| 1014 | Ga0070687_100580583 | |||
| 1015 | Ga0070661_100206043 | |||
| 1016 | Ga0070661_100597518 | |||
| 1017 | Ga0070692_11133852 | |||
| 1018 | Ga0070669_100443346 | |||
| 1019 | Ga0070675_100063736 | |||
| 1020 | Ga0070674_100688727 | |||
| 1021 | Ga0070673_100452017 | |||
| 1022 | Ga0070709_10596502 | |||
| 1023 | Ga0070713_100040111 | |||
| 1024 | Ga0070701_10175363 | |||
| 1025 | Ga0070711_100129730 | |||
| 1026 | Ga0070711_100664273 | |||
| 1027 | Ga0070700_101315065 | |||
| 1028 | Ga0070694_100570890 | |||
| 1029 | Ga0070694_101131353 | |||
| 1030 | Ga0070663_100239123 | |||
| 1031 | Ga0070678_100470936 | |||
| 1032 | Ga0070678_100652866 | |||
| 1033 | Ga0070681_10088625 | |||
| 1034 | Ga0070681_10627559 | |||
| 1035 | Ga0070681_10702598 | |||
| 1036 | Ga0068867_100057812 | |||
| 1037 | Ga0068867_100301413 | |||
| 1038 | Ga0070685_10475463 | |||
| 1039 | Ga0070707_102141001 | |||
| 1040 | Ga0070698_101617732 | |||
| 1041 | Ga0070679_100462873 | |||
| 1042 | Ga0068853_100558689 | |||
| 1043 | Ga0070686_100520399 | |||
| 1044 | Ga0070695_100195237 | |||
| 1045 | Ga0070695_100976294 | |||
| 1046 | Ga0070696_100887507 | |||
| 1047 | Ga0070693_100005048 | |||
| 1048 | Ga0070693_100357871 | |||
| 1049 | Ga0070693_100699790 | |||
| 1050 | Ga0070665_100001059 | |||
| 1051 | Ga0070665_100091129 | |||
| 1052 | Ga0070704_100018129 | |||
| 1053 | Ga0070704_100128921 | |||
| 1054 | Ga0070704_100244230 | |||
| 1055 | Ga0068855_100008249 | |||
| 1056 | Ga0070664_100808020 | |||
| 1057 | Ga0070664_101224579 | |||
| 1058 | Ga0068854_100132290 | |||
| 1059 | Ga0068854_100211793 | |||
| 1060 | Ga0068852_100002208 | |||
| 1061 | Ga0068852_101632820 | |||
| 1062 | Ga0068859_100337700 | |||
| 1063 | Ga0068864_100625080 | |||
| 1064 | Ga0068861_100282436 | |||
| 1065 | Ga0068861_101868485 | |||
| 1066 | Ga0068851_10018416 | |||
| 1067 | Ga0068858_100012301 | |||
| 1068 | Ga0068858_100159203 | |||
| 1069 | Ga0068858_101025234 | |||
| 1070 | Ga0068860_101435092 | |||
| 1071 | Ga0068862_101633005 | |||
| 1072 | Ga0068862_102011803 | |||
| 1073 | Ga0081539_10378110 | |||
| 1074 | Ga0075364_10002445 | |||
| 1075 | Ga0075364_10004592 | |||
| 1076 | Ga0075364_10007007 | |||
| 1077 | Ga0075364_10109884 | |||
| 1078 | Ga0070715_10094362 | |||
| 1079 | Ga0070716_100009989 | |||
| 1080 | Ga0070716_100359235 | |||
| 1081 | Ga0075367_10346117 | |||
| 1082 | Ga0075369_10147689 | |||
| 1083 | Ga0075366_10116574 | |||
| 1084 | Ga0097621_100007616 | |||
| 1085 | Ga0097621_100009054 | |||
| 1086 | Ga0097621_100086881 | |||
| 1087 | Ga0068871_100006498 | |||
| 1088 | Ga0068871_100072587 | |||
| 1089 | Ga0068871_100124948 | |||
| 1090 | Ga0068871_100335359 | |||
| 1091 | Ga0075428_100006503 | |||
| 1092 | Ga0075433_10674742 | |||
| 1093 | Ga0075433_10948002 | |||
| 1094 | Ga0075434_100047404 | |||
| 1095 | Ga0075434_100119458 | |||
| 1096 | Ga0075434_101562038 | |||
| 1097 | Ga0075429_100100535 | |||
| 1098 | Ga0068865_100073079 | |||
| 1099 | Ga0068865_100681850 | |||
| 1100 | Ga0068865_100724343 | |||
| 1101 | Ga0068865_101795990 | |||
| 1102 | Ga0075436_100184107 | |||
| 1103 | Ga0075436_100275520 | |||
| 1104 | Ga0097620_101474986 | |||
| 1105 | Ga0079104_1000075 | |||
| 1106 | Ga0079104_1000201 | |||
| 1107 | Ga0079104_1000365 | |||
| 1108 | Ga0079104_1000393 | |||
| 1109 | Ga0079104_1000633 | |||
| 1110 | Ga0079104_1004575 | |||
| 1111 | Ga0079104_1014486 | |||
| 1112 | Ga0079104_1093474 | |||
| 1113 | Ga0079104_1109260 | |||
| 1114 | Ga0075435_100745732 | |||
| 1115 | Ga0099794_10007400 | |||
| 1116 | Ga0099794_10048093 | |||
| 1117 | Ga0105251_10000059 | |||
| 1118 | Ga0105251_10000095 | |||
| 1119 | Ga0105251_10001934 | |||
| 1120 | Ga0105251_10002308 | |||
| 1121 | Ga0105251_10004319 | |||
| 1122 | Ga0105251_10013853 | |||
| 1123 | Ga0105251_10039845 | |||
| 1124 | Ga0105244_10000492 | |||
| 1125 | Ga0105244_10009735 | |||
| 1126 | Ga0105244_10016161 | |||
| 1127 | Ga0105244_10023125 | |||
| 1128 | Ga0105244_10179570 | |||
| 1129 | Ga0105250_10001437 | |||
| 1130 | Ga0105250_10003023 | |||
