F487004

General Info

Members Datasets Scaffolds Average Seq Length
966 412 1932 451

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0000211|Ga0495585_0000211_44969_46534
Length 521
Sequence MSQNSNLHAPGASVQALNVQEFLNRHPFSPFQWLIFGLCFVIVLLDGFDTAAIGFIAPSLTREWGVSRPDLAPVLSAALFGLAVGALGSGPLADRMGRKKVLIGSVLLFGLACTWSAFSADLRQLTILRFVTGLGLGAAMPNAVTLMSEYCPDQRRSMMTNAMFCGFPLGAAFGGFLAAWMIPLWGWRSVLLLGGIAPLVLAALMLLLLPESVRYLVARRQPAQRIRAALSRIAPSAANAQSFVMTEKAAATGAKGGIGVVLSRSYVAGSLMLWLAYFMGLVIFYALINWMPILFRDAGIEPRTATLIAALFPLGGVGAILFGWLMDRYNANLVIAAGYALTAASIYAIGQAAGHVGMLMLVVFVGGILMNTAQSSMPALAAAFYPTQGRATGVAWMLGIGRFGGIAGSFLVAELARRQFGLGAIFTVVACAGVVSTVALLVKEFTHPEDKSDTPAVQGEVLGHRACFTLHEAGTGRRSGPVFAPRHKARVPSRRPACPSPASAAPRVRIPKFCPSSAPAD

