F487015

General Info

Members Datasets Scaffolds Average Seq Length
967 472 1934 312

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100556001|Ga0070665_1005560011
Length 291
Sequence MTSLDLRGLNPAPITPFTRDGAVDYDAIQRLGSWLGSIDGVKSLTVLGHAGEGTFLTQDEQVRVIGAFKESVDGKLPIGASAGLVYPSHGWLRFGYQDGAPQDRYRALHEGSGLPLILFQYPDVTKATYNLDTQLEIAAQDGVFATKNGVRNMRRWDREIPVLRKENPDLQILSCHDEYLLHTMFDVDGLLVGYGGLAPEPLVELIAAGKARDYPAARALHDRLLPVTATVYHRGSHMEGTVALKEGLVHRGILEHATVRSPLLPLAPGAHEEIAAALDSAGLGSVVPALV

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
182 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
230 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
233 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
234 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
238 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
239 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
240 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
241 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
242 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
243 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
244 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
245 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
246 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
247 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
248 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
249 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
252 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
253 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
254 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
255 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
350 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
366 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
367 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
368 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
369 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
379 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
380 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
387 2508501050 Microvirga lupini Lut6 Isolate Nodule
388 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
389 2511231022 Pseudomonas sp. GM79 Isolate Nodule
390 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
391 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
392 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
393 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
394 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
395 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
396 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
397 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
398 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
399 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
400 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
401 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
402 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
403 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
404 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
405 2636415599 Klebsiella variicola DX120E Isolate Unclassified
406 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
407 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
408 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
409 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
410 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
411 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
412 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
413 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
414 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
415 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
416 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
417 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
418 2775507074 Klebsiella sp. D5A Isolate Unclassified
419 2791355267 Rhizobium sp. L18 Isolate Nodule
420 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
421 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
422 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
423 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