| 1131 | Ga0105250_10003263 | |||
| 1132 | Ga0105250_10014289 | |||
| 1133 | Ga0105250_10064963 | |||
| 1134 | Ga0105250_10406285 | |||
| 1135 | Ga0105240_10603666 | |||
| 1136 | Ga0105240_12058803 | |||
| 1137 | Ga0111539_10001926 | |||
| 1138 | Ga0105245_10063400 | |||
| 1139 | Ga0105245_10346774 | |||
| 1140 | Ga0105247_10000048 | |||
| 1141 | Ga0114129_12086825 | |||
| 1142 | Ga0105243_10390554 | |||
| 1143 | Ga0105243_10461327 | |||
| 1144 | Ga0105243_10834870 | |||
| 1145 | Ga0105241_10000011 | |||
| 1146 | Ga0105241_10485221 | |||
| 1147 | Ga0105241_10705625 | |||
| 1148 | Ga0105241_11987294 | |||
| 1149 | Ga0105242_10004829 | |||
| 1150 | Ga0105242_10058987 | |||
| 1151 | Ga0105242_10079008 | |||
| 1152 | Ga0105242_10275254 | |||
| 1153 | Ga0105242_10421353 | |||
| 1154 | Ga0105242_10717925 | |||
| 1155 | Ga0105242_11110735 | |||
| 1156 | Ga0105242_12175794 | |||
| 1157 | Ga0105248_10017686 | |||
| 1158 | Ga0105248_10571757 | |||
| 1159 | Ga0105248_10834109 | |||
| 1160 | Ga0105238_10298441 | |||
| 1161 | Ga0105238_10382073 | |||
| 1162 | Ga0105147_105402 | |||
| 1163 | Ga0105239_10782256 | |||
| 1164 | Ga0157373_10081290 | |||
| 1165 | Ga0157373_10081315 | |||
| 1166 | Ga0157371_10145974 | |||
| 1167 | Ga0157371_11189844 | |||
| 1168 | Ga0157370_10036610 | |||
| 1169 | Ga0157370_10860115 | |||
| 1170 | Ga0157370_11011251 | |||
| 1171 | Ga0157369_10117752 | |||
| 1172 | Ga0157369_10182804 | |||
| 1173 | Ga0157374_10000104 | |||
| 1174 | Ga0157374_10293378 | |||
| 1175 | Ga0157374_11071054 | |||
| 1176 | Ga0157378_10044245 | |||
| 1177 | Ga0157378_10180762 | |||
| 1178 | Ga0157378_11332658 | |||
| 1179 | Ga0163162_10120065 | |||
| 1180 | Ga0163162_10167337 | |||
| 1181 | Ga0163162_10790689 | |||
| 1182 | Ga0157372_10002107 | |||
| 1183 | Ga0157372_10082577 | |||
| 1184 | Ga0157372_10186523 | |||
| 1185 | Ga0157372_12952868 | |||
| 1186 | Ga0157375_10025335 | |||
| 1187 | Ga0157375_11815739 | |||
| 1188 | Ga0163163_11904632 | |||
| 1189 | Ga0157380_11008574 | |||
| 1190 | Ga0157380_12342514 | |||
| 1191 | Ga0182008_10005391 | |||
| 1192 | Ga0182008_10039474 | |||
| 1193 | Ga0157379_10022492 | |||
| 1194 | Ga0157379_10057239 | |||
| 1195 | Ga0157376_10063556 | |||
| 1196 | Ga0157376_10098142 | |||
| 1197 | Ga0157376_10098918 | |||
| 1198 | Ga0157376_10373060 | |||
| 1199 | Ga0157376_10388863 | |||
| 1200 | Ga0157376_10486419 | |||
| 1201 | Ga0182006_1000024 | |||
| 1202 | Ga0182006_1027678 | |||
| 1203 | Ga0182006_1052496 | |||
| 1204 | Ga0182007_10003840 | |||
| 1205 | Ga0182005_1011700 | |||
| 1206 | Ga0183361_10006 | |||
| 1207 | Ga0163161_10000005 | |||
| 1208 | Ga0163161_11324204 | |||
| 1209 | Ga0163161_12100340 | |||
| 1210 | Ga0213872_10107994 | |||
| 1211 | Ga0213876_10000065 | |||
| 1212 | Ga0213876_10096216 | |||
| 1213 | Ga0209435_101932 | |||
| 1214 | Ga0209674_100005 | |||
| 1215 | Ga0209674_100240 | |||
| 1216 | Ga0209672_100001 | |||
| 1217 | Ga0209672_100023 | |||
| 1218 | Ga0209147_100001 | |||
| 1219 | Ga0209147_100127 | |||
| 1220 | Ga0209563_102559 | |||
| 1221 | Ga0207427_102173 | |||
| 1222 | Ga0209258_100001 | |||
| 1223 | Ga0209258_100134 | |||
| 1224 | Ga0207425_1008165 | |||
| 1225 | Ga0209677_112110 | |||
| 1226 | Ga0209148_1000003 | |||
| 1227 | Ga0209759_1000152 | |||
| 1228 | Ga0209759_1000405 | |||
| 1229 | Ga0209129_1000104 | |||
| 1230 | Ga0209233_1000016 | |||
| 1231 | Ga0209455_1000001 | |||
| 1232 | Ga0209455_1011566 | |||
| 1233 | Ga0207656_10016168 | |||
| 1234 | Ga0207696_1000039 | |||
| 1235 | Ga0207696_1000166 | |||
| 1236 | Ga0207696_1001162 | |||
| 1237 | Ga0207696_1003316 | |||
| 1238 | Ga0207696_1011571 | |||
| 1239 | Ga0207655_1000062 | |||
| 1240 | Ga0207655_1000078 | |||
| 1241 | Ga0207655_1000199 | |||
| 1242 | Ga0207655_1020086 | |||
| 1243 | Ga0207713_1000069 | |||
| 1244 | Ga0207713_1000086 | |||
| 1245 | Ga0207713_1000180 | |||
| 1246 | Ga0207713_1000202 | |||
| 1247 | Ga0207713_1004002 | |||
| 1248 | Ga0207713_1012628 | |||
| 1249 | Ga0207713_1027207 | |||
| 1250 | Ga0207713_1035423 | |||
