F487004
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 966 | 412 | 1932 | 451 |
Family's Representative Sequence
| Representative Sequence | 3300046492|Ga0495585_0000211|Ga0495585_0000211_44969_46534 |
| Length | 521 |
| Sequence | MSQNSNLHAPGASVQALNVQEFLNRHPFSPFQWLIFGLCFVIVLLDGFDTAAIGFIAPSLTREWGVSRPDLAPVLSAALFGLAVGALGSGPLADRMGRKKVLIGSVLLFGLACTWSAFSADLRQLTILRFVTGLGLGAAMPNAVTLMSEYCPDQRRSMMTNAMFCGFPLGAAFGGFLAAWMIPLWGWRSVLLLGGIAPLVLAALMLLLLPESVRYLVARRQPAQRIRAALSRIAPSAANAQSFVMTEKAAATGAKGGIGVVLSRSYVAGSLMLWLAYFMGLVIFYALINWMPILFRDAGIEPRTATLIAALFPLGGVGAILFGWLMDRYNANLVIAAGYALTAASIYAIGQAAGHVGMLMLVVFVGGILMNTAQSSMPALAAAFYPTQGRATGVAWMLGIGRFGGIAGSFLVAELARRQFGLGAIFTVVACAGVVSTVALLVKEFTHPEDKSDTPAVQGEVLGHRACFTLHEAGTGRRSGPVFAPRHKARVPSRRPACPSPASAAPRVRIPKFCPSSAPAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 52 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 77 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 127 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 133 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 136 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 140 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 145 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 151 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 162 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 163 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 164 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 165 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 166 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 167 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 170 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 171 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 172 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 175 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 176 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 177 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 178 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 298 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 299 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 302 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 305 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 306 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 307 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 308 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 309 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 310 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 311 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 312 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 313 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 314 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 315 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 316 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 317 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 318 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 319 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 320 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 321 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 322 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 323 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 324 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 325 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 326 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 327 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 328 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 329 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 330 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 331 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 332 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 333 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 334 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 335 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 336 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 337 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 338 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 339 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 340 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 341 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 342 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 343 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 344 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 345 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 346 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 347 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 348 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 349 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 350 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 351 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 352 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 353 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 354 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 355 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 356 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 357 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 358 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 359 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 360 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 361 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 362 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 363 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 364 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 365 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 366 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 367 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 368 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 369 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 370 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 371 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 372 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 373 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 374 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 375 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 376 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 377 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 378 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 379 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 380 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 381 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 382 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 383 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 384 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 385 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 386 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 387 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 388 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 389 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 390 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 391 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 392 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 393 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 394 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 395 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 396 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 397 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 398 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 399 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 400 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 401 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 402 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 403 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 404 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 405 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 406 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 407 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 408 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 409 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 410 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 411 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 412 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.78 |
| Metatranscriptomes | 0 |
| Isolates | 12.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.7 |
| Nodule | 2.9 |
| Rhizoplane | 3.83 |
| Rhizosphere | 68.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495585_0000211 | 3300046492 | Bacteria | 61010 |
| 2 | JGI24740J21852_10001309 | 3300001979 | Bacteria | 11320 |
| 3 | JGI24739J22299_10001079 | 3300001989 | Bacteria | 10164 |
| 4 | JGI24739J22299_10001779 | 3300001989 | Bacteria | 8204 |
| 5 | JGI24739J22299_10005316 | 3300001989 | Bacteria | 4905 |
| 6 | JGI24739J22299_10007027 | 3300001989 | Bacteria | 4238 |
| 7 | JGI24735J21928_10001507 | 3300002067 | Bacteria | 8236 |
| 8 | JGI24735J21928_10003601 | 3300002067 | Bacteria | 5259 |
| 9 | JGI24735J21928_10003905 | 3300002067 | Bacteria | 5044 |
| 10 | JGI24735J21928_10007512 | 3300002067 | Bacteria | 3554 |
| 11 | JGI24735J21928_10015154 | 3300002067 | Bacteria | 2408 |
| 12 | JGI24738J21930_10011891 | 3300002075 | Bacteria | 1907 |
| 13 | JGI25156J39149_1000137 | 3300002705 | Bacteria | 53605 |
| 14 | JGI25156J39149_1000236 | 3300002705 | Bacteria | 37992 |
| 15 | JGI25156J39149_1000642 | 3300002705 | Bacteria | 19182 |
| 16 | JGI25156J39149_1001363 | 3300002705 | Bacteria | 10484 |
| 17 | JGI25156J39149_1002647 | 3300002705 | Bacteria | 6290 |
| 18 | JGI25154J39366_1000106 | 3300002738 | Bacteria | 74019 |
| 19 | JGI25157J39369_1000154 | 3300002741 | Bacteria | 57286 |
| 20 | JGI25151J46595_10005982 | 3300003187 | Bacteria | 6193 |
| 21 | JGI25151J46595_10034388 | 3300003187 | Bacteria | 1939 |
| 22 | JGI25165J46597_1000939 | 3300003214 | Bacteria | 19950 |
| 23 | JGI25165J46597_1001941 | 3300003214 | Bacteria | 8149 |
| 24 | rootH1_10000900 | 3300003316 | Bacteria | 45745 |
| 25 | rootH1_10017467 | 3300003316 | Bacteria | 5013 |
| 26 | rootH1_10043777 | 3300003316 | Bacteria | 1673 |
| 27 | rootH2_10009909 | 3300003320 | Bacteria | 3746 |
| 28 | rootL2_10009014 | 3300003322 | Bacteria | 15136 |
| 29 | rootH1_10033602 | 3300003323 | Bacteria | 9701 |
| 30 | rootH1_10050263 | 3300003323 | Bacteria | 6314 |
| 31 | rootH1_10111356 | 3300003323 | Bacteria | 2154 |
| 32 | JGI25160J50197_1000025 | 3300003354 | Bacteria | 186706 |
| 33 | JGI25160J50197_1000101 | 3300003354 | Bacteria | 83840 |
| 34 | Ga0055539_1000197 | 3300003752 | Bacteria | 49212 |
| 35 | Ga0055539_1000488 | 3300003752 | Bacteria | 12803 |
| 36 | Ga0055533_1000040 | 3300003756 | Bacteria | 242927 |
| 37 | Ga0055533_1000159 | 3300003756 | Bacteria | 65219 |
| 38 | Ga0055533_1000611 | 3300003756 | Bacteria | 12060 |
| 39 | Ga0055532_1000014 | 3300003758 | Bacteria | 344702 |
| 40 | Ga0055532_1000140 | 3300003758 | Bacteria | 71626 |
| 41 | Ga0055532_1002026 | 3300003758 | Bacteria | 4651 |
| 42 | Ga0055525_1000745 | 3300003759 | Bacteria | 11105 |
| 43 | Ga0055527_1000013 | 3300003760 | Bacteria | 347416 |
| 44 | Ga0055527_1000089 | 3300003760 | Bacteria | 71626 |
| 45 | Ga0055527_1000280 | 3300003760 | Bacteria | 30042 |
| 46 | Ga0055535_1000011 | 3300003761 | Bacteria | 347416 |
| 47 | Ga0055535_1000164 | 3300003761 | Bacteria | 71626 |
| 48 | Ga0055535_1000591 | 3300003761 | Bacteria | 30042 |
| 49 | Ga0055535_1002021 | 3300003761 | Bacteria | 8279 |
| 50 | Ga0055542_1000018 | 3300003762 | Bacteria | 347416 |
| 51 | Ga0055542_1000208 | 3300003762 | Bacteria | 71626 |
| 52 | Ga0055542_1001740 | 3300003762 | Bacteria | 9278 |
| 53 | Ga0055542_1002922 | 3300003762 | Bacteria | 5036 |
| 54 | Ga0055529_1000017 | 3300003763 | Bacteria | 347416 |
| 55 | Ga0055529_1000053 | 3300003763 | Bacteria | 198996 |
| 56 | Ga0055529_1000227 | 3300003763 | Bacteria | 71626 |
| 57 | Ga0055529_1000978 | 3300003763 | Bacteria | 14276 |
| 58 | Ga0055526_1000105 | 3300003771 | Bacteria | 73056 |
| 59 | Ga0055528_1003527 | 3300003790 | Bacteria | 7809 |
| 60 | Ga0055530_10000614 | 3300003791 | Bacteria | 30953 |