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
133 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
185 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
298 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
299 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
306 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
307 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
308 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
309 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
310 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
311 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
312 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
313 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
314 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
315 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
316 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
317 2519103095 Burkholderia sp. KJ006 Isolate Nodule
318 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
319 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
320 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
321 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
322 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
323 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
324 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
325 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
326 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
327 2643221556 Massilia sp. Root1485 Isolate Unclassified
328 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
329 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
330 2643221684 Massilia sp. Root133 Isolate Unclassified
331 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
332 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
333 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
334 2721755523 Delftia sp. HK171 Isolate Unclassified
335 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
336 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
337 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
338 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
339 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
340 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
341 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
342 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
343 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
344 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
345 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
346 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
347 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
348 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
349 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
350 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
351 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
352 2818991450 Burkholderia sp. 604 Isolate Unclassified
353 2818991452 Burkholderia cepacia 561 Isolate Unclassified
354 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
355 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
356 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
357 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
358 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
359 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
360 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
361 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
362 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
363 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
364 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
365 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
366 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
367 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
368 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
369 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
370 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
371 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
372 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
373 2904564687 Burkholderia sp. 571 Isolate Unclassified
374 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
375 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
376 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
377 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
378 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
379 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
380 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
381 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
382 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
383 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
384 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
385 2928163908 Burkholderia sp. 567 Isolate Unclassified
386 2928170801 Burkholderia sp. 572 Isolate Unclassified
387 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
388 2928536128 Burkholderia sola 565 Isolate Unclassified
389 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
390 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
391 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
392 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
393 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
394 639633007 Azoarcus olearius BH72 Isolate Unclassified
395 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
396 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
397 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
398 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
399 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
400 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
401 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
402 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
403 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
404 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
405 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
406 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
407 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
408 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
409 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
410 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
411 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
412 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.78
Metatranscriptomes 0
Isolates 12.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.7
Nodule 2.9
Rhizoplane 3.83
Rhizosphere 68.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0000211 3300046492 Bacteria 61010
2 JGI24740J21852_10001309 3300001979 Bacteria 11320
3 JGI24739J22299_10001079 3300001989 Bacteria 10164
4 JGI24739J22299_10001779 3300001989 Bacteria 8204
5 JGI24739J22299_10005316 3300001989 Bacteria 4905
6 JGI24739J22299_10007027 3300001989 Bacteria 4238
7 JGI24735J21928_10001507 3300002067 Bacteria 8236
8 JGI24735J21928_10003601 3300002067 Bacteria 5259
9 JGI24735J21928_10003905 3300002067 Bacteria 5044
10 JGI24735J21928_10007512 3300002067 Bacteria 3554
11 JGI24735J21928_10015154 3300002067 Bacteria 2408
12 JGI24738J21930_10011891 3300002075 Bacteria 1907
13 JGI25156J39149_1000137 3300002705 Bacteria 53605
14 JGI25156J39149_1000236 3300002705 Bacteria 37992
15 JGI25156J39149_1000642 3300002705 Bacteria 19182
16 JGI25156J39149_1001363 3300002705 Bacteria 10484
17 JGI25156J39149_1002647 3300002705 Bacteria 6290
18 JGI25154J39366_1000106 3300002738 Bacteria 74019
19 JGI25157J39369_1000154 3300002741 Bacteria 57286
20 JGI25151J46595_10005982 3300003187 Bacteria 6193
21 JGI25151J46595_10034388 3300003187 Bacteria 1939
22 JGI25165J46597_1000939 3300003214 Bacteria 19950
23 JGI25165J46597_1001941 3300003214 Bacteria 8149
24 rootH1_10000900 3300003316 Bacteria 45745
25 rootH1_10017467 3300003316 Bacteria 5013
26 rootH1_10043777 3300003316 Bacteria 1673
27 rootH2_10009909 3300003320 Bacteria 3746
28 rootL2_10009014 3300003322 Bacteria 15136
29 rootH1_10033602 3300003323 Bacteria 9701
30 rootH1_10050263 3300003323 Bacteria 6314
31 rootH1_10111356 3300003323 Bacteria 2154
32 JGI25160J50197_1000025 3300003354 Bacteria 186706
33 JGI25160J50197_1000101 3300003354 Bacteria 83840
34 Ga0055539_1000197 3300003752 Bacteria 49212
35 Ga0055539_1000488 3300003752 Bacteria 12803
36 Ga0055533_1000040 3300003756 Bacteria 242927
37 Ga0055533_1000159 3300003756 Bacteria 65219
38 Ga0055533_1000611 3300003756 Bacteria 12060
39 Ga0055532_1000014 3300003758 Bacteria 344702
40 Ga0055532_1000140 3300003758 Bacteria 71626
41 Ga0055532_1002026 3300003758 Bacteria 4651
42 Ga0055525_1000745 3300003759 Bacteria 11105
43 Ga0055527_1000013 3300003760 Bacteria 347416
44 Ga0055527_1000089 3300003760 Bacteria 71626
45 Ga0055527_1000280 3300003760 Bacteria 30042
46 Ga0055535_1000011 3300003761 Bacteria 347416
47 Ga0055535_1000164 3300003761 Bacteria 71626
48 Ga0055535_1000591 3300003761 Bacteria 30042
49 Ga0055535_1002021 3300003761 Bacteria 8279
50 Ga0055542_1000018 3300003762 Bacteria 347416
51 Ga0055542_1000208 3300003762 Bacteria 71626
52 Ga0055542_1001740 3300003762 Bacteria 9278
53 Ga0055542_1002922 3300003762 Bacteria 5036
54 Ga0055529_1000017 3300003763 Bacteria 347416
55 Ga0055529_1000053 3300003763 Bacteria 198996
56 Ga0055529_1000227 3300003763 Bacteria 71626
57 Ga0055529_1000978 3300003763 Bacteria 14276
58 Ga0055526_1000105 3300003771 Bacteria 73056
59 Ga0055528_1003527 3300003790 Bacteria 7809
60 Ga0055530_10000614 3300003791 Bacteria 30953
61 Ga0055530_10001720 3300003791 Bacteria 15410
62 Ga0055530_10020189 3300003791 Bacteria 1999
63 Ga0055540_1000014 3300003792 Bacteria 234171
64 Ga0055540_1005240 3300003792 Bacteria 5536
65 Ga0055531_10003071 3300003794 Bacteria 10800
66 Ga0055531_10005969 3300003794 Bacteria 6996
67 Ga0058692_1004472 3300003856 Bacteria 4138
68 Ga0065165_1000173 3300005262 Bacteria 114553
69 Ga0065165_1000188 3300005262 Bacteria 108637
70 Ga0065165_1001702 3300005262 Bacteria 22116
71 Ga0070658_10010287 3300005327 Bacteria 7504
72 Ga0070682_100012280 3300005337 Bacteria 4906
73 Ga0070660_100000159 3300005339 Bacteria 43943
74 Ga0070660_100000637 3300005339 Bacteria 23264
75 Ga0070660_100002295 3300005339 Bacteria 13142
76 Ga0070661_100081238 3300005344 Bacteria 2393
77 Ga0070659_100000223 3300005366 Bacteria 44089
78 Ga0070659_100096166 3300005366 Bacteria 2379
79 Ga0070714_100010374 3300005435 Bacteria 7362
80 Ga0070713_100001762 3300005436 Bacteria 13965
81 Ga0070711_100019644 3300005439 Bacteria 4338
82 Ga0070708_100149747 3300005445 Bacteria 2169
83 Ga0070663_100001049 3300005455 Bacteria 15125
84 Ga0070663_100032949 3300005455 Bacteria 3576
85 Ga0068853_100028416 3300005539 Bacteria 4704