| 1251 | Ga0207682_10077951 | |||
| 1252 | Ga0207642_10167385 | |||
| 1253 | Ga0207710_10000026 | |||
| 1254 | Ga0207647_10066910 | |||
| 1255 | Ga0207685_10019276 | |||
| 1256 | Ga0207699_10472355 | |||
| 1257 | Ga0207705_10133856 | |||
| 1258 | Ga0207705_10430727 | |||
| 1259 | Ga0207654_10000012 | |||
| 1260 | Ga0207654_10357299 | |||
| 1261 | Ga0207654_10455448 | |||
| 1262 | Ga0207707_10773859 | |||
| 1263 | Ga0207693_10292339 | |||
| 1264 | Ga0207663_10554751 | |||
| 1265 | Ga0207662_10091371 | |||
| 1266 | Ga0207662_10145402 | |||
| 1267 | Ga0207657_10060755 | |||
| 1268 | Ga0207649_10123796 | |||
| 1269 | Ga0207650_10321606 | |||
| 1270 | Ga0207659_10351592 | |||
| 1271 | Ga0207659_10361840 | |||
| 1272 | Ga0207687_10137966 | |||
| 1273 | Ga0207687_10184419 | |||
| 1274 | Ga0207700_10009038 | |||
| 1275 | Ga0207690_10732823 | |||
| 1276 | Ga0207690_11004835 | |||
| 1277 | Ga0207686_10042151 | |||
| 1278 | Ga0207686_10112937 | |||
| 1279 | Ga0207686_10328903 | |||
| 1280 | Ga0207686_10334785 | |||
| 1281 | Ga0207686_10704913 | |||
| 1282 | Ga0207686_11291665 | |||
| 1283 | Ga0207709_10337687 | |||
| 1284 | Ga0207670_10091382 | |||
| 1285 | Ga0207670_10279859 | |||
| 1286 | Ga0207669_10619505 | |||
| 1287 | Ga0207704_10442878 | |||
| 1288 | Ga0207704_10670219 | |||
| 1289 | Ga0207665_10035734 | |||
| 1290 | Ga0207665_10225755 | |||
| 1291 | Ga0207711_10064825 | |||
| 1292 | Ga0207689_10224307 | |||
| 1293 | Ga0207689_10939978 | |||
| 1294 | Ga0207679_10787968 | |||
| 1295 | Ga0207679_11807383 | |||
| 1296 | Ga0207667_10137351 | |||
| 1297 | Ga0207651_10093143 | |||
| 1298 | Ga0207712_11306774 | |||
| 1299 | Ga0207712_12133835 | |||
| 1300 | Ga0207640_10139703 | |||
| 1301 | Ga0207658_10098859 | |||
| 1302 | Ga0207677_10019019 | |||
| 1303 | Ga0207677_10273496 | |||
| 1304 | Ga0207677_10654926 | |||
| 1305 | Ga0207677_11577365 | |||
| 1306 | Ga0207703_10015754 | |||
| 1307 | Ga0207703_10599650 | |||
| 1308 | Ga0207639_10879783 | |||
| 1309 | Ga0207678_10072141 | |||
| 1310 | Ga0207708_10182101 | |||
| 1311 | Ga0207641_11644932 | |||
| 1312 | Ga0207648_10025902 | |||
| 1313 | Ga0207648_11599736 | |||
| 1314 | Ga0207648_11675424 | |||
| 1315 | Ga0207676_10901227 | |||
| 1316 | Ga0207675_100419074 | |||
| 1317 | Ga0207675_100997021 | |||
| 1318 | Ga0207675_101339691 | |||
| 1319 | Ga0207683_10174639 | |||
| 1320 | Ga0207683_10693029 | |||
| 1321 | Ga0207698_10001058 | |||
| 1322 | Ga0209281_1000004 | |||
| 1323 | Ga0209281_1000014 | |||
| 1324 | Ga0209281_1000079 | |||
| 1325 | Ga0209281_1000142 | |||
| 1326 | Ga0209281_1000171 | |||
| 1327 | Ga0209281_1000184 | |||
| 1328 | Ga0209281_1000901 | |||
| 1329 | Ga0209281_1001407 | |||
| 1330 | Ga0209371_1000015 | |||
| 1331 | Ga0209371_1000221 | |||
| 1332 | Ga0209371_1000867 | |||
| 1333 | Ga0209371_1001808 | |||
| 1334 | Ga0209371_1006483 | |||
| 1335 | Ga0209371_1020569 | |||
| 1336 | Ga0209371_1022855 | |||
| 1337 | Ga0209588_1001752 | |||
| 1338 | Ga0209966_1011073 | |||
| 1339 | Ga0207428_10010038 | |||
| 1340 | Ga0268266_10000213 | |||
| 1341 | Ga0268266_10052108 | |||
| 1342 | Ga0268266_10443332 | |||
| 1343 | Ga0268265_12113213 | |||
| 1344 | Ga0268265_12350815 | |||
| 1345 | Ga0268264_10346609 | |||
| 1346 | Ga0265338_10000437 | |||
| 1347 | Ga0268256_1000018 | |||
| 1348 | Ga0268256_1000296 | |||
| 1349 | Ga0268256_1000482 | |||
| 1350 | Ga0268256_1009140 | |||
| 1351 | Ga0268256_1025000 | |||
| 1352 | Ga0268256_1025802 | |||
| 1353 | Ga0265332_10015178 | |||
| 1354 | Ga0265331_10025255 | |||
| 1355 | Ga0265327_10034490 | |||
| 1356 | Ga0307408_100016005 | |||
| 1357 | Ga0307408_100234393 | |||
| 1358 | Ga0307408_101438142 | |||
| 1359 | Ga0307408_101522855 | |||
| 1360 | Ga0316575_10003170 | |||
| 1361 | Ga0316575_10073313 | |||
| 1362 | Ga0316575_10083176 | |||
| 1363 | Ga0316575_10383102 | |||
| 1364 | Ga0316575_10424041 | |||
| 1365 | Ga0316579_10000166 | |||
| 1366 | Ga0316579_10001592 | |||
| 1367 | Ga0316579_10008011 | |||
| 1368 | Ga0316579_10071113 | |||
| 1369 | Ga0316576_10002247 | |||
| 1370 | Ga0316576_10020056 | |||