| 61 | Ga0055530_10001720 | 3300003791 | Bacteria | 15410 |
| 62 | Ga0055530_10020189 | 3300003791 | Bacteria | 1999 |
| 63 | Ga0055540_1000014 | 3300003792 | Bacteria | 234171 |
| 64 | Ga0055540_1005240 | 3300003792 | Bacteria | 5536 |
| 65 | Ga0055531_10003071 | 3300003794 | Bacteria | 10800 |
| 66 | Ga0055531_10005969 | 3300003794 | Bacteria | 6996 |
| 67 | Ga0058692_1004472 | 3300003856 | Bacteria | 4138 |
| 68 | Ga0065165_1000173 | 3300005262 | Bacteria | 114553 |
| 69 | Ga0065165_1000188 | 3300005262 | Bacteria | 108637 |
| 70 | Ga0065165_1001702 | 3300005262 | Bacteria | 22116 |
| 71 | Ga0070658_10010287 | 3300005327 | Bacteria | 7504 |
| 72 | Ga0070682_100012280 | 3300005337 | Bacteria | 4906 |
| 73 | Ga0070660_100000159 | 3300005339 | Bacteria | 43943 |
| 74 | Ga0070660_100000637 | 3300005339 | Bacteria | 23264 |
| 75 | Ga0070660_100002295 | 3300005339 | Bacteria | 13142 |
| 76 | Ga0070661_100081238 | 3300005344 | Bacteria | 2393 |
| 77 | Ga0070659_100000223 | 3300005366 | Bacteria | 44089 |
| 78 | Ga0070659_100096166 | 3300005366 | Bacteria | 2379 |
| 79 | Ga0070714_100010374 | 3300005435 | Bacteria | 7362 |
| 80 | Ga0070713_100001762 | 3300005436 | Bacteria | 13965 |
| 81 | Ga0070711_100019644 | 3300005439 | Bacteria | 4338 |
| 82 | Ga0070708_100149747 | 3300005445 | Bacteria | 2169 |
| 83 | Ga0070663_100001049 | 3300005455 | Bacteria | 15125 |
| 84 | Ga0070663_100032949 | 3300005455 | Bacteria | 3576 |
| 85 | Ga0068853_100028416 | 3300005539 | Bacteria | 4704 |
| 86 | Ga0068855_100022088 | 3300005563 | Bacteria | 7627 |
| 87 | Ga0068855_100028363 | 3300005563 | Bacteria | 6696 |
| 88 | Ga0070664_100081794 | 3300005564 | Bacteria | 2784 |
| 89 | Ga0068857_100223918 | 3300005577 | Bacteria | 1719 |
| 90 | Ga0068854_100004290 | 3300005578 | Bacteria | 8987 |
| 91 | Ga0068856_100022922 | 3300005614 | Bacteria | 6072 |
| 92 | Ga0068856_100205354 | 3300005614 | Bacteria | 1985 |
| 93 | Ga0068866_10050504 | 3300005718 | Bacteria | 2112 |
| 94 | Ga0075366_10009886 | 3300006195 | Bacteria | 5338 |
| 95 | Ga0075366_10090319 | 3300006195 | Bacteria | 1834 |
| 96 | Ga0075370_10041483 | 3300006353 | Bacteria | 2598 |
| 97 | Ga0068865_100156038 | 3300006881 | Bacteria | 1736 |
| 98 | Ga0079104_1000013 | 3300006946 | Bacteria | 349477 |
| 99 | Ga0079104_1000724 | 3300006946 | Bacteria | 29488 |
| 100 | Ga0105251_10000335 | 3300009011 | Bacteria | 47275 |
| 101 | Ga0105251_10000589 | 3300009011 | Bacteria | 33409 |
| 102 | Ga0105240_10001196 | 3300009093 | Bacteria | 45244 |
| 103 | Ga0105240_10012745 | 3300009093 | Bacteria | 11588 |
| 104 | Ga0105240_10013343 | 3300009093 | Bacteria | 11291 |
| 105 | Ga0105240_10024279 | 3300009093 | Bacteria | 7998 |
| 106 | Ga0105240_10042007 | 3300009093 | Bacteria | 5829 |
| 107 | Ga0105240_10057300 | 3300009093 | Bacteria | 4869 |
| 108 | Ga0105240_10091306 | 3300009093 | Bacteria | 3721 |
| 109 | Ga0105240_10093220 | 3300009093 | Bacteria | 3676 |
| 110 | Ga0105240_10110662 | 3300009093 | Bacteria | 3324 |
| 111 | Ga0105247_10080443 | 3300009101 | Bacteria | 2052 |
| 112 | Ga0105243_10004635 | 3300009148 | Bacteria | 10832 |
| 113 | Ga0105241_10035913 | 3300009174 | Bacteria | 3729 |
| 114 | Ga0105241_10038664 | 3300009174 | Bacteria | 3597 |
| 115 | Ga0105237_10000645 | 3300009545 | Bacteria | 48648 |
| 116 | Ga0105237_10006307 | 3300009545 | Bacteria | 13184 |
| 117 | Ga0105237_10024649 | 3300009545 | Bacteria | 6153 |
| 118 | Ga0105237_10065380 | 3300009545 | Bacteria | 3633 |
| 119 | Ga0105237_10087124 | 3300009545 | Bacteria | 3112 |
| 120 | Ga0105237_10103770 | 3300009545 | Bacteria | 2835 |
| 121 | Ga0105237_10114049 | 3300009545 | Bacteria | 2695 |
| 122 | Ga0105237_10139007 | 3300009545 | Bacteria | 2423 |
| 123 | Ga0105238_10009283 | 3300009551 | Bacteria | 9845 |
| 124 | Ga0105238_10111614 | 3300009551 | Bacteria | 2714 |
| 125 | Ga0105238_10241617 | 3300009551 | Bacteria | 1783 |
| 126 | Ga0105239_10000572 | 3300010375 | Bacteria | 52626 |
| 127 | Ga0105239_10007488 | 3300010375 | Bacteria | 12526 |
| 128 | Ga0105239_10017482 | 3300010375 | Bacteria | 7930 |
| 129 | Ga0105239_10101297 | 3300010375 | Bacteria | 3186 |
| 130 | Ga0105239_10120756 | 3300010375 | Bacteria | 2910 |
| 131 | Ga0105246_10087739 | 3300011119 | Bacteria | 2234 |
| 132 | Ga0157373_10014530 | 3300013100 | Bacteria | 5770 |
| 133 | Ga0157370_10003565 | 3300013104 | Bacteria | 18222 |
| 134 | Ga0157370_10014525 | 3300013104 | Bacteria | 8050 |
| 135 | Ga0157370_10059821 | 3300013104 | Bacteria | 3619 |
| 136 | Ga0157369_10006615 | 3300013105 | Bacteria | 13409 |
| 137 | Ga0157369_10030856 | 3300013105 | Bacteria | 5909 |
| 138 | Ga0157374_10000081 | 3300013296 | Bacteria | 95406 |
| 139 | Ga0157374_10000834 | 3300013296 | Bacteria | 26952 |
| 140 | Ga0157372_10011733 | 3300013307 | Bacteria | 9331 |
| 141 | Ga0157372_10020789 | 3300013307 | Bacteria | 7088 |
| 142 | Ga0157375_10002531 | 3300013308 | Bacteria | 15860 |
| 143 | Ga0157375_10379723 | 3300013308 | Bacteria | 1580 |
| 144 | Ga0163163_10059963 | 3300014325 | Bacteria | 3766 |
| 145 | Ga0182008_10009819 | 3300014497 | Bacteria | 5149 |
| 146 | Ga0182008_10039610 | 3300014497 | Bacteria | 2354 |
| 147 | Ga0182006_1002702 | 3300015261 | Bacteria | 9517 |
| 148 | Ga0182007_10001639 | 3300015262 | Bacteria | 11844 |
| 149 | Ga0182007_10005892 | 3300015262 | Bacteria | 5323 |
| 150 | Ga0182005_1004230 | 3300015265 | Bacteria | 4684 |
| 151 | Ga0183361_10003 | 3300016635 | Bacteria | 577277 |
| 152 | Ga0163161_10080887 | 3300017792 | Bacteria | 2392 |
| 153 | Ga0213872_10000134 | 3300021361 | Bacteria | 67449 |
| 154 | Ga0213872_10037606 | 3300021361 | Bacteria | 2210 |
| 155 | Ga0213876_10000312 | 3300021384 | Bacteria | 42654 |
| 156 | Ga0213875_10005957 | 3300021388 | Bacteria | 6466 |
| 157 | Ga0209566_100443 | 3300025225 | Bacteria | 30572 |
| 158 | Ga0209674_100020 | 3300025226 | Bacteria | 672397 |
| 159 | Ga0209674_100051 | 3300025226 | Bacteria | 338399 |
| 160 | Ga0209674_100066 | 3300025226 | Bacteria | 256739 |
| 161 | Ga0209674_101758 | 3300025226 | Bacteria | 5260 |
| 162 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 163 | Ga0209672_100013 | 3300025228 | Bacteria | 740693 |
| 164 | Ga0209672_100027 | 3300025228 | Bacteria | 344500 |
| 165 | Ga0209672_100063 | 3300025228 | Bacteria | 204903 |
| 166 | Ga0209672_100708 | 3300025228 | Bacteria | 16597 |
| 167 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 168 | Ga0209147_100013 | 3300025229 | Bacteria | 660057 |
| 169 | Ga0209147_100035 | 3300025229 | Bacteria | 344500 |
| 170 | Ga0209147_100077 | 3300025229 | Bacteria | 205964 |
| 171 | Ga0209147_100119 | 3300025229 | Bacteria | 142860 |
| 172 | Ga0209563_100129 | 3300025230 | Bacteria | 99977 |
| 173 | Ga0209563_100306 | 3300025230 | Bacteria | 19672 |
| 174 | Ga0209563_100645 | 3300025230 | Bacteria | 11214 |
| 175 | Ga0207427_100487 | 3300025231 | Bacteria | 21325 |
| 176 | Ga0207427_101027 | 3300025231 | Bacteria | 11666 |
| 177 | Ga0207427_103184 | 3300025231 | Bacteria | 3627 |
| 178 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 179 | Ga0209258_100052 | 3300025242 | Bacteria | 344500 |
| 180 | Ga0209258_100074 | 3300025242 | Bacteria | 271062 |
| 181 | Ga0209258_100105 | 3300025242 | Bacteria | 207862 |
| 182 | Ga0209258_100328 | 3300025242 | Bacteria | 71792 |
| 183 | Ga0209646_1000127 | 3300025246 | Bacteria | 131920 |
| 184 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 185 | Ga0209677_100085 | 3300025253 | Bacteria | 116046 |
| 186 | Ga0209677_100157 | 3300025253 | Bacteria | 62213 |
| 187 | Ga0209148_1000020 | 3300025254 | Bacteria | 740693 |
| 188 | Ga0209148_1000064 | 3300025254 | Bacteria | 344500 |
| 189 | Ga0209148_1000107 | 3300025254 | Bacteria | 207862 |
| 190 | Ga0209148_1002924 | 3300025254 | Bacteria | 5184 |
| 191 | Ga0209148_1005329 | 3300025254 | Bacteria | 2972 |
| 192 | Ga0209759_1000015 | 3300025256 | Bacteria | 388724 |
| 193 | Ga0209759_1000028 | 3300025256 | Bacteria | 298755 |
| 194 | Ga0209759_1000129 | 3300025256 | Bacteria | 131961 |
| 195 | Ga0209759_1000279 | 3300025256 | Bacteria | 71943 |
| 196 | Ga0209759_1000315 | 3300025256 | Bacteria | 64918 |
| 197 | Ga0209759_1000521 | 3300025256 | Bacteria | 41549 |
| 198 | Ga0209759_1001009 | 3300025256 | Bacteria | 19019 |
| 199 | Ga0209759_1001226 | 3300025256 | Bacteria | 15698 |
| 200 | Ga0209233_1000073 | 3300025261 | Bacteria | 362383 |
| 201 | Ga0209233_1000294 | 3300025261 | Bacteria | 62768 |
| 202 | Ga0209565_1012923 | 3300025263 | Bacteria | 1972 |
| 203 | Ga0209455_1000017 | 3300025272 | Bacteria | 740693 |
| 204 | Ga0209455_1000057 | 3300025272 | Bacteria | 344500 |
| 205 | Ga0209455_1000066 | 3300025272 | Bacteria | 316811 |
| 206 | Ga0209455_1000100 | 3300025272 | Bacteria | 207862 |
| 207 | Ga0209455_1000138 | 3300025272 | Bacteria | 141021 |
| 208 | Ga0209673_1000101 | 3300025273 | Bacteria | 190230 |
| 209 | Ga0209673_1009213 | 3300025273 | Bacteria | 4304 |
| 210 | Ga0209130_1004958 | 3300025284 | Bacteria | 4819 |
| 211 | Ga0209025_1000115 | 3300025294 | Bacteria | 218871 |
| 212 | Ga0209025_1000286 | 3300025294 | Bacteria | 114096 |
| 213 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 214 | Ga0209564_1007435 | 3300025295 | Bacteria | 5656 |
| 215 | Ga0209564_1007842 | 3300025295 | Bacteria | 5413 |
| 216 | Ga0209050_1000142 | 3300025298 | Bacteria | 172356 |
| 217 | Ga0209050_1002975 | 3300025298 | Bacteria | 13196 |
| 218 | Ga0209256_1000130 | 3300025299 | Bacteria | 163227 |
| 219 | Ga0209256_1000840 | 3300025299 | Bacteria | 38531 |
| 220 | Ga0207426_1000020 | 3300025302 | Bacteria | 558084 |
| 221 | Ga0207426_1000056 | 3300025302 | Bacteria | 373596 |
| 222 | Ga0207426_1004594 | 3300025302 | Bacteria | 6661 |
| 223 | Ga0209051_1000035 | 3300025303 | Bacteria | 346999 |
| 224 | Ga0209051_1002864 | 3300025303 | Bacteria | 11863 |
| 225 | Ga0209051_1004454 | 3300025303 | Bacteria | 8621 |
| 226 | Ga0209051_1005258 | 3300025303 | Bacteria | 7627 |
| 227 | Ga0209051_1028996 | 3300025303 | Bacteria | 2175 |
| 228 | Ga0209257_1000494 | 3300025304 | Bacteria | 70693 |
| 229 | Ga0209257_1004031 | 3300025304 | Bacteria | 11813 |
| 230 | Ga0207696_1012173 | 3300025711 | Bacteria | 3052 |
| 231 | Ga0207713_1000948 | 3300025735 | Bacteria | 26051 |
| 232 | Ga0207713_1005024 | 3300025735 | Bacteria | 8421 |
| 233 | Ga0207713_1014454 | 3300025735 | Bacteria | 4101 |
| 234 | Ga0207692_10001173 | 3300025898 | Bacteria | 9689 |
| 235 | Ga0207647_10000553 | 3300025904 | Bacteria | 29707 |
| 236 | Ga0207647_10000738 | 3300025904 | Bacteria | 25647 |
| 237 | Ga0207647_10001254 | 3300025904 | Bacteria | 19523 |
| 238 | Ga0207647_10001656 | 3300025904 | Bacteria | 17150 |
| 239 | Ga0207647_10055174 | 3300025904 | Bacteria | 2442 |
| 240 | Ga0207699_10006667 | 3300025906 | Bacteria | 5601 |
| 241 | Ga0207705_10005147 | 3300025909 | Bacteria | 9802 |
| 242 | Ga0207705_10065196 | 3300025909 | Bacteria | 2633 |
| 243 | Ga0207695_10000368 | 3300025913 | Bacteria | 103176 |
| 244 | Ga0207695_10011940 | 3300025913 | Bacteria | 10460 |
| 245 | Ga0207695_10015690 | 3300025913 | Bacteria | 8911 |
| 246 | Ga0207695_10018460 | 3300025913 | Bacteria | 8067 |
| 247 | Ga0207695_10043331 | 3300025913 | Bacteria | 4797 |
| 248 | Ga0207695_10058194 | 3300025913 | Bacteria | 4012 |
| 249 | Ga0207695_10085995 | 3300025913 | Bacteria | 3172 |
| 250 | Ga0207695_10134338 | 3300025913 | Bacteria | 2429 |
| 251 | Ga0207671_10002474 | 3300025914 | Bacteria | 19736 |
| 252 | Ga0207671_10109891 | 3300025914 | Bacteria | 2097 |
| 253 | Ga0207671_10159391 | 3300025914 | Bacteria | 1747 |
| 254 | Ga0207663_10000327 | 3300025916 | Bacteria | 20836 |
| 255 | Ga0207657_10000442 | 3300025919 | Bacteria | 43937 |
| 256 | Ga0207657_10001219 | 3300025919 | Bacteria | 27407 |
| 257 | Ga0207657_10001423 | 3300025919 | Bacteria | 25532 |
| 258 | Ga0207694_10036318 | 3300025924 | Bacteria | 3782 |
| 259 | Ga0207694_10207052 | 3300025924 | Bacteria | 1597 |
| 260 | Ga0207700_10038443 | 3300025928 | Bacteria | 3473 |
| 261 | Ga0207664_10094268 | 3300025929 | Bacteria | 2460 |
| 262 | Ga0207690_10000037 | 3300025932 | Bacteria | 142658 |
| 263 | Ga0207706_10179484 | 3300025933 | Bacteria | 1859 |
| 264 | Ga0207709_10000172 | 3300025935 | Bacteria | 86654 |
| 265 | Ga0207665_10013914 | 3300025939 | Bacteria | 5292 |