86 Ga0068855_100022088 3300005563 Bacteria 7627
87 Ga0068855_100028363 3300005563 Bacteria 6696
88 Ga0070664_100081794 3300005564 Bacteria 2784
89 Ga0068857_100223918 3300005577 Bacteria 1719
90 Ga0068854_100004290 3300005578 Bacteria 8987
91 Ga0068856_100022922 3300005614 Bacteria 6072
92 Ga0068856_100205354 3300005614 Bacteria 1985
93 Ga0068866_10050504 3300005718 Bacteria 2112
94 Ga0075366_10009886 3300006195 Bacteria 5338
95 Ga0075366_10090319 3300006195 Bacteria 1834
96 Ga0075370_10041483 3300006353 Bacteria 2598
97 Ga0068865_100156038 3300006881 Bacteria 1736
98 Ga0079104_1000013 3300006946 Bacteria 349477
99 Ga0079104_1000724 3300006946 Bacteria 29488
100 Ga0105251_10000335 3300009011 Bacteria 47275
101 Ga0105251_10000589 3300009011 Bacteria 33409
102 Ga0105240_10001196 3300009093 Bacteria 45244
103 Ga0105240_10012745 3300009093 Bacteria 11588
104 Ga0105240_10013343 3300009093 Bacteria 11291
105 Ga0105240_10024279 3300009093 Bacteria 7998
106 Ga0105240_10042007 3300009093 Bacteria 5829
107 Ga0105240_10057300 3300009093 Bacteria 4869
108 Ga0105240_10091306 3300009093 Bacteria 3721
109 Ga0105240_10093220 3300009093 Bacteria 3676
110 Ga0105240_10110662 3300009093 Bacteria 3324
111 Ga0105247_10080443 3300009101 Bacteria 2052
112 Ga0105243_10004635 3300009148 Bacteria 10832
113 Ga0105241_10035913 3300009174 Bacteria 3729
114 Ga0105241_10038664 3300009174 Bacteria 3597
115 Ga0105237_10000645 3300009545 Bacteria 48648
116 Ga0105237_10006307 3300009545 Bacteria 13184
117 Ga0105237_10024649 3300009545 Bacteria 6153
118 Ga0105237_10065380 3300009545 Bacteria 3633
119 Ga0105237_10087124 3300009545 Bacteria 3112
120 Ga0105237_10103770 3300009545 Bacteria 2835
121 Ga0105237_10114049 3300009545 Bacteria 2695
122 Ga0105237_10139007 3300009545 Bacteria 2423
123 Ga0105238_10009283 3300009551 Bacteria 9845
124 Ga0105238_10111614 3300009551 Bacteria 2714
125 Ga0105238_10241617 3300009551 Bacteria 1783
126 Ga0105239_10000572 3300010375 Bacteria 52626
127 Ga0105239_10007488 3300010375 Bacteria 12526
128 Ga0105239_10017482 3300010375 Bacteria 7930
129 Ga0105239_10101297 3300010375 Bacteria 3186
130 Ga0105239_10120756 3300010375 Bacteria 2910
131 Ga0105246_10087739 3300011119 Bacteria 2234
132 Ga0157373_10014530 3300013100 Bacteria 5770
133 Ga0157370_10003565 3300013104 Bacteria 18222
134 Ga0157370_10014525 3300013104 Bacteria 8050
135 Ga0157370_10059821 3300013104 Bacteria 3619
136 Ga0157369_10006615 3300013105 Bacteria 13409
137 Ga0157369_10030856 3300013105 Bacteria 5909
138 Ga0157374_10000081 3300013296 Bacteria 95406
139 Ga0157374_10000834 3300013296 Bacteria 26952
140 Ga0157372_10011733 3300013307 Bacteria 9331
141 Ga0157372_10020789 3300013307 Bacteria 7088
142 Ga0157375_10002531 3300013308 Bacteria 15860
143 Ga0157375_10379723 3300013308 Bacteria 1580
144 Ga0163163_10059963 3300014325 Bacteria 3766
145 Ga0182008_10009819 3300014497 Bacteria 5149
146 Ga0182008_10039610 3300014497 Bacteria 2354
147 Ga0182006_1002702 3300015261 Bacteria 9517
148 Ga0182007_10001639 3300015262 Bacteria 11844
149 Ga0182007_10005892 3300015262 Bacteria 5323
150 Ga0182005_1004230 3300015265 Bacteria 4684
151 Ga0183361_10003 3300016635 Bacteria 577277
152 Ga0163161_10080887 3300017792 Bacteria 2392
153 Ga0213872_10000134 3300021361 Bacteria 67449
154 Ga0213872_10037606 3300021361 Bacteria 2210
155 Ga0213876_10000312 3300021384 Bacteria 42654
156 Ga0213875_10005957 3300021388 Bacteria 6466
157 Ga0209566_100443 3300025225 Bacteria 30572
158 Ga0209674_100020 3300025226 Bacteria 672397
159 Ga0209674_100051 3300025226 Bacteria 338399
160 Ga0209674_100066 3300025226 Bacteria 256739
161 Ga0209674_101758 3300025226 Bacteria 5260
162 Ga0209672_100012 3300025228 Bacteria 795742
163 Ga0209672_100013 3300025228 Bacteria 740693
164 Ga0209672_100027 3300025228 Bacteria 344500
165 Ga0209672_100063 3300025228 Bacteria 204903
166 Ga0209672_100708 3300025228 Bacteria 16597
167 Ga0209147_100007 3300025229 Bacteria 795684
168 Ga0209147_100013 3300025229 Bacteria 660057
169 Ga0209147_100035 3300025229 Bacteria 344500
170 Ga0209147_100077 3300025229 Bacteria 205964
171 Ga0209147_100119 3300025229 Bacteria 142860
172 Ga0209563_100129 3300025230 Bacteria 99977
173 Ga0209563_100306 3300025230 Bacteria 19672
174 Ga0209563_100645 3300025230 Bacteria 11214
175 Ga0207427_100487 3300025231 Bacteria 21325
176 Ga0207427_101027 3300025231 Bacteria 11666
177 Ga0207427_103184 3300025231 Bacteria 3627
178 Ga0209258_100014 3300025242 Bacteria 720132
179 Ga0209258_100052 3300025242 Bacteria 344500
180 Ga0209258_100074 3300025242 Bacteria 271062
181 Ga0209258_100105 3300025242 Bacteria 207862
182 Ga0209258_100328 3300025242 Bacteria 71792
183 Ga0209646_1000127 3300025246 Bacteria 131920
184 Ga0209026_1000004 3300025250 Bacteria 949012
185 Ga0209677_100085 3300025253 Bacteria 116046
186 Ga0209677_100157 3300025253 Bacteria 62213
187 Ga0209148_1000020 3300025254 Bacteria 740693
188 Ga0209148_1000064 3300025254 Bacteria 344500
189 Ga0209148_1000107 3300025254 Bacteria 207862
190 Ga0209148_1002924 3300025254 Bacteria 5184
191 Ga0209148_1005329 3300025254 Bacteria 2972
192 Ga0209759_1000015 3300025256 Bacteria 388724
193 Ga0209759_1000028 3300025256 Bacteria 298755
194 Ga0209759_1000129 3300025256 Bacteria 131961
195 Ga0209759_1000279 3300025256 Bacteria 71943
196 Ga0209759_1000315 3300025256 Bacteria 64918
197 Ga0209759_1000521 3300025256 Bacteria 41549
198 Ga0209759_1001009 3300025256 Bacteria 19019
199 Ga0209759_1001226 3300025256 Bacteria 15698
200 Ga0209233_1000073 3300025261 Bacteria 362383
201 Ga0209233_1000294 3300025261 Bacteria 62768
202 Ga0209565_1012923 3300025263 Bacteria 1972
203 Ga0209455_1000017 3300025272 Bacteria 740693
204 Ga0209455_1000057 3300025272 Bacteria 344500
205 Ga0209455_1000066 3300025272 Bacteria 316811
206 Ga0209455_1000100 3300025272 Bacteria 207862
207 Ga0209455_1000138 3300025272 Bacteria 141021
208 Ga0209673_1000101 3300025273 Bacteria 190230
209 Ga0209673_1009213 3300025273 Bacteria 4304
210 Ga0209130_1004958 3300025284 Bacteria 4819
211 Ga0209025_1000115 3300025294 Bacteria 218871
212 Ga0209025_1000286 3300025294 Bacteria 114096
213 Ga0209564_1000007 3300025295 Bacteria 1028582
214 Ga0209564_1007435 3300025295 Bacteria 5656
215 Ga0209564_1007842 3300025295 Bacteria 5413
216 Ga0209050_1000142 3300025298 Bacteria 172356
217 Ga0209050_1002975 3300025298 Bacteria 13196
218 Ga0209256_1000130 3300025299 Bacteria 163227
219 Ga0209256_1000840 3300025299 Bacteria 38531
220 Ga0207426_1000020 3300025302 Bacteria 558084
221 Ga0207426_1000056 3300025302 Bacteria 373596
222 Ga0207426_1004594 3300025302 Bacteria 6661
223 Ga0209051_1000035 3300025303 Bacteria 346999
224 Ga0209051_1002864 3300025303 Bacteria 11863
225 Ga0209051_1004454 3300025303 Bacteria 8621
226 Ga0209051_1005258 3300025303 Bacteria 7627
227 Ga0209051_1028996 3300025303 Bacteria 2175
228 Ga0209257_1000494 3300025304 Bacteria 70693
229 Ga0209257_1004031 3300025304 Bacteria 11813
230 Ga0207696_1012173 3300025711 Bacteria 3052
231 Ga0207713_1000948 3300025735 Bacteria 26051
232 Ga0207713_1005024 3300025735 Bacteria 8421
233 Ga0207713_1014454 3300025735 Bacteria 4101
234 Ga0207692_10001173 3300025898 Bacteria 9689
235 Ga0207647_10000553 3300025904 Bacteria 29707
236 Ga0207647_10000738 3300025904 Bacteria 25647
237 Ga0207647_10001254 3300025904 Bacteria 19523
238 Ga0207647_10001656 3300025904 Bacteria 17150
239 Ga0207647_10055174 3300025904 Bacteria 2442
240 Ga0207699_10006667 3300025906 Bacteria 5601
241 Ga0207705_10005147 3300025909 Bacteria 9802
242 Ga0207705_10065196 3300025909 Bacteria 2633
243 Ga0207695_10000368 3300025913 Bacteria 103176
244 Ga0207695_10011940 3300025913 Bacteria 10460
245 Ga0207695_10015690 3300025913 Bacteria 8911
246 Ga0207695_10018460 3300025913 Bacteria 8067
247 Ga0207695_10043331 3300025913 Bacteria 4797
248 Ga0207695_10058194 3300025913 Bacteria 4012
249 Ga0207695_10085995 3300025913 Bacteria 3172
250 Ga0207695_10134338 3300025913 Bacteria 2429
251 Ga0207671_10002474 3300025914 Bacteria 19736
252 Ga0207671_10109891 3300025914 Bacteria 2097
253 Ga0207671_10159391 3300025914 Bacteria 1747
254 Ga0207663_10000327 3300025916 Bacteria 20836
255 Ga0207657_10000442 3300025919 Bacteria 43937
256 Ga0207657_10001219 3300025919 Bacteria 27407
257 Ga0207657_10001423 3300025919 Bacteria 25532
258 Ga0207694_10036318 3300025924 Bacteria 3782
259 Ga0207694_10207052 3300025924 Bacteria 1597
260 Ga0207700_10038443 3300025928 Bacteria 3473
261 Ga0207664_10094268 3300025929 Bacteria 2460
262 Ga0207690_10000037 3300025932 Bacteria 142658
263 Ga0207706_10179484 3300025933 Bacteria 1859
264 Ga0207709_10000172 3300025935 Bacteria 86654
265 Ga0207665_10013914 3300025939 Bacteria 5292
266 Ga0207667_10018107 3300025949 Bacteria 7908
267 Ga0207667_10040261 3300025949 Bacteria 4976
268 Ga0207667_10200826 3300025949 Bacteria 2045
269 Ga0207658_10115035 3300025986 Bacteria 2134
270 Ga0207658_10179778 3300025986 Bacteria 1750
271 Ga0207639_10018607 3300026041 Bacteria 4940
272 Ga0207639_10071183 3300026041 Bacteria 2719
273 Ga0207678_10000317 3300026067 Bacteria 43506
274 Ga0207678_10010832 3300026067 Bacteria 8012
275 Ga0207702_10143469 3300026078 Bacteria 2164
276 Ga0207674_10058378 3300026116 Bacteria 3909
277 Ga0207683_10135673 3300026121 Bacteria 2215
278 Ga0207683_10147985 3300026121 Bacteria 2119
279 Ga0207698_10017622 3300026142 Bacteria 4852
280 Ga0209281_1000020 3300027111 Bacteria 575972
281 Ga0209281_1000076 3300027111 Bacteria 263350
282 Ga0209371_1000080 3300027312 Bacteria 185771
283 Ga0209371_1014775 3300027312 Bacteria 2124
284 Ga0265337_1001439 3300028556 Bacteria 11715
285 Ga0265326_10001380 3300028558 Bacteria 8553
286 Ga0265334_10005260 3300028573 Bacteria 5665
287 Ga0265318_10003474 3300028577 Bacteria 7906
288 Ga0265323_10000992 3300028653 Bacteria 14760
289 Ga0265322_10002589 3300028654 Bacteria 5560
290 Ga0265336_10000003 3300028666 Bacteria 423158
291 Ga0265336_10000063 3300028666 Bacteria 98413
292 Ga0307515_10000737 3300028794 Bacteria 75687
293 Ga0265338_10000154 3300028800 Bacteria 125708
294 Ga0265324_10001590 3300029957 Bacteria 12642
295 Ga0268256_1000160 3300030500 Bacteria 86682
296 Ga0268256_1015142 3300030500 Bacteria 2263
297 Ga0307511_10098629 3300030521 Bacteria 1933
298 Ga0265339_10001335 3300031249 Bacteria 18436
299 Ga0265327_10005550 3300031251 Bacteria 10474
300 Ga0307513_10015012 3300031456 Bacteria 9403
301 Ga0307408_100000029 3300031548 Bacteria 227806
302 Ga0307514_10000408 3300031649 Bacteria 95961
303 Ga0307514_10001033 3300031649 Bacteria 40119
304 Ga0265314_10001952 3300031711 Bacteria 21949
305 Ga0307516_10000424 3300031730 Bacteria 55291
306 Ga0307412_10000002 3300031911 Bacteria 743446
307 Ga0307416_100010306 3300032002 Bacteria 6166
308 Ga0373934_0005435 3300035086 Bacteria 4721