| 1371 | Ga0316576_10047234 | |||
| 1372 | Ga0316576_10150233 | |||
| 1373 | Ga0316576_10539590 | |||
| 1374 | Ga0316578_10007566 | |||
| 1375 | Ga0316578_10010365 | |||
| 1376 | Ga0316578_10011211 | |||
| 1377 | Ga0316578_10188720 | |||
| 1378 | Ga0316578_10203799 | |||
| 1379 | Ga0316578_10331464 | |||
| 1380 | Ga0316578_10404389 | |||
| 1381 | Ga0316578_10450724 | |||
| 1382 | Ga0316578_10788372 | |||
| 1383 | Ga0307405_10415799 | |||
| 1384 | Ga0316577_10007349 | |||
| 1385 | Ga0316577_10025632 | |||
| 1386 | Ga0316577_10085194 | |||
| 1387 | Ga0316577_10090512 | |||
| 1388 | Ga0316577_10126628 | |||
| 1389 | Ga0316577_10156907 | |||
| 1390 | Ga0316577_10189202 | |||
| 1391 | Ga0316577_10208269 | |||
| 1392 | Ga0316577_10244551 | |||
| 1393 | Ga0316577_10333796 | |||
| 1394 | Ga0316577_10631675 | |||
| 1395 | Ga0307413_10185902 | |||
| 1396 | Ga0307410_10839006 | |||
| 1397 | Ga0307406_11736058 | |||
| 1398 | Ga0307412_10000008 | |||
| 1399 | Ga0307412_10797864 | |||
| 1400 | Ga0307412_10975572 | |||
| 1401 | Ga0307409_100253454 | |||
| 1402 | Ga0307409_101303169 | |||
| 1403 | Ga0307416_100068522 | |||
| 1404 | Ga0307416_100716091 | |||
| 1405 | Ga0307416_100873333 | |||
| 1406 | Ga0316583_10002671 | |||
| 1407 | Ga0316583_10003546 | |||
| 1408 | Ga0316583_10003976 | |||
| 1409 | Ga0316583_10027667 | |||
| 1410 | Ga0316583_10069160 | |||
| 1411 | Ga0316583_10075684 | |||
| 1412 | Ga0316583_10077462 | |||
| 1413 | Ga0316583_10176418 | |||
| 1414 | Ga0316585_10000025 | |||
| 1415 | Ga0316585_10041606 | |||
| 1416 | Ga0316585_10117994 | |||
| 1417 | Ga0316580_10001116 | |||
| 1418 | Ga0316580_10010848 | |||
| 1419 | Ga0316580_10036841 | |||
| 1420 | Ga0316580_10082323 | |||
| 1421 | Ga0316580_10282659 | |||
| 1422 | Ga0316593_10000022 | |||
| 1423 | Ga0316593_10000063 | |||
| 1424 | Ga0316593_10000189 | |||
| 1425 | Ga0316593_10000373 | |||
| 1426 | Ga0316593_10000378 | |||
| 1427 | Ga0316593_10000410 | |||
| 1428 | Ga0316593_10000534 | |||
| 1429 | Ga0316593_10000536 | |||
| 1430 | Ga0316593_10000714 | |||
| 1431 | Ga0316593_10000847 | |||
| 1432 | Ga0316593_10006179 | |||
| 1433 | Ga0316593_10009179 | |||
| 1434 | Ga0316593_10010401 | |||
| 1435 | Ga0316593_10011638 | |||
| 1436 | Ga0316593_10011695 | |||
| 1437 | Ga0316593_10015438 | |||
| 1438 | Ga0316593_10031057 | |||
| 1439 | Ga0316593_10039047 | |||
| 1440 | Ga0316593_10046365 | |||
| 1441 | Ga0316593_10073690 | |||
| 1442 | Ga0316593_10173446 | |||
| 1443 | Ga0316593_10316729 | |||
| 1444 | Ga0316593_10322666 | |||
| 1445 | Ga0316592_1155182 | |||
| 1446 | Ga0316586_1075717 | |||
| 1447 | Ga0316596_1000357 | |||
| 1448 | Ga0316596_1011271 | |||
| 1449 | Ga0316596_1013554 | |||
| 1450 | Ga0316596_1027389 | |||
| 1451 | Ga0316596_1029345 | |||
| 1452 | Ga0316596_1038833 | |||
| 1453 | Ga0316596_1074651 | |||
| 1454 | Ga0316596_1133759 | |||
| 1455 | Ga0316596_1207472 | |||
| 1456 | Ga0373930_0094254 | |||
| 1457 | Ga0373938_0079650 | |||
| 1458 | Ga0373934_0026886 | |||
| 1459 | Ga0373934_0061966 | |||
| 1460 | Ga0373951_0175613 | |||
| 1461 | Ga0373923_0041195 | |||
| 1462 | Ga0373932_0292692 | |||
| 1463 | Ga0373936_0263778 | |||
| 1464 | Ga0373936_0476353 | |||
| 1465 | Ga0373953_0068844 | |||
| 1466 | Ga0373954_0196606 | |||
| 1467 | Ga0373956_0000024 | |||
| 1468 | Ga0373956_0017108 | |||
| 1469 | Ga0373943_0366924 | |||
| 1470 | Ga0373943_0389702 | |||
| 1471 | Ga0373946_0080067 | |||
| 1472 | Ga0373946_0456464 | |||
| 1473 | Ga0373946_0750237 | |||
| 1474 | Ga0373955_0016875 | |||
| 1475 | Ga0373955_0394464 | |||
| 1476 | Ga0373955_0675983 | |||
| 1477 | Ga0373962_0121263 | |||
| 1478 | Ga0316574_0000748 | |||
| 1479 | Ga0316574_0001967 | |||
| 1480 | Ga0316574_0004868 | |||
| 1481 | Ga0316574_0006357 | |||
| 1482 | Ga0316574_0019010 | |||
| 1483 | Ga0316574_0026509 | |||
| 1484 | Ga0316574_0072040 | |||
| 1485 | Ga0316574_0096801 | |||
| 1486 | Ga0316574_0112688 | |||
| 1487 | Ga0316574_0117769 | |||
| 1488 | Ga0316574_0149683 | |||
| 1489 | Ga0316574_0171803 | |||
| 1490 | Ga0316574_0223115 | |||