| 266 | Ga0207667_10018107 | 3300025949 | Bacteria | 7908 |
| 267 | Ga0207667_10040261 | 3300025949 | Bacteria | 4976 |
| 268 | Ga0207667_10200826 | 3300025949 | Bacteria | 2045 |
| 269 | Ga0207658_10115035 | 3300025986 | Bacteria | 2134 |
| 270 | Ga0207658_10179778 | 3300025986 | Bacteria | 1750 |
| 271 | Ga0207639_10018607 | 3300026041 | Bacteria | 4940 |
| 272 | Ga0207639_10071183 | 3300026041 | Bacteria | 2719 |
| 273 | Ga0207678_10000317 | 3300026067 | Bacteria | 43506 |
| 274 | Ga0207678_10010832 | 3300026067 | Bacteria | 8012 |
| 275 | Ga0207702_10143469 | 3300026078 | Bacteria | 2164 |
| 276 | Ga0207674_10058378 | 3300026116 | Bacteria | 3909 |
| 277 | Ga0207683_10135673 | 3300026121 | Bacteria | 2215 |
| 278 | Ga0207683_10147985 | 3300026121 | Bacteria | 2119 |
| 279 | Ga0207698_10017622 | 3300026142 | Bacteria | 4852 |
| 280 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 281 | Ga0209281_1000076 | 3300027111 | Bacteria | 263350 |
| 282 | Ga0209371_1000080 | 3300027312 | Bacteria | 185771 |
| 283 | Ga0209371_1014775 | 3300027312 | Bacteria | 2124 |
| 284 | Ga0265337_1001439 | 3300028556 | Bacteria | 11715 |
| 285 | Ga0265326_10001380 | 3300028558 | Bacteria | 8553 |
| 286 | Ga0265334_10005260 | 3300028573 | Bacteria | 5665 |
| 287 | Ga0265318_10003474 | 3300028577 | Bacteria | 7906 |
| 288 | Ga0265323_10000992 | 3300028653 | Bacteria | 14760 |
| 289 | Ga0265322_10002589 | 3300028654 | Bacteria | 5560 |
| 290 | Ga0265336_10000003 | 3300028666 | Bacteria | 423158 |
| 291 | Ga0265336_10000063 | 3300028666 | Bacteria | 98413 |
| 292 | Ga0307515_10000737 | 3300028794 | Bacteria | 75687 |
| 293 | Ga0265338_10000154 | 3300028800 | Bacteria | 125708 |
| 294 | Ga0265324_10001590 | 3300029957 | Bacteria | 12642 |
| 295 | Ga0268256_1000160 | 3300030500 | Bacteria | 86682 |
| 296 | Ga0268256_1015142 | 3300030500 | Bacteria | 2263 |
| 297 | Ga0307511_10098629 | 3300030521 | Bacteria | 1933 |
| 298 | Ga0265339_10001335 | 3300031249 | Bacteria | 18436 |
| 299 | Ga0265327_10005550 | 3300031251 | Bacteria | 10474 |
| 300 | Ga0307513_10015012 | 3300031456 | Bacteria | 9403 |
| 301 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 302 | Ga0307514_10000408 | 3300031649 | Bacteria | 95961 |
| 303 | Ga0307514_10001033 | 3300031649 | Bacteria | 40119 |
| 304 | Ga0265314_10001952 | 3300031711 | Bacteria | 21949 |
| 305 | Ga0307516_10000424 | 3300031730 | Bacteria | 55291 |
| 306 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 307 | Ga0307416_100010306 | 3300032002 | Bacteria | 6166 |
| 308 | Ga0373934_0005435 | 3300035086 | Bacteria | 4721 |
| 309 | Ga0373939_0000469 | 3300035114 | Bacteria | 10203 |
| 310 | Ga0373960_0002278 | 3300035121 | Bacteria | 4319 |
| 311 | Ga0373943_0107883 | 3300035170 | Bacteria | 1465 |
| 312 | Ga0373962_0016516 | 3300035242 | Bacteria | 1904 |
| 313 | Ga0373927_0091434 | 3300035695 | Bacteria | 1976 |
| 314 | Ga0395899_0000005 | 3300037312 | Bacteria | 772966 |
| 315 | Ga0395900_0000003 | 3300037418 | Bacteria | 587648 |
| 316 | Ga0395900_0021389 | 3300037418 | Bacteria | 6613 |
| 317 | Ga0395900_0057494 | 3300037418 | Bacteria | 4005 |
| 318 | Ga0395898_0000003 | 3300037466 | Bacteria | 772986 |
| 319 | Ga0395898_0015437 | 3300037466 | Bacteria | 7832 |
| 320 | Ga0395898_0057172 | 3300037466 | Bacteria | 3802 |
| 321 | Ga0395898_0074039 | 3300037466 | Bacteria | 3290 |
| 322 | Ga0395905_0000004 | 3300037471 | Bacteria | 674991 |
| 323 | Ga0395905_0000009 | 3300037471 | Bacteria | 488729 |
| 324 | Ga0395905_0004257 | 3300037471 | Bacteria | 14949 |
| 325 | Ga0395905_0012101 | 3300037471 | Bacteria | 8312 |
| 326 | Ga0395905_0013595 | 3300037471 | Bacteria | 7797 |
| 327 | Ga0395905_0222404 | 3300037471 | Bacteria | 1767 |
| 328 | Ga0436364_0100220 | 3300037853 | Bacteria | 61250 |
| 329 | Ga0436364_0465200 | 3300037853 | Bacteria | 2168 |
| 330 | Ga0436364_0586291 | 3300037853 | Bacteria | 97560 |
| 331 | Ga0436364_0783389 | 3300037853 | Bacteria | 17507 |
| 332 | Ga0436364_0841842 | 3300037853 | Bacteria | 1928 |
| 333 | Ga0395901_0000009 | 3300038443 | Bacteria | 479396 |
| 334 | Ga0395901_0038206 | 3300038443 | Bacteria | 4966 |
| 335 | Ga0395901_0130414 | 3300038443 | Bacteria | 2641 |
| 336 | Ga0395901_0185873 | 3300038443 | Bacteria | 2179 |
| 337 | Ga0395901_0201249 | 3300038443 | Bacteria | 2087 |
| 338 | Ga0436365_0552641 | 3300039437 | Bacteria | 23591 |
| 339 | Ga0436365_0821809 | 3300039437 | Bacteria | 3267 |
| 340 | Ga0436365_1478189 | 3300039437 | Bacteria | 2267 |
| 341 | Ga0436360_0091417 | 3300039438 | Bacteria | 2318 |
| 342 | Ga0436360_0624080 | 3300039438 | Bacteria | 4755 |
| 343 | Ga0436361_0033961 | 3300039447 | Bacteria | 8485 |
| 344 | Ga0436361_0193139 | 3300039447 | Bacteria | 16854 |
| 345 | Ga0436361_0455065 | 3300039447 | Bacteria | 73475 |
| 346 | Ga0436361_1139408 | 3300039447 | Bacteria | 4705 |
| 347 | Ga0436363_0679974 | 3300039450 | Bacteria | 5752 |
| 348 | Ga0436362_0295156 | 3300039453 | Bacteria | 1831 |
| 349 | Ga0436362_1208322 | 3300039453 | Bacteria | 1784 |
| 350 | Ga0439448_0000025 | 3300042005 | Bacteria | 24247 |
| 351 | Ga0439448_0002656 | 3300042005 | Bacteria | 4879 |
| 352 | Ga0451577_0010994 | 3300042876 | Bacteria | 8596 |
| 353 | Ga0466969_0002900 | 3300044656 | Bacteria | 9150 |
| 354 | Ga0466969_0079966 | 3300044656 | Bacteria | 1561 |
| 355 | Ga0466972_0011461 | 3300044658 | Bacteria | 4452 |
| 356 | Ga0466965_0003466 | 3300044683 | Bacteria | 6919 |
| 357 | Ga0466965_0016314 | 3300044683 | Bacteria | 3532 |
| 358 | Ga0466966_0000037 | 3300044684 | Bacteria | 97578 |
| 359 | Ga0466966_0001374 | 3300044684 | Bacteria | 15651 |
| 360 | Ga0466966_0005943 | 3300044684 | Bacteria | 8052 |
| 361 | Ga0466961_0000258 | 3300044693 | Bacteria | 35598 |
| 362 | Ga0466961_0003537 | 3300044693 | Bacteria | 9749 |
| 363 | Ga0466961_0010435 | 3300044693 | Bacteria | 5928 |
| 364 | Ga0466961_0016999 | 3300044693 | Bacteria | 4672 |
| 365 | Ga0466961_0038448 | 3300044693 | Bacteria | 3069 |
| 366 | Ga0466963_0044011 | 3300044694 | Bacteria | 2937 |
| 367 | Ga0466964_0000407 | 3300044706 | Bacteria | 13000 |
| 368 | Ga0453684_0003874 | 3300044712 | Bacteria | 32937 |
| 369 | Ga0453684_0039960 | 3300044712 | Bacteria | 6380 |
| 370 | Ga0466971_0078563 | 3300044719 | Bacteria | 1503 |
| 371 | Ga0466968_0030835 | 3300044735 | Bacteria | 2223 |
| 372 | Ga0466957_0033487 | 3300044842 | Bacteria | 3083 |
| 373 | Ga0466959_0005077 | 3300045049 | Bacteria | 8952 |
| 374 | Ga0466959_0018695 | 3300045049 | Bacteria | 5089 |
| 375 | Ga0466959_0048665 | 3300045049 | Bacteria | 3115 |
| 376 | Ga0466959_0063890 | 3300045049 | Bacteria | 2672 |
| 377 | Ga0451576_0012383 | 3300045051 | Bacteria | 9582 |
| 378 | Ga0466958_0007398 | 3300045836 | Bacteria | 6038 |
| 379 | Ga0466958_0038355 | 3300045836 | Bacteria | 2874 |
| 380 | Ga0466958_0113524 | 3300045836 | Bacteria | 1692 |
| 381 | Ga0495592_0008740 | 3300046454 | Bacteria | 7604 |
| 382 | Ga0495592_0050462 | 3300046454 | Bacteria | 3091 |
| 383 | Ga0495603_0000430 | 3300046455 | Bacteria | 23265 |
| 384 | Ga0495603_0001760 | 3300046455 | Bacteria | 12754 |
| 385 | Ga0495603_0004181 | 3300046455 | Bacteria | 8602 |
| 386 | Ga0495603_0013805 | 3300046455 | Bacteria | 4888 |
| 387 | Ga0495603_0095291 | 3300046455 | Bacteria | 1739 |
| 388 | Ga0495590_0000013 | 3300046457 | Bacteria | 271977 |
| 389 | Ga0495590_0006335 | 3300046457 | Bacteria | 4627 |
| 390 | Ga0495590_0030841 | 3300046457 | Bacteria | 1878 |
| 391 | Ga0495591_000109 | 3300046458 | Bacteria | 94877 |
| 392 | Ga0495591_003119 | 3300046458 | Bacteria | 8763 |
| 393 | Ga0495629_0000027 | 3300046459 | Bacteria | 129244 |
| 394 | Ga0495629_0000184 | 3300046459 | Bacteria | 56265 |
| 395 | Ga0495629_0000262 | 3300046459 | Bacteria | 45919 |
| 396 | Ga0495629_0002023 | 3300046459 | Bacteria | 15768 |
| 397 | Ga0495629_0002885 | 3300046459 | Bacteria | 13133 |
| 398 | Ga0495629_0080644 | 3300046459 | Bacteria | 2272 |
| 399 | Ga0495629_0127476 | 3300046459 | Bacteria | 1773 |
| 400 | Ga0495629_0208369 | 3300046459 | Bacteria | 1350 |
| 401 | Ga0495638_0001152 | 3300046460 | Bacteria | 25467 |
| 402 | Ga0495638_0012125 | 3300046460 | Bacteria | 5919 |
| 403 | Ga0495641_0043944 | 3300046461 | Bacteria | 2064 |
| 404 | Ga0495651_0080184 | 3300046462 | Bacteria | 2466 |
| 405 | Ga0495653_0000323 | 3300046463 | Bacteria | 38936 |
| 406 | Ga0495653_0001078 | 3300046463 | Bacteria | 21050 |
| 407 | Ga0495653_0003556 | 3300046463 | Bacteria | 12558 |
| 408 | Ga0495653_0004636 | 3300046463 | Bacteria | 11117 |
| 409 | Ga0495653_0012355 | 3300046463 | Bacteria | 6968 |
| 410 | Ga0495653_0026186 | 3300046463 | Bacteria | 4679 |
| 411 | Ga0495653_0053932 | 3300046463 | Bacteria | 3073 |
| 412 | Ga0495653_0079310 | 3300046463 | Bacteria | 2432 |
| 413 | Ga0495653_0090892 | 3300046463 | Bacteria | 2232 |
| 414 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 415 | Ga0495650_0000155 | 3300046471 | Bacteria | 155947 |
| 416 | Ga0495650_0000322 | 3300046471 | Bacteria | 85802 |
| 417 | Ga0495650_0007783 | 3300046471 | Bacteria | 6374 |
| 418 | Ga0495650_0008029 | 3300046471 | Bacteria | 6233 |
| 419 | Ga0495650_0010335 | 3300046471 | Bacteria | 5215 |
| 420 | Ga0495650_0019378 | 3300046471 | Bacteria | 3350 |
| 421 | Ga0495580_0000464 | 3300046472 | Bacteria | 33698 |
| 422 | Ga0495580_0005399 | 3300046472 | Bacteria | 10568 |
| 423 | Ga0495580_0021677 | 3300046472 | Bacteria | 4738 |
| 424 | Ga0495580_0031660 | 3300046472 | Bacteria | 3820 |
| 425 | Ga0495580_0040928 | 3300046472 | Bacteria | 3307 |
| 426 | Ga0495580_0172731 | 3300046472 | Bacteria | 1494 |
| 427 | Ga0495582_0002757 | 3300046473 | Bacteria | 9801 |
| 428 | Ga0495582_0002869 | 3300046473 | Bacteria | 9638 |
| 429 | Ga0495582_0017483 | 3300046473 | Bacteria | 3923 |
| 430 | Ga0495582_0047889 | 3300046473 | Bacteria | 2354 |
| 431 | Ga0495605_0001158 | 3300046474 | Bacteria | 17488 |
| 432 | Ga0495605_0001269 | 3300046474 | Bacteria | 16723 |
| 433 | Ga0495605_0002220 | 3300046474 | Bacteria | 12125 |
| 434 | Ga0495605_0003943 | 3300046474 | Bacteria | 8775 |
| 435 | Ga0495605_0004941 | 3300046474 | Bacteria | 7791 |
| 436 | Ga0495605_0007402 | 3300046474 | Bacteria | 6230 |
| 437 | Ga0495605_0015189 | 3300046474 | Bacteria | 4194 |
| 438 | Ga0495605_0017678 | 3300046474 | Bacteria | 3835 |
| 439 | Ga0495605_0017952 | 3300046474 | Bacteria | 3800 |
| 440 | Ga0495605_0019289 | 3300046474 | Bacteria | 3647 |
| 441 | Ga0495605_0030728 | 3300046474 | Bacteria | 2751 |
| 442 | Ga0495605_0062388 | 3300046474 | Bacteria | 1781 |
| 443 | Ga0495639_0004351 | 3300046475 | Bacteria | 6075 |
| 444 | Ga0495662_0041700 | 3300046476 | Bacteria | 2216 |
| 445 | Ga0495662_0066486 | 3300046476 | Bacteria | 1744 |
| 446 | Ga0495664_0002960 | 3300046477 | Bacteria | 9171 |
| 447 | Ga0495664_0007286 | 3300046477 | Bacteria | 6137 |
| 448 | Ga0495584_0000026 | 3300046491 | Bacteria | 114028 |
| 449 | Ga0495584_0000029 | 3300046491 | Bacteria | 105850 |
| 450 | Ga0495584_0001869 | 3300046491 | Bacteria | 12180 |
| 451 | Ga0495584_0001997 | 3300046491 | Bacteria | 11733 |
| 452 | Ga0495584_0002177 | 3300046491 | Bacteria | 11176 |
| 453 | Ga0495584_0003468 | 3300046491 | Bacteria | 8676 |
| 454 | Ga0495585_0010743 | 3300046492 | Bacteria | 5438 |
| 455 | Ga0495585_0012655 | 3300046492 | Bacteria | 4966 |
| 456 | Ga0495585_0024534 | 3300046492 | Bacteria | 3457 |
| 457 | Ga0495596_0000173 | 3300046500 | Bacteria | 44841 |
| 458 | Ga0495596_0000355 | 3300046500 | Bacteria | 29677 |
| 459 | Ga0495596_0000604 | 3300046500 | Bacteria | 22532 |
| 460 | Ga0495596_0000786 | 3300046500 | Bacteria | 19278 |
| 461 | Ga0495596_0000991 | 3300046500 | Bacteria | 16870 |
| 462 | Ga0495596_0003689 | 3300046500 | Bacteria | 7655 |
| 463 | Ga0495596_0015195 | 3300046500 | Bacteria | 3230 |
| 464 | Ga0495596_0018761 | 3300046500 | Bacteria | 2849 |
| 465 | Ga0495596_0025063 | 3300046500 | Bacteria | 2413 |
| 466 | Ga0495607_0000215 | 3300046501 | Bacteria | 61794 |
| 467 | Ga0495607_0000316 | 3300046501 | Bacteria | 50215 |
| 468 | Ga0495607_0001536 | 3300046501 | Bacteria | 20304 |
| 469 | Ga0495607_0002120 | 3300046501 | Bacteria | 16568 |
| 470 | Ga0495583_0000011 | 3300046506 | Bacteria | 350215 |
| 471 | Ga0495583_0000040 | 3300046506 | Bacteria | 236558 |
| 472 | Ga0495583_0000296 | 3300046506 | Bacteria | 78991 |