424 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
425 2818991452 Burkholderia cepacia 561 Isolate Unclassified
426 2818991457 Xanthomonas translucens 569 Isolate Unclassified
427 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
428 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
429 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
430 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
431 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
432 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
433 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
434 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
435 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
436 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
437 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
438 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
439 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
440 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
441 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
442 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
443 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
444 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
445 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
446 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
447 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
448 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
449 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
450 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
451 2928170801 Burkholderia sp. 572 Isolate Unclassified
452 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
453 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
454 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
455 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
456 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
457 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
458 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
459 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
460 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
461 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
462 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
463 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
464 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
465 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
466 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
467 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
468 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
469 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
470 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
471 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
472 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.83
Metatranscriptomes 2.28
Isolates 8.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 6.72
Nodule 1.24
Rhizoplane 6.31
Rhizosphere 74.25
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100556001 3300005548 Bacteria 1160
2 SwRhRL2b_contig_1024214 2162886007 Bacteria 6871
3 SwRhRL2b_contig_1448349 2162886007 Bacteria 21841
4 SwRhRL2b_contig_1845099 2162886007 Bacteria 4827
5 SwRhRL2b_contig_2237776 2162886007 Bacteria 72079
6 SwRhRL2b_contig_42532 2162886007 Bacteria 5384
7 JGI24739J22299_10000367 3300001989 Bacteria 15471
8 JGI24034J26672_10004338 3300002239 Bacteria 2006
9 JGI24751J29686_10007770 3300002459 Bacteria 2191
10 JGI25156J39149_1000365 3300002705 Bacteria 29267
11 JGI25406J46586_10017074 3300003203 Bacteria 3007
12 JGI25153J46596_10000751 3300003215 Bacteria 19822
13 rootL2_10000529 3300003322 Bacteria 63830
14 rootH1_10012306 3300003323 Bacteria 24318
15 Ga0055533_1000469 3300003756 Bacteria 15224
16 Ga0055532_1000577 3300003758 Bacteria 15091
17 Ga0055527_1000866 3300003760 Bacteria 7868
18 Ga0055535_1001178 3300003761 Bacteria 15112
19 Ga0055535_1011754 3300003761 Bacteria 1367
20 Ga0055542_1001170 3300003762 Bacteria 15112
21 Ga0055529_1000817 3300003763 Bacteria 18688
22 Ga0055524_1007666 3300003775 Bacteria 4561
23 Ga0055528_1003975 3300003790 Bacteria 7237