| 1491 | Ga0316574_0229180 | |||
| 1492 | Ga0316574_0353425 | |||
| 1493 | Ga0316574_0354581 | |||
| 1494 | Ga0316574_0387049 | |||
| 1495 | Ga0316574_0651368 | |||
| 1496 | Ga0316574_0672537 | |||
| 1497 | Ga0373924_0011697 | |||
| 1498 | Ga0373931_0154429 | |||
| 1499 | Ga0373931_0171989 | |||
| 1500 | Ga0373931_0649595 | |||
| 1501 | Ga0373935_0403092 | |||
| 1502 | Ga0373935_0872395 | |||
| 1503 | Ga0373935_1372708 | |||
| 1504 | Ga0373927_0095027 | |||
| 1505 | Ga0373933_0001797 | |||
| 1506 | Ga0373933_0625137 | |||
| 1507 | Ga0373947_0133470 | |||
| 1508 | Ga0373947_0555010 | |||
| 1509 | Ga0373937_0071339 | |||
| 1510 | Ga0373937_0538608 | |||
| 1511 | Ga0373937_0549442 | |||
| 1512 | Ga0373937_0833286 | |||
| 1513 | Ga0316582_0000356 | |||
| 1514 | Ga0316582_0001138 | |||
| 1515 | Ga0316582_0003304 | |||
| 1516 | Ga0316582_0003393 | |||
| 1517 | Ga0316582_0008678 | |||
| 1518 | Ga0316582_0037790 | |||
| 1519 | Ga0316582_0040423 | |||
| 1520 | Ga0316582_0066343 | |||
| 1521 | Ga0316582_0088588 | |||
| 1522 | Ga0316582_0092240 | |||
| 1523 | Ga0316582_0116838 | |||
| 1524 | Ga0316582_0145162 | |||
| 1525 | Ga0316582_0154190 | |||
| 1526 | Ga0316582_0211340 | |||
| 1527 | Ga0316582_0237126 | |||
| 1528 | Ga0316582_0276998 | |||
| 1529 | Ga0316582_0434745 | |||
| 1530 | Ga0316582_0443962 | |||
| 1531 | Ga0316582_0651361 | |||
| 1532 | Ga0316582_0741101 | |||
| 1533 | Ga0316584_0003189 | |||
| 1534 | Ga0316584_0003517 | |||
| 1535 | Ga0316584_0005698 | |||
| 1536 | Ga0316584_0005825 | |||
| 1537 | Ga0316584_0022402 | |||
| 1538 | Ga0316584_0076465 | |||
| 1539 | Ga0316584_0094405 | |||
| 1540 | Ga0316584_0138016 | |||
| 1541 | Ga0316584_0585754 | |||
| 1542 | Ga0316584_0965838 | |||
| 1543 | Ga0316584_1146010 | |||
| 1544 | Ga0316584_1200895 | |||
| 1545 | Ga0373925_0086034 | |||
| 1546 | Ga0373925_0211615 | |||
| 1547 | Ga0395905_0000050 | |||
| 1548 | Ga0316581_0029303 | |||
| 1549 | Ga0316581_0031542 | |||
| 1550 | Ga0316581_0143840 | |||
| 1551 | Ga0400484_24412 | |||
| 1552 | Ga0400484_38179 | |||
| 1553 | Ga0400490_11517 | |||
| 1554 | Ga0400490_13120 | |||
| 1555 | Ga0400490_18522 | |||
| 1556 | Ga0400490_22126 | |||
| 1557 | Ga0400490_23950 | |||
| 1558 | Ga0400490_30842 | |||
| 1559 | Ga0400490_48844 | |||
| 1560 | Ga0400491_01922 | |||
| 1561 | Ga0400491_24888 | |||
| 1562 | Ga0400485_14652 | |||
| 1563 | Ga0400485_17084 | |||
| 1564 | Ga0400485_19195 | |||
| 1565 | Ga0400488_17899 | |||
| 1566 | Ga0400488_18723 | |||
| 1567 | Ga0400488_34854 | |||
| 1568 | Ga0400488_45757 | |||
| 1569 | Ga0400488_48988 | |||
| 1570 | Ga0400488_62546 | |||
| 1571 | Ga0400486_01330 | |||
| 1572 | Ga0400486_08001 | |||
| 1573 | Ga0400486_26876 | |||
| 1574 | Ga0400486_31436 | |||
| 1575 | Ga0400483_023047 | |||
| 1576 | Ga0400483_023048 | |||
| 1577 | Ga0400483_068582 | |||
| 1578 | Ga0400483_068705 | |||
| 1579 | Ga0400483_075161 | |||
| 1580 | Ga0400483_076132 | |||
| 1581 | Ga0400483_093628 | |||
| 1582 | Ga0400483_105262 | |||
| 1583 | Ga0400483_130844 | |||
| 1584 | Ga0400483_152590 | |||
| 1585 | Ga0400483_164381 | |||
| 1586 | Ga0400483_171387 | |||
| 1587 | Ga0400483_187275 | |||
| 1588 | Ga0400483_218008 | |||
| 1589 | Ga0400483_220571 | |||
| 1590 | Ga0400483_239456 | |||
| 1591 | Ga0400483_249287 | |||
| 1592 | Ga0400483_289306 | |||
| 1593 | Ga0400483_291627 | |||
| 1594 | Ga0400489_46000 | |||
| 1595 | Ga0400487_02579 | |||
| 1596 | Ga0400487_23468 | |||
| 1597 | Ga0400487_34970 | |||
| 1598 | Ga0400487_64287 | |||
| 1599 | Ga0400487_65366 | |||
| 1600 | Ga0436365_1585837 | |||
| 1601 | Ga0436365_1613017 | |||
| 1602 | Ga0439438_003058 | |||
| 1603 | Ga0439438_019507 | |||
| 1604 | Ga0439439_0107193 | |||
| 1605 | Ga0439447_159608 | |||
| 1606 | Ga0439466_0042115 | |||
| 1607 | Ga0451851_0919370 | |||
| 1608 | Ga0451853_1858486 | |||
| 1609 | Ga0439432_007984 | |||
| 1610 | Ga0439432_018173 | |||
| 1611 | Ga0439452_000002 | |||
| 1612 | Ga0439452_000036 | |||
| 1613 | Ga0439452_000270 | |||
| 1614 | Ga0450900_006194 | |||
| 1615 | Ga0439464_0013001 | |||