| 473 | Ga0495583_0000378 | 3300046506 | Bacteria | 69104 |
| 474 | Ga0495583_0001070 | 3300046506 | Bacteria | 30573 |
| 475 | Ga0495583_0003300 | 3300046506 | Bacteria | 12506 |
| 476 | Ga0495583_0003830 | 3300046506 | Bacteria | 11153 |
| 477 | Ga0495583_0007163 | 3300046506 | Bacteria | 7093 |
| 478 | Ga0495583_0023731 | 3300046506 | Bacteria | 3096 |
| 479 | Ga0495606_0001789 | 3300046507 | Bacteria | 27342 |
| 480 | Ga0495606_0003521 | 3300046507 | Bacteria | 16538 |
| 481 | Ga0495606_0024866 | 3300046507 | Bacteria | 4303 |
| 482 | Ga0495606_0126188 | 3300046507 | Bacteria | 1526 |
| 483 | Ga0495608_0008753 | 3300046511 | Bacteria | 7079 |
| 484 | Ga0495608_0036947 | 3300046511 | Bacteria | 3286 |
| 485 | Ga0495608_0038012 | 3300046511 | Bacteria | 3235 |
| 486 | Ga0495610_0004903 | 3300046512 | Bacteria | 9722 |
| 487 | Ga0495610_0061606 | 3300046512 | Bacteria | 1782 |
| 488 | Ga0495616_0000012 | 3300046513 | Bacteria | 211342 |
| 489 | Ga0495616_0000282 | 3300046513 | Bacteria | 41088 |
| 490 | Ga0495616_0004739 | 3300046513 | Bacteria | 8528 |
| 491 | Ga0495616_0007303 | 3300046513 | Bacteria | 6613 |
| 492 | Ga0495616_0008091 | 3300046513 | Bacteria | 6261 |
| 493 | Ga0495616_0024106 | 3300046513 | Bacteria | 3266 |
| 494 | Ga0495616_0025566 | 3300046513 | Bacteria | 3152 |
| 495 | Ga0495616_0029447 | 3300046513 | Bacteria | 2899 |
| 496 | Ga0495616_0059686 | 3300046513 | Bacteria | 1875 |
| 497 | Ga0495618_0014796 | 3300046514 | Bacteria | 4759 |
| 498 | Ga0495618_0017556 | 3300046514 | Bacteria | 4389 |
| 499 | Ga0495628_0004051 | 3300046516 | Bacteria | 13038 |
| 500 | Ga0495628_0011994 | 3300046516 | Bacteria | 7309 |
| 501 | Ga0495628_0024722 | 3300046516 | Bacteria | 4914 |
| 502 | Ga0495628_0040382 | 3300046516 | Bacteria | 3728 |
| 503 | Ga0495628_0061116 | 3300046516 | Bacteria | 2955 |
| 504 | Ga0495628_0087335 | 3300046516 | Bacteria | 2417 |
| 505 | Ga0495628_0107157 | 3300046516 | Bacteria | 2152 |
| 506 | Ga0495630_0012035 | 3300046517 | Bacteria | 6275 |
| 507 | Ga0495630_0019324 | 3300046517 | Bacteria | 5007 |
| 508 | Ga0495631_0000737 | 3300046518 | Bacteria | 21033 |
| 509 | Ga0495631_0000861 | 3300046518 | Bacteria | 19091 |
| 510 | Ga0495631_0002653 | 3300046518 | Bacteria | 9973 |
| 511 | Ga0495631_0003830 | 3300046518 | Bacteria | 8157 |
| 512 | Ga0495631_0008115 | 3300046518 | Bacteria | 5303 |
| 513 | Ga0495631_0011388 | 3300046518 | Bacteria | 4373 |
| 514 | Ga0495631_0051344 | 3300046518 | Bacteria | 1802 |
| 515 | Ga0495632_0000012 | 3300046519 | Bacteria | 264389 |
| 516 | Ga0495632_0000367 | 3300046519 | Bacteria | 42974 |
| 517 | Ga0495632_0000530 | 3300046519 | Bacteria | 36061 |
| 518 | Ga0495632_0002018 | 3300046519 | Bacteria | 16008 |
| 519 | Ga0495632_0008241 | 3300046519 | Bacteria | 6424 |
| 520 | Ga0495632_0021529 | 3300046519 | Bacteria | 3473 |
| 521 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 522 | Ga0495643_0001945 | 3300046522 | Bacteria | 17383 |
| 523 | Ga0495643_0005793 | 3300046522 | Bacteria | 8271 |
| 524 | Ga0495643_0011088 | 3300046522 | Bacteria | 5509 |
| 525 | Ga0495643_0025217 | 3300046522 | Bacteria | 3366 |
| 526 | Ga0495643_0064765 | 3300046522 | Bacteria | 1930 |
| 527 | Ga0495644_0015669 | 3300046523 | Bacteria | 2906 |
| 528 | Ga0495644_0016327 | 3300046523 | Bacteria | 2841 |
| 529 | Ga0495644_0022233 | 3300046523 | Bacteria | 2417 |
| 530 | Ga0495648_0000648 | 3300046524 | Bacteria | 37132 |
| 531 | Ga0495648_0006040 | 3300046524 | Bacteria | 9940 |
| 532 | Ga0495648_0006664 | 3300046524 | Bacteria | 9354 |
| 533 | Ga0495648_0022004 | 3300046524 | Bacteria | 4400 |
| 534 | Ga0495648_0030675 | 3300046524 | Bacteria | 3550 |
| 535 | Ga0495648_0089876 | 3300046524 | Bacteria | 1722 |
| 536 | Ga0495663_0004271 | 3300046525 | Bacteria | 4027 |
| 537 | Ga0495666_0001260 | 3300046526 | Bacteria | 12277 |
| 538 | Ga0495666_0006755 | 3300046526 | Bacteria | 5768 |
| 539 | Ga0495666_0011241 | 3300046526 | Bacteria | 4465 |
| 540 | Ga0495666_0013933 | 3300046526 | Bacteria | 4009 |
| 541 | Ga0495666_0020985 | 3300046526 | Bacteria | 3234 |
| 542 | Ga0495642_0000091 | 3300046528 | Bacteria | 53133 |
| 543 | Ga0495642_0002541 | 3300046528 | Bacteria | 7382 |
| 544 | Ga0495642_0003697 | 3300046528 | Bacteria | 6002 |
| 545 | Ga0495642_0011402 | 3300046528 | Bacteria | 3415 |
| 546 | Ga0495642_0019504 | 3300046528 | Bacteria | 2659 |
| 547 | Ga0495642_0048943 | 3300046528 | Bacteria | 1735 |
| 548 | Ga0495652_0011870 | 3300046529 | Bacteria | 7874 |
| 549 | Ga0495652_0019974 | 3300046529 | Bacteria | 5958 |
| 550 | Ga0495652_0039650 | 3300046529 | Bacteria | 4072 |
| 551 | Ga0495652_0155766 | 3300046529 | Bacteria | 1779 |
| 552 | Ga0495652_0184361 | 3300046529 | Bacteria | 1598 |
| 553 | Ga0495654_0001482 | 3300046530 | Bacteria | 16073 |
| 554 | Ga0495654_0012346 | 3300046530 | Bacteria | 4590 |
| 555 | Ga0495665_0002053 | 3300046531 | Bacteria | 10902 |
| 556 | Ga0495665_0002164 | 3300046531 | Bacteria | 10625 |
| 557 | Ga0495665_0006614 | 3300046531 | Bacteria | 6257 |
| 558 | Ga0495665_0020962 | 3300046531 | Bacteria | 3512 |
| 559 | Ga0495665_0023187 | 3300046531 | Bacteria | 3332 |
| 560 | Ga0495640_0002090 | 3300046533 | Bacteria | 15908 |
| 561 | Ga0495640_0002685 | 3300046533 | Bacteria | 14303 |
| 562 | Ga0495640_0015535 | 3300046533 | Bacteria | 5726 |
| 563 | Ga0495586_0003135 | 3300046535 | Bacteria | 8895 |
| 564 | Ga0495586_0003172 | 3300046535 | Bacteria | 8847 |
| 565 | Ga0495586_0011394 | 3300046535 | Bacteria | 4730 |
| 566 | Ga0495586_0012543 | 3300046535 | Bacteria | 4496 |
| 567 | Ga0495587_0003273 | 3300046536 | Bacteria | 10809 |
| 568 | Ga0495587_0010841 | 3300046536 | Bacteria | 5784 |
| 569 | Ga0495587_0051630 | 3300046536 | Bacteria | 2430 |
| 570 | Ga0495587_0080803 | 3300046536 | Bacteria | 1883 |
| 571 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 572 | Ga0495609_0001492 | 3300046538 | Bacteria | 15496 |
| 573 | Ga0495609_0002530 | 3300046538 | Bacteria | 11212 |
| 574 | Ga0495609_0013249 | 3300046538 | Bacteria | 3899 |
| 575 | Ga0495597_0000560 | 3300046542 | Bacteria | 30875 |
| 576 | Ga0495597_0000911 | 3300046542 | Bacteria | 22921 |
| 577 | Ga0495597_0023439 | 3300046542 | Bacteria | 2854 |
| 578 | Ga0495597_0024676 | 3300046542 | Bacteria | 2773 |
| 579 | Ga0495645_0000102 | 3300046543 | Bacteria | 59126 |
| 580 | Ga0495645_0002579 | 3300046543 | Bacteria | 12321 |
| 581 | Ga0495645_0033652 | 3300046543 | Bacteria | 3739 |
| 582 | Ga0495645_0117294 | 3300046543 | Bacteria | 1878 |
| 583 | Ga0495645_0161474 | 3300046543 | Bacteria | 1549 |
| 584 | Ga0495622_0000006 | 3300046557 | Bacteria | 245799 |
| 585 | Ga0495622_0000018 | 3300046557 | Bacteria | 173985 |
| 586 | Ga0495622_0043841 | 3300046557 | Bacteria | 2079 |
| 587 | Ga0495633_0000874 | 3300046558 | Bacteria | 26052 |
| 588 | Ga0495633_0004611 | 3300046558 | Bacteria | 8684 |
| 589 | Ga0495633_0042551 | 3300046558 | Bacteria | 2156 |
| 590 | Ga0495667_0060110 | 3300046559 | Bacteria | 2493 |
| 591 | Ga0495656_0014983 | 3300046615 | Bacteria | 2917 |
| 592 | Ga0495656_0027094 | 3300046615 | Bacteria | 2287 |
| 593 | Ga0495656_0032289 | 3300046615 | Bacteria | 2129 |
| 594 | Ga0495656_0036650 | 3300046615 | Bacteria | 2021 |
| 595 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 596 | Ga0495668_0002062 | 3300046616 | Bacteria | 17425 |
| 597 | Ga0495668_0005360 | 3300046616 | Bacteria | 8741 |
| 598 | Ga0495668_0017295 | 3300046616 | Bacteria | 4184 |
| 599 | Ga0495668_0044109 | 3300046616 | Bacteria | 2478 |
| 600 | Ga0495634_0008052 | 3300046642 | Bacteria | 7866 |
| 601 | Ga0495634_0010099 | 3300046642 | Bacteria | 6929 |
| 602 | Ga0495634_0037461 | 3300046642 | Bacteria | 3313 |
| 603 | Ga0495634_0069049 | 3300046642 | Bacteria | 2332 |
| 604 | Ga0495634_0128589 | 3300046642 | Bacteria | 1616 |
| 605 | Ga0495611_0001733 | 3300046648 | Bacteria | 10560 |
| 606 | Ga0495611_0063534 | 3300046648 | Bacteria | 1680 |
| 607 | Ga0495625_0042373 | 3300046660 | Bacteria | 3309 |
| 608 | Ga0495625_0129856 | 3300046660 | Bacteria | 1708 |
| 609 | Ga0495635_0011202 | 3300046663 | Bacteria | 6286 |
| 610 | Ga0495635_0013616 | 3300046663 | Bacteria | 5692 |
| 611 | Ga0495635_0021097 | 3300046663 | Bacteria | 4539 |
| 612 | Ga0495635_0035456 | 3300046663 | Bacteria | 3458 |
| 613 | Ga0495661_0000049 | 3300046665 | Bacteria | 144060 |
| 614 | Ga0495661_0000053 | 3300046665 | Bacteria | 140234 |
| 615 | Ga0495661_0003280 | 3300046665 | Bacteria | 12015 |
| 616 | Ga0495661_0010540 | 3300046665 | Bacteria | 6302 |
| 617 | Ga0495661_0012256 | 3300046665 | Bacteria | 5790 |
| 618 | Ga0495661_0022956 | 3300046665 | Bacteria | 4055 |
| 619 | Ga0495661_0026303 | 3300046665 | Bacteria | 3749 |
| 620 | Ga0495661_0030771 | 3300046665 | Bacteria | 3414 |
| 621 | Ga0495661_0033284 | 3300046665 | Bacteria | 3252 |
| 622 | Ga0495661_0057564 | 3300046665 | Bacteria | 2320 |
| 623 | Ga0495588_0000062 | 3300046674 | Bacteria | 253674 |
| 624 | Ga0495588_0020368 | 3300046674 | Bacteria | 3259 |
| 625 | Ga0495588_0035899 | 3300046674 | Bacteria | 2513 |
| 626 | Ga0495657_0018615 | 3300046675 | Bacteria | 5021 |
| 627 | Ga0495599_0002748 | 3300046678 | Bacteria | 10266 |
| 628 | Ga0495599_0003298 | 3300046678 | Bacteria | 9417 |
| 629 | Ga0495623_0003937 | 3300046679 | Bacteria | 9789 |
| 630 | Ga0495623_0007395 | 3300046679 | Bacteria | 7130 |
| 631 | Ga0495623_0008781 | 3300046679 | Bacteria | 6560 |
| 632 | Ga0495623_0017834 | 3300046679 | Bacteria | 4585 |
| 633 | Ga0495623_0019894 | 3300046679 | Bacteria | 4340 |
| 634 | Ga0495646_0001647 | 3300046680 | Bacteria | 13330 |
| 635 | Ga0495646_0003189 | 3300046680 | Bacteria | 10189 |
| 636 | Ga0495646_0005124 | 3300046680 | Bacteria | 8266 |
| 637 | Ga0495646_0070710 | 3300046680 | Bacteria | 2055 |
| 638 | Ga0495669_0000157 | 3300046684 | Bacteria | 43325 |
| 639 | Ga0495669_0001448 | 3300046684 | Bacteria | 9794 |
| 640 | Ga0495669_0002071 | 3300046684 | Bacteria | 8216 |
| 641 | Ga0495669_0007195 | 3300046684 | Bacteria | 4664 |
| 642 | Ga0495613_0005190 | 3300046689 | Bacteria | 9780 |
| 643 | Ga0495613_0071370 | 3300046689 | Bacteria | 2531 |
| 644 | Ga0495624_0005097 | 3300046690 | Bacteria | 9495 |
| 645 | Ga0495624_0006209 | 3300046690 | Bacteria | 8493 |
| 646 | Ga0495624_0006488 | 3300046690 | Bacteria | 8297 |
| 647 | Ga0495624_0007132 | 3300046690 | Bacteria | 7864 |
| 648 | Ga0495624_0016699 | 3300046690 | Bacteria | 4941 |
| 649 | Ga0495624_0022724 | 3300046690 | Bacteria | 4139 |
| 650 | Ga0495624_0036015 | 3300046690 | Bacteria | 3192 |
| 651 | Ga0495670_0045979 | 3300046691 | Bacteria | 2180 |
| 652 | Ga0495649_0000071 | 3300046694 | Bacteria | 89386 |
| 653 | Ga0495649_0000283 | 3300046694 | Bacteria | 44818 |
| 654 | Ga0495649_0000465 | 3300046694 | Bacteria | 34846 |
| 655 | Ga0495649_0000496 | 3300046694 | Bacteria | 33713 |
| 656 | Ga0495649_0002364 | 3300046694 | Bacteria | 13344 |
| 657 | Ga0495649_0008289 | 3300046694 | Bacteria | 6257 |
| 658 | Ga0495649_0018320 | 3300046694 | Bacteria | 3941 |
| 659 | Ga0495649_0019509 | 3300046694 | Bacteria | 3809 |
| 660 | Ga0495589_0000103 | 3300046794 | Bacteria | 81696 |
| 661 | Ga0495589_0001477 | 3300046794 | Bacteria | 13524 |
| 662 | Ga0495589_0002349 | 3300046794 | Bacteria | 10618 |
| 663 | Ga0495589_0004136 | 3300046794 | Bacteria | 7763 |
| 664 | Ga0495589_0011582 | 3300046794 | Bacteria | 4579 |
| 665 | Ga0495589_0017606 | 3300046794 | Bacteria | 3666 |
| 666 | Ga0495589_0025749 | 3300046794 | Bacteria | 2983 |
| 667 | Ga0495589_0042656 | 3300046794 | Bacteria | 2260 |
| 668 | Ga0495589_0053329 | 3300046794 | Bacteria | 1996 |
| 669 | Ga0495600_0001801 | 3300046809 | Bacteria | 11985 |
| 670 | Ga0495600_0001987 | 3300046809 | Bacteria | 11489 |
| 671 | Ga0495600_0004945 | 3300046809 | Bacteria | 8006 |
| 672 | Ga0495600_0105546 | 3300046809 | Bacteria | 1835 |
| 673 | Ga0495660_0000057 | 3300046810 | Bacteria | 133310 |
| 674 | Ga0495660_0001412 | 3300046810 | Bacteria | 16457 |
| 675 | Ga0495660_0003177 | 3300046810 | Bacteria | 10225 |
| 676 | Ga0495660_0010951 | 3300046810 | Bacteria | 5271 |
| 677 | Ga0495581_0000771 | 3300047315 | Bacteria | 16987 |
| 678 | Ga0495581_0000959 | 3300047315 | Bacteria | 15501 |
| 679 | Ga0495581_0001239 | 3300047315 | Bacteria | 14042 |
| 680 | Ga0495604_0000860 | 3300047317 | Bacteria | 25329 |