309 Ga0373939_0000469 3300035114 Bacteria 10203
310 Ga0373960_0002278 3300035121 Bacteria 4319
311 Ga0373943_0107883 3300035170 Bacteria 1465
312 Ga0373962_0016516 3300035242 Bacteria 1904
313 Ga0373927_0091434 3300035695 Bacteria 1976
314 Ga0395899_0000005 3300037312 Bacteria 772966
315 Ga0395900_0000003 3300037418 Bacteria 587648
316 Ga0395900_0021389 3300037418 Bacteria 6613
317 Ga0395900_0057494 3300037418 Bacteria 4005
318 Ga0395898_0000003 3300037466 Bacteria 772986
319 Ga0395898_0015437 3300037466 Bacteria 7832
320 Ga0395898_0057172 3300037466 Bacteria 3802
321 Ga0395898_0074039 3300037466 Bacteria 3290
322 Ga0395905_0000004 3300037471 Bacteria 674991
323 Ga0395905_0000009 3300037471 Bacteria 488729
324 Ga0395905_0004257 3300037471 Bacteria 14949
325 Ga0395905_0012101 3300037471 Bacteria 8312
326 Ga0395905_0013595 3300037471 Bacteria 7797
327 Ga0395905_0222404 3300037471 Bacteria 1767
328 Ga0436364_0100220 3300037853 Bacteria 61250
329 Ga0436364_0465200 3300037853 Bacteria 2168
330 Ga0436364_0586291 3300037853 Bacteria 97560
331 Ga0436364_0783389 3300037853 Bacteria 17507
332 Ga0436364_0841842 3300037853 Bacteria 1928
333 Ga0395901_0000009 3300038443 Bacteria 479396
334 Ga0395901_0038206 3300038443 Bacteria 4966
335 Ga0395901_0130414 3300038443 Bacteria 2641
336 Ga0395901_0185873 3300038443 Bacteria 2179
337 Ga0395901_0201249 3300038443 Bacteria 2087
338 Ga0436365_0552641 3300039437 Bacteria 23591
339 Ga0436365_0821809 3300039437 Bacteria 3267
340 Ga0436365_1478189 3300039437 Bacteria 2267
341 Ga0436360_0091417 3300039438 Bacteria 2318
342 Ga0436360_0624080 3300039438 Bacteria 4755
343 Ga0436361_0033961 3300039447 Bacteria 8485
344 Ga0436361_0193139 3300039447 Bacteria 16854
345 Ga0436361_0455065 3300039447 Bacteria 73475
346 Ga0436361_1139408 3300039447 Bacteria 4705
347 Ga0436363_0679974 3300039450 Bacteria 5752
348 Ga0436362_0295156 3300039453 Bacteria 1831
349 Ga0436362_1208322 3300039453 Bacteria 1784
350 Ga0439448_0000025 3300042005 Bacteria 24247
351 Ga0439448_0002656 3300042005 Bacteria 4879
352 Ga0451577_0010994 3300042876 Bacteria 8596
353 Ga0466969_0002900 3300044656 Bacteria 9150
354 Ga0466969_0079966 3300044656 Bacteria 1561
355 Ga0466972_0011461 3300044658 Bacteria 4452
356 Ga0466965_0003466 3300044683 Bacteria 6919
357 Ga0466965_0016314 3300044683 Bacteria 3532
358 Ga0466966_0000037 3300044684 Bacteria 97578
359 Ga0466966_0001374 3300044684 Bacteria 15651
360 Ga0466966_0005943 3300044684 Bacteria 8052
361 Ga0466961_0000258 3300044693 Bacteria 35598
362 Ga0466961_0003537 3300044693 Bacteria 9749
363 Ga0466961_0010435 3300044693 Bacteria 5928
364 Ga0466961_0016999 3300044693 Bacteria 4672
365 Ga0466961_0038448 3300044693 Bacteria 3069
366 Ga0466963_0044011 3300044694 Bacteria 2937
367 Ga0466964_0000407 3300044706 Bacteria 13000
368 Ga0453684_0003874 3300044712 Bacteria 32937
369 Ga0453684_0039960 3300044712 Bacteria 6380
370 Ga0466971_0078563 3300044719 Bacteria 1503
371 Ga0466968_0030835 3300044735 Bacteria 2223
372 Ga0466957_0033487 3300044842 Bacteria 3083
373 Ga0466959_0005077 3300045049 Bacteria 8952
374 Ga0466959_0018695 3300045049 Bacteria 5089
375 Ga0466959_0048665 3300045049 Bacteria 3115
376 Ga0466959_0063890 3300045049 Bacteria 2672
377 Ga0451576_0012383 3300045051 Bacteria 9582
378 Ga0466958_0007398 3300045836 Bacteria 6038
379 Ga0466958_0038355 3300045836 Bacteria 2874
380 Ga0466958_0113524 3300045836 Bacteria 1692
381 Ga0495592_0008740 3300046454 Bacteria 7604
382 Ga0495592_0050462 3300046454 Bacteria 3091
383 Ga0495603_0000430 3300046455 Bacteria 23265
384 Ga0495603_0001760 3300046455 Bacteria 12754
385 Ga0495603_0004181 3300046455 Bacteria 8602
386 Ga0495603_0013805 3300046455 Bacteria 4888
387 Ga0495603_0095291 3300046455 Bacteria 1739
388 Ga0495590_0000013 3300046457 Bacteria 271977
389 Ga0495590_0006335 3300046457 Bacteria 4627
390 Ga0495590_0030841 3300046457 Bacteria 1878
391 Ga0495591_000109 3300046458 Bacteria 94877
392 Ga0495591_003119 3300046458 Bacteria 8763
393 Ga0495629_0000027 3300046459 Bacteria 129244
394 Ga0495629_0000184 3300046459 Bacteria 56265
395 Ga0495629_0000262 3300046459 Bacteria 45919
396 Ga0495629_0002023 3300046459 Bacteria 15768
397 Ga0495629_0002885 3300046459 Bacteria 13133
398 Ga0495629_0080644 3300046459 Bacteria 2272
399 Ga0495629_0127476 3300046459 Bacteria 1773
400 Ga0495629_0208369 3300046459 Bacteria 1350
401 Ga0495638_0001152 3300046460 Bacteria 25467
402 Ga0495638_0012125 3300046460 Bacteria 5919
403 Ga0495641_0043944 3300046461 Bacteria 2064
404 Ga0495651_0080184 3300046462 Bacteria 2466
405 Ga0495653_0000323 3300046463 Bacteria 38936
406 Ga0495653_0001078 3300046463 Bacteria 21050
407 Ga0495653_0003556 3300046463 Bacteria 12558
408 Ga0495653_0004636 3300046463 Bacteria 11117
409 Ga0495653_0012355 3300046463 Bacteria 6968
410 Ga0495653_0026186 3300046463 Bacteria 4679
411 Ga0495653_0053932 3300046463 Bacteria 3073
412 Ga0495653_0079310 3300046463 Bacteria 2432
413 Ga0495653_0090892 3300046463 Bacteria 2232
414 Ga0495650_0000001 3300046471 Bacteria 1085492
415 Ga0495650_0000155 3300046471 Bacteria 155947
416 Ga0495650_0000322 3300046471 Bacteria 85802
417 Ga0495650_0007783 3300046471 Bacteria 6374
418 Ga0495650_0008029 3300046471 Bacteria 6233
419 Ga0495650_0010335 3300046471 Bacteria 5215
420 Ga0495650_0019378 3300046471 Bacteria 3350
421 Ga0495580_0000464 3300046472 Bacteria 33698
422 Ga0495580_0005399 3300046472 Bacteria 10568
423 Ga0495580_0021677 3300046472 Bacteria 4738
424 Ga0495580_0031660 3300046472 Bacteria 3820
425 Ga0495580_0040928 3300046472 Bacteria 3307
426 Ga0495580_0172731 3300046472 Bacteria 1494
427 Ga0495582_0002757 3300046473 Bacteria 9801
428 Ga0495582_0002869 3300046473 Bacteria 9638
429 Ga0495582_0017483 3300046473 Bacteria 3923
430 Ga0495582_0047889 3300046473 Bacteria 2354
431 Ga0495605_0001158 3300046474 Bacteria 17488
432 Ga0495605_0001269 3300046474 Bacteria 16723
433 Ga0495605_0002220 3300046474 Bacteria 12125
434 Ga0495605_0003943 3300046474 Bacteria 8775
435 Ga0495605_0004941 3300046474 Bacteria 7791
436 Ga0495605_0007402 3300046474 Bacteria 6230
437 Ga0495605_0015189 3300046474 Bacteria 4194
438 Ga0495605_0017678 3300046474 Bacteria 3835
439 Ga0495605_0017952 3300046474 Bacteria 3800
440 Ga0495605_0019289 3300046474 Bacteria 3647
441 Ga0495605_0030728 3300046474 Bacteria 2751
442 Ga0495605_0062388 3300046474 Bacteria 1781
443 Ga0495639_0004351 3300046475 Bacteria 6075
444 Ga0495662_0041700 3300046476 Bacteria 2216
445 Ga0495662_0066486 3300046476 Bacteria 1744
446 Ga0495664_0002960 3300046477 Bacteria 9171
447 Ga0495664_0007286 3300046477 Bacteria 6137
448 Ga0495584_0000026 3300046491 Bacteria 114028
449 Ga0495584_0000029 3300046491 Bacteria 105850
450 Ga0495584_0001869 3300046491 Bacteria 12180
451 Ga0495584_0001997 3300046491 Bacteria 11733
452 Ga0495584_0002177 3300046491 Bacteria 11176
453 Ga0495584_0003468 3300046491 Bacteria 8676
454 Ga0495585_0010743 3300046492 Bacteria 5438
455 Ga0495585_0012655 3300046492 Bacteria 4966
456 Ga0495585_0024534 3300046492 Bacteria 3457
457 Ga0495596_0000173 3300046500 Bacteria 44841
458 Ga0495596_0000355 3300046500 Bacteria 29677
459 Ga0495596_0000604 3300046500 Bacteria 22532
460 Ga0495596_0000786 3300046500 Bacteria 19278
461 Ga0495596_0000991 3300046500 Bacteria 16870
462 Ga0495596_0003689 3300046500 Bacteria 7655
463 Ga0495596_0015195 3300046500 Bacteria 3230
464 Ga0495596_0018761 3300046500 Bacteria 2849
465 Ga0495596_0025063 3300046500 Bacteria 2413
466 Ga0495607_0000215 3300046501 Bacteria 61794
467 Ga0495607_0000316 3300046501 Bacteria 50215
468 Ga0495607_0001536 3300046501 Bacteria 20304
469 Ga0495607_0002120 3300046501 Bacteria 16568
470 Ga0495583_0000011 3300046506 Bacteria 350215
471 Ga0495583_0000040 3300046506 Bacteria 236558
472 Ga0495583_0000296 3300046506 Bacteria 78991
473 Ga0495583_0000378 3300046506 Bacteria 69104
474 Ga0495583_0001070 3300046506 Bacteria 30573
475 Ga0495583_0003300 3300046506 Bacteria 12506
476 Ga0495583_0003830 3300046506 Bacteria 11153
477 Ga0495583_0007163 3300046506 Bacteria 7093
478 Ga0495583_0023731 3300046506 Bacteria 3096
479 Ga0495606_0001789 3300046507 Bacteria 27342
480 Ga0495606_0003521 3300046507 Bacteria 16538
481 Ga0495606_0024866 3300046507 Bacteria 4303
482 Ga0495606_0126188 3300046507 Bacteria 1526
483 Ga0495608_0008753 3300046511 Bacteria 7079
484 Ga0495608_0036947 3300046511 Bacteria 3286
485 Ga0495608_0038012 3300046511 Bacteria 3235
486 Ga0495610_0004903 3300046512 Bacteria 9722
487 Ga0495610_0061606 3300046512 Bacteria 1782
488 Ga0495616_0000012 3300046513 Bacteria 211342
489 Ga0495616_0000282 3300046513 Bacteria 41088
490 Ga0495616_0004739 3300046513 Bacteria 8528
491 Ga0495616_0007303 3300046513 Bacteria 6613
492 Ga0495616_0008091 3300046513 Bacteria 6261
493 Ga0495616_0024106 3300046513 Bacteria 3266
494 Ga0495616_0025566 3300046513 Bacteria 3152
495 Ga0495616_0029447 3300046513 Bacteria 2899
496 Ga0495616_0059686 3300046513 Bacteria 1875
497 Ga0495618_0014796 3300046514 Bacteria 4759
498 Ga0495618_0017556 3300046514 Bacteria 4389
499 Ga0495628_0004051 3300046516 Bacteria 13038
500 Ga0495628_0011994 3300046516 Bacteria 7309
501 Ga0495628_0024722 3300046516 Bacteria 4914
502 Ga0495628_0040382 3300046516 Bacteria 3728
503 Ga0495628_0061116 3300046516 Bacteria 2955
504 Ga0495628_0087335 3300046516 Bacteria 2417
505 Ga0495628_0107157 3300046516 Bacteria 2152
506 Ga0495630_0012035 3300046517 Bacteria 6275
507 Ga0495630_0019324 3300046517 Bacteria 5007
508 Ga0495631_0000737 3300046518 Bacteria 21033
509 Ga0495631_0000861 3300046518 Bacteria 19091
510 Ga0495631_0002653 3300046518 Bacteria 9973
511 Ga0495631_0003830 3300046518 Bacteria 8157
512 Ga0495631_0008115 3300046518 Bacteria 5303
513 Ga0495631_0011388 3300046518 Bacteria 4373
514 Ga0495631_0051344 3300046518 Bacteria 1802
515 Ga0495632_0000012 3300046519 Bacteria 264389
516 Ga0495632_0000367 3300046519 Bacteria 42974
517 Ga0495632_0000530 3300046519 Bacteria 36061
518 Ga0495632_0002018 3300046519 Bacteria 16008
519 Ga0495632_0008241 3300046519 Bacteria 6424
520 Ga0495632_0021529 3300046519 Bacteria 3473
521 Ga0495637_0000008 3300046520 Bacteria 404658
522 Ga0495643_0001945 3300046522 Bacteria 17383
523 Ga0495643_0005793 3300046522 Bacteria 8271
524 Ga0495643_0011088 3300046522 Bacteria 5509
525 Ga0495643_0025217 3300046522 Bacteria 3366
526 Ga0495643_0064765 3300046522 Bacteria 1930
527 Ga0495644_0015669 3300046523 Bacteria 2906
528 Ga0495644_0016327 3300046523 Bacteria 2841
529 Ga0495644_0022233 3300046523 Bacteria 2417
530 Ga0495648_0000648 3300046524 Bacteria 37132
531 Ga0495648_0006040 3300046524 Bacteria 9940
532 Ga0495648_0006664 3300046524 Bacteria 9354
533 Ga0495648_0022004 3300046524 Bacteria 4400
534 Ga0495648_0030675 3300046524 Bacteria 3550