| 1616 | Ga0439464_0016542 | |||
| 1617 | Ga0451577_0101028 | |||
| 1618 | Ga0451577_0246453 | |||
| 1619 | Ga0451577_0251020 | |||
| 1620 | Ga0451577_0531454 | |||
| 1621 | Ga0451577_0538398 | |||
| 1622 | Ga0453683_0145204 | |||
| 1623 | Ga0453684_0000005 | |||
| 1624 | Ga0453684_0007382 | |||
| 1625 | Ga0453684_0264256 | |||
| 1626 | Ga0453684_0540007 | |||
| 1627 | Ga0453684_1033249 | |||
| 1628 | Ga0451576_0000034 | |||
| 1629 | Ga0451576_0000461 | |||
| 1630 | Ga0451576_0066240 | |||
| 1631 | Ga0451576_0134068 | |||
| 1632 | Ga0451576_0171590 | |||
| 1633 | Ga0451576_0566285 | |||
| 1634 | Ga0451576_0864672 | |||
| 1635 | Ga0451576_0909564 | |||
| 1636 | Ga0495627_000433 | |||
| 1637 | Ga0495592_0001313 | |||
| 1638 | Ga0495592_0035700 | |||
| 1639 | Ga0495592_0076229 | |||
| 1640 | Ga0495592_0087719 | |||
| 1641 | Ga0495603_0051535 | |||
| 1642 | Ga0495590_0005690 | |||
| 1643 | Ga0495591_000066 | |||
| 1644 | Ga0495591_005751 | |||
| 1645 | Ga0495629_0008262 | |||
| 1646 | Ga0495629_0009715 | |||
| 1647 | Ga0495629_0099939 | |||
| 1648 | Ga0495638_0005497 | |||
| 1649 | Ga0495641_0019820 | |||
| 1650 | Ga0495641_0024414 | |||
| 1651 | Ga0495651_0001164 | |||
| 1652 | Ga0495651_0003321 | |||
| 1653 | Ga0495651_0221737 | |||
| 1654 | Ga0495651_0435522 | |||
| 1655 | Ga0495651_0899396 | |||
| 1656 | Ga0495653_0001712 | |||
| 1657 | Ga0495653_0045461 | |||
| 1658 | Ga0495653_0064843 | |||
| 1659 | Ga0495653_0069955 | |||
| 1660 | Ga0495650_0000326 | |||
| 1661 | Ga0495650_0009064 | |||
| 1662 | Ga0495650_0013790 | |||
| 1663 | Ga0495580_0001745 | |||
| 1664 | Ga0495580_0044244 | |||
| 1665 | Ga0495580_0088429 | |||
| 1666 | Ga0495582_0005561 | |||
| 1667 | Ga0495582_0144212 | |||
| 1668 | Ga0495605_0007456 | |||
| 1669 | Ga0495639_0055350 | |||
| 1670 | Ga0495662_0036737 | |||
| 1671 | Ga0495662_0044605 | |||
| 1672 | Ga0495662_0060251 | |||
| 1673 | Ga0495662_0093033 | |||
| 1674 | Ga0495664_0003770 | |||
| 1675 | Ga0495664_0070366 | |||
| 1676 | Ga0495664_0106516 | |||
| 1677 | Ga0495664_0522093 | |||
| 1678 | Ga0495594_0085091 | |||
| 1679 | Ga0495594_0085339 | |||
| 1680 | Ga0495596_0009887 | |||
| 1681 | Ga0495596_0032104 | |||
| 1682 | Ga0495606_0002813 | |||
| 1683 | Ga0495606_0019929 | |||
| 1684 | Ga0495606_0028739 | |||
| 1685 | Ga0495608_0004176 | |||
| 1686 | Ga0495608_0026692 | |||
| 1687 | Ga0495608_0026754 | |||
| 1688 | Ga0495608_0084657 | |||
| 1689 | Ga0495610_0014021 | |||
| 1690 | Ga0495618_0020240 | |||
| 1691 | Ga0495618_0106945 | |||
| 1692 | Ga0495618_0256069 | |||
| 1693 | Ga0495620_0019454 | |||
| 1694 | Ga0495628_0011513 | |||
| 1695 | Ga0495628_0029916 | |||
| 1696 | Ga0495628_0033225 | |||
| 1697 | Ga0495628_0065873 | |||
| 1698 | Ga0495628_0124454 | |||
| 1699 | Ga0495628_0367357 | |||
| 1700 | Ga0495630_0018171 | |||
| 1701 | Ga0495630_0053365 | |||
| 1702 | Ga0495630_0053406 | |||
| 1703 | Ga0495630_0263267 | |||
| 1704 | Ga0495630_0686498 | |||
| 1705 | Ga0495643_0107211 | |||
| 1706 | Ga0495643_0126123 | |||
| 1707 | Ga0495648_0033444 | |||
| 1708 | Ga0495648_0036486 | |||
| 1709 | Ga0495663_0317091 | |||
| 1710 | Ga0495666_0001724 | |||
| 1711 | Ga0495666_0004045 | |||
| 1712 | Ga0495666_0014527 | |||
| 1713 | Ga0495666_0031606 | |||
| 1714 | Ga0495652_0019979 | |||
| 1715 | Ga0495652_0087237 | |||
| 1716 | Ga0495652_0092003 | |||
| 1717 | Ga0495652_0259508 | |||
| 1718 | Ga0495652_1122335 | |||
| 1719 | Ga0495654_0000964 | |||
| 1720 | Ga0495654_0016345 | |||
| 1721 | Ga0495665_0005305 | |||
| 1722 | Ga0495665_0006059 | |||
| 1723 | Ga0495665_0009459 | |||
| 1724 | Ga0495665_0063494 | |||
| 1725 | Ga0495640_0007608 | |||
| 1726 | Ga0495640_0010353 | |||
| 1727 | Ga0495640_0394283 | |||
| 1728 | Ga0495586_0004361 | |||
| 1729 | Ga0495586_0052836 | |||
| 1730 | Ga0495586_0151331 | |||
| 1731 | Ga0495587_0000845 | |||
| 1732 | Ga0495587_0022745 | |||
| 1733 | Ga0495587_0053763 | |||
| 1734 | Ga0495621_0021458 | |||
| 1735 | Ga0495597_0001266 | |||
| 1736 | Ga0495597_0111126 | |||
| 1737 | Ga0495645_0005078 | |||