| 681 | Ga0495604_0002237 | 3300047317 | Bacteria | 15504 |
| 682 | Ga0495604_0018061 | 3300047317 | Bacteria | 5644 |
| 683 | Ga0495604_0021063 | 3300047317 | Bacteria | 5202 |
| 684 | Ga0495604_0054945 | 3300047317 | Bacteria | 3070 |
| 685 | Ga0495604_0060906 | 3300047317 | Bacteria | 2889 |
| 686 | Ga0495604_0068196 | 3300047317 | Bacteria | 2700 |
| 687 | Ga0495674_0004658 | 3300047319 | Bacteria | 13185 |
| 688 | Ga0495674_0005289 | 3300047319 | Bacteria | 12379 |
| 689 | Ga0495674_0014260 | 3300047319 | Bacteria | 7442 |
| 690 | Ga0495674_0017782 | 3300047319 | Bacteria | 6620 |
| 691 | Ga0495674_0082328 | 3300047319 | Bacteria | 2759 |
| 692 | Ga0495674_0196192 | 3300047319 | Bacteria | 1676 |
| 693 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 694 | Ga0495672_0000078 | 3300047320 | Bacteria | 164474 |
| 695 | Ga0495672_0001165 | 3300047320 | Bacteria | 26623 |
| 696 | Ga0495672_0002211 | 3300047320 | Bacteria | 18128 |
| 697 | Ga0495672_0016324 | 3300047320 | Bacteria | 5008 |
| 698 | Ga0495672_0071231 | 3300047320 | Bacteria | 1968 |
| 699 | Ga0495676_0010858 | 3300047321 | Bacteria | 8238 |
| 700 | Ga0495676_0096081 | 3300047321 | Bacteria | 2204 |
| 701 | Ga0495676_0114563 | 3300047321 | Bacteria | 1972 |
| 702 | Ga0495680_0009339 | 3300047322 | Bacteria | 8830 |
| 703 | Ga0495680_0036606 | 3300047322 | Bacteria | 3939 |
| 704 | Ga0495680_0105057 | 3300047322 | Bacteria | 2100 |
| 705 | Ga0495680_0132264 | 3300047322 | Bacteria | 1832 |
| 706 | Ga0495683_0000168 | 3300047323 | Bacteria | 63828 |
| 707 | Ga0495683_0002012 | 3300047323 | Bacteria | 12617 |
| 708 | Ga0495683_0006526 | 3300047323 | Bacteria | 6372 |
| 709 | Ga0495683_0016692 | 3300047323 | Bacteria | 3810 |
| 710 | Ga0495683_0022551 | 3300047323 | Bacteria | 3237 |
| 711 | Ga0495683_0022922 | 3300047323 | Bacteria | 3210 |
| 712 | Ga0495683_0026064 | 3300047323 | Bacteria | 2992 |
| 713 | Ga0495687_000019 | 3300047443 | Bacteria | 341756 |
| 714 | Ga0495687_000021 | 3300047443 | Bacteria | 334681 |
| 715 | Ga0495687_000036 | 3300047443 | Bacteria | 255427 |
| 716 | Ga0495687_000740 | 3300047443 | Bacteria | 35582 |
| 717 | Ga0495687_001452 | 3300047443 | Bacteria | 21757 |
| 718 | Ga0495687_005545 | 3300047443 | Bacteria | 8004 |
| 719 | Ga0495687_055706 | 3300047443 | Bacteria | 1652 |
| 720 | Ga0495675_0001858 | 3300047444 | Bacteria | 12573 |
| 721 | Ga0495675_0010651 | 3300047444 | Bacteria | 5750 |
| 722 | Ga0495675_0033325 | 3300047444 | Bacteria | 3288 |
| 723 | Ga0495677_0000009 | 3300047445 | Bacteria | 170927 |
| 724 | Ga0495677_0000242 | 3300047445 | Bacteria | 24158 |
| 725 | Ga0495677_0011525 | 3300047445 | Bacteria | 3233 |
| 726 | Ga0495677_0016713 | 3300047445 | Bacteria | 2661 |
| 727 | Ga0495677_0052506 | 3300047445 | Bacteria | 1502 |
| 728 | Ga0495679_000006 | 3300047446 | Bacteria | 449956 |
| 729 | Ga0495679_000975 | 3300047446 | Bacteria | 17664 |
| 730 | Ga0495679_004533 | 3300047446 | Bacteria | 6371 |
| 731 | Ga0495685_000553 | 3300047447 | Bacteria | 11583 |
| 732 | Ga0495673_0016978 | 3300047469 | Bacteria | 3708 |
| 733 | Ga0495673_0017267 | 3300047469 | Bacteria | 3670 |
| 734 | Ga0495673_0035925 | 3300047469 | Bacteria | 2278 |
| 735 | Ga0495681_0010716 | 3300047470 | Bacteria | 5526 |
| 736 | Ga0495681_0041389 | 3300047470 | Bacteria | 2237 |
| 737 | Ga0495681_0048302 | 3300047470 | Bacteria | 2018 |
| 738 | Ga0495686_0000407 | 3300047472 | Bacteria | 68110 |
| 739 | Ga0495686_0052240 | 3300047472 | Bacteria | 2563 |
| 740 | Ga0495593_0000758 | 3300047673 | Bacteria | 18721 |
| 741 | Ga0495593_0004348 | 3300047673 | Bacteria | 8431 |
| 742 | Ga0495593_0020592 | 3300047673 | Bacteria | 3693 |
| 743 | Ga0495593_0045292 | 3300047673 | Bacteria | 2348 |
| 744 | Ga0495602_0001303 | 3300048088 | Bacteria | 24603 |
| 745 | Ga0495602_0015792 | 3300048088 | Bacteria | 7605 |
| 746 | Ga0495602_0018800 | 3300048088 | Bacteria | 6884 |
| 747 | Ga0495602_0064879 | 3300048088 | Bacteria | 3154 |
| 748 | Ga0495602_0066803 | 3300048088 | Bacteria | 3096 |
| 749 | Ga0495602_0102446 | 3300048088 | Bacteria | 2346 |
| 750 | Ga0495614_0000224 | 3300048089 | Bacteria | 22077 |
| 751 | Ga0495614_0005369 | 3300048089 | Bacteria | 5781 |
| 752 | Ga0495614_0006411 | 3300048089 | Bacteria | 5282 |
| 753 | Ga0495615_0000185 | 3300048090 | Bacteria | 15261 |
| 754 | Ga0495626_0000038 | 3300048091 | Bacteria | 175936 |
| 755 | Ga0495626_0002361 | 3300048091 | Bacteria | 13240 |
| 756 | Ga0495626_0002442 | 3300048091 | Bacteria | 12899 |
| 757 | Ga0495626_0004231 | 3300048091 | Bacteria | 8877 |
| 758 | Ga0495626_0004742 | 3300048091 | Bacteria | 8219 |
| 759 | Ga0495626_0012827 | 3300048091 | Bacteria | 4375 |
| 760 | Ga0495626_0021752 | 3300048091 | Bacteria | 3176 |
| 761 | Ga0495626_0026200 | 3300048091 | Bacteria | 2844 |
| 762 | Ga0495626_0028271 | 3300048091 | Bacteria | 2720 |
| 763 | Ga0495626_0029195 | 3300048091 | Bacteria | 2670 |
| 764 | Ga0495626_0033003 | 3300048091 | Bacteria | 2482 |
| 765 | Ga0495626_0070493 | 3300048091 | Bacteria | 1572 |
| 766 | Ga0496100_0000094 | 3300048903 | Bacteria | 50690 |
| 767 | Ga0496100_0003268 | 3300048903 | Bacteria | 8421 |
| 768 | Ga0496100_0030967 | 3300048903 | Bacteria | 3322 |
| 769 | Ga0496100_0032647 | 3300048903 | Bacteria | 3249 |
| 770 | Ga0496101_0000181 | 3300048904 | Bacteria | 50837 |
| 771 | Ga0496101_0002769 | 3300048904 | Bacteria | 10749 |
| 772 | Ga0496101_0011151 | 3300048904 | Bacteria | 5955 |
| 773 | Ga0496101_0048810 | 3300048904 | Bacteria | 3043 |
| 774 | Ga0496102_0000397 | 3300048905 | Bacteria | 50794 |
| 775 | Ga0496103_0000361 | 3300048906 | Bacteria | 41064 |
| 776 | Ga0496103_0002066 | 3300048906 | Bacteria | 12846 |
| 777 | Ga0496104_0012096 | 3300048907 | Bacteria | 7747 |
| 778 | Ga0496104_0046174 | 3300048907 | Bacteria | 4100 |
| 779 | Ga0496104_0115410 | 3300048907 | Bacteria | 2576 |
| 780 | Ga0496105_0010331 | 3300048908 | Bacteria | 7340 |
| 781 | Ga0496105_0026467 | 3300048908 | Bacteria | 4731 |
| 782 | Ga0496105_0029959 | 3300048908 | Bacteria | 4456 |
| 783 | Ga0496107_0078468 | 3300048910 | Bacteria | 2406 |
| 784 | Ga0496107_0086338 | 3300048910 | Bacteria | 2290 |
| 785 | Ga0496108_0045993 | 3300048911 | Bacteria | 3645 |
| 786 | Ga0496109_0025462 | 3300048912 | Bacteria | 5273 |
| 787 | Ga0496110_0030550 | 3300048913 | Bacteria | 4645 |
| 788 | Ga0496110_0042559 | 3300048913 | Bacteria | 3964 |
| 789 | Ga0496111_0013862 | 3300048914 | Bacteria | 5498 |
| 790 | Ga0496111_0038872 | 3300048914 | Bacteria | 3409 |
| 791 | Ga0496112_0004476 | 3300048915 | Bacteria | 11852 |
| 792 | Ga0496112_0010228 | 3300048915 | Bacteria | 8505 |
| 793 | Ga0496112_0092935 | 3300048915 | Bacteria | 2986 |
| 794 | Ga0496113_0000770 | 3300048916 | Bacteria | 16519 |
| 795 | Ga0496113_0013419 | 3300048916 | Bacteria | 5551 |
| 796 | Ga0496113_0102214 | 3300048916 | Bacteria | 2222 |
| 797 | Ga0496114_0007422 | 3300048917 | Bacteria | 8667 |
| 798 | Ga0496116_0012411 | 3300048919 | Bacteria | 6963 |
| 799 | Ga0496116_0092800 | 3300048919 | Bacteria | 1830 |
| 800 | Ga0496117_0000210 | 3300048920 | Bacteria | 112808 |
| 801 | Ga0496117_0000454 | 3300048920 | Bacteria | 68282 |
| 802 | Ga0496117_0036767 | 3300048920 | Bacteria | 3659 |
| 803 | Ga0496117_0037985 | 3300048920 | Bacteria | 3579 |
| 804 | Ga0496118_0000788 | 3300048921 | Bacteria | 50781 |
| 805 | Ga0496118_0008718 | 3300048921 | Bacteria | 10420 |
| 806 | Ga0496118_0038323 | 3300048921 | Bacteria | 3844 |
| 807 | Ga0496121_0000457 | 3300048924 | Bacteria | 80467 |
| 808 | Ga0496121_0008889 | 3300048924 | Bacteria | 11678 |
| 809 | Ga0496121_0012700 | 3300048924 | Bacteria | 9138 |
| 810 | Ga0496121_0021494 | 3300048924 | Bacteria | 6317 |
| 811 | Ga0496121_0023477 | 3300048924 | Bacteria | 5938 |
| 812 | Ga0496122_0001753 | 3300048925 | Bacteria | 33345 |
| 813 | Ga0496122_0019617 | 3300048925 | Bacteria | 6165 |
| 814 | Ga0496123_0001273 | 3300048926 | Bacteria | 36130 |
| 815 | Ga0496123_0003705 | 3300048926 | Bacteria | 16808 |
| 816 | Ga0496123_0130405 | 3300048926 | Bacteria | 1394 |
| 817 | Ga0496124_0005065 | 3300048927 | Bacteria | 15036 |
| 818 | Ga0496124_0068102 | 3300048927 | Bacteria | 2960 |
| 819 | Ga0496124_0069217 | 3300048927 | Bacteria | 2930 |
| 820 | Ga0496124_0137513 | 3300048927 | Bacteria | 1932 |
| 821 | Ga0496125_0004347 | 3300048928 | Bacteria | 16436 |
| 822 | Ga0496125_0023523 | 3300048928 | Bacteria | 5685 |
| 823 | Ga0496125_0074761 | 3300048928 | Bacteria | 2626 |
| 824 | Ga0496126_0004490 | 3300048929 | Bacteria | 16643 |
| 825 | Ga0496126_0007857 | 3300048929 | Bacteria | 11616 |
| 826 | Ga0496126_0022739 | 3300048929 | Bacteria | 6090 |
| 827 | Ga0496126_0072233 | 3300048929 | Bacteria | 3070 |
| 828 | Ga0496126_0109122 | 3300048929 | Bacteria | 2412 |
| 829 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 830 | Ga0495678_000061 | 3300049459 | Bacteria | 142649 |
| 831 | Ga0495678_002401 | 3300049459 | Bacteria | 12781 |
| 832 | Ga0495678_028831 | 3300049459 | Bacteria | 2337 |
| 833 | Ga0495682_0000130 | 3300049460 | Bacteria | 65523 |
| 834 | Ga0495682_0016023 | 3300049460 | Bacteria | 2836 |
| 835 | Ga0495682_0017166 | 3300049460 | Bacteria | 2735 |
| 836 | Ga0495682_0017393 | 3300049460 | Bacteria | 2714 |
| 837 | Ga0501034_0000049 | 3300049571 | Bacteria | 213166 |
| 838 | Ga0501047_0089024 | 3300049581 | Bacteria | 2964 |
| 839 | Ga0501266_001158 | 3300049763 | Bacteria | 3382 |
| 840 | Ga0500635_0000040 | 3300053080 | Bacteria | 91731 |
| 841 | Ga0500572_004263 | 3300053111 | Bacteria | 3248 |
| 842 | Ga0500559_0017828 | 3300053136 | Bacteria | 3002 |
| 843 | Ga0500636_0024953 | 3300053177 | Bacteria | 3533 |
| 844 | Ga0501084_0015006 | 3300054114 | Bacteria | 6423 |
| 845 | Ga0500661_006759 | 3300055283 | Bacteria | 2134 |
| 846 | Ga0466962_0001546 | 3300061719 | Bacteria | 10747 |
| 847 | Ga0466962_0028904 | 3300061719 | Bacteria | 2655 |
| 848 | Ga0466962_0033663 | 3300061719 | Bacteria | 2452 |
| 849 | 2501077496 | 2501025502 | Bacteria | 9641094 |
| 850 | 2509131867 | 2508501125 | Bacteria | 7208311 |
| 851 | 2510247773 | 2510065045 | Bacteria | 7761063 |
| 852 | 2511088924 | 2510917013 | Bacteria | 9951648 |
| 853 | 2512350115 | 2512047030 | Bacteria | 9031815 |
| 854 | 2513557610 | 2513237082 | Bacteria | 8640282 |
| 855 | 2513565663 | 2513237083 | Bacteria | 8410967 |
| 856 | 2513963593 | 2513237151 | Bacteria | 6309801 |
| 857 | 2514053048 | 2513237166 | Bacteria | 10373764 |
| 858 | 2514053459 | 2513237166 | Bacteria | 10373764 |
| 859 | 2515682095 | 2515154122 | Bacteria | 8609520 |
| 860 | 2515689757 | 2515154123 | Bacteria | 6387382 |
| 861 | 2516025258 | 2515154189 | Bacteria | 9629850 |
| 862 | 2519460685 | 2519103095 | Bacteria | 6629912 |
| 863 | 2521556665 | 2521172590 | Bacteria | 5047645 |
| 864 | 2527080245 | 2526164713 | Bacteria | 6780608 |
| 865 | 2563063661 | 2562617112 | Bacteria | 10918404 |
| 866 | 2563063857 | 2562617112 | Bacteria | 10918404 |
| 867 | 2585293139 | 2582581311 | Bacteria | 6763856 |
| 868 | 2599100819 | 2597490356 | Bacteria | 7030811 |
| 869 | 2599740362 | 2599185239 | Bacteria | 8686614 |
| 870 | 2599748998 | 2599185240 | Bacteria | 7968121 |
| 871 | 2600211055 | 2599185355 | Bacteria | 7968906 |
| 872 | 2600811665 | 2600255067 | Bacteria | 6795583 |
| 873 | 2643798777 | 2643221556 | Bacteria | 7251154 |
| 874 | 2644222255 | 2643221639 | Bacteria | 6649903 |
| 875 | 2644258140 | 2643221646 | Bacteria | 6433402 |
| 876 | 2644471128 | 2643221684 | Bacteria | 7145183 |
| 877 | 2676747204 | 2675903129 | Bacteria | 7964495 |
| 878 | 2713474544 | 2711768613 | Bacteria | 11048459 |
| 879 | 2713474752 | 2711768613 | Bacteria | 11048459 |
| 880 | 2719643795 | 2718217991 | Bacteria | 7829542 |
| 881 | 2722883079 | 2721755523 | Bacteria | 6430384 |
| 882 | 2738824239 | 2738541296 | Bacteria | 7285013 |
| 883 | 2738836648 | 2738541298 | Bacteria | 7286732 |
| 884 | 2738878179 | 2738541306 | Bacteria | 7284992 |
| 885 | 2739189871 | 2738543002 | Bacteria | 7284546 |
| 886 | 2739224773 | 2738543008 | Bacteria | 7282815 |
| 887 | 2746090415 | 2744054900 | Bacteria | 8399525 |
| 888 | 2746095855 | 2744054901 | Bacteria | 8397047 |
| 889 | 2753569397 | 2751185846 | Bacteria | 7242164 |
| 890 | 2792835304 | 2791355137 | Bacteria | 9654227 |
| 891 | 2792836729 | 2791355137 | Bacteria | 9654227 |
| 892 | 2808973899 | 2808606384 | Bacteria | 8474373 |
| 893 | 2809008659 | 2808606390 | Bacteria | 8476311 |
| 894 | 2809015835 | 2808606391 | Bacteria | 8308166 |
| 895 | 2809143252 | 2808606418 | Bacteria | 6724496 |
| 896 | 2817257561 | 2816332253 | Bacteria | 6764532 |
| 897 | 2817282035 | 2816332256 | Bacteria | 6891714 |
| 898 | 2817451504 | 2816332286 | Bacteria | 6853759 |
| 899 | 2819618028 | 2818991449 | Bacteria | 5518009 |
| 900 | 2819621406 | 2818991450 | Bacteria | 6962147 |
| 901 | 2819635368 | 2818991452 | Bacteria | 8442785 |
| 902 | 2839141443 | 2839138175 | Bacteria | 6549354 |
| 903 | 2842325459 | 2842324504 | Bacteria | 9364110 |
| 904 | 2842334809 | 2842333319 | Bacteria | 8899485 |
| 905 | 2842349738 | 2842348783 | Bacteria | 9002918 |
| 906 | 2842455025 | 2842454564 | Bacteria | 8730687 |
| 907 | 2848863981 | 2848858292 | Bacteria | 7391279 |
| 908 | 2856293374 | 2856287931 | Bacteria | 7223934 |
| 909 | 2857366758 | 2857357740 | Bacteria | 9937880 |
| 910 | 2863425182 | 2863421361 | Bacteria | 7300805 |
| 911 | 2870074151 | 2870068957 | Bacteria | 8925310 |
| 912 | 2885274443 | 2885270888 | Bacteria | 9831543 |
| 913 | 2900640142 | 2900634093 | Bacteria | 10263517 |
| 914 | 2902685507 | 2902682994 | Bacteria | 8951596 |
| 915 | 2904434844 | 2904434214 | Bacteria | 6230908 |
| 916 | 2904441955 | 2904439833 | Bacteria | 5931679 |
| 917 | 2904482826 | 2904479285 | Bacteria | 5073931 |
| 918 | 2904489205 | 2904483920 | Bacteria | 7545285 |
| 919 | 2904489318 | 2904483920 | Bacteria | 7545285 |
| 920 | 2904533252 | 2904530477 | Bacteria | 5876334 |
| 921 | 2904547059 | 2904541872 | Bacteria | 8915136 |
| 922 | 2904571586 | 2904564687 | Bacteria | 7609577 |
| 923 | 2904578642 | 2904571731 | Bacteria | 7608790 |
| 924 | 2904586200 | 2904584206 | Bacteria | 6028872 |
| 925 | 2904591987 | 2904589729 | Bacteria | 6113573 |
| 926 | 2904601851 | 2904601388 | Bacteria | 5884906 |
| 927 | 2904621205 | 2904615490 | Bacteria | 10047340 |
| 928 | 2904621350 | 2904615490 | Bacteria | 10047340 |
| 929 | 2919083822 | 2919079590 | Bacteria | 5946433 |
| 930 | 2919529819 | 2919527303 | Bacteria | 7718827 |
| 931 | 2919531686 | 2919527303 | Bacteria | 7718827 |
| 932 | 2921643598 | 2921643360 | Bacteria | 11448031 |
| 933 | 2921647620 | 2921643360 | Bacteria | 11448031 |
| 934 | 2928109081 | 2928108538 | Bacteria | 7360024 |
| 935 | 2928136304 | 2928135762 | Bacteria | 7259641 |
| 936 | 2928161034 | 2928157003 | Bacteria | 7522202 |
| 937 | 2928166030 | 2928163908 | Bacteria | 7561269 |
| 938 | 2928171041 | 2928170801 | Bacteria | 8785406 |
| 939 | 2928503914 | 2928503688 | Bacteria | 7268108 |
| 940 | 2928536525 | 2928536128 | Bacteria | 7657547 |
| 941 | 2929165595 | 2929160207 | Bacteria | 9075316 |
| 942 | 2932422649 | 2932422444 | Bacteria | 4678430 |
| 943 | 2945938289 | 2945934425 | Bacteria | 7444609 |
| 944 | 2981991293 | 2981990288 | Bacteria | 7590678 |
| 945 | 2990703903 | 2990703756 | Bacteria | 7715990 |
| 946 | 2990708288 | 2990703756 | Bacteria | 7715990 |
| 947 | 639787698 | 639633007 | Bacteria | 4376040 |
| 948 | 642423421 | 641736151 | Bacteria | 7477263 |
| 949 | 642413941 | 641736154 | Bacteria | 7689995 |
| 950 | 642595568 | 642555112 | Bacteria | 8676562 |
| 951 | 642598626 | 642555112 | Bacteria | 8676562 |
| 952 | 642617161 | 642555113 | Bacteria | 8214658 |
| 953 | 8003961139 | 8003955200 | Bacteria | 8601927 |
| 954 | 8018849166 | 8018845410 | Bacteria | 8933938 |
| 955 | 8020811170 | 8020807995 | Bacteria | 6801506 |
| 956 | 8020943722 | 8020938398 | Bacteria | 7472757 |
| 957 | 8020950057 | 8020945358 | Bacteria | 8467355 |
| 958 | 8020953775 | 8020953355 | Bacteria | 7439080 |
| 959 | 8021123213 | 8021120328 | Bacteria | 8782274 |
| 960 | 8039103022 | 8039098773 | Bacteria | 6602928 |
| 961 | 8040168277 | 8040167225 | Bacteria | 6542727 |
| 962 | 8040175937 | 8040173305 | Bacteria | 6827067 |
| 963 | 8047678333 | 8047673197 | Bacteria | 7395230 |
| 964 | 8054007492 | 8054002106 | Bacteria | 7987183 |
| 965 | 8055272623 | 8055266321 | Bacteria | 7999742 |
| 966 | 8055303844 | 8055301274 | Bacteria | 8587385 |
| 967 | Ga0495585_0000211 | |||
| 968 | JGI24740J21852_10001309 | |||
| 969 | JGI24739J22299_10001079 | |||
| 970 | JGI24739J22299_10001779 | |||
| 971 | JGI24739J22299_10005316 | |||
| 972 | JGI24739J22299_10007027 | |||
| 973 | JGI24735J21928_10001507 | |||
| 974 | JGI24735J21928_10003601 | |||
| 975 | JGI24735J21928_10003905 | |||
| 976 | JGI24735J21928_10007512 | |||
| 977 | JGI24735J21928_10015154 | |||
| 978 | JGI24738J21930_10011891 | |||
| 979 | JGI25156J39149_1000137 | |||
| 980 | JGI25156J39149_1000236 | |||
| 981 | JGI25156J39149_1000642 | |||
| 982 | JGI25156J39149_1001363 | |||
| 983 | JGI25156J39149_1002647 | |||
| 984 | JGI25154J39366_1000106 | |||
| 985 | JGI25157J39369_1000154 | |||
| 986 | JGI25151J46595_10005982 | |||
| 987 | JGI25151J46595_10034388 | |||
| 988 | JGI25165J46597_1000939 | |||
| 989 | JGI25165J46597_1001941 | |||
| 990 | rootH1_10000900 | |||
| 991 | rootH1_10017467 | |||
| 992 | rootH1_10043777 | |||
| 993 | rootH2_10009909 | |||
| 994 | rootL2_10009014 | |||
| 995 | rootH1_10033602 | |||
| 996 | rootH1_10050263 | |||
| 997 | rootH1_10111356 | |||
| 998 | JGI25160J50197_1000025 | |||
| 999 | JGI25160J50197_1000101 | |||
| 1000 | Ga0055539_1000197 | |||
| 1001 | Ga0055539_1000488 | |||
| 1002 | Ga0055533_1000040 | |||
| 1003 | Ga0055533_1000159 | |||
| 1004 | Ga0055533_1000611 | |||
| 1005 | Ga0055532_1000014 | |||
| 1006 | Ga0055532_1000140 | |||
| 1007 | Ga0055532_1002026 | |||
| 1008 | Ga0055525_1000745 | |||
| 1009 | Ga0055527_1000013 | |||
| 1010 | Ga0055527_1000089 | |||
| 1011 | Ga0055527_1000280 | |||
| 1012 | Ga0055535_1000011 | |||
| 1013 | Ga0055535_1000164 | |||
| 1014 | Ga0055535_1000591 | |||
| 1015 | Ga0055535_1002021 | |||
| 1016 | Ga0055542_1000018 | |||
| 1017 | Ga0055542_1000208 | |||
| 1018 | Ga0055542_1001740 | |||
| 1019 | Ga0055542_1002922 | |||
| 1020 | Ga0055529_1000017 | |||
| 1021 | Ga0055529_1000053 | |||
| 1022 | Ga0055529_1000227 | |||
| 1023 | Ga0055529_1000978 | |||
| 1024 | Ga0055526_1000105 | |||
| 1025 | Ga0055528_1003527 | |||
| 1026 | Ga0055530_10000614 | |||
| 1027 | Ga0055530_10001720 | |||
| 1028 | Ga0055530_10020189 | |||
| 1029 | Ga0055540_1000014 | |||
| 1030 | Ga0055540_1005240 | |||
| 1031 | Ga0055531_10003071 | |||
| 1032 | Ga0055531_10005969 | |||
| 1033 | Ga0058692_1004472 | |||
| 1034 | Ga0065165_1000173 | |||
| 1035 | Ga0065165_1000188 | |||
| 1036 | Ga0065165_1001702 | |||
| 1037 | Ga0070658_10010287 | |||
| 1038 | Ga0070682_100012280 | |||
| 1039 | Ga0070660_100000159 | |||
| 1040 | Ga0070660_100000637 | |||
| 1041 | Ga0070660_100002295 | |||
| 1042 | Ga0070661_100081238 | |||
| 1043 | Ga0070659_100000223 | |||
| 1044 | Ga0070659_100096166 | |||
| 1045 | Ga0070714_100010374 | |||
| 1046 | Ga0070713_100001762 | |||
| 1047 | Ga0070711_100019644 | |||
| 1048 | Ga0070708_100149747 | |||
| 1049 | Ga0070663_100001049 | |||
| 1050 | Ga0070663_100032949 | |||
| 1051 | Ga0068853_100028416 | |||
| 1052 | Ga0068855_100022088 | |||
| 1053 | Ga0068855_100028363 | |||
| 1054 | Ga0070664_100081794 | |||
| 1055 | Ga0068857_100223918 | |||
| 1056 | Ga0068854_100004290 | |||
| 1057 | Ga0068856_100022922 | |||
| 1058 | Ga0068856_100205354 | |||
| 1059 | Ga0068866_10050504 | |||
| 1060 | Ga0075366_10009886 | |||
| 1061 | Ga0075366_10090319 | |||
| 1062 | Ga0075370_10041483 | |||
| 1063 | Ga0068865_100156038 | |||
| 1064 | Ga0079104_1000013 | |||
| 1065 | Ga0079104_1000724 | |||
| 1066 | Ga0105251_10000335 | |||
| 1067 | Ga0105251_10000589 | |||
| 1068 | Ga0105240_10001196 | |||
| 1069 | Ga0105240_10012745 | |||
| 1070 | Ga0105240_10013343 | |||
| 1071 | Ga0105240_10024279 | |||
| 1072 | Ga0105240_10042007 | |||
| 1073 | Ga0105240_10057300 | |||
| 1074 | Ga0105240_10091306 | |||
| 1075 | Ga0105240_10093220 | |||
| 1076 | Ga0105240_10110662 | |||
| 1077 | Ga0105247_10080443 | |||
| 1078 | Ga0105243_10004635 | |||
| 1079 | Ga0105241_10035913 | |||
| 1080 | Ga0105241_10038664 | |||
| 1081 | Ga0105237_10000645 | |||
| 1082 | Ga0105237_10006307 | |||
| 1083 | Ga0105237_10024649 | |||
| 1084 | Ga0105237_10065380 | |||
| 1085 | Ga0105237_10087124 | |||
| 1086 | Ga0105237_10103770 | |||
| 1087 | Ga0105237_10114049 | |||
| 1088 | Ga0105237_10139007 | |||
| 1089 | Ga0105238_10009283 | |||
| 1090 | Ga0105238_10111614 | |||
| 1091 | Ga0105238_10241617 | |||
| 1092 | Ga0105239_10000572 | |||
| 1093 | Ga0105239_10007488 | |||
| 1094 | Ga0105239_10017482 | |||
| 1095 | Ga0105239_10101297 | |||
| 1096 | Ga0105239_10120756 | |||
| 1097 | Ga0105246_10087739 | |||
| 1098 | Ga0157373_10014530 | |||
| 1099 | Ga0157370_10003565 | |||
| 1100 | Ga0157370_10014525 | |||
| 1101 | Ga0157370_10059821 | |||
| 1102 | Ga0157369_10006615 | |||
| 1103 | Ga0157369_10030856 | |||
| 1104 | Ga0157374_10000081 | |||
| 1105 | Ga0157374_10000834 | |||
| 1106 | Ga0157372_10011733 | |||
| 1107 | Ga0157372_10020789 | |||
| 1108 | Ga0157375_10002531 | |||
| 1109 | Ga0157375_10379723 | |||
| 1110 | Ga0163163_10059963 | |||
| 1111 | Ga0182008_10009819 | |||
| 1112 | Ga0182008_10039610 | |||
| 1113 | Ga0182006_1002702 | |||
| 1114 | Ga0182007_10001639 | |||
| 1115 | Ga0182007_10005892 | |||
| 1116 | Ga0182005_1004230 | |||
| 1117 | Ga0183361_10003 | |||
| 1118 | Ga0163161_10080887 | |||
| 1119 | Ga0213872_10000134 | |||
| 1120 | Ga0213872_10037606 | |||
| 1121 | Ga0213876_10000312 | |||
| 1122 | Ga0213875_10005957 | |||
| 1123 | Ga0209566_100443 | |||
| 1124 | Ga0209674_100020 | |||
| 1125 | Ga0209674_100051 | |||
| 1126 | Ga0209674_100066 | |||
| 1127 | Ga0209674_101758 | |||
| 1128 | Ga0209672_100012 | |||
| 1129 | Ga0209672_100013 | |||
| 1130 | Ga0209672_100027 | |||
| 1131 | Ga0209672_100063 | |||
| 1132 | Ga0209672_100708 | |||
| 1133 | Ga0209147_100007 | |||
| 1134 | Ga0209147_100013 | |||
| 1135 | Ga0209147_100035 | |||
| 1136 | Ga0209147_100077 | |||
| 1137 | Ga0209147_100119 | |||
| 1138 | Ga0209563_100129 | |||
| 1139 | Ga0209563_100306 | |||
| 1140 | Ga0209563_100645 | |||
| 1141 | Ga0207427_100487 | |||
| 1142 | Ga0207427_101027 | |||
| 1143 | Ga0207427_103184 | |||
| 1144 | Ga0209258_100014 | |||
| 1145 | Ga0209258_100052 | |||
| 1146 | Ga0209258_100074 | |||
| 1147 | Ga0209258_100105 | |||
| 1148 | Ga0209258_100328 | |||
| 1149 | Ga0209646_1000127 | |||
| 1150 | Ga0209026_1000004 | |||
| 1151 | Ga0209677_100085 | |||
| 1152 | Ga0209677_100157 | |||
| 1153 | Ga0209148_1000020 | |||
| 1154 | Ga0209148_1000064 | |||
| 1155 | Ga0209148_1000107 | |||
| 1156 | Ga0209148_1002924 | |||
| 1157 | Ga0209148_1005329 | |||
| 1158 | Ga0209759_1000015 | |||
| 1159 | Ga0209759_1000028 | |||
| 1160 | Ga0209759_1000129 | |||
| 1161 | Ga0209759_1000279 | |||
| 1162 | Ga0209759_1000315 | |||
| 1163 | Ga0209759_1000521 | |||
| 1164 | Ga0209759_1001009 | |||
| 1165 | Ga0209759_1001226 | |||
| 1166 | Ga0209233_1000073 | |||
| 1167 | Ga0209233_1000294 | |||
| 1168 | Ga0209565_1012923 | |||
| 1169 | Ga0209455_1000017 | |||
| 1170 | Ga0209455_1000057 | |||
| 1171 | Ga0209455_1000066 | |||
| 1172 | Ga0209455_1000100 | |||
| 1173 | Ga0209455_1000138 | |||
| 1174 | Ga0209673_1000101 | |||
| 1175 | Ga0209673_1009213 | |||
| 1176 | Ga0209130_1004958 | |||
| 1177 | Ga0209025_1000115 | |||
| 1178 | Ga0209025_1000286 | |||
| 1179 | Ga0209564_1000007 | |||
| 1180 | Ga0209564_1007435 | |||
| 1181 | Ga0209564_1007842 | |||
| 1182 | Ga0209050_1000142 | |||
| 1183 | Ga0209050_1002975 | |||
| 1184 | Ga0209256_1000130 | |||
| 1185 | Ga0209256_1000840 | |||
| 1186 | Ga0207426_1000020 | |||
| 1187 | Ga0207426_1000056 | |||
| 1188 | Ga0207426_1004594 | |||
| 1189 | Ga0209051_1000035 | |||
| 1190 | Ga0209051_1002864 | |||
| 1191 | Ga0209051_1004454 | |||
| 1192 | Ga0209051_1005258 | |||
| 1193 | Ga0209051_1028996 | |||
| 1194 | Ga0209257_1000494 | |||
| 1195 | Ga0209257_1004031 | |||
| 1196 | Ga0207696_1012173 | |||
| 1197 | Ga0207713_1000948 | |||
| 1198 | Ga0207713_1005024 | |||
| 1199 | Ga0207713_1014454 | |||
| 1200 | Ga0207692_10001173 | |||
| 1201 | Ga0207647_10000553 | |||
| 1202 | Ga0207647_10000738 | |||
| 1203 | Ga0207647_10001254 | |||
| 1204 | Ga0207647_10001656 | |||
| 1205 | Ga0207647_10055174 | |||
| 1206 | Ga0207699_10006667 | |||
| 1207 | Ga0207705_10005147 | |||
| 1208 | Ga0207705_10065196 | |||
| 1209 | Ga0207695_10000368 | |||
| 1210 | Ga0207695_10011940 | |||
| 1211 | Ga0207695_10015690 | |||
| 1212 | Ga0207695_10018460 | |||
| 1213 | Ga0207695_10043331 | |||
| 1214 | Ga0207695_10058194 | |||
| 1215 | Ga0207695_10085995 | |||
| 1216 | Ga0207695_10134338 | |||
| 1217 | Ga0207671_10002474 | |||
| 1218 | Ga0207671_10109891 | |||
| 1219 | Ga0207671_10159391 | |||
| 1220 | Ga0207663_10000327 | |||
| 1221 | Ga0207657_10000442 | |||
| 1222 | Ga0207657_10001219 | |||
| 1223 | Ga0207657_10001423 | |||
| 1224 | Ga0207694_10036318 | |||
| 1225 | Ga0207694_10207052 | |||
| 1226 | Ga0207700_10038443 | |||
| 1227 | Ga0207664_10094268 | |||
| 1228 | Ga0207690_10000037 | |||
| 1229 | Ga0207706_10179484 | |||
| 1230 | Ga0207709_10000172 | |||
| 1231 | Ga0207665_10013914 | |||
| 1232 | Ga0207667_10018107 | |||
| 1233 | Ga0207667_10040261 | |||
| 1234 | Ga0207667_10200826 | |||
| 1235 | Ga0207658_10115035 | |||
| 1236 | Ga0207658_10179778 | |||
| 1237 | Ga0207639_10018607 | |||
| 1238 | Ga0207639_10071183 | |||
| 1239 | Ga0207678_10000317 | |||
| 1240 | Ga0207678_10010832 | |||
| 1241 | Ga0207702_10143469 | |||
| 1242 | Ga0207674_10058378 | |||
| 1243 | Ga0207683_10135673 | |||
| 1244 | Ga0207683_10147985 | |||
| 1245 | Ga0207698_10017622 | |||
| 1246 | Ga0209281_1000020 | |||
| 1247 | Ga0209281_1000076 | |||
| 1248 | Ga0209371_1000080 | |||
| 1249 | Ga0209371_1014775 | |||
| 1250 | Ga0265337_1001439 | |||
| 1251 | Ga0265326_10001380 | |||
| 1252 | Ga0265334_10005260 | |||
| 1253 | Ga0265318_10003474 | |||
| 1254 | Ga0265323_10000992 | |||
| 1255 | Ga0265322_10002589 | |||
| 1256 | Ga0265336_10000003 | |||
| 1257 | Ga0265336_10000063 | |||
| 1258 | Ga0307515_10000737 | |||
| 1259 | Ga0265338_10000154 | |||
| 1260 | Ga0265324_10001590 | |||
| 1261 | Ga0268256_1000160 | |||
| 1262 | Ga0268256_1015142 | |||
| 1263 | Ga0307511_10098629 | |||
| 1264 | Ga0265339_10001335 | |||
| 1265 | Ga0265327_10005550 | |||
| 1266 | Ga0307513_10015012 | |||
| 1267 | Ga0307408_100000029 | |||
| 1268 | Ga0307514_10000408 | |||
| 1269 | Ga0307514_10001033 | |||
| 1270 | Ga0265314_10001952 | |||
| 1271 | Ga0307516_10000424 | |||
| 1272 | Ga0307412_10000002 | |||
| 1273 | Ga0307416_100010306 | |||
| 1274 | Ga0373934_0005435 | |||
| 1275 | Ga0373939_0000469 | |||
| 1276 | Ga0373960_0002278 | |||
| 1277 | Ga0373943_0107883 | |||
| 1278 | Ga0373962_0016516 | |||
| 1279 | Ga0373927_0091434 | |||
| 1280 | Ga0395899_0000005 | |||
| 1281 | Ga0395900_0000003 | |||
| 1282 | Ga0395900_0021389 | |||
| 1283 | Ga0395900_0057494 | |||
| 1284 | Ga0395898_0000003 | |||
| 1285 | Ga0395898_0015437 | |||
| 1286 | Ga0395898_0057172 | |||
| 1287 | Ga0395898_0074039 | |||
| 1288 | Ga0395905_0000004 | |||
| 1289 | Ga0395905_0000009 | |||
| 1290 | Ga0395905_0004257 | |||
| 1291 | Ga0395905_0012101 | |||
| 1292 | Ga0395905_0013595 | |||
| 1293 | Ga0395905_0222404 | |||
| 1294 | Ga0436364_0100220 | |||
| 1295 | Ga0436364_0465200 | |||
| 1296 | Ga0436364_0586291 | |||
| 1297 | Ga0436364_0783389 | |||
| 1298 | Ga0436364_0841842 | |||
| 1299 | Ga0395901_0000009 | |||
| 1300 | Ga0395901_0038206 | |||
| 1301 | Ga0395901_0130414 | |||
| 1302 | Ga0395901_0185873 | |||
| 1303 | Ga0395901_0201249 | |||
| 1304 | Ga0436365_0552641 | |||
| 1305 | Ga0436365_0821809 | |||
| 1306 | Ga0436365_1478189 | |||
| 1307 | Ga0436360_0091417 | |||
| 1308 | Ga0436360_0624080 | |||
| 1309 | Ga0436361_0033961 | |||
| 1310 | Ga0436361_0193139 | |||
| 1311 | Ga0436361_0455065 | |||
| 1312 | Ga0436361_1139408 | |||
| 1313 | Ga0436363_0679974 | |||
| 1314 | Ga0436362_0295156 | |||
| 1315 | Ga0436362_1208322 | |||
| 1316 | Ga0439448_0000025 | |||
| 1317 | Ga0439448_0002656 | |||
| 1318 | Ga0451577_0010994 | |||
| 1319 | Ga0466969_0002900 | |||
| 1320 | Ga0466969_0079966 | |||
| 1321 | Ga0466972_0011461 | |||
| 1322 | Ga0466965_0003466 | |||
| 1323 | Ga0466965_0016314 | |||
| 1324 | Ga0466966_0000037 | |||
| 1325 | Ga0466966_0001374 | |||
| 1326 | Ga0466966_0005943 | |||
| 1327 | Ga0466961_0000258 | |||
| 1328 | Ga0466961_0003537 | |||
| 1329 | Ga0466961_0010435 | |||
| 1330 | Ga0466961_0016999 | |||
| 1331 | Ga0466961_0038448 | |||
| 1332 | Ga0466963_0044011 | |||
| 1333 | Ga0466964_0000407 | |||
| 1334 | Ga0453684_0003874 | |||
| 1335 | Ga0453684_0039960 | |||
| 1336 | Ga0466971_0078563 | |||
| 1337 | Ga0466968_0030835 | |||
| 1338 | Ga0466957_0033487 | |||
| 1339 | Ga0466959_0005077 | |||
| 1340 | Ga0466959_0018695 | |||
| 1341 | Ga0466959_0048665 | |||
| 1342 | Ga0466959_0063890 | |||
| 1343 | Ga0451576_0012383 | |||
| 1344 | Ga0466958_0007398 | |||
| 1345 | Ga0466958_0038355 | |||
| 1346 | Ga0466958_0113524 | |||
| 1347 | Ga0495592_0008740 | |||
| 1348 | Ga0495592_0050462 | |||
| 1349 | Ga0495603_0000430 | |||
| 1350 | Ga0495603_0001760 | |||
| 1351 | Ga0495603_0004181 | |||
| 1352 | Ga0495603_0013805 | |||
| 1353 | Ga0495603_0095291 | |||
| 1354 | Ga0495590_0000013 | |||
| 1355 | Ga0495590_0006335 | |||
| 1356 | Ga0495590_0030841 | |||
| 1357 | Ga0495591_000109 | |||
| 1358 | Ga0495591_003119 | |||
| 1359 | Ga0495629_0000027 | |||
| 1360 | Ga0495629_0000184 | |||
| 1361 | Ga0495629_0000262 | |||
| 1362 | Ga0495629_0002023 | |||
| 1363 | Ga0495629_0002885 | |||
| 1364 | Ga0495629_0080644 | |||
| 1365 | Ga0495629_0127476 | |||
| 1366 | Ga0495629_0208369 | |||
| 1367 | Ga0495638_0001152 | |||
| 1368 | Ga0495638_0012125 | |||
| 1369 | Ga0495641_0043944 | |||
| 1370 | Ga0495651_0080184 | |||
| 1371 | Ga0495653_0000323 | |||
| 1372 | Ga0495653_0001078 | |||
| 1373 | Ga0495653_0003556 | |||
| 1374 | Ga0495653_0004636 | |||
| 1375 | Ga0495653_0012355 | |||
| 1376 | Ga0495653_0026186 | |||
| 1377 | Ga0495653_0053932 | |||
| 1378 | Ga0495653_0079310 | |||
| 1379 | Ga0495653_0090892 | |||
| 1380 | Ga0495650_0000001 | |||
| 1381 | Ga0495650_0000155 | |||
| 1382 | Ga0495650_0000322 | |||
| 1383 | Ga0495650_0007783 | |||
| 1384 | Ga0495650_0008029 | |||
| 1385 | Ga0495650_0010335 | |||
| 1386 | Ga0495650_0019378 | |||
| 1387 | Ga0495580_0000464 | |||
| 1388 | Ga0495580_0005399 | |||
| 1389 | Ga0495580_0021677 | |||
| 1390 | Ga0495580_0031660 | |||
| 1391 | Ga0495580_0040928 | |||
| 1392 | Ga0495580_0172731 | |||
| 1393 | Ga0495582_0002757 | |||
| 1394 | Ga0495582_0002869 | |||
| 1395 | Ga0495582_0017483 | |||
| 1396 | Ga0495582_0047889 | |||
| 1397 | Ga0495605_0001158 | |||
| 1398 | Ga0495605_0001269 | |||
| 1399 | Ga0495605_0002220 | |||
| 1400 | Ga0495605_0003943 | |||
| 1401 | Ga0495605_0004941 | |||
| 1402 | Ga0495605_0007402 | |||
| 1403 | Ga0495605_0015189 | |||
| 1404 | Ga0495605_0017678 | |||
| 1405 | Ga0495605_0017952 | |||
| 1406 | Ga0495605_0019289 | |||
| 1407 | Ga0495605_0030728 | |||
| 1408 | Ga0495605_0062388 | |||
| 1409 | Ga0495639_0004351 | |||
| 1410 | Ga0495662_0041700 | |||
| 1411 | Ga0495662_0066486 | |||
| 1412 | Ga0495664_0002960 | |||
| 1413 | Ga0495664_0007286 | |||
| 1414 | Ga0495584_0000026 | |||
| 1415 | Ga0495584_0000029 | |||
| 1416 | Ga0495584_0001869 | |||
| 1417 | Ga0495584_0001997 | |||
| 1418 | Ga0495584_0002177 | |||
| 1419 | Ga0495584_0003468 | |||
| 1420 | Ga0495585_0010743 | |||
| 1421 | Ga0495585_0012655 | |||
| 1422 | Ga0495585_0024534 | |||
| 1423 | Ga0495596_0000173 | |||
| 1424 | Ga0495596_0000355 | |||
| 1425 | Ga0495596_0000604 | |||
| 1426 | Ga0495596_0000786 | |||
| 1427 | Ga0495596_0000991 | |||
| 1428 | Ga0495596_0003689 | |||
| 1429 | Ga0495596_0015195 | |||
| 1430 | Ga0495596_0018761 | |||
| 1431 | Ga0495596_0025063 | |||
| 1432 | Ga0495607_0000215 | |||
| 1433 | Ga0495607_0000316 | |||
| 1434 | Ga0495607_0001536 | |||
| 1435 | Ga0495607_0002120 | |||
| 1436 | Ga0495583_0000011 | |||
| 1437 | Ga0495583_0000040 | |||
| 1438 | Ga0495583_0000296 | |||
| 1439 | Ga0495583_0000378 | |||
| 1440 | Ga0495583_0001070 | |||
| 1441 | Ga0495583_0003300 | |||
| 1442 | Ga0495583_0003830 | |||
| 1443 | Ga0495583_0007163 | |||
| 1444 | Ga0495583_0023731 | |||
| 1445 | Ga0495606_0001789 | |||
| 1446 | Ga0495606_0003521 | |||
| 1447 | Ga0495606_0024866 | |||
| 1448 | Ga0495606_0126188 | |||
| 1449 | Ga0495608_0008753 | |||
| 1450 | Ga0495608_0036947 | |||
| 1451 | Ga0495608_0038012 | |||
| 1452 | Ga0495610_0004903 | |||
| 1453 | Ga0495610_0061606 | |||
| 1454 | Ga0495616_0000012 | |||
| 1455 | Ga0495616_0000282 | |||
| 1456 | Ga0495616_0004739 | |||
| 1457 | Ga0495616_0007303 | |||
| 1458 | Ga0495616_0008091 | |||
| 1459 | Ga0495616_0024106 | |||
| 1460 | Ga0495616_0025566 | |||
| 1461 | Ga0495616_0029447 | |||
| 1462 | Ga0495616_0059686 | |||
| 1463 | Ga0495618_0014796 | |||
| 1464 | Ga0495618_0017556 | |||
| 1465 | Ga0495628_0004051 | |||
| 1466 | Ga0495628_0011994 | |||
| 1467 | Ga0495628_0024722 | |||
| 1468 | Ga0495628_0040382 | |||
| 1469 | Ga0495628_0061116 | |||
| 1470 | Ga0495628_0087335 | |||
| 1471 | Ga0495628_0107157 | |||
| 1472 | Ga0495630_0012035 | |||
| 1473 | Ga0495630_0019324 | |||
| 1474 | Ga0495631_0000737 | |||
| 1475 | Ga0495631_0000861 | |||
| 1476 | Ga0495631_0002653 | |||
| 1477 | Ga0495631_0003830 | |||
| 1478 | Ga0495631_0008115 | |||
| 1479 | Ga0495631_0011388 | |||
| 1480 | Ga0495631_0051344 | |||
| 1481 | Ga0495632_0000012 | |||
| 1482 | Ga0495632_0000367 | |||
| 1483 | Ga0495632_0000530 | |||
| 1484 | Ga0495632_0002018 | |||
| 1485 | Ga0495632_0008241 | |||
| 1486 | Ga0495632_0021529 | |||
| 1487 | Ga0495637_0000008 | |||
| 1488 | Ga0495643_0001945 | |||
| 1489 | Ga0495643_0005793 | |||
| 1490 | Ga0495643_0011088 | |||
| 1491 | Ga0495643_0025217 | |||
| 1492 | Ga0495643_0064765 | |||
| 1493 | Ga0495644_0015669 | |||
| 1494 | Ga0495644_0016327 | |||
| 1495 | Ga0495644_0022233 | |||
| 1496 | Ga0495648_0000648 | |||
| 1497 | Ga0495648_0006040 | |||
| 1498 | Ga0495648_0006664 | |||
| 1499 | Ga0495648_0022004 | |||
| 1500 | Ga0495648_0030675 | |||
| 1501 | Ga0495648_0089876 | |||
| 1502 | Ga0495663_0004271 | |||
| 1503 | Ga0495666_0001260 | |||
| 1504 | Ga0495666_0006755 | |||
| 1505 | Ga0495666_0011241 | |||
| 1506 | Ga0495666_0013933 | |||
| 1507 | Ga0495666_0020985 | |||
| 1508 | Ga0495642_0000091 | |||
| 1509 | Ga0495642_0002541 | |||
| 1510 | Ga0495642_0003697 | |||
| 1511 | Ga0495642_0011402 | |||
| 1512 | Ga0495642_0019504 | |||
| 1513 | Ga0495642_0048943 | |||
| 1514 | Ga0495652_0011870 | |||
| 1515 | Ga0495652_0019974 | |||
| 1516 | Ga0495652_0039650 | |||
| 1517 | Ga0495652_0155766 | |||
| 1518 | Ga0495652_0184361 | |||
| 1519 | Ga0495654_0001482 | |||
| 1520 | Ga0495654_0012346 | |||
| 1521 | Ga0495665_0002053 | |||
| 1522 | Ga0495665_0002164 | |||
| 1523 | Ga0495665_0006614 | |||
| 1524 | Ga0495665_0020962 | |||
| 1525 | Ga0495665_0023187 | |||
| 1526 | Ga0495640_0002090 | |||
| 1527 | Ga0495640_0002685 | |||
| 1528 | Ga0495640_0015535 | |||
| 1529 | Ga0495586_0003135 | |||
| 1530 | Ga0495586_0003172 | |||
| 1531 | Ga0495586_0011394 | |||
| 1532 | Ga0495586_0012543 | |||
| 1533 | Ga0495587_0003273 | |||
| 1534 | Ga0495587_0010841 | |||
| 1535 | Ga0495587_0051630 | |||
| 1536 | Ga0495587_0080803 | |||
| 1537 | Ga0495609_0000001 | |||
| 1538 | Ga0495609_0001492 | |||
| 1539 | Ga0495609_0002530 | |||
| 1540 | Ga0495609_0013249 | |||
| 1541 | Ga0495597_0000560 | |||
| 1542 | Ga0495597_0000911 | |||
| 1543 | Ga0495597_0023439 | |||
| 1544 | Ga0495597_0024676 | |||
| 1545 | Ga0495645_0000102 | |||
| 1546 | Ga0495645_0002579 | |||
| 1547 | Ga0495645_0033652 | |||
| 1548 | Ga0495645_0117294 | |||
| 1549 | Ga0495645_0161474 | |||
| 1550 | Ga0495622_0000006 | |||
| 1551 | Ga0495622_0000018 | |||
| 1552 | Ga0495622_0043841 | |||
| 1553 | Ga0495633_0000874 | |||
| 1554 | Ga0495633_0004611 | |||
| 1555 | Ga0495633_0042551 | |||
| 1556 | Ga0495667_0060110 | |||
| 1557 | Ga0495656_0014983 | |||
| 1558 | Ga0495656_0027094 | |||
| 1559 | Ga0495656_0032289 | |||
| 1560 | Ga0495656_0036650 | |||
| 1561 | Ga0495668_0000018 | |||
| 1562 | Ga0495668_0002062 | |||
| 1563 | Ga0495668_0005360 | |||
| 1564 | Ga0495668_0017295 | |||
| 1565 | Ga0495668_0044109 | |||
| 1566 | Ga0495634_0008052 | |||
| 1567 | Ga0495634_0010099 | |||
| 1568 | Ga0495634_0037461 | |||
| 1569 | Ga0495634_0069049 | |||
| 1570 | Ga0495634_0128589 | |||
| 1571 | Ga0495611_0001733 | |||
| 1572 | Ga0495611_0063534 | |||
| 1573 | Ga0495625_0042373 | |||
| 1574 | Ga0495625_0129856 | |||
| 1575 | Ga0495635_0011202 | |||
| 1576 | Ga0495635_0013616 | |||
| 1577 | Ga0495635_0021097 | |||
| 1578 | Ga0495635_0035456 | |||
| 1579 | Ga0495661_0000049 | |||
| 1580 | Ga0495661_0000053 | |||
| 1581 | Ga0495661_0003280 | |||
| 1582 | Ga0495661_0010540 | |||
| 1583 | Ga0495661_0012256 | |||
| 1584 | Ga0495661_0022956 | |||
| 1585 | Ga0495661_0026303 | |||
| 1586 | Ga0495661_0030771 | |||
| 1587 | Ga0495661_0033284 | |||
| 1588 | Ga0495661_0057564 | |||
| 1589 | Ga0495588_0000062 | |||
| 1590 | Ga0495588_0020368 | |||
| 1591 | Ga0495588_0035899 | |||
| 1592 | Ga0495657_0018615 | |||
| 1593 | Ga0495599_0002748 | |||
| 1594 | Ga0495599_0003298 | |||
| 1595 | Ga0495623_0003937 | |||
| 1596 | Ga0495623_0007395 | |||
| 1597 | Ga0495623_0008781 | |||
| 1598 | Ga0495623_0017834 | |||
| 1599 | Ga0495623_0019894 | |||
| 1600 | Ga0495646_0001647 | |||
| 1601 | Ga0495646_0003189 | |||
| 1602 | Ga0495646_0005124 | |||
| 1603 | Ga0495646_0070710 | |||
| 1604 | Ga0495669_0000157 | |||
| 1605 | Ga0495669_0001448 | |||
| 1606 | Ga0495669_0002071 | |||
| 1607 | Ga0495669_0007195 | |||
| 1608 | Ga0495613_0005190 | |||
| 1609 | Ga0495613_0071370 | |||
| 1610 | Ga0495624_0005097 | |||
| 1611 | Ga0495624_0006209 | |||
| 1612 | Ga0495624_0006488 | |||
| 1613 | Ga0495624_0007132 | |||
| 1614 | Ga0495624_0016699 | |||
| 1615 | Ga0495624_0022724 | |||
| 1616 | Ga0495624_0036015 | |||
| 1617 | Ga0495670_0045979 | |||
| 1618 | Ga0495649_0000071 | |||
| 1619 | Ga0495649_0000283 | |||
| 1620 | Ga0495649_0000465 | |||
| 1621 | Ga0495649_0000496 | |||
| 1622 | Ga0495649_0002364 | |||
| 1623 | Ga0495649_0008289 | |||
| 1624 | Ga0495649_0018320 | |||
| 1625 | Ga0495649_0019509 | |||
| 1626 | Ga0495589_0000103 | |||
| 1627 | Ga0495589_0001477 | |||
| 1628 | Ga0495589_0002349 | |||
| 1629 | Ga0495589_0004136 | |||
| 1630 | Ga0495589_0011582 | |||
| 1631 | Ga0495589_0017606 | |||
| 1632 | Ga0495589_0025749 | |||
| 1633 | Ga0495589_0042656 | |||
| 1634 | Ga0495589_0053329 | |||
| 1635 | Ga0495600_0001801 | |||
| 1636 | Ga0495600_0001987 | |||
| 1637 | Ga0495600_0004945 | |||
| 1638 | Ga0495600_0105546 | |||
| 1639 | Ga0495660_0000057 | |||
| 1640 | Ga0495660_0001412 | |||
| 1641 | Ga0495660_0003177 | |||
| 1642 | Ga0495660_0010951 | |||
| 1643 | Ga0495581_0000771 | |||
| 1644 | Ga0495581_0000959 | |||
| 1645 | Ga0495581_0001239 | |||
| 1646 | Ga0495604_0000860 | |||
| 1647 | Ga0495604_0002237 | |||
| 1648 | Ga0495604_0018061 | |||
| 1649 | Ga0495604_0021063 | |||
| 1650 | Ga0495604_0054945 | |||
| 1651 | Ga0495604_0060906 | |||
| 1652 | Ga0495604_0068196 | |||
| 1653 | Ga0495674_0004658 | |||
| 1654 | Ga0495674_0005289 | |||
| 1655 | Ga0495674_0014260 | |||
| 1656 | Ga0495674_0017782 | |||
| 1657 | Ga0495674_0082328 | |||
| 1658 | Ga0495674_0196192 | |||
| 1659 | Ga0495672_0000033 | |||
| 1660 | Ga0495672_0000078 | |||
| 1661 | Ga0495672_0001165 | |||
| 1662 | Ga0495672_0002211 | |||
| 1663 | Ga0495672_0016324 | |||
| 1664 | Ga0495672_0071231 | |||
| 1665 | Ga0495676_0010858 | |||
| 1666 | Ga0495676_0096081 | |||
| 1667 | Ga0495676_0114563 | |||
| 1668 | Ga0495680_0009339 | |||
| 1669 | Ga0495680_0036606 | |||
| 1670 | Ga0495680_0105057 | |||
| 1671 | Ga0495680_0132264 | |||
| 1672 | Ga0495683_0000168 | |||
| 1673 | Ga0495683_0002012 | |||
| 1674 | Ga0495683_0006526 | |||
| 1675 | Ga0495683_0016692 | |||
| 1676 | Ga0495683_0022551 | |||
| 1677 | Ga0495683_0022922 | |||
| 1678 | Ga0495683_0026064 | |||
| 1679 | Ga0495687_000019 | |||
| 1680 | Ga0495687_000021 | |||
| 1681 | Ga0495687_000036 | |||
| 1682 | Ga0495687_000740 | |||
| 1683 | Ga0495687_001452 | |||
| 1684 | Ga0495687_005545 | |||
| 1685 | Ga0495687_055706 | |||
| 1686 | Ga0495675_0001858 | |||
| 1687 | Ga0495675_0010651 | |||
| 1688 | Ga0495675_0033325 | |||
| 1689 | Ga0495677_0000009 | |||
| 1690 | Ga0495677_0000242 | |||
| 1691 | Ga0495677_0011525 | |||
| 1692 | Ga0495677_0016713 | |||
| 1693 | Ga0495677_0052506 | |||
| 1694 | Ga0495679_000006 | |||
| 1695 | Ga0495679_000975 | |||
| 1696 | Ga0495679_004533 | |||
| 1697 | Ga0495685_000553 | |||
| 1698 | Ga0495673_0016978 | |||
| 1699 | Ga0495673_0017267 | |||
| 1700 | Ga0495673_0035925 | |||
| 1701 | Ga0495681_0010716 | |||
| 1702 | Ga0495681_0041389 | |||
| 1703 | Ga0495681_0048302 | |||
| 1704 | Ga0495686_0000407 | |||
| 1705 | Ga0495686_0052240 | |||
| 1706 | Ga0495593_0000758 | |||
| 1707 | Ga0495593_0004348 | |||
| 1708 | Ga0495593_0020592 | |||
| 1709 | Ga0495593_0045292 | |||
| 1710 | Ga0495602_0001303 | |||
| 1711 | Ga0495602_0015792 | |||
| 1712 | Ga0495602_0018800 | |||
| 1713 | Ga0495602_0064879 | |||
| 1714 | Ga0495602_0066803 | |||
| 1715 | Ga0495602_0102446 | |||
| 1716 | Ga0495614_0000224 | |||
| 1717 | Ga0495614_0005369 | |||
| 1718 | Ga0495614_0006411 | |||
| 1719 | Ga0495615_0000185 | |||
| 1720 | Ga0495626_0000038 | |||
| 1721 | Ga0495626_0002361 | |||
| 1722 | Ga0495626_0002442 | |||
| 1723 | Ga0495626_0004231 | |||
| 1724 | Ga0495626_0004742 | |||
| 1725 | Ga0495626_0012827 | |||
| 1726 | Ga0495626_0021752 | |||
| 1727 | Ga0495626_0026200 | |||
| 1728 | Ga0495626_0028271 | |||
| 1729 | Ga0495626_0029195 | |||
| 1730 | Ga0495626_0033003 | |||
| 1731 | Ga0495626_0070493 | |||
| 1732 | Ga0496100_0000094 | |||
| 1733 | Ga0496100_0003268 | |||
| 1734 | Ga0496100_0030967 | |||
| 1735 | Ga0496100_0032647 | |||
| 1736 | Ga0496101_0000181 | |||
| 1737 | Ga0496101_0002769 | |||
| 1738 | Ga0496101_0011151 | |||
| 1739 | Ga0496101_0048810 | |||
| 1740 | Ga0496102_0000397 | |||
| 1741 | Ga0496103_0000361 | |||
| 1742 | Ga0496103_0002066 | |||
| 1743 | Ga0496104_0012096 | |||
| 1744 | Ga0496104_0046174 | |||
| 1745 | Ga0496104_0115410 | |||
| 1746 | Ga0496105_0010331 | |||
| 1747 | Ga0496105_0026467 | |||
| 1748 | Ga0496105_0029959 | |||
| 1749 | Ga0496107_0078468 | |||
| 1750 | Ga0496107_0086338 | |||
| 1751 | Ga0496108_0045993 | |||
| 1752 | Ga0496109_0025462 | |||
| 1753 | Ga0496110_0030550 | |||
| 1754 | Ga0496110_0042559 | |||
| 1755 | Ga0496111_0013862 | |||
| 1756 | Ga0496111_0038872 | |||
| 1757 | Ga0496112_0004476 | |||
| 1758 | Ga0496112_0010228 | |||
| 1759 | Ga0496112_0092935 | |||
| 1760 | Ga0496113_0000770 | |||
| 1761 | Ga0496113_0013419 | |||
| 1762 | Ga0496113_0102214 | |||
| 1763 | Ga0496114_0007422 | |||
| 1764 | Ga0496116_0012411 | |||
| 1765 | Ga0496116_0092800 | |||
| 1766 | Ga0496117_0000210 | |||
| 1767 | Ga0496117_0000454 | |||
| 1768 | Ga0496117_0036767 | |||
| 1769 | Ga0496117_0037985 | |||
| 1770 | Ga0496118_0000788 | |||
| 1771 | Ga0496118_0008718 | |||
| 1772 | Ga0496118_0038323 | |||
| 1773 | Ga0496121_0000457 | |||
| 1774 | Ga0496121_0008889 | |||
| 1775 | Ga0496121_0012700 | |||
| 1776 | Ga0496121_0021494 | |||
| 1777 | Ga0496121_0023477 | |||
| 1778 | Ga0496122_0001753 | |||
| 1779 | Ga0496122_0019617 | |||
| 1780 | Ga0496123_0001273 | |||
| 1781 | Ga0496123_0003705 | |||
| 1782 | Ga0496123_0130405 | |||
| 1783 | Ga0496124_0005065 | |||
| 1784 | Ga0496124_0068102 | |||
| 1785 | Ga0496124_0069217 | |||
| 1786 | Ga0496124_0137513 | |||
| 1787 | Ga0496125_0004347 | |||
| 1788 | Ga0496125_0023523 | |||
| 1789 | Ga0496125_0074761 | |||
| 1790 | Ga0496126_0004490 | |||
| 1791 | Ga0496126_0007857 | |||
| 1792 | Ga0496126_0022739 | |||
| 1793 | Ga0496126_0072233 | |||
| 1794 | Ga0496126_0109122 | |||
| 1795 | Ga0495678_000024 | |||
| 1796 | Ga0495678_000061 | |||
| 1797 | Ga0495678_002401 | |||
| 1798 | Ga0495678_028831 | |||
| 1799 | Ga0495682_0000130 | |||
| 1800 | Ga0495682_0016023 | |||
| 1801 | Ga0495682_0017166 | |||
| 1802 | Ga0495682_0017393 | |||
| 1803 | Ga0501034_0000049 | |||
| 1804 | Ga0501047_0089024 | |||
| 1805 | Ga0501266_001158 | |||
| 1806 | Ga0500635_0000040 | |||
| 1807 | Ga0500572_004263 | |||
| 1808 | Ga0500559_0017828 | |||
| 1809 | Ga0500636_0024953 | |||
| 1810 | Ga0501084_0015006 | |||
| 1811 | Ga0500661_006759 | |||
| 1812 | Ga0466962_0001546 | |||
| 1813 | Ga0466962_0028904 | |||
| 1814 | Ga0466962_0033663 | |||
| 1815 | 2501077496 | |||
| 1816 | 2509131867 | |||
| 1817 | 2510247773 | |||
| 1818 | 2511088924 | |||
| 1819 | 2512350115 | |||
| 1820 | 2513557610 | |||
| 1821 | 2513565663 | |||
| 1822 | 2513963593 | |||
| 1823 | 2514053048 | |||
| 1824 | 2514053459 | |||
| 1825 | 2515682095 | |||
| 1826 | 2515689757 | |||
| 1827 | 2516025258 | |||
| 1828 | 2519460685 | |||
| 1829 | 2521556665 | |||
| 1830 | 2527080245 | |||
| 1831 | 2563063661 | |||
| 1832 | 2563063857 | |||
| 1833 | 2585293139 | |||
| 1834 | 2599100819 | |||
| 1835 | 2599740362 | |||
| 1836 | 2599748998 | |||
| 1837 | 2600211055 | |||
| 1838 | 2600811665 | |||
| 1839 | 2643798777 | |||
| 1840 | 2644222255 | |||
| 1841 | 2644258140 | |||
| 1842 | 2644471128 | |||
| 1843 | 2676747204 | |||
| 1844 | 2713474544 | |||
| 1845 | 2713474752 | |||
| 1846 | 2719643795 | |||
| 1847 | 2722883079 | |||
| 1848 | 2738824239 | |||
| 1849 | 2738836648 | |||
| 1850 | 2738878179 | |||
| 1851 | 2739189871 | |||
| 1852 | 2739224773 | |||
| 1853 | 2746090415 | |||
| 1854 | 2746095855 | |||
| 1855 | 2753569397 | |||
| 1856 | 2792835304 | |||
| 1857 | 2792836729 | |||
| 1858 | 2808973899 | |||
| 1859 | 2809008659 | |||
| 1860 | 2809015835 | |||
| 1861 | 2809143252 | |||
| 1862 | 2817257561 | |||
| 1863 | 2817282035 | |||
| 1864 | 2817451504 | |||
| 1865 | 2819618028 | |||
| 1866 | 2819621406 | |||
| 1867 | 2819635368 | |||
| 1868 | 2839141443 | |||
| 1869 | 2842325459 | |||
| 1870 | 2842334809 | |||
| 1871 | 2842349738 | |||
| 1872 | 2842455025 | |||
| 1873 | 2848863981 | |||
| 1874 | 2856293374 | |||
| 1875 | 2857366758 | |||
| 1876 | 2863425182 | |||
| 1877 | 2870074151 | |||
| 1878 | 2885274443 | |||
| 1879 | 2900640142 | |||
| 1880 | 2902685507 | |||
| 1881 | 2904434844 | |||
| 1882 | 2904441955 | |||
| 1883 | 2904482826 | |||
| 1884 | 2904489205 | |||
| 1885 | 2904489318 | |||
| 1886 | 2904533252 | |||
| 1887 | 2904547059 | |||
| 1888 | 2904571586 | |||
| 1889 | 2904578642 | |||
| 1890 | 2904586200 | |||
| 1891 | 2904591987 | |||
| 1892 | 2904601851 | |||
| 1893 | 2904621205 | |||
| 1894 | 2904621350 | |||
| 1895 | 2919083822 | |||
| 1896 | 2919529819 | |||
| 1897 | 2919531686 | |||
| 1898 | 2921643598 | |||
| 1899 | 2921647620 | |||
| 1900 | 2928109081 | |||
| 1901 | 2928136304 | |||
| 1902 | 2928161034 | |||
| 1903 | 2928166030 | |||
| 1904 | 2928171041 | |||
| 1905 | 2928503914 | |||
| 1906 | 2928536525 | |||
| 1907 | 2929165595 | |||
| 1908 | 2932422649 | |||
| 1909 | 2945938289 | |||
| 1910 | 2981991293 | |||
| 1911 | 2990703903 | |||
| 1912 | 2990708288 | |||
| 1913 | 639787698 | |||
| 1914 | 642423421 | |||
| 1915 | 642413941 | |||
| 1916 | 642595568 | |||
| 1917 | 642598626 | |||
| 1918 | 642617161 | |||
| 1919 | 8003961139 | |||
| 1920 | 8018849166 | |||
| 1921 | 8020811170 | |||
| 1922 | 8020943722 | |||
| 1923 | 8020950057 | |||
| 1924 | 8020953775 | |||
| 1925 | 8021123213 | |||
| 1926 | 8039103022 | |||
| 1927 | 8040168277 | |||
| 1928 | 8040175937 | |||
| 1929 | 8047678333 | |||
| 1930 | 8054007492 | |||
| 1931 | 8055272623 | |||
| 1932 | 8055303844 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6g9x-assembly2.cif.gz_B | crystal structure of a mfs transporter at 2.54 angstroem resolution | 0.9026 | 23 | 431 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.9005 | 26 | 432 |
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.9004 | 23 | 432 |
| 6hcl-assembly2.cif.gz_B | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.8992 | 23 | 432 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.8913 | 26 | 432 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77589_11_202_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9595 | 21 | 205 | 1.20.1250.20 |
| af_Q2FW85_14_250_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9537 | 26 | 201 | 1.20.1250.20 |
| af_Q59WF2_48_242_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9509 | 21 | 200 | 1.20.1250.20 |
| af_Q09752_36_273_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9504 | 29 | 200 | 1.20.1250.20 |
| af_A0A0R0F726_79_268_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9503 | 20 | 202 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D4MNS1-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9577 | 22 | 157 |
GO:0016020
GO:0022857 GO:0046677 |
| AF-A0A2V9RJV5-F1-model_v4 | MFS transporter | 0.9575 | 32 | 193 |
GO:0016020
GO:0022857 |
| AF-A0A066W0G0-F1-model_v4 | deleted | 0.95 | 21 | 200 |
|
| AF-A0A3S1U0X0-F1-model_v4 | MFS transporter | 0.9489 | 31 | 167 |
GO:0005886
GO:0022857 |
| AF-A0A1Q8QWG6-F1-model_v4 | Sialic acid transporter (Permease) NanT | 0.9467 | 21 | 210 |
GO:0005886
GO:0046943 |