535 Ga0495648_0089876 3300046524 Bacteria 1722
536 Ga0495663_0004271 3300046525 Bacteria 4027
537 Ga0495666_0001260 3300046526 Bacteria 12277
538 Ga0495666_0006755 3300046526 Bacteria 5768
539 Ga0495666_0011241 3300046526 Bacteria 4465
540 Ga0495666_0013933 3300046526 Bacteria 4009
541 Ga0495666_0020985 3300046526 Bacteria 3234
542 Ga0495642_0000091 3300046528 Bacteria 53133
543 Ga0495642_0002541 3300046528 Bacteria 7382
544 Ga0495642_0003697 3300046528 Bacteria 6002
545 Ga0495642_0011402 3300046528 Bacteria 3415
546 Ga0495642_0019504 3300046528 Bacteria 2659
547 Ga0495642_0048943 3300046528 Bacteria 1735
548 Ga0495652_0011870 3300046529 Bacteria 7874
549 Ga0495652_0019974 3300046529 Bacteria 5958
550 Ga0495652_0039650 3300046529 Bacteria 4072
551 Ga0495652_0155766 3300046529 Bacteria 1779
552 Ga0495652_0184361 3300046529 Bacteria 1598
553 Ga0495654_0001482 3300046530 Bacteria 16073
554 Ga0495654_0012346 3300046530 Bacteria 4590
555 Ga0495665_0002053 3300046531 Bacteria 10902
556 Ga0495665_0002164 3300046531 Bacteria 10625
557 Ga0495665_0006614 3300046531 Bacteria 6257
558 Ga0495665_0020962 3300046531 Bacteria 3512
559 Ga0495665_0023187 3300046531 Bacteria 3332
560 Ga0495640_0002090 3300046533 Bacteria 15908
561 Ga0495640_0002685 3300046533 Bacteria 14303
562 Ga0495640_0015535 3300046533 Bacteria 5726
563 Ga0495586_0003135 3300046535 Bacteria 8895
564 Ga0495586_0003172 3300046535 Bacteria 8847
565 Ga0495586_0011394 3300046535 Bacteria 4730
566 Ga0495586_0012543 3300046535 Bacteria 4496
567 Ga0495587_0003273 3300046536 Bacteria 10809
568 Ga0495587_0010841 3300046536 Bacteria 5784
569 Ga0495587_0051630 3300046536 Bacteria 2430
570 Ga0495587_0080803 3300046536 Bacteria 1883
571 Ga0495609_0000001 3300046538 Bacteria 1060094
572 Ga0495609_0001492 3300046538 Bacteria 15496
573 Ga0495609_0002530 3300046538 Bacteria 11212
574 Ga0495609_0013249 3300046538 Bacteria 3899
575 Ga0495597_0000560 3300046542 Bacteria 30875
576 Ga0495597_0000911 3300046542 Bacteria 22921
577 Ga0495597_0023439 3300046542 Bacteria 2854
578 Ga0495597_0024676 3300046542 Bacteria 2773
579 Ga0495645_0000102 3300046543 Bacteria 59126
580 Ga0495645_0002579 3300046543 Bacteria 12321
581 Ga0495645_0033652 3300046543 Bacteria 3739
582 Ga0495645_0117294 3300046543 Bacteria 1878
583 Ga0495645_0161474 3300046543 Bacteria 1549
584 Ga0495622_0000006 3300046557 Bacteria 245799
585 Ga0495622_0000018 3300046557 Bacteria 173985
586 Ga0495622_0043841 3300046557 Bacteria 2079
587 Ga0495633_0000874 3300046558 Bacteria 26052
588 Ga0495633_0004611 3300046558 Bacteria 8684
589 Ga0495633_0042551 3300046558 Bacteria 2156
590 Ga0495667_0060110 3300046559 Bacteria 2493
591 Ga0495656_0014983 3300046615 Bacteria 2917
592 Ga0495656_0027094 3300046615 Bacteria 2287
593 Ga0495656_0032289 3300046615 Bacteria 2129
594 Ga0495656_0036650 3300046615 Bacteria 2021
595 Ga0495668_0000018 3300046616 Bacteria 417480
596 Ga0495668_0002062 3300046616 Bacteria 17425
597 Ga0495668_0005360 3300046616 Bacteria 8741
598 Ga0495668_0017295 3300046616 Bacteria 4184
599 Ga0495668_0044109 3300046616 Bacteria 2478
600 Ga0495634_0008052 3300046642 Bacteria 7866
601 Ga0495634_0010099 3300046642 Bacteria 6929
602 Ga0495634_0037461 3300046642 Bacteria 3313
603 Ga0495634_0069049 3300046642 Bacteria 2332
604 Ga0495634_0128589 3300046642 Bacteria 1616
605 Ga0495611_0001733 3300046648 Bacteria 10560
606 Ga0495611_0063534 3300046648 Bacteria 1680
607 Ga0495625_0042373 3300046660 Bacteria 3309
608 Ga0495625_0129856 3300046660 Bacteria 1708
609 Ga0495635_0011202 3300046663 Bacteria 6286
610 Ga0495635_0013616 3300046663 Bacteria 5692
611 Ga0495635_0021097 3300046663 Bacteria 4539
612 Ga0495635_0035456 3300046663 Bacteria 3458
613 Ga0495661_0000049 3300046665 Bacteria 144060
614 Ga0495661_0000053 3300046665 Bacteria 140234
615 Ga0495661_0003280 3300046665 Bacteria 12015
616 Ga0495661_0010540 3300046665 Bacteria 6302
617 Ga0495661_0012256 3300046665 Bacteria 5790
618 Ga0495661_0022956 3300046665 Bacteria 4055
619 Ga0495661_0026303 3300046665 Bacteria 3749
620 Ga0495661_0030771 3300046665 Bacteria 3414
621 Ga0495661_0033284 3300046665 Bacteria 3252
622 Ga0495661_0057564 3300046665 Bacteria 2320
623 Ga0495588_0000062 3300046674 Bacteria 253674
624 Ga0495588_0020368 3300046674 Bacteria 3259
625 Ga0495588_0035899 3300046674 Bacteria 2513
626 Ga0495657_0018615 3300046675 Bacteria 5021
627 Ga0495599_0002748 3300046678 Bacteria 10266
628 Ga0495599_0003298 3300046678 Bacteria 9417
629 Ga0495623_0003937 3300046679 Bacteria 9789
630 Ga0495623_0007395 3300046679 Bacteria 7130
631 Ga0495623_0008781 3300046679 Bacteria 6560
632 Ga0495623_0017834 3300046679 Bacteria 4585
633 Ga0495623_0019894 3300046679 Bacteria 4340
634 Ga0495646_0001647 3300046680 Bacteria 13330
635 Ga0495646_0003189 3300046680 Bacteria 10189
636 Ga0495646_0005124 3300046680 Bacteria 8266
637 Ga0495646_0070710 3300046680 Bacteria 2055
638 Ga0495669_0000157 3300046684 Bacteria 43325
639 Ga0495669_0001448 3300046684 Bacteria 9794
640 Ga0495669_0002071 3300046684 Bacteria 8216
641 Ga0495669_0007195 3300046684 Bacteria 4664
642 Ga0495613_0005190 3300046689 Bacteria 9780
643 Ga0495613_0071370 3300046689 Bacteria 2531
644 Ga0495624_0005097 3300046690 Bacteria 9495
645 Ga0495624_0006209 3300046690 Bacteria 8493
646 Ga0495624_0006488 3300046690 Bacteria 8297
647 Ga0495624_0007132 3300046690 Bacteria 7864
648 Ga0495624_0016699 3300046690 Bacteria 4941
649 Ga0495624_0022724 3300046690 Bacteria 4139
650 Ga0495624_0036015 3300046690 Bacteria 3192
651 Ga0495670_0045979 3300046691 Bacteria 2180
652 Ga0495649_0000071 3300046694 Bacteria 89386
653 Ga0495649_0000283 3300046694 Bacteria 44818
654 Ga0495649_0000465 3300046694 Bacteria 34846
655 Ga0495649_0000496 3300046694 Bacteria 33713
656 Ga0495649_0002364 3300046694 Bacteria 13344
657 Ga0495649_0008289 3300046694 Bacteria 6257
658 Ga0495649_0018320 3300046694 Bacteria 3941
659 Ga0495649_0019509 3300046694 Bacteria 3809
660 Ga0495589_0000103 3300046794 Bacteria 81696
661 Ga0495589_0001477 3300046794 Bacteria 13524
662 Ga0495589_0002349 3300046794 Bacteria 10618
663 Ga0495589_0004136 3300046794 Bacteria 7763
664 Ga0495589_0011582 3300046794 Bacteria 4579
665 Ga0495589_0017606 3300046794 Bacteria 3666
666 Ga0495589_0025749 3300046794 Bacteria 2983
667 Ga0495589_0042656 3300046794 Bacteria 2260
668 Ga0495589_0053329 3300046794 Bacteria 1996
669 Ga0495600_0001801 3300046809 Bacteria 11985
670 Ga0495600_0001987 3300046809 Bacteria 11489
671 Ga0495600_0004945 3300046809 Bacteria 8006
672 Ga0495600_0105546 3300046809 Bacteria 1835
673 Ga0495660_0000057 3300046810 Bacteria 133310
674 Ga0495660_0001412 3300046810 Bacteria 16457
675 Ga0495660_0003177 3300046810 Bacteria 10225
676 Ga0495660_0010951 3300046810 Bacteria 5271
677 Ga0495581_0000771 3300047315 Bacteria 16987
678 Ga0495581_0000959 3300047315 Bacteria 15501
679 Ga0495581_0001239 3300047315 Bacteria 14042
680 Ga0495604_0000860 3300047317 Bacteria 25329
681 Ga0495604_0002237 3300047317 Bacteria 15504
682 Ga0495604_0018061 3300047317 Bacteria 5644
683 Ga0495604_0021063 3300047317 Bacteria 5202
684 Ga0495604_0054945 3300047317 Bacteria 3070
685 Ga0495604_0060906 3300047317 Bacteria 2889
686 Ga0495604_0068196 3300047317 Bacteria 2700
687 Ga0495674_0004658 3300047319 Bacteria 13185
688 Ga0495674_0005289 3300047319 Bacteria 12379
689 Ga0495674_0014260 3300047319 Bacteria 7442
690 Ga0495674_0017782 3300047319 Bacteria 6620
691 Ga0495674_0082328 3300047319 Bacteria 2759
692 Ga0495674_0196192 3300047319 Bacteria 1676
693 Ga0495672_0000033 3300047320 Bacteria 291992
694 Ga0495672_0000078 3300047320 Bacteria 164474
695 Ga0495672_0001165 3300047320 Bacteria 26623
696 Ga0495672_0002211 3300047320 Bacteria 18128
697 Ga0495672_0016324 3300047320 Bacteria 5008
698 Ga0495672_0071231 3300047320 Bacteria 1968
699 Ga0495676_0010858 3300047321 Bacteria 8238
700 Ga0495676_0096081 3300047321 Bacteria 2204
701 Ga0495676_0114563 3300047321 Bacteria 1972
702 Ga0495680_0009339 3300047322 Bacteria 8830
703 Ga0495680_0036606 3300047322 Bacteria 3939
704 Ga0495680_0105057 3300047322 Bacteria 2100
705 Ga0495680_0132264 3300047322 Bacteria 1832
706 Ga0495683_0000168 3300047323 Bacteria 63828
707 Ga0495683_0002012 3300047323 Bacteria 12617
708 Ga0495683_0006526 3300047323 Bacteria 6372
709 Ga0495683_0016692 3300047323 Bacteria 3810
710 Ga0495683_0022551 3300047323 Bacteria 3237
711 Ga0495683_0022922 3300047323 Bacteria 3210
712 Ga0495683_0026064 3300047323 Bacteria 2992
713 Ga0495687_000019 3300047443 Bacteria 341756
714 Ga0495687_000021 3300047443 Bacteria 334681
715 Ga0495687_000036 3300047443 Bacteria 255427
716 Ga0495687_000740 3300047443 Bacteria 35582
717 Ga0495687_001452 3300047443 Bacteria 21757
718 Ga0495687_005545 3300047443 Bacteria 8004
719 Ga0495687_055706 3300047443 Bacteria 1652
720 Ga0495675_0001858 3300047444 Bacteria 12573
721 Ga0495675_0010651 3300047444 Bacteria 5750
722 Ga0495675_0033325 3300047444 Bacteria 3288
723 Ga0495677_0000009 3300047445 Bacteria 170927
724 Ga0495677_0000242 3300047445 Bacteria 24158
725 Ga0495677_0011525 3300047445 Bacteria 3233
726 Ga0495677_0016713 3300047445 Bacteria 2661
727 Ga0495677_0052506 3300047445 Bacteria 1502
728 Ga0495679_000006 3300047446 Bacteria 449956
729 Ga0495679_000975 3300047446 Bacteria 17664
730 Ga0495679_004533 3300047446 Bacteria 6371
731 Ga0495685_000553 3300047447 Bacteria 11583
732 Ga0495673_0016978 3300047469 Bacteria 3708
733 Ga0495673_0017267 3300047469 Bacteria 3670
734 Ga0495673_0035925 3300047469 Bacteria 2278
735 Ga0495681_0010716 3300047470 Bacteria 5526
736 Ga0495681_0041389 3300047470 Bacteria 2237
737 Ga0495681_0048302 3300047470 Bacteria 2018
738 Ga0495686_0000407 3300047472 Bacteria 68110
739 Ga0495686_0052240 3300047472 Bacteria 2563
740 Ga0495593_0000758 3300047673 Bacteria 18721
741 Ga0495593_0004348 3300047673 Bacteria 8431
742 Ga0495593_0020592 3300047673 Bacteria 3693
743 Ga0495593_0045292 3300047673 Bacteria 2348
744 Ga0495602_0001303 3300048088 Bacteria 24603
745 Ga0495602_0015792 3300048088 Bacteria 7605
746 Ga0495602_0018800 3300048088 Bacteria 6884
747 Ga0495602_0064879 3300048088 Bacteria 3154
748 Ga0495602_0066803 3300048088 Bacteria 3096
749 Ga0495602_0102446 3300048088 Bacteria 2346
750 Ga0495614_0000224 3300048089 Bacteria 22077
751 Ga0495614_0005369 3300048089 Bacteria 5781
752 Ga0495614_0006411 3300048089 Bacteria 5282
753 Ga0495615_0000185 3300048090 Bacteria 15261
754 Ga0495626_0000038 3300048091 Bacteria 175936
755 Ga0495626_0002361 3300048091 Bacteria 13240
756 Ga0495626_0002442 3300048091 Bacteria 12899
757 Ga0495626_0004231 3300048091 Bacteria 8877
758 Ga0495626_0004742 3300048091 Bacteria 8219
759 Ga0495626_0012827 3300048091 Bacteria 4375
760 Ga0495626_0021752 3300048091 Bacteria 3176
761 Ga0495626_0026200 3300048091 Bacteria 2844
762 Ga0495626_0028271 3300048091 Bacteria 2720
763 Ga0495626_0029195 3300048091 Bacteria 2670
764 Ga0495626_0033003 3300048091 Bacteria 2482
765 Ga0495626_0070493 3300048091 Bacteria 1572
766 Ga0496100_0000094 3300048903 Bacteria 50690
767 Ga0496100_0003268 3300048903 Bacteria 8421
768 Ga0496100_0030967 3300048903 Bacteria 3322
769 Ga0496100_0032647 3300048903 Bacteria 3249
770 Ga0496101_0000181 3300048904 Bacteria 50837
771 Ga0496101_0002769 3300048904 Bacteria 10749
772 Ga0496101_0011151 3300048904 Bacteria 5955
773 Ga0496101_0048810 3300048904 Bacteria 3043
774 Ga0496102_0000397 3300048905 Bacteria 50794
775 Ga0496103_0000361 3300048906 Bacteria 41064
776 Ga0496103_0002066 3300048906 Bacteria 12846
777 Ga0496104_0012096 3300048907 Bacteria 7747
778 Ga0496104_0046174 3300048907 Bacteria 4100
779 Ga0496104_0115410 3300048907 Bacteria 2576
780 Ga0496105_0010331 3300048908 Bacteria 7340
781 Ga0496105_0026467 3300048908 Bacteria 4731
782 Ga0496105_0029959 3300048908 Bacteria 4456
783 Ga0496107_0078468 3300048910 Bacteria 2406
784 Ga0496107_0086338 3300048910 Bacteria 2290
785 Ga0496108_0045993 3300048911 Bacteria 3645
786 Ga0496109_0025462 3300048912 Bacteria 5273
787 Ga0496110_0030550 3300048913 Bacteria 4645
788 Ga0496110_0042559 3300048913 Bacteria 3964
789 Ga0496111_0013862 3300048914 Bacteria 5498
790 Ga0496111_0038872 3300048914 Bacteria 3409
791 Ga0496112_0004476 3300048915 Bacteria 11852
792 Ga0496112_0010228 3300048915 Bacteria 8505
793 Ga0496112_0092935 3300048915 Bacteria 2986
794 Ga0496113_0000770 3300048916 Bacteria 16519
795 Ga0496113_0013419 3300048916 Bacteria 5551
796 Ga0496113_0102214 3300048916 Bacteria 2222
797 Ga0496114_0007422 3300048917 Bacteria 8667
798 Ga0496116_0012411 3300048919 Bacteria 6963
799 Ga0496116_0092800 3300048919 Bacteria 1830
800 Ga0496117_0000210 3300048920 Bacteria 112808
801 Ga0496117_0000454 3300048920 Bacteria 68282
802 Ga0496117_0036767 3300048920 Bacteria 3659
803 Ga0496117_0037985 3300048920 Bacteria 3579
804 Ga0496118_0000788 3300048921 Bacteria 50781
805 Ga0496118_0008718 3300048921 Bacteria 10420
806 Ga0496118_0038323 3300048921 Bacteria 3844
807 Ga0496121_0000457 3300048924 Bacteria 80467
808 Ga0496121_0008889 3300048924 Bacteria 11678
809 Ga0496121_0012700 3300048924 Bacteria 9138
810 Ga0496121_0021494 3300048924 Bacteria 6317
811 Ga0496121_0023477 3300048924 Bacteria 5938
812 Ga0496122_0001753 3300048925 Bacteria 33345
813 Ga0496122_0019617 3300048925 Bacteria 6165
814 Ga0496123_0001273 3300048926 Bacteria 36130
815 Ga0496123_0003705 3300048926 Bacteria 16808
816 Ga0496123_0130405 3300048926 Bacteria 1394
817 Ga0496124_0005065 3300048927 Bacteria 15036
818 Ga0496124_0068102 3300048927 Bacteria 2960
819 Ga0496124_0069217 3300048927 Bacteria 2930
820 Ga0496124_0137513 3300048927 Bacteria 1932
821 Ga0496125_0004347 3300048928 Bacteria 16436
822 Ga0496125_0023523 3300048928 Bacteria 5685
823 Ga0496125_0074761 3300048928 Bacteria 2626
824 Ga0496126_0004490 3300048929 Bacteria 16643
825 Ga0496126_0007857 3300048929 Bacteria 11616
826 Ga0496126_0022739 3300048929 Bacteria 6090
827 Ga0496126_0072233 3300048929 Bacteria 3070
828 Ga0496126_0109122 3300048929 Bacteria 2412
829 Ga0495678_000024 3300049459 Bacteria 229034
830 Ga0495678_000061 3300049459 Bacteria 142649
831 Ga0495678_002401 3300049459 Bacteria 12781
832 Ga0495678_028831 3300049459 Bacteria 2337
833 Ga0495682_0000130 3300049460 Bacteria 65523
834 Ga0495682_0016023 3300049460 Bacteria 2836
835 Ga0495682_0017166 3300049460 Bacteria 2735
836 Ga0495682_0017393 3300049460 Bacteria 2714
837 Ga0501034_0000049 3300049571 Bacteria 213166
838 Ga0501047_0089024 3300049581 Bacteria 2964
839 Ga0501266_001158 3300049763 Bacteria 3382
840 Ga0500635_0000040 3300053080 Bacteria 91731
841 Ga0500572_004263 3300053111 Bacteria 3248
842 Ga0500559_0017828 3300053136 Bacteria 3002
843 Ga0500636_0024953 3300053177 Bacteria 3533
844 Ga0501084_0015006 3300054114 Bacteria 6423
845 Ga0500661_006759 3300055283 Bacteria 2134
846 Ga0466962_0001546 3300061719 Bacteria 10747
847 Ga0466962_0028904 3300061719 Bacteria 2655
848 Ga0466962_0033663 3300061719 Bacteria 2452
849 2501077496 2501025502 Bacteria 9641094
850 2509131867 2508501125 Bacteria 7208311
851 2510247773 2510065045 Bacteria 7761063
852 2511088924 2510917013 Bacteria 9951648
853 2512350115 2512047030 Bacteria 9031815
854 2513557610 2513237082 Bacteria 8640282
855 2513565663 2513237083 Bacteria 8410967
856 2513963593 2513237151 Bacteria 6309801
857 2514053048 2513237166 Bacteria 10373764
858 2514053459 2513237166 Bacteria 10373764
859 2515682095 2515154122 Bacteria 8609520
860 2515689757 2515154123 Bacteria 6387382
861 2516025258 2515154189 Bacteria 9629850
862 2519460685 2519103095 Bacteria 6629912
863 2521556665 2521172590 Bacteria 5047645
864 2527080245 2526164713 Bacteria 6780608
865 2563063661 2562617112 Bacteria 10918404
866 2563063857 2562617112 Bacteria 10918404
867 2585293139 2582581311 Bacteria 6763856
868 2599100819 2597490356 Bacteria 7030811
869 2599740362 2599185239 Bacteria 8686614
870 2599748998 2599185240 Bacteria 7968121
871 2600211055 2599185355 Bacteria 7968906
872 2600811665 2600255067 Bacteria 6795583
873 2643798777 2643221556 Bacteria 7251154
874 2644222255 2643221639 Bacteria 6649903
875 2644258140 2643221646 Bacteria 6433402
876 2644471128 2643221684 Bacteria 7145183
877 2676747204 2675903129 Bacteria 7964495
878 2713474544 2711768613 Bacteria 11048459
879 2713474752 2711768613 Bacteria 11048459
880 2719643795 2718217991 Bacteria 7829542
881 2722883079 2721755523 Bacteria 6430384
882 2738824239 2738541296 Bacteria 7285013
883 2738836648 2738541298 Bacteria 7286732
884 2738878179 2738541306 Bacteria 7284992
885 2739189871 2738543002 Bacteria 7284546
886 2739224773 2738543008 Bacteria 7282815
887 2746090415 2744054900 Bacteria 8399525
888 2746095855 2744054901 Bacteria 8397047
889 2753569397 2751185846 Bacteria 7242164
890 2792835304 2791355137 Bacteria 9654227
891 2792836729 2791355137 Bacteria 9654227
892 2808973899 2808606384 Bacteria 8474373
893 2809008659 2808606390 Bacteria 8476311
894 2809015835 2808606391 Bacteria 8308166
895 2809143252 2808606418 Bacteria 6724496
896 2817257561 2816332253 Bacteria 6764532
897 2817282035 2816332256 Bacteria 6891714
898 2817451504 2816332286 Bacteria 6853759
899 2819618028 2818991449 Bacteria 5518009
900 2819621406 2818991450 Bacteria 6962147
901 2819635368 2818991452 Bacteria 8442785
902 2839141443 2839138175 Bacteria 6549354
903 2842325459 2842324504 Bacteria 9364110
904 2842334809 2842333319 Bacteria 8899485
905 2842349738 2842348783 Bacteria 9002918
906 2842455025 2842454564 Bacteria 8730687
907 2848863981 2848858292 Bacteria 7391279
908 2856293374 2856287931 Bacteria 7223934
909 2857366758 2857357740 Bacteria 9937880
910 2863425182 2863421361 Bacteria 7300805
911 2870074151 2870068957 Bacteria 8925310
912 2885274443 2885270888 Bacteria 9831543
913 2900640142 2900634093 Bacteria 10263517
914 2902685507 2902682994 Bacteria 8951596
915 2904434844 2904434214 Bacteria 6230908
916 2904441955 2904439833 Bacteria 5931679
917 2904482826 2904479285 Bacteria 5073931
918 2904489205 2904483920 Bacteria 7545285
919 2904489318 2904483920 Bacteria 7545285
920 2904533252 2904530477 Bacteria 5876334
921 2904547059 2904541872 Bacteria 8915136
922 2904571586 2904564687 Bacteria 7609577
923 2904578642 2904571731 Bacteria 7608790
924 2904586200 2904584206 Bacteria 6028872
925 2904591987 2904589729 Bacteria 6113573
926 2904601851 2904601388 Bacteria 5884906
927 2904621205 2904615490 Bacteria 10047340
928 2904621350 2904615490 Bacteria 10047340
929 2919083822 2919079590 Bacteria 5946433
930 2919529819 2919527303 Bacteria 7718827
931 2919531686 2919527303 Bacteria 7718827
932 2921643598 2921643360 Bacteria 11448031
933 2921647620 2921643360 Bacteria 11448031
934 2928109081 2928108538 Bacteria 7360024
935 2928136304 2928135762 Bacteria 7259641
936 2928161034 2928157003 Bacteria 7522202
937 2928166030 2928163908 Bacteria 7561269
938 2928171041 2928170801 Bacteria 8785406
939 2928503914 2928503688 Bacteria 7268108
940 2928536525 2928536128 Bacteria 7657547
941 2929165595 2929160207 Bacteria 9075316
942 2932422649 2932422444 Bacteria 4678430
943 2945938289 2945934425 Bacteria 7444609
944 2981991293 2981990288 Bacteria 7590678
945 2990703903 2990703756 Bacteria 7715990
946 2990708288 2990703756 Bacteria 7715990
947 639787698 639633007 Bacteria 4376040
948 642423421 641736151 Bacteria 7477263
949 642413941 641736154 Bacteria 7689995
950 642595568 642555112 Bacteria 8676562
951 642598626 642555112 Bacteria 8676562
952 642617161 642555113 Bacteria 8214658
953 8003961139 8003955200 Bacteria 8601927
954 8018849166 8018845410 Bacteria 8933938
955 8020811170 8020807995 Bacteria 6801506
956 8020943722 8020938398 Bacteria 7472757
957 8020950057 8020945358 Bacteria 8467355
958 8020953775 8020953355 Bacteria 7439080
959 8021123213 8021120328 Bacteria 8782274
960 8039103022 8039098773 Bacteria 6602928
961 8040168277 8040167225 Bacteria 6542727
962 8040175937 8040173305 Bacteria 6827067
963 8047678333 8047673197 Bacteria 7395230
964 8054007492 8054002106 Bacteria 7987183
965 8055272623 8055266321 Bacteria 7999742
966 8055303844 8055301274 Bacteria 8587385
967 Ga0495585_0000211
968 JGI24740J21852_10001309
969 JGI24739J22299_10001079
970 JGI24739J22299_10001779
971 JGI24739J22299_10005316
972 JGI24739J22299_10007027
973 JGI24735J21928_10001507
974 JGI24735J21928_10003601
975 JGI24735J21928_10003905
976 JGI24735J21928_10007512
977 JGI24735J21928_10015154
978 JGI24738J21930_10011891
979 JGI25156J39149_1000137
980 JGI25156J39149_1000236
981 JGI25156J39149_1000642
982 JGI25156J39149_1001363
983 JGI25156J39149_1002647
984 JGI25154J39366_1000106
985 JGI25157J39369_1000154
986 JGI25151J46595_10005982
987 JGI25151J46595_10034388
988 JGI25165J46597_1000939
989 JGI25165J46597_1001941
990 rootH1_10000900
991 rootH1_10017467
992 rootH1_10043777
993 rootH2_10009909
994 rootL2_10009014
995 rootH1_10033602
996 rootH1_10050263
997 rootH1_10111356
998 JGI25160J50197_1000025
999 JGI25160J50197_1000101
1000 Ga0055539_1000197
1001 Ga0055539_1000488
1002 Ga0055533_1000040
1003 Ga0055533_1000159
1004 Ga0055533_1000611
1005 Ga0055532_1000014
1006 Ga0055532_1000140
1007 Ga0055532_1002026
1008 Ga0055525_1000745
1009 Ga0055527_1000013
1010 Ga0055527_1000089
1011 Ga0055527_1000280
1012 Ga0055535_1000011
1013 Ga0055535_1000164
1014 Ga0055535_1000591
1015 Ga0055535_1002021
1016 Ga0055542_1000018
1017 Ga0055542_1000208
1018 Ga0055542_1001740
1019 Ga0055542_1002922
1020 Ga0055529_1000017
1021 Ga0055529_1000053
1022 Ga0055529_1000227
1023 Ga0055529_1000978
1024 Ga0055526_1000105
1025 Ga0055528_1003527
1026 Ga0055530_10000614
1027 Ga0055530_10001720
1028 Ga0055530_10020189
1029 Ga0055540_1000014
1030 Ga0055540_1005240
1031 Ga0055531_10003071
1032 Ga0055531_10005969
1033 Ga0058692_1004472
1034 Ga0065165_1000173
1035 Ga0065165_1000188
1036 Ga0065165_1001702
1037 Ga0070658_10010287
1038 Ga0070682_100012280
1039 Ga0070660_100000159
1040 Ga0070660_100000637
1041 Ga0070660_100002295
1042 Ga0070661_100081238
1043 Ga0070659_100000223
1044 Ga0070659_100096166
1045 Ga0070714_100010374
1046 Ga0070713_100001762
1047 Ga0070711_100019644
1048 Ga0070708_100149747
1049 Ga0070663_100001049
1050 Ga0070663_100032949
1051 Ga0068853_100028416
1052 Ga0068855_100022088
1053 Ga0068855_100028363
1054 Ga0070664_100081794
1055 Ga0068857_100223918
1056 Ga0068854_100004290
1057 Ga0068856_100022922
1058 Ga0068856_100205354
1059 Ga0068866_10050504
1060 Ga0075366_10009886
1061 Ga0075366_10090319
1062 Ga0075370_10041483
1063 Ga0068865_100156038
1064 Ga0079104_1000013
1065 Ga0079104_1000724
1066 Ga0105251_10000335
1067 Ga0105251_10000589
1068 Ga0105240_10001196
1069 Ga0105240_10012745
1070 Ga0105240_10013343
1071 Ga0105240_10024279
1072 Ga0105240_10042007
1073 Ga0105240_10057300
1074 Ga0105240_10091306
1075 Ga0105240_10093220
1076 Ga0105240_10110662
1077 Ga0105247_10080443
1078 Ga0105243_10004635
1079 Ga0105241_10035913
1080 Ga0105241_10038664
1081 Ga0105237_10000645
1082 Ga0105237_10006307
1083 Ga0105237_10024649
1084 Ga0105237_10065380
1085 Ga0105237_10087124
1086 Ga0105237_10103770
1087 Ga0105237_10114049
1088 Ga0105237_10139007
1089 Ga0105238_10009283
1090 Ga0105238_10111614
1091 Ga0105238_10241617
1092 Ga0105239_10000572
1093 Ga0105239_10007488
1094 Ga0105239_10017482
1095 Ga0105239_10101297
1096 Ga0105239_10120756
1097 Ga0105246_10087739
1098 Ga0157373_10014530
1099 Ga0157370_10003565
1100 Ga0157370_10014525
1101 Ga0157370_10059821
1102 Ga0157369_10006615
1103 Ga0157369_10030856
1104 Ga0157374_10000081
1105 Ga0157374_10000834
1106 Ga0157372_10011733
1107 Ga0157372_10020789
1108 Ga0157375_10002531
1109 Ga0157375_10379723
1110 Ga0163163_10059963
1111 Ga0182008_10009819
1112 Ga0182008_10039610
1113 Ga0182006_1002702
1114 Ga0182007_10001639
1115 Ga0182007_10005892
1116 Ga0182005_1004230
1117 Ga0183361_10003
1118 Ga0163161_10080887
1119 Ga0213872_10000134
1120 Ga0213872_10037606
1121 Ga0213876_10000312
1122 Ga0213875_10005957
1123 Ga0209566_100443
1124 Ga0209674_100020
1125 Ga0209674_100051
1126 Ga0209674_100066
1127 Ga0209674_101758
1128 Ga0209672_100012
1129 Ga0209672_100013
1130 Ga0209672_100027
1131 Ga0209672_100063
1132 Ga0209672_100708
1133 Ga0209147_100007
1134 Ga0209147_100013
1135 Ga0209147_100035
1136 Ga0209147_100077
1137 Ga0209147_100119
1138 Ga0209563_100129
1139 Ga0209563_100306
1140 Ga0209563_100645
1141 Ga0207427_100487
1142 Ga0207427_101027
1143 Ga0207427_103184
1144 Ga0209258_100014
1145 Ga0209258_100052
1146 Ga0209258_100074
1147 Ga0209258_100105
1148 Ga0209258_100328
1149 Ga0209646_1000127
1150 Ga0209026_1000004
1151 Ga0209677_100085
1152 Ga0209677_100157
1153 Ga0209148_1000020
1154 Ga0209148_1000064
1155 Ga0209148_1000107
1156 Ga0209148_1002924
1157 Ga0209148_1005329
1158 Ga0209759_1000015
1159 Ga0209759_1000028
1160 Ga0209759_1000129
1161 Ga0209759_1000279
1162 Ga0209759_1000315
1163 Ga0209759_1000521
1164 Ga0209759_1001009
1165 Ga0209759_1001226
1166 Ga0209233_1000073
1167 Ga0209233_1000294
1168 Ga0209565_1012923
1169 Ga0209455_1000017
1170 Ga0209455_1000057
1171 Ga0209455_1000066
1172 Ga0209455_1000100
1173 Ga0209455_1000138
1174 Ga0209673_1000101
1175 Ga0209673_1009213
1176 Ga0209130_1004958
1177 Ga0209025_1000115
1178 Ga0209025_1000286
1179 Ga0209564_1000007
1180 Ga0209564_1007435
1181 Ga0209564_1007842
1182 Ga0209050_1000142
1183 Ga0209050_1002975
1184 Ga0209256_1000130
1185 Ga0209256_1000840
1186 Ga0207426_1000020
1187 Ga0207426_1000056
1188 Ga0207426_1004594
1189 Ga0209051_1000035
1190 Ga0209051_1002864
1191 Ga0209051_1004454
1192 Ga0209051_1005258
1193 Ga0209051_1028996
1194 Ga0209257_1000494
1195 Ga0209257_1004031
1196 Ga0207696_1012173
1197 Ga0207713_1000948
1198 Ga0207713_1005024
1199 Ga0207713_1014454
1200 Ga0207692_10001173
1201 Ga0207647_10000553
1202 Ga0207647_10000738
1203 Ga0207647_10001254
1204 Ga0207647_10001656
1205 Ga0207647_10055174
1206 Ga0207699_10006667
1207 Ga0207705_10005147
1208 Ga0207705_10065196
1209 Ga0207695_10000368
1210 Ga0207695_10011940
1211 Ga0207695_10015690
1212 Ga0207695_10018460
1213 Ga0207695_10043331
1214 Ga0207695_10058194
1215 Ga0207695_10085995
1216 Ga0207695_10134338
1217 Ga0207671_10002474
1218 Ga0207671_10109891
1219 Ga0207671_10159391
1220 Ga0207663_10000327
1221 Ga0207657_10000442
1222 Ga0207657_10001219
1223 Ga0207657_10001423
1224 Ga0207694_10036318
1225 Ga0207694_10207052
1226 Ga0207700_10038443
1227 Ga0207664_10094268
1228 Ga0207690_10000037
1229 Ga0207706_10179484
1230 Ga0207709_10000172
1231 Ga0207665_10013914
1232 Ga0207667_10018107
1233 Ga0207667_10040261
1234 Ga0207667_10200826
1235 Ga0207658_10115035
1236 Ga0207658_10179778
1237 Ga0207639_10018607
1238 Ga0207639_10071183
1239 Ga0207678_10000317
1240 Ga0207678_10010832
1241 Ga0207702_10143469
1242 Ga0207674_10058378
1243 Ga0207683_10135673
1244 Ga0207683_10147985
1245 Ga0207698_10017622
1246 Ga0209281_1000020
1247 Ga0209281_1000076
1248 Ga0209371_1000080
1249 Ga0209371_1014775
1250 Ga0265337_1001439
1251 Ga0265326_10001380
1252 Ga0265334_10005260
1253 Ga0265318_10003474
1254 Ga0265323_10000992
1255 Ga0265322_10002589
1256 Ga0265336_10000003
1257 Ga0265336_10000063
1258 Ga0307515_10000737
1259 Ga0265338_10000154
1260 Ga0265324_10001590
1261 Ga0268256_1000160
1262 Ga0268256_1015142
1263 Ga0307511_10098629
1264 Ga0265339_10001335
1265 Ga0265327_10005550
1266 Ga0307513_10015012
1267 Ga0307408_100000029
1268 Ga0307514_10000408
1269 Ga0307514_10001033
1270 Ga0265314_10001952
1271 Ga0307516_10000424
1272 Ga0307412_10000002
1273 Ga0307416_100010306
1274 Ga0373934_0005435
1275 Ga0373939_0000469
1276 Ga0373960_0002278
1277 Ga0373943_0107883
1278 Ga0373962_0016516
1279 Ga0373927_0091434
1280 Ga0395899_0000005
1281 Ga0395900_0000003
1282 Ga0395900_0021389
1283 Ga0395900_0057494
1284 Ga0395898_0000003
1285 Ga0395898_0015437
1286 Ga0395898_0057172
1287 Ga0395898_0074039
1288 Ga0395905_0000004
1289 Ga0395905_0000009
1290 Ga0395905_0004257
1291 Ga0395905_0012101
1292 Ga0395905_0013595
1293 Ga0395905_0222404
1294 Ga0436364_0100220
1295 Ga0436364_0465200
1296 Ga0436364_0586291
1297 Ga0436364_0783389
1298 Ga0436364_0841842
1299 Ga0395901_0000009
1300 Ga0395901_0038206
1301 Ga0395901_0130414
1302 Ga0395901_0185873
1303 Ga0395901_0201249
1304 Ga0436365_0552641
1305 Ga0436365_0821809
1306 Ga0436365_1478189
1307 Ga0436360_0091417
1308 Ga0436360_0624080
1309 Ga0436361_0033961
1310 Ga0436361_0193139
1311 Ga0436361_0455065
1312 Ga0436361_1139408
1313 Ga0436363_0679974
1314 Ga0436362_0295156
1315 Ga0436362_1208322
1316 Ga0439448_0000025
1317 Ga0439448_0002656
1318 Ga0451577_0010994
1319 Ga0466969_0002900
1320 Ga0466969_0079966
1321 Ga0466972_0011461
1322 Ga0466965_0003466
1323 Ga0466965_0016314
1324 Ga0466966_0000037
1325 Ga0466966_0001374
1326 Ga0466966_0005943
1327 Ga0466961_0000258
1328 Ga0466961_0003537
1329 Ga0466961_0010435
1330 Ga0466961_0016999
1331 Ga0466961_0038448
1332 Ga0466963_0044011
1333 Ga0466964_0000407
1334 Ga0453684_0003874
1335 Ga0453684_0039960
1336 Ga0466971_0078563
1337 Ga0466968_0030835
1338 Ga0466957_0033487
1339 Ga0466959_0005077
1340 Ga0466959_0018695
1341 Ga0466959_0048665
1342 Ga0466959_0063890
1343 Ga0451576_0012383
1344 Ga0466958_0007398
1345 Ga0466958_0038355
1346 Ga0466958_0113524
1347 Ga0495592_0008740
1348 Ga0495592_0050462
1349 Ga0495603_0000430
1350 Ga0495603_0001760
1351 Ga0495603_0004181
1352 Ga0495603_0013805
1353 Ga0495603_0095291
1354 Ga0495590_0000013
1355 Ga0495590_0006335
1356 Ga0495590_0030841
1357 Ga0495591_000109
1358 Ga0495591_003119
1359 Ga0495629_0000027
1360 Ga0495629_0000184
1361 Ga0495629_0000262
1362 Ga0495629_0002023
1363 Ga0495629_0002885
1364 Ga0495629_0080644
1365 Ga0495629_0127476
1366 Ga0495629_0208369
1367 Ga0495638_0001152
1368 Ga0495638_0012125
1369 Ga0495641_0043944
1370 Ga0495651_0080184
1371 Ga0495653_0000323
1372 Ga0495653_0001078
1373 Ga0495653_0003556
1374 Ga0495653_0004636
1375 Ga0495653_0012355
1376 Ga0495653_0026186
1377 Ga0495653_0053932
1378 Ga0495653_0079310
1379 Ga0495653_0090892
1380 Ga0495650_0000001
1381 Ga0495650_0000155
1382 Ga0495650_0000322
1383 Ga0495650_0007783
1384 Ga0495650_0008029
1385 Ga0495650_0010335
1386 Ga0495650_0019378
1387 Ga0495580_0000464
1388 Ga0495580_0005399
1389 Ga0495580_0021677
1390 Ga0495580_0031660
1391 Ga0495580_0040928
1392 Ga0495580_0172731
1393 Ga0495582_0002757
1394 Ga0495582_0002869
1395 Ga0495582_0017483
1396 Ga0495582_0047889
1397 Ga0495605_0001158
1398 Ga0495605_0001269
1399 Ga0495605_0002220
1400 Ga0495605_0003943
1401 Ga0495605_0004941
1402 Ga0495605_0007402
1403 Ga0495605_0015189
1404 Ga0495605_0017678
1405 Ga0495605_0017952
1406 Ga0495605_0019289
1407 Ga0495605_0030728
1408 Ga0495605_0062388
1409 Ga0495639_0004351
1410 Ga0495662_0041700
1411 Ga0495662_0066486
1412 Ga0495664_0002960
1413 Ga0495664_0007286
1414 Ga0495584_0000026
1415 Ga0495584_0000029
1416 Ga0495584_0001869
1417 Ga0495584_0001997
1418 Ga0495584_0002177
1419 Ga0495584_0003468
1420 Ga0495585_0010743
1421 Ga0495585_0012655
1422 Ga0495585_0024534
1423 Ga0495596_0000173
1424 Ga0495596_0000355
1425 Ga0495596_0000604
1426 Ga0495596_0000786
1427 Ga0495596_0000991
1428 Ga0495596_0003689
1429 Ga0495596_0015195
1430 Ga0495596_0018761
1431 Ga0495596_0025063
1432 Ga0495607_0000215
1433 Ga0495607_0000316
1434 Ga0495607_0001536
1435 Ga0495607_0002120
1436 Ga0495583_0000011
1437 Ga0495583_0000040
1438 Ga0495583_0000296
1439 Ga0495583_0000378
1440 Ga0495583_0001070
1441 Ga0495583_0003300
1442 Ga0495583_0003830
1443 Ga0495583_0007163
1444 Ga0495583_0023731
1445 Ga0495606_0001789
1446 Ga0495606_0003521
1447 Ga0495606_0024866
1448 Ga0495606_0126188
1449 Ga0495608_0008753
1450 Ga0495608_0036947
1451 Ga0495608_0038012
1452 Ga0495610_0004903
1453 Ga0495610_0061606
1454 Ga0495616_0000012
1455 Ga0495616_0000282
1456 Ga0495616_0004739
1457 Ga0495616_0007303
1458 Ga0495616_0008091
1459 Ga0495616_0024106
1460 Ga0495616_0025566
1461 Ga0495616_0029447
1462 Ga0495616_0059686
1463 Ga0495618_0014796
1464 Ga0495618_0017556
1465 Ga0495628_0004051
1466 Ga0495628_0011994
1467 Ga0495628_0024722
1468 Ga0495628_0040382
1469 Ga0495628_0061116
1470 Ga0495628_0087335
1471 Ga0495628_0107157
1472 Ga0495630_0012035
1473 Ga0495630_0019324
1474 Ga0495631_0000737
1475 Ga0495631_0000861
1476 Ga0495631_0002653
1477 Ga0495631_0003830
1478 Ga0495631_0008115
1479 Ga0495631_0011388
1480 Ga0495631_0051344
1481 Ga0495632_0000012
1482 Ga0495632_0000367
1483 Ga0495632_0000530
1484 Ga0495632_0002018
1485 Ga0495632_0008241
1486 Ga0495632_0021529
1487 Ga0495637_0000008
1488 Ga0495643_0001945
1489 Ga0495643_0005793
1490 Ga0495643_0011088
1491 Ga0495643_0025217
1492 Ga0495643_0064765
1493 Ga0495644_0015669
1494 Ga0495644_0016327
1495 Ga0495644_0022233
1496 Ga0495648_0000648
1497 Ga0495648_0006040
1498 Ga0495648_0006664
1499 Ga0495648_0022004
1500 Ga0495648_0030675
1501 Ga0495648_0089876
1502 Ga0495663_0004271
1503 Ga0495666_0001260
1504 Ga0495666_0006755
1505 Ga0495666_0011241
1506 Ga0495666_0013933
1507 Ga0495666_0020985
1508 Ga0495642_0000091
1509 Ga0495642_0002541
1510 Ga0495642_0003697
1511 Ga0495642_0011402
1512 Ga0495642_0019504
1513 Ga0495642_0048943
1514 Ga0495652_0011870
1515 Ga0495652_0019974
1516 Ga0495652_0039650
1517 Ga0495652_0155766
1518 Ga0495652_0184361
1519 Ga0495654_0001482
1520 Ga0495654_0012346
1521 Ga0495665_0002053
1522 Ga0495665_0002164
1523 Ga0495665_0006614
1524 Ga0495665_0020962
1525 Ga0495665_0023187
1526 Ga0495640_0002090
1527 Ga0495640_0002685
1528 Ga0495640_0015535
1529 Ga0495586_0003135
1530 Ga0495586_0003172
1531 Ga0495586_0011394
1532 Ga0495586_0012543
1533 Ga0495587_0003273
1534 Ga0495587_0010841
1535 Ga0495587_0051630
1536 Ga0495587_0080803
1537 Ga0495609_0000001
1538 Ga0495609_0001492
1539 Ga0495609_0002530
1540 Ga0495609_0013249
1541 Ga0495597_0000560
1542 Ga0495597_0000911
1543 Ga0495597_0023439
1544 Ga0495597_0024676
1545 Ga0495645_0000102
1546 Ga0495645_0002579
1547 Ga0495645_0033652
1548 Ga0495645_0117294
1549 Ga0495645_0161474
1550 Ga0495622_0000006
1551 Ga0495622_0000018
1552 Ga0495622_0043841
1553 Ga0495633_0000874
1554 Ga0495633_0004611
1555 Ga0495633_0042551
1556 Ga0495667_0060110
1557 Ga0495656_0014983
1558 Ga0495656_0027094
1559 Ga0495656_0032289
1560 Ga0495656_0036650
1561 Ga0495668_0000018
1562 Ga0495668_0002062
1563 Ga0495668_0005360
1564 Ga0495668_0017295
1565 Ga0495668_0044109
1566 Ga0495634_0008052
1567 Ga0495634_0010099
1568 Ga0495634_0037461
1569 Ga0495634_0069049
1570 Ga0495634_0128589
1571 Ga0495611_0001733
1572 Ga0495611_0063534
1573 Ga0495625_0042373
1574 Ga0495625_0129856
1575 Ga0495635_0011202
1576 Ga0495635_0013616
1577 Ga0495635_0021097
1578 Ga0495635_0035456
1579 Ga0495661_0000049
1580 Ga0495661_0000053
1581 Ga0495661_0003280
1582 Ga0495661_0010540
1583 Ga0495661_0012256
1584 Ga0495661_0022956
1585 Ga0495661_0026303
1586 Ga0495661_0030771
1587 Ga0495661_0033284
1588 Ga0495661_0057564
1589 Ga0495588_0000062
1590 Ga0495588_0020368
1591 Ga0495588_0035899
1592 Ga0495657_0018615
1593 Ga0495599_0002748
1594 Ga0495599_0003298
1595 Ga0495623_0003937
1596 Ga0495623_0007395
1597 Ga0495623_0008781
1598 Ga0495623_0017834
1599 Ga0495623_0019894
1600 Ga0495646_0001647
1601 Ga0495646_0003189
1602 Ga0495646_0005124
1603 Ga0495646_0070710
1604 Ga0495669_0000157
1605 Ga0495669_0001448
1606 Ga0495669_0002071
1607 Ga0495669_0007195
1608 Ga0495613_0005190
1609 Ga0495613_0071370
1610 Ga0495624_0005097
1611 Ga0495624_0006209
1612 Ga0495624_0006488
1613 Ga0495624_0007132
1614 Ga0495624_0016699
1615 Ga0495624_0022724
1616 Ga0495624_0036015
1617 Ga0495670_0045979
1618 Ga0495649_0000071
1619 Ga0495649_0000283
1620 Ga0495649_0000465
1621 Ga0495649_0000496
1622 Ga0495649_0002364
1623 Ga0495649_0008289
1624 Ga0495649_0018320
1625 Ga0495649_0019509
1626 Ga0495589_0000103
1627 Ga0495589_0001477
1628 Ga0495589_0002349
1629 Ga0495589_0004136
1630 Ga0495589_0011582
1631 Ga0495589_0017606
1632 Ga0495589_0025749
1633 Ga0495589_0042656
1634 Ga0495589_0053329
1635 Ga0495600_0001801
1636 Ga0495600_0001987
1637 Ga0495600_0004945
1638 Ga0495600_0105546
1639 Ga0495660_0000057
1640 Ga0495660_0001412
1641 Ga0495660_0003177
1642 Ga0495660_0010951
1643 Ga0495581_0000771
1644 Ga0495581_0000959
1645 Ga0495581_0001239
1646 Ga0495604_0000860
1647 Ga0495604_0002237
1648 Ga0495604_0018061
1649 Ga0495604_0021063
1650 Ga0495604_0054945
1651 Ga0495604_0060906
1652 Ga0495604_0068196
1653 Ga0495674_0004658
1654 Ga0495674_0005289
1655 Ga0495674_0014260
1656 Ga0495674_0017782
1657 Ga0495674_0082328
1658 Ga0495674_0196192
1659 Ga0495672_0000033
1660 Ga0495672_0000078
1661 Ga0495672_0001165
1662 Ga0495672_0002211
1663 Ga0495672_0016324
1664 Ga0495672_0071231
1665 Ga0495676_0010858
1666 Ga0495676_0096081
1667 Ga0495676_0114563
1668 Ga0495680_0009339
1669 Ga0495680_0036606
1670 Ga0495680_0105057
1671 Ga0495680_0132264
1672 Ga0495683_0000168
1673 Ga0495683_0002012
1674 Ga0495683_0006526
1675 Ga0495683_0016692
1676 Ga0495683_0022551
1677 Ga0495683_0022922
1678 Ga0495683_0026064
1679 Ga0495687_000019
1680 Ga0495687_000021
1681 Ga0495687_000036
1682 Ga0495687_000740
1683 Ga0495687_001452
1684 Ga0495687_005545
1685 Ga0495687_055706
1686 Ga0495675_0001858
1687 Ga0495675_0010651
1688 Ga0495675_0033325
1689 Ga0495677_0000009
1690 Ga0495677_0000242
1691 Ga0495677_0011525
1692 Ga0495677_0016713
1693 Ga0495677_0052506
1694 Ga0495679_000006
1695 Ga0495679_000975
1696 Ga0495679_004533
1697 Ga0495685_000553
1698 Ga0495673_0016978
1699 Ga0495673_0017267
1700 Ga0495673_0035925
1701 Ga0495681_0010716
1702 Ga0495681_0041389
1703 Ga0495681_0048302
1704 Ga0495686_0000407
1705 Ga0495686_0052240
1706 Ga0495593_0000758
1707 Ga0495593_0004348
1708 Ga0495593_0020592
1709 Ga0495593_0045292
1710 Ga0495602_0001303
1711 Ga0495602_0015792
1712 Ga0495602_0018800
1713 Ga0495602_0064879
1714 Ga0495602_0066803
1715 Ga0495602_0102446
1716 Ga0495614_0000224
1717 Ga0495614_0005369
1718 Ga0495614_0006411
1719 Ga0495615_0000185
1720 Ga0495626_0000038
1721 Ga0495626_0002361
1722 Ga0495626_0002442
1723 Ga0495626_0004231
1724 Ga0495626_0004742
1725 Ga0495626_0012827
1726 Ga0495626_0021752
1727 Ga0495626_0026200
1728 Ga0495626_0028271
1729 Ga0495626_0029195
1730 Ga0495626_0033003
1731 Ga0495626_0070493
1732 Ga0496100_0000094
1733 Ga0496100_0003268
1734 Ga0496100_0030967
1735 Ga0496100_0032647
1736 Ga0496101_0000181
1737 Ga0496101_0002769
1738 Ga0496101_0011151
1739 Ga0496101_0048810
1740 Ga0496102_0000397
1741 Ga0496103_0000361
1742 Ga0496103_0002066
1743 Ga0496104_0012096
1744 Ga0496104_0046174
1745 Ga0496104_0115410
1746 Ga0496105_0010331
1747 Ga0496105_0026467
1748 Ga0496105_0029959
1749 Ga0496107_0078468
1750 Ga0496107_0086338
1751 Ga0496108_0045993
1752 Ga0496109_0025462
1753 Ga0496110_0030550
1754 Ga0496110_0042559
1755 Ga0496111_0013862
1756 Ga0496111_0038872
1757 Ga0496112_0004476
1758 Ga0496112_0010228
1759 Ga0496112_0092935
1760 Ga0496113_0000770
1761 Ga0496113_0013419
1762 Ga0496113_0102214
1763 Ga0496114_0007422
1764 Ga0496116_0012411
1765 Ga0496116_0092800
1766 Ga0496117_0000210
1767 Ga0496117_0000454
1768 Ga0496117_0036767
1769 Ga0496117_0037985
1770 Ga0496118_0000788
1771 Ga0496118_0008718
1772 Ga0496118_0038323
1773 Ga0496121_0000457
1774 Ga0496121_0008889
1775 Ga0496121_0012700
1776 Ga0496121_0021494
1777 Ga0496121_0023477
1778 Ga0496122_0001753
1779 Ga0496122_0019617
1780 Ga0496123_0001273
1781 Ga0496123_0003705
1782 Ga0496123_0130405
1783 Ga0496124_0005065
1784 Ga0496124_0068102
1785 Ga0496124_0069217
1786 Ga0496124_0137513
1787 Ga0496125_0004347
1788 Ga0496125_0023523
1789 Ga0496125_0074761
1790 Ga0496126_0004490
1791 Ga0496126_0007857
1792 Ga0496126_0022739
1793 Ga0496126_0072233
1794 Ga0496126_0109122
1795 Ga0495678_000024
1796 Ga0495678_000061
1797 Ga0495678_002401
1798 Ga0495678_028831
1799 Ga0495682_0000130
1800 Ga0495682_0016023
1801 Ga0495682_0017166
1802 Ga0495682_0017393
1803 Ga0501034_0000049
1804 Ga0501047_0089024
1805 Ga0501266_001158
1806 Ga0500635_0000040
1807 Ga0500572_004263
1808 Ga0500559_0017828
1809 Ga0500636_0024953
1810 Ga0501084_0015006
1811 Ga0500661_006759
1812 Ga0466962_0001546
1813 Ga0466962_0028904
1814 Ga0466962_0033663
1815 2501077496
1816 2509131867
1817 2510247773
1818 2511088924
1819 2512350115
1820 2513557610
1821 2513565663
1822 2513963593
1823 2514053048
1824 2514053459
1825 2515682095
1826 2515689757
1827 2516025258
1828 2519460685
1829 2521556665
1830 2527080245
1831 2563063661
1832 2563063857
1833 2585293139
1834 2599100819
1835 2599740362
1836 2599748998
1837 2600211055
1838 2600811665
1839 2643798777
1840 2644222255
1841 2644258140
1842 2644471128
1843 2676747204
1844 2713474544
1845 2713474752
1846 2719643795
1847 2722883079
1848 2738824239
1849 2738836648
1850 2738878179
1851 2739189871
1852 2739224773
1853 2746090415
1854 2746095855
1855 2753569397
1856 2792835304
1857 2792836729
1858 2808973899
1859 2809008659
1860 2809015835
1861 2809143252
1862 2817257561
1863 2817282035
1864 2817451504
1865 2819618028
1866 2819621406
1867 2819635368
1868 2839141443
1869 2842325459
1870 2842334809
1871 2842349738
1872 2842455025
1873 2848863981
1874 2856293374
1875 2857366758
1876 2863425182
1877 2870074151
1878 2885274443
1879 2900640142
1880 2902685507
1881 2904434844
1882 2904441955
1883 2904482826
1884 2904489205
1885 2904489318
1886 2904533252
1887 2904547059
1888 2904571586
1889 2904578642
1890 2904586200
1891 2904591987
1892 2904601851
1893 2904621205
1894 2904621350
1895 2919083822
1896 2919529819
1897 2919531686
1898 2921643598
1899 2921647620
1900 2928109081
1901 2928136304
1902 2928161034
1903 2928166030
1904 2928171041
1905 2928503914
1906 2928536525
1907 2929165595
1908 2932422649
1909 2945938289
1910 2981991293
1911 2990703903
1912 2990708288
1913 639787698
1914 642423421
1915 642413941
1916 642595568
1917 642598626
1918 642617161
1919 8003961139
1920 8018849166
1921 8020811170
1922 8020943722
1923 8020950057
1924 8020953775
1925 8021123213
1926 8039103022
1927 8040168277
1928 8040175937
1929 8047678333
1930 8054007492
1931 8055272623
1932 8055303844

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

39

317

0.87

PF07690

MFS_1

Major Facilitator Superfamily

273

497

0.86

PF00083

Sugar_tr

Sugar (and other) transporter

36

312

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.9026 23 431
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.9005 26 432
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.9004 23 432
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.8992 23 432
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8913 26 432
ID Description Score Start End Superfamily
af_P77589_11_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9595 21 205 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9537 26 201 1.20.1250.20
af_Q59WF2_48_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9509 21 200 1.20.1250.20
af_Q09752_36_273_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9504 29 200 1.20.1250.20
af_A0A0R0F726_79_268_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9503 20 202 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4D4MNS1-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9577 22 157 GO:0016020
GO:0022857
GO:0046677
AF-A0A2V9RJV5-F1-model_v4 MFS transporter 0.9575 32 193 GO:0016020
GO:0022857
AF-A0A066W0G0-F1-model_v4 deleted 0.95 21 200
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9489 31 167 GO:0005886
GO:0022857
AF-A0A1Q8QWG6-F1-model_v4 Sialic acid transporter (Permease) NanT 0.9467 21 210 GO:0005886
GO:0046943

Map