| 1738 | Ga0495645_0060781 | |||
| 1739 | Ga0495645_0600156 | |||
| 1740 | Ga0495645_0694729 | |||
| 1741 | Ga0495622_0087462 | |||
| 1742 | Ga0495633_0360525 | |||
| 1743 | Ga0495667_0047368 | |||
| 1744 | Ga0495667_0389617 | |||
| 1745 | Ga0495634_0005222 | |||
| 1746 | Ga0495634_0010809 | |||
| 1747 | Ga0495634_0014642 | |||
| 1748 | Ga0495634_0130899 | |||
| 1749 | Ga0495625_0002671 | |||
| 1750 | Ga0495635_0020425 | |||
| 1751 | Ga0495635_0023389 | |||
| 1752 | Ga0495635_0042769 | |||
| 1753 | Ga0495635_0170115 | |||
| 1754 | Ga0495661_0017977 | |||
| 1755 | Ga0495661_0032063 | |||
| 1756 | Ga0495588_0029013 | |||
| 1757 | Ga0495588_0103118 | |||
| 1758 | Ga0495657_0011839 | |||
| 1759 | Ga0495657_0130660 | |||
| 1760 | Ga0495657_0319775 | |||
| 1761 | Ga0495599_0018741 | |||
| 1762 | Ga0495599_0026148 | |||
| 1763 | Ga0495599_0045972 | |||
| 1764 | Ga0495599_0058244 | |||
| 1765 | Ga0495599_0546512 | |||
| 1766 | Ga0495623_0071830 | |||
| 1767 | Ga0495623_0216904 | |||
| 1768 | Ga0495646_0004507 | |||
| 1769 | Ga0495646_0021509 | |||
| 1770 | Ga0495646_0096810 | |||
| 1771 | Ga0495647_0028969 | |||
| 1772 | Ga0495658_0176625 | |||
| 1773 | Ga0495669_0126951 | |||
| 1774 | Ga0495613_0015752 | |||
| 1775 | Ga0495613_0020692 | |||
| 1776 | Ga0495613_0516682 | |||
| 1777 | Ga0495624_0020183 | |||
| 1778 | Ga0495624_0088756 | |||
| 1779 | Ga0495624_0118496 | |||
| 1780 | Ga0495624_0130548 | |||
| 1781 | Ga0495624_0544477 | |||
| 1782 | Ga0495670_0353466 | |||
| 1783 | Ga0495649_0001045 | |||
| 1784 | Ga0495649_0001390 | |||
| 1785 | Ga0495649_0006282 | |||
| 1786 | Ga0495649_0136022 | |||
| 1787 | Ga0495649_0325329 | |||
| 1788 | Ga0495589_0000032 | |||
| 1789 | Ga0495589_0022934 | |||
| 1790 | Ga0495589_0296103 | |||
| 1791 | Ga0495600_0015117 | |||
| 1792 | Ga0495600_0078879 | |||
| 1793 | Ga0495600_0109577 | |||
| 1794 | Ga0495660_0046599 | |||
| 1795 | Ga0495581_0001049 | |||
| 1796 | Ga0495581_0018271 | |||
| 1797 | Ga0495604_0001474 | |||
| 1798 | Ga0495604_0018792 | |||
| 1799 | Ga0495604_0028929 | |||
| 1800 | Ga0495604_0046393 | |||
| 1801 | Ga0495604_0410842 | |||
| 1802 | Ga0495674_0032854 | |||
| 1803 | Ga0495674_0046785 | |||
| 1804 | Ga0495674_0058935 | |||
| 1805 | Ga0495674_0092710 | |||
| 1806 | Ga0495674_0338292 | |||
| 1807 | Ga0495674_1420440 | |||
| 1808 | Ga0495672_0000156 | |||
| 1809 | Ga0495672_0139772 | |||
| 1810 | Ga0495676_0045713 | |||
| 1811 | Ga0495676_0048592 | |||
| 1812 | Ga0495676_0057991 | |||
| 1813 | Ga0495680_0006154 | |||
| 1814 | Ga0495680_0017184 | |||
| 1815 | Ga0495680_0068306 | |||
| 1816 | Ga0495680_0112126 | |||
| 1817 | Ga0495683_0006981 | |||
| 1818 | Ga0495687_019977 | |||
| 1819 | Ga0495675_0010643 | |||
| 1820 | Ga0495675_0020929 | |||
| 1821 | Ga0495675_0036406 | |||
| 1822 | Ga0495679_000195 | |||
| 1823 | Ga0495679_001999 | |||
| 1824 | Ga0495679_002765 | |||
| 1825 | Ga0495679_006165 | |||
| 1826 | Ga0495681_0131001 | |||
| 1827 | Ga0495681_0209986 | |||
| 1828 | Ga0495684_0156547 | |||
| 1829 | Ga0495684_0458328 | |||
| 1830 | Ga0495686_0000002 | |||
| 1831 | Ga0495686_0433351 | |||
| 1832 | Ga0495593_0008398 | |||
| 1833 | Ga0495593_0012038 | |||
| 1834 | Ga0495602_0011608 | |||
| 1835 | Ga0495602_0044036 | |||
| 1836 | Ga0495602_0070335 | |||
| 1837 | Ga0495602_0083251 | |||
| 1838 | Ga0495614_0000826 | |||
| 1839 | Ga0495614_0003464 | |||
| 1840 | Ga0495614_0262032 | |||
| 1841 | Ga0495626_0087058 | |||
| 1842 | Ga0496100_0494036 | |||
| 1843 | Ga0496101_1025543 | |||
| 1844 | Ga0496102_0069517 | |||
| 1845 | Ga0496102_1572291 | |||
| 1846 | Ga0496103_0021032 | |||
| 1847 | Ga0496103_0133620 | |||
| 1848 | Ga0496104_0764620 | |||
| 1849 | Ga0496105_0799561 | |||
| 1850 | Ga0496106_0000023 | |||
| 1851 | Ga0496110_0177508 | |||
| 1852 | Ga0496111_0167246 | |||
| 1853 | Ga0496112_0501198 | |||
| 1854 | Ga0496113_0531412 | |||
| 1855 | Ga0496115_0457801 | |||
| 1856 | Ga0496116_0000007 | |||
| 1857 | Ga0496116_0003553 | |||
| 1858 | Ga0496116_0012961 | |||
| 1859 | Ga0496117_0003271 | |||