24 Ga0055528_1012987 3300003790 Eukaryota 3193
25 Ga0055528_1016714 3300003790 Bacteria 2579
26 Ga0055540_1000571 3300003792 Bacteria 27072
27 Ga0055531_10008799 3300003794 Bacteria 5260
28 Ga0058692_1000014 3300003856 Bacteria 313984
29 Ga0058692_1000028 3300003856 Bacteria 193757
30 Ga0058860_11916293 3300004801 Bacteria 1742
31 Ga0065703_1000280 3300005272 Bacteria 23631
32 Ga0065714_10002420 3300005288 Bacteria 27261
33 Ga0065704_10000243 3300005289 Bacteria 54713
34 Ga0065704_10000696 3300005289 Bacteria 13952
35 Ga0065704_10070144 3300005289 Bacteria 333223
36 Ga0065704_10070434 3300005289 Bacteria 25013
37 Ga0065704_10070457 3300005289 Bacteria 24058
38 Ga0070658_10015399 3300005327 Bacteria 6120
39 Ga0070670_100011500 3300005331 Bacteria 7571
40 Ga0070670_100019120 3300005331 Bacteria 5874
41 Ga0070670_100021935 3300005331 Bacteria 5494
42 Ga0070670_100074262 3300005331 Bacteria 2921
43 Ga0070670_100113107 3300005331 Bacteria 2340
44 Ga0070670_100117294 3300005331 Bacteria 2296
45 Ga0070670_100175692 3300005331 Bacteria 1859
46 Ga0068869_100174439 3300005334 Bacteria 1681
47 Ga0070682_100074703 3300005337 Bacteria 2177
48 Ga0068868_100022641 3300005338 Bacteria 4746
49 Ga0068868_100320528 3300005338 Bacteria 1320
50 Ga0070689_100015734 3300005340 Bacteria 5524
51 Ga0070689_100211342 3300005340 Bacteria 1588
52 Ga0070661_100127517 3300005344 Bacteria 1910
53 Ga0070692_10123958 3300005345 Bacteria 1444
54 Ga0070668_100004095 3300005347 Bacteria 10797
55 Ga0070668_100013153 3300005347 Bacteria 6169
56 Ga0070668_100014523 3300005347 Bacteria 5886
57 Ga0070668_100017328 3300005347 Bacteria 5394
58 Ga0070668_100017619 3300005347 Bacteria 5356
59 Ga0070668_100046278 3300005347 Bacteria 3340
60 Ga0070668_100062129 3300005347 Bacteria 2893
61 Ga0070668_100109911 3300005347 Bacteria 2193
62 Ga0070669_100000198 3300005353 Bacteria 52322
63 Ga0070669_100008875 3300005353 Bacteria 7170
64 Ga0070669_100010205 3300005353 Bacteria 6673
65 Ga0070669_100010538 3300005353 Bacteria 6564
66 Ga0070669_100020177 3300005353 Bacteria 4759
67 Ga0070669_100031025 3300005353 Bacteria 3859
68 Ga0070669_100137244 3300005353 Bacteria 1882
69 Ga0070669_100353720 3300005353 Bacteria 1193
70 Ga0070675_100035183 3300005354 Bacteria 4068
71 Ga0070675_100074071 3300005354 Bacteria 2828
72 Ga0070671_100000044 3300005355 Bacteria 86204
73 Ga0070671_100001152 3300005355 Bacteria 19660
74 Ga0070671_100014900 3300005355 Bacteria 6281
75 Ga0070671_100023842 3300005355 Bacteria 5008
76 Ga0070671_100053822 3300005355 Bacteria 3345
77 Ga0070673_100014750 3300005364 Bacteria 5460
78 Ga0070673_100108118 3300005364 Bacteria 2302
79 Ga0070667_100000485 3300005367 Bacteria 40311
80 Ga0070667_100004482 3300005367 Bacteria 11779
81 Ga0070709_10448100 3300005434 Bacteria 972
82 Ga0070713_100000289 3300005436 Bacteria 33226
83 Ga0070713_100072441 3300005436 Bacteria 2914
84 Ga0070713_100075934 3300005436 Bacteria 2852
85 Ga0070710_10027841 3300005437 Bacteria 3018
86 Ga0070711_100056576 3300005439 Bacteria 2713
87 Ga0070711_100058341 3300005439 Bacteria 2676
88 Ga0070711_100064195 3300005439 Bacteria 2565
89 Ga0070708_100066790 3300005445 Bacteria 3228
90 Ga0070663_100028759 3300005455 Bacteria 3788
91 Ga0070663_100100255 3300005455 Bacteria 2160
92 Ga0070663_100185400 3300005455 Bacteria 1617
93 Ga0070662_100128344 3300005457 Eukaryota 1952
94 Ga0070662_100198505 3300005457 Bacteria 1590
95 Ga0068867_100026629 3300005459 Bacteria 4153
96 Ga0070685_10072180 3300005466 Bacteria 2048
97 Ga0070685_10174814 3300005466 Bacteria 1378
98 Ga0070706_100025076 3300005467 Bacteria 5488
99 Ga0070699_100053313 3300005518 Bacteria 3500
100 Ga0070672_100036248 3300005543 Bacteria 3757
101 Ga0070672_100059975 3300005543 Bacteria 2995
102 Ga0070693_100119230 3300005547 Bacteria 1634
103 Ga0070665_100000878 3300005548 Bacteria 38691
104 Ga0070665_100003594 3300005548 Bacteria 16417
105 Ga0070665_100034401 3300005548 Bacteria 5096
106 Ga0070665_100097495 3300005548 Bacteria 2945
107 Ga0070665_100141383 3300005548 Bacteria 2410
108 Ga0070665_100191133 3300005548 Bacteria 2048
109 Ga0070665_100205038 3300005548 Bacteria 1972
110 Ga0070665_100299023 3300005548 Bacteria 1612
111 Ga0068855_100000037 3300005563 Bacteria 158161
112 Ga0068855_100020370 3300005563 Bacteria 7956
113 Ga0070664_100032779 3300005564 Bacteria 4346
114 Ga0068857_100002837 3300005577 Bacteria 14244
115 Ga0068854_100357091 3300005578 Bacteria 1198
116 Ga0068856_100154509 3300005614 Bacteria 2304
117 Ga0068852_100273399 3300005616 Bacteria 1626
118 Ga0068859_100042732 3300005617 Bacteria 4553
119 Ga0068859_100098143 3300005617 Bacteria 2983
120 Ga0068859_100251484 3300005617 Bacteria 1858
121 Ga0068859_100411617 3300005617 Bacteria 1448
122 Ga0068864_100010805 3300005618 Bacteria 7543
123 Ga0068864_100083125 3300005618 Bacteria 2811
124 Ga0068864_100169922 3300005618 Bacteria 1987
125 Ga0068861_100269451 3300005719 Bacteria 1461
126 Ga0068861_100341983 3300005719 Bacteria 1310
127 Ga0068870_10023888 3300005840 Bacteria 3020
128 Ga0068863_100009249 3300005841 Bacteria 9610
129 Ga0068863_100010052 3300005841 Bacteria 9209
130 Ga0068863_100040210 3300005841 Bacteria 4447
131 Ga0068863_100065603 3300005841 Bacteria 3435
132 Ga0068858_100006378 3300005842 Bacteria 11490
133 Ga0068858_100038154 3300005842 Bacteria 4456
134 Ga0068858_100063792 3300005842 Bacteria 3408
135 Ga0068860_100004982 3300005843 Bacteria 13534
136 Ga0068860_100007867 3300005843 Bacteria 10642
137 Ga0068860_100050953 3300005843 Bacteria 3940
138 Ga0068860_100151415 3300005843 Bacteria 2234
139 Ga0068860_100251985 3300005843 Bacteria 1720
140 Ga0068860_100467543 3300005843 Bacteria 1256
141 Ga0068862_100011964 3300005844 Bacteria 7167
142 Ga0068862_100012903 3300005844 Bacteria 6911
143 Ga0068862_100030283 3300005844 Bacteria 4560
144 Ga0068862_100073070 3300005844 Bacteria 2964
145 Ga0068862_100076885 3300005844 Bacteria 2889
146 Ga0068862_100084915 3300005844 Bacteria 2750
147 Ga0081455_10015596 3300005937 Bacteria 7374
148 Ga0081540_1000175 3300005983 Bacteria 67078
149 Ga0081540_1022037 3300005983 Bacteria 3770
150 Ga0081539_10004485 3300005985 Bacteria 15365
151 Ga0081539_10073243 3300005985 Bacteria 1828
152 Ga0075363_100014851 3300006048 Bacteria 3817
153 Ga0075363_100040205 3300006048 Bacteria 2464
154 Ga0075363_100125773 3300006048 Bacteria 1435
155 Ga0075364_10050785 3300006051 Bacteria 2707
156 Ga0075432_10009478 3300006058 Bacteria 3315
157 Ga0075432_10010009 3300006058 Bacteria 3221
158 Ga0070716_100035078 3300006173 Bacteria 2756
159 Ga0075362_10017169 3300006177 Bacteria 2978
160 Ga0075367_10020906 3300006178 Bacteria 3651
161 Ga0075367_10053954 3300006178 Bacteria 2383
162 Ga0075369_10016219 3300006186 Bacteria 3003
163 Ga0075369_10019958 3300006186 Bacteria 2741
164 Ga0075366_10000419 3300006195 Bacteria 19896
165 Ga0075366_10011020 3300006195 Bacteria 5090
166 Ga0075366_10015917 3300006195 Bacteria 4317
167 Ga0075366_10054373 3300006195 Bacteria 2378
168 Ga0075370_10035756 3300006353 Bacteria 2789
169 Ga0075370_10211532 3300006353 Bacteria 1145
170 Ga0075428_100068666 3300006844 Bacteria 3877
171 Ga0075430_100011408 3300006846 Bacteria 7543
172 Ga0075430_100129615 3300006846 Bacteria 2102
173 Ga0075430_100138678 3300006846 Bacteria 2025
174 Ga0075431_100300468 3300006847 Bacteria 1622
175 Ga0075433_10016630 3300006852 Bacteria 6070
176 Ga0075434_100001356 3300006871 Bacteria 20544
177 Ga0075434_100296667 3300006871 Bacteria 1636
178 Ga0075429_100016836 3300006880 Bacteria 6326
179 Ga0097620_100042731 3300006931 Bacteria 4553
180 Ga0097620_100098144 3300006931 Bacteria 2983
181 Ga0097620_100251475 3300006931 Bacteria 1858
182 Ga0097620_100411614 3300006931 Bacteria 1448
183 Ga0099823_1000033 3300006944 Bacteria 68228
184 Ga0099794_10002464 3300007265 Bacteria 6823
185 Ga0105251_10000075 3300009011 Bacteria 94904
186 Ga0105251_10000239 3300009011 Bacteria 54956
187 Ga0105251_10001294 3300009011 Bacteria 21632
188 Ga0105251_10001422 3300009011 Bacteria 20620
189 Ga0105251_10001607 3300009011 Bacteria 19211
190 Ga0105251_10002112 3300009011 Bacteria 16005
191 Ga0105251_10013543 3300009011 Bacteria 4558
192 Ga0105251_10024951 3300009011 Bacteria 3064
193 Ga0105251_10025991 3300009011 Bacteria 2986
194 Ga0105251_10032576 3300009011 Bacteria 2596
195 Ga0105244_10005583 3300009036 Bacteria 8324
196 Ga0105250_10002874 3300009092 Bacteria 8414
197 Ga0105250_10003656 3300009092 Bacteria 7239
198 Ga0105240_10023443 3300009093 Bacteria 8160
199 Ga0111539_10562013 3300009094 Bacteria 1329
200 Ga0105245_10037563 3300009098 Bacteria 4306
201 Ga0105247_10004686 3300009101 Bacteria 8713
202 Ga0105247_10034631 3300009101 Bacteria 3076
203 Ga0105243_10000249 3300009148 Bacteria 61872
204 Ga0105243_10015538 3300009148 Bacteria 5754
205 Ga0105243_10023100 3300009148 Bacteria 4730
206 Ga0105243_10023311 3300009148 Bacteria 4711
207 Ga0105248_10003673 3300009177 Bacteria 16996
208 Ga0105248_10014957 3300009177 Bacteria 8542
209 Ga0105248_10042429 3300009177 Bacteria 5102
210 Ga0105248_10126471 3300009177 Bacteria 2883
211 Ga0105248_10156962 3300009177 Bacteria 2567
212 Ga0105248_10157398 3300009177 Bacteria 2563
213 Ga0105248_10403316 3300009177 Bacteria 1539
214 Ga0105237_10024655 3300009545 Bacteria 6152
215 Ga0105237_10509750 3300009545 Bacteria 1210
216 Ga0105238_10028042 3300009551 Bacteria 5737
217 Ga0105249_10010654 3300009553 Bacteria 8076
218 Ga0105249_10226790 3300009553 Bacteria 1841
219 Ga0105148_100125 3300009978 Bacteria 11767
220 Ga0105148_102481 3300009978 Bacteria 1299
221 Ga0099796_10021889 3300010159 Bacteria 1976
222 Ga0105239_10001024 3300010375 Eukaryota 39022
223 Ga0105239_10200367 3300010375 Bacteria 2236
224 Ga0105239_10339797 3300010375 Bacteria 1694
225 Ga0105246_10019597 3300011119 Bacteria 4326
226 Ga0157370_10007312 3300013104 Bacteria 12048
227 Ga0157369_10196540 3300013105 Eukaryota 2118
228 Ga0157369_10405814 3300013105 Bacteria 1413
229 Ga0157374_10159694 3300013296 Bacteria 2195
230 Ga0157374_10431268 3300013296 Bacteria 1318
231 Ga0157374_10626342 3300013296 Bacteria 1087
232 Ga0163162_10000398 3300013306 Bacteria 39865
233 Ga0163162_10014417 3300013306 Bacteria 7724
234 Ga0163162_10037551 3300013306 Bacteria 4834
235 Ga0163162_10107352 3300013306 Bacteria 2887
236 Ga0163162_10172008 3300013306 Bacteria 2291
237 Ga0163162_10340260 3300013306 Bacteria 1633
238 Ga0157372_10274997 3300013307 Bacteria 1958
239 Ga0157375_10039196 3300013308 Bacteria 4558
240 Ga0163163_10026334 3300014325 Bacteria 5558
241 Ga0163163_10096555 3300014325 Bacteria 2976
242 Ga0157380_10000081 3300014326 Bacteria 53155
243 Ga0157380_10114610 3300014326 Bacteria 2272
244 Ga0157377_10195811 3300014745 Bacteria 1280
245 Ga0157379_10140333 3300014968 Bacteria 2178
246 Ga0157379_10194644 3300014968 Bacteria 1832
247 Ga0182007_10004297 3300015262 Bacteria 6489
248 Ga0163161_10000427 3300017792 Bacteria 35484
249 Ga0163161_10011170 3300017792 Bacteria 6221
250 Ga0163161_10028287 3300017792 Bacteria 3980
251 Ga0163161_10181101 3300017792 Bacteria 1616
252 Ga0163161_10213310 3300017792 Bacteria 1492
253 Ga0206355_1050631 3300020076 Bacteria 1024
254 Ga0206354_11554051 3300020081 Bacteria 1043
255 Ga0224712_10150079 3300022467 Eukaryota 1032
256 Ga0209674_100049 3300025226 Bacteria 346969
257 Ga0209672_100097 3300025228 Bacteria 110837
258 Ga0209147_100106 3300025229 Bacteria 156899
259 Ga0209258_100157 3300025242 Bacteria 156898
260 Ga0209258_101138 3300025242 Bacteria 10991
261 Ga0209258_107071 3300025242 Bacteria 1695
262 Ga0209148_1000150 3300025254 Bacteria 156898
263 Ga0209759_1000041 3300025256 Bacteria 252893
264 Ga0209455_1000132 3300025272 Bacteria 156899
265 Ga0209673_1000324 3300025273 Eukaryota 87582
266 Ga0209673_1001616 3300025273 Bacteria 19667
267 Ga0209673_1003540 3300025273 Bacteria 9118
268 Ga0209673_1003939 3300025273 Bacteria 8301
269 Ga0209564_1011053 3300025295 Bacteria 4082
270 Ga0209758_1000382 3300025297 Bacteria 76653
271 Ga0209758_1004836 3300025297 Bacteria 10869
272 Ga0209050_1002396 3300025298 Bacteria 16244
273 Ga0209050_1021597 3300025298 Bacteria 2340
274 Ga0209256_1001786 3300025299 Bacteria 20365
275 Ga0209051_1000462 3300025303 Bacteria 53349
276 Ga0209051_1002774 3300025303 Bacteria 12094
277 Ga0209257_1001143 3300025304 Bacteria 33909
278 Ga0209257_1009675 3300025304 Bacteria 5092
279 Ga0207696_1001489 3300025711 Bacteria 12622
280 Ga0207696_1002726 3300025711 Bacteria 8415
281 Ga0207696_1025010 3300025711 Bacteria 1867
282 Ga0207655_1000327 3300025728 Bacteria 70037
283 Ga0207655_1000339 3300025728 Bacteria 68128
284 Ga0207713_1000038 3300025735 Bacteria 247609
285 Ga0207713_1001016 3300025735 Bacteria 24447
286 Ga0207713_1003536 3300025735 Bacteria 10585
287 Ga0207713_1006052 3300025735 Bacteria 7460
288 Ga0207713_1007177 3300025735 Bacteria 6639
289 Ga0207713_1007672 3300025735 Bacteria 6314
290 Ga0207713_1010855 3300025735 Bacteria 5007
291 Ga0207710_10001632 3300025900 Bacteria 10954
292 Ga0207710_10052925 3300025900 Bacteria 1826
293 Ga0207680_10057312 3300025903 Bacteria 2357
294 Ga0207680_10315771 3300025903 Bacteria 1092
295 Ga0207685_10018230 3300025905 Bacteria 2287
296 Ga0207645_10089515 3300025907 Bacteria 1979
297 Ga0207645_10131205 3300025907 Bacteria 1631
298 Ga0207643_10031355 3300025908 Bacteria 2963
299 Ga0207705_10005976 3300025909 Bacteria 9055
300 Ga0207705_10249496 3300025909 Bacteria 1353
301 Ga0207695_10014875 3300025913 Bacteria 9185
302 Ga0207695_10064490 3300025913 Bacteria 3771
303 Ga0207671_10017485 3300025914 Bacteria 5526
304 Ga0207671_10133716 3300025914 Eukaryota 1906
305 Ga0207671_10366936 3300025914 Bacteria 1143
306 Ga0207693_10033688 3300025915 Bacteria 4041
307 Ga0207693_10058144 3300025915 Bacteria 3029
308 Ga0207693_10351693 3300025915 Bacteria 1153
309 Ga0207663_10074208 3300025916 Bacteria 2204
310 Ga0207663_10205893 3300025916 Bacteria 1422
311 Ga0207662_10018677 3300025918 Bacteria 3938
312 Ga0207657_10088952 3300025919 Bacteria 2580
313 Ga0207649_10301479 3300025920 Bacteria 1171
314 Ga0207681_10000177 3300025923 Bacteria 52335
315 Ga0207681_10010161 3300025923 Bacteria 5763
316 Ga0207681_10036366 3300025923 Bacteria 3248
317 Ga0207681_10052906 3300025923 Bacteria 2755
318 Ga0207694_10202000 3300025924 Bacteria 1617
319 Ga0207694_10329011 3300025924 Bacteria 1262
320 Ga0207650_10002502 3300025925 Bacteria 12761
321 Ga0207650_10011955 3300025925 Bacteria 5984
322 Ga0207650_10012392 3300025925 Bacteria 5886
323 Ga0207650_10038911 3300025925 Bacteria 3475
324 Ga0207650_10208193 3300025925 Bacteria 1570
325 Ga0207659_10011480 3300025926 Bacteria 5597
326 Ga0207659_10138200 3300025926 Bacteria 1888
327 Ga0207687_10017974 3300025927 Bacteria 4665
328 Ga0207700_10000071 3300025928 Bacteria 62757
329 Ga0207700_10057725 3300025928 Bacteria 2928
330 Ga0207644_10000080 3300025931 Bacteria 70312
331 Ga0207644_10000766 3300025931 Bacteria 20334
332 Ga0207644_10002305 3300025931 Bacteria 12382
333 Ga0207644_10017094 3300025931 Bacteria 4892
334 Ga0207644_10040520 3300025931 Bacteria 3292
335 Ga0207644_10056327 3300025931 Bacteria 2837
336 Ga0207690_10225262 3300025932 Bacteria 1437
337 Ga0207706_10022990 3300025933 Bacteria 5598
338 Ga0207706_10081730 3300025933 Bacteria 2839
339 Ga0207706_10379492 3300025933 Eukaryota 1227
340 Ga0207709_10000001 3300025935 Bacteria 2228154
341 Ga0207709_10003040 3300025935 Bacteria 10173
342 Ga0207709_10032763 3300025935 Bacteria 3045
343 Ga0207709_10034026 3300025935 Bacteria 2999
344 Ga0207670_10074057 3300025936 Bacteria 2363
345 Ga0207670_10113520 3300025936 Bacteria 1957
346 Ga0207669_10035112 3300025937 Bacteria 2849
347 Ga0207669_10084002 3300025937 Bacteria 2050
348 Ga0207691_10070957 3300025940 Bacteria 3145
349 Ga0207691_10407052 3300025940 Bacteria 1160
350 Ga0207711_10003533 3300025941 Bacteria 13532
351 Ga0207711_10009758 3300025941 Bacteria 7986
352 Ga0207711_10020446 3300025941 Bacteria 5518
353 Ga0207711_10282102 3300025941 Bacteria 1530
354 Ga0207689_10138058 3300025942 Bacteria 2007
355 Ga0207689_10373778 3300025942 Bacteria 1186
356 Ga0207679_10077238 3300025945 Bacteria 2532
357 Ga0207679_10536605 3300025945 Bacteria 1048
358 Ga0207667_10000053 3300025949 Bacteria 226712
359 Ga0207667_10001176 3300025949 Bacteria 32896
360 Ga0207651_10038654 3300025960 Bacteria 3139
361 Ga0207651_10070979 3300025960 Bacteria 2466
362 Ga0207651_10233357 3300025960 Bacteria 1495
363 Ga0207712_10005748 3300025961 Bacteria 7818
364 Ga0207712_10101710 3300025961 Bacteria 2138
365 Ga0207668_10004844 3300025972 Bacteria 7922
366 Ga0207668_10021228 3300025972 Bacteria 4139
367 Ga0207668_10021701 3300025972 Bacteria 4098
368 Ga0207668_10034036 3300025972 Bacteria 3380
369 Ga0207668_10082720 3300025972 Bacteria 2333
370 Ga0207640_10246346 3300025981 Bacteria 1384
371 Ga0207658_10000213 3300025986 Bacteria 60739
372 Ga0207658_10003133 3300025986 Bacteria 11830
373 Ga0207703_10035852 3300026035 Bacteria 3944
374 Ga0207703_10052382 3300026035 Bacteria 3314
375 Ga0207639_10274664 3300026041 Bacteria 1480
376 Ga0207678_10124403 3300026067 Bacteria 2200
377 Ga0207678_10130582 3300026067 Bacteria 2143
378 Ga0207678_10210463 3300026067 Bacteria 1663
379 Ga0207641_10003981 3300026088 Bacteria 12894
380 Ga0207641_10020272 3300026088 Bacteria 5460
381 Ga0207641_10032484 3300026088 Bacteria 4333
382 Ga0207641_10050190 3300026088 Bacteria 3529
383 Ga0207648_10093070 3300026089 Bacteria 2636
384 Ga0207648_10477397 3300026089 Bacteria 1138
385 Ga0207676_10014487 3300026095 Bacteria 5675
386 Ga0207676_10068794 3300026095 Bacteria 2833
387 Ga0207674_10022818 3300026116 Bacteria 6715
388 Ga0207674_10179237 3300026116 Bacteria 2070
389 Ga0207675_100001472 3300026118 Bacteria 23626
390 Ga0207675_100052226 3300026118 Bacteria 3814
391 Ga0207675_100126177 3300026118 Bacteria 2424
392 Ga0207675_100245502 3300026118 Bacteria 1731
393 Ga0207683_10221060 3300026121 Bacteria 1726
394 Ga0207683_10259477 3300026121 Bacteria 1587
395 Ga0207698_10200048 3300026142 Bacteria 1788
396 Ga0207698_10256724 3300026142 Bacteria 1603
397 Ga0209389_1005072 3300027296 Bacteria 11128
398 Ga0209371_1000025 3300027312 Bacteria 450640
399 Ga0209371_1000040 3300027312 Bacteria 340804
400 Ga0209371_1000259 3300027312 Bacteria 64107
401 Ga0209371_1000604 3300027312 Bacteria 32202
402 Ga0209588_1000642 3300027671 Bacteria 8805
403 Ga0268266_10001045 3300028379 Bacteria 34723
404 Ga0268266_10002815 3300028379 Bacteria 18142
405 Ga0268266_10042995 3300028379 Bacteria 3860
406 Ga0268266_10074285 3300028379 Bacteria 2952
407 Ga0268266_10211819 3300028379 Bacteria 1777
408 Ga0268266_10258706 3300028379 Bacteria 1612
409 Ga0268266_10418653 3300028379 Bacteria 1269
410 Ga0268265_10000218 3300028380 Bacteria 66258
411 Ga0268265_10026965 3300028380 Bacteria 4094
412 Ga0268265_10045029 3300028380 Bacteria 3289
413 Ga0268265_10047013 3300028380 Bacteria 3230
414 Ga0268265_10058166 3300028380 Bacteria 2950
415 Ga0268265_10080942 3300028380 Bacteria 2563
416 Ga0268265_10309660 3300028380 Bacteria 1425
417 Ga0268264_10002221 3300028381 Bacteria 17217
418 Ga0268264_10003005 3300028381 Bacteria 14622
419 Ga0268264_10028441 3300028381 Bacteria 4573
420 Ga0268264_10546447 3300028381 Bacteria 1136
421 Ga0307515_10001534 3300028794 Bacteria 51647
422 Ga0268256_1000027 3300030500 Bacteria 450640
423 Ga0268256_1000041 3300030500 Bacteria 340725
424 Ga0268256_1000233 3300030500 Bacteria 58915
425 Ga0268256_1000510 3300030500 Bacteria 32695
426 Ga0265330_10051485 3300031235 Bacteria 1805
427 Ga0265332_10011181 3300031238 Bacteria 3988
428 Ga0307513_10440403 3300031456 Bacteria 1029
429 Ga0307408_100002383 3300031548 Bacteria 13264
430 Ga0307408_100016611 3300031548 Bacteria 4916
431 Ga0307408_100057979 3300031548 Bacteria 2813
432 Ga0307408_100071439 3300031548 Bacteria 2566
433 Ga0307408_100132766 3300031548 Bacteria 1944
434 Ga0307408_100268014 3300031548 Bacteria 1416
435 Ga0307405_10051184 3300031731 Bacteria 2561
436 Ga0307405_10134869 3300031731 Bacteria 1712
437 Ga0307413_10030443 3300031824 Bacteria 3032
438 Ga0307413_10058751 3300031824 Bacteria 2359
439 Ga0307413_10076889 3300031824 Bacteria 2123
440 Ga0307413_10386825 3300031824 Bacteria 1092
441 Ga0307410_10008484 3300031852 Bacteria 5699
442 Ga0307410_10028554 3300031852 Bacteria 3541
443 Ga0307410_10085192 3300031852 Bacteria 2229
444 Ga0307410_10223043 3300031852 Bacteria 1451
445 Ga0307410_10264875 3300031852 Bacteria 1342
446 Ga0307410_10287293 3300031852 Bacteria 1293
447 Ga0307406_10232960 3300031901 Bacteria 1376
448 Ga0307406_10461950 3300031901 Bacteria 1021
449 Ga0307407_10008019 3300031903 Bacteria 4819
450 Ga0307407_10031390 3300031903 Bacteria 2877
451 Ga0307407_10354241 3300031903 Bacteria 1040
452 Ga0307412_10000015 3300031911 Bacteria 333589
453 Ga0307412_10017164 3300031911 Bacteria 4329
454 Ga0307412_10104590 3300031911 Bacteria 2009
455 Ga0307412_10257455 3300031911 Bacteria 1358
456 Ga0307409_100026764 3300031995 Bacteria 4074
457 Ga0307409_100176283 3300031995 Bacteria 1887
458 Ga0307409_100339081 3300031995 Bacteria 1414
459 Ga0307409_100417644 3300031995 Bacteria 1286
460 Ga0307416_100013635 3300032002 Bacteria 5534
461 Ga0307416_100091117 3300032002 Bacteria 2617
462 Ga0307414_10544612 3300032004 Bacteria 1033
463 Ga0307415_100009223 3300032126 Bacteria 5516
464 Ga0316593_10002636 3300032168 Bacteria 4302
465 Ga0316593_10012634 3300032168 Bacteria 2482
466 Ga0316593_10094855 3300032168 Unclassified 1053
467 Ga0316592_1001937 3300033524 Bacteria 3488
468 Ga0316592_1007064 3300033524 Bacteria 2181
469 Ga0316592_1008227 3300033524 Bacteria 2054
470 Ga0316588_1015147 3300033528 Bacteria 1695
471 Ga0316596_1011671 3300033541 Bacteria 2152
472 Ga0373926_0048813 3300035083 Bacteria 1523
473 Ga0373926_0101378 3300035083 Bacteria 1077
474 Ga0373923_0027239 3300035111 Bacteria 2279
475 Ga0373936_0019183 3300035113 Bacteria 2649
476 Ga0373945_0011383 3300035116 Bacteria 2942
477 Ga0373953_0009240 3300035117 Bacteria 3383
478 Ga0373954_0003072 3300035118 Bacteria 7049
479 Ga0373954_0067827 3300035118 Bacteria 1691
480 Ga0373943_0016830 3300035170 Bacteria 3340
481 Ga0373946_0011243 3300035171 Bacteria 3334
482 Ga0373946_0034050 3300035171 Bacteria 2054
483 Ga0373955_0004841 3300035172 Bacteria 6000
484 Ga0316574_0002172 3300035398 Bacteria 9728
485 Ga0316574_0058353 3300035398 Bacteria 2418
486 Ga0373935_0027481 3300035692 Bacteria 3516
487 Ga0373935_0045369 3300035692 Bacteria 2773
488 Ga0373935_0128848 3300035692 Bacteria 1698
489 Ga0373927_0018924 3300035695 Bacteria 4518
490 Ga0373927_0024801 3300035695 Bacteria 3919
491 Ga0373927_0185870 3300035695 Bacteria 1363
492 Ga0373933_0058601 3300035724 Bacteria 2317
493 Ga0373947_0011648 3300035725 Bacteria 5044
494 Ga0373947_0045708 3300035725 Bacteria 2620
495 Ga0373937_0022427 3300036401 Bacteria 5676
496 Ga0373937_0040021 3300036401 Bacteria 4273
497 Ga0373937_0316220 3300036401 Bacteria 1477
498 Ga0395899_0002992 3300037312 Bacteria 13497
499 Ga0395899_0024573 3300037312 Bacteria 4555
500 Ga0395899_0047828 3300037312 Bacteria 3184
501 Ga0395899_0057145 3300037312 Bacteria 2881
502 Ga0395899_0218317 3300037312 Bacteria 1322
503 Ga0395900_0008700 3300037418 Bacteria 10428
504 Ga0395900_0017614 3300037418 Bacteria 7289
505 Ga0395900_0072067 3300037418 Bacteria 3552
506 Ga0395900_0173016 3300037418 Bacteria 2197
507 Ga0395900_0254885 3300037418 Bacteria 1754
508 Ga0395898_0006782 3300037466 Bacteria 12189
509 Ga0395898_0014126 3300037466 Bacteria 8208
510 Ga0395898_0083465 3300037466 Bacteria 3079
511 Ga0395898_0181688 3300037466 Bacteria 2010
512 Ga0395898_0390286 3300037466 Bacteria 1327
513 Ga0395905_0002322 3300037471 Bacteria 21290
514 Ga0395905_0003918 3300037471 Bacteria 15668
515 Ga0395905_0009494 3300037471 Bacteria 9509
516 Ga0395905_0109828 3300037471 Bacteria 2589
517 Ga0395901_0005411 3300038443 Bacteria 12918
518 Ga0395901_0066588 3300038443 Bacteria 3751
519 Ga0395901_0347415 3300038443 Bacteria 1531
520 Ga0436361_0370358 3300039447 Bacteria 2121
521 Ga0436363_0686554 3300039450 Bacteria 3209
522 Ga0439436_0005519 3300041404 Bacteria 3874
523 Ga0439436_0005596 3300041404 Bacteria 3852
524 Ga0439436_0051288 3300041404 Bacteria 1165
525 Ga0439436_0056261 3300041404 Bacteria 1105
526 Ga0439438_005139 3300041405 Bacteria 4871
527 Ga0439438_022614 3300041405 Bacteria 1742
528 Ga0439439_0000787 3300041406 Bacteria 5749
529 Ga0439439_0010348 3300041406 Bacteria 2227
530 Ga0439466_0007836 3300041411 Bacteria 4034
531 Ga0439466_0009017 3300041411 Bacteria 3745
532 Ga0451793_1176449 3300041452 Bacteria 1613
533 Ga0451795_1559355 3300041456 Bacteria 1463
534 Ga0451839_0004112 3300041496 Bacteria 1670
535 Ga0439433_0002116 3300041999 Bacteria 4176
536 Ga0439433_0004175 3300041999 Bacteria 3104
537 Ga0439433_0013928 3300041999 Bacteria 1769
538 Ga0439432_000130 3300042006 Bacteria 24966
539 Ga0439449_0010688 3300042007 Bacteria 3468
540 Ga0439449_0069846 3300042007 Bacteria 1294
541 Ga0439451_000493 3300042009 Bacteria 7615
542 Ga0439451_004046 3300042009 Bacteria 2982
543 Ga0439452_000001 3300042010 Bacteria 1725439
544 Ga0439452_042071 3300042010 Bacteria 1072
545 Ga0439456_000597 3300042013 Bacteria 7573
546 Ga0439456_001303 3300042013 Bacteria 4969
547 Ga0439457_003680 3300042014 Bacteria 4137
548 Ga0439463_000469 3300042016 Bacteria 