| 1860 | Ga0496117_0003856 | |||
| 1861 | Ga0496117_0019314 | |||
| 1862 | Ga0496117_0040958 | |||
| 1863 | Ga0496117_0075288 | |||
| 1864 | Ga0496117_0111359 | |||
| 1865 | Ga0496117_0164340 | |||
| 1866 | Ga0496118_0001700 | |||
| 1867 | Ga0496118_0001781 | |||
| 1868 | Ga0496118_0010415 | |||
| 1869 | Ga0496118_0021027 | |||
| 1870 | Ga0496118_0030452 | |||
| 1871 | Ga0496118_0053651 | |||
| 1872 | Ga0496119_0000013 | |||
| 1873 | Ga0496119_0001881 | |||
| 1874 | Ga0496119_0090294 | |||
| 1875 | Ga0496120_0003642 | |||
| 1876 | Ga0496120_0007320 | |||
| 1877 | Ga0496120_0020001 | |||
| 1878 | Ga0496121_0004540 | |||
| 1879 | Ga0496121_0005179 | |||
| 1880 | Ga0496121_0012769 | |||
| 1881 | Ga0496121_0066801 | |||
| 1882 | Ga0496122_0000619 | |||
| 1883 | Ga0496122_0000849 | |||
| 1884 | Ga0496122_0001669 | |||
| 1885 | Ga0496122_0123695 | |||
| 1886 | Ga0496123_0000012 | |||
| 1887 | Ga0496123_0001359 | |||
| 1888 | Ga0496123_0001875 | |||
| 1889 | Ga0496123_0112664 | |||
| 1890 | Ga0496123_0254332 | |||
| 1891 | Ga0496124_0000049 | |||
| 1892 | Ga0496124_0001722 | |||
| 1893 | Ga0496124_0028242 | |||
| 1894 | Ga0496124_0088620 | |||
| 1895 | Ga0496124_0467276 | |||
| 1896 | Ga0496124_0567361 | |||
| 1897 | Ga0496124_0839208 | |||
| 1898 | Ga0496125_0000405 | |||
| 1899 | Ga0496125_0046818 | |||
| 1900 | Ga0496125_0084257 | |||
| 1901 | Ga0496126_0000031 | |||
| 1902 | Ga0496126_0034302 | |||
| 1903 | Ga0496126_0078886 | |||
| 1904 | Ga0496126_0372232 | |||
| 1905 | Ga0496126_1304420 | |||
| 1906 | Ga0501261_041006 | |||
| 1907 | Ga0501280_004384 | |||
| 1908 | nmdc:mga00v17_14683_c1 | |||
| 1909 | nmdc:mga00v17_2036_c1 | |||
| 1910 | nmdc:mga00v17_316684_c1 | |||
| 1911 | nmdc:mga00v17_689621_c1 | |||
| 1912 | nmdc:mga00v17_920272_c1 | |||
| 1913 | nmdc:mga0k408_834066_c1 | |||
| 1914 | nmdc:mga0k408_9476_c1 | |||
| 1915 | nmdc:mga05p37_1685756_c1 | |||
| 1916 | nmdc:mga09592_887527_c1 | |||
| 1917 | nmdc:mga0qj67_440290_c1 | |||
| 1918 | nmdc:mga08y16_101458_c1 | |||
| 1919 | nmdc:mga08y16_1567005_c1 | |||
| 1920 | nmdc:mga0n895_431777_c1 | |||
| 1921 | nmdc:mga0n895_668864_c1 | |||
| 1922 | nmdc:mga0n895_771058_c1 | |||
| 1923 | nmdc:mga0a205_543073_c1 | |||
| 1924 | nmdc:mga0sz30_116226_c1 | |||
| 1925 | Ga0495601_0007759 | |||
| 1926 | Ga0495601_0053564 | |||
| 1927 | Ga0495601_0146949 | |||
| 1928 | Ga0495612_0049590 | |||
| 1929 | Ga0495595_0021725 | |||
| 1930 | Ga0495595_0073949 | |||
| 1931 | Ga0495619_0262169 | |||
| 1932 | Ga0466962_0428647 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i7h-assembly3.cif.gz_C | crystal sturcuture of fdx | 0.9786 | 2 | 109 |
| 1i7h-assembly3.cif.gz_C | crystal sturcuture of fdx | 0.9697 | 2 | 109 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.9623 | 1 | 107 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.9368 | 1 | 107 |
| 2y5c-assembly2.cif.gz_B | structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster | 0.8802 | 2 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i7hA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.979 | 2 | 109 | 3.10.20.30 |
| 1i7hA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9614 | 2 | 109 | 3.10.20.30 |
| af_Q9CPW2_55_168_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8794 | 2 | 104 | 3.10.20.30 |
| af_A4I234_54_172_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8693 | 2 | 104 | 3.10.20.30 |
| 4ltuB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8634 | 2 | 104 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L9CCH0-F1-model_v4 | deleted | 0.9977 | 1 | 91 |
|
| AF-A0A2X1SLU2-F1-model_v4 | 2Fe-2S ferredoxin | 0.9976 | 1 | 101 |
GO:0005829
GO:0008198 GO:0009055 GO:0016226 GO:0051537 GO:0140647 |
| AF-A0A1A7BVS5-F1-model_v4 | 2Fe-2S ferredoxin | 0.9932 | 1 | 106 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |
| AF-A0A7R8X0J1-F1-model_v4 | 2Fe-2S ferredoxin | 0.9929 | 1 | 101 |
GO:0005829
GO:0009055 GO:0016226 GO:0051537 GO:0140647 |
| AF-A0A6M6AKZ5-F1-model_v4 | Ferredoxin | 0.9923 | 1 | 71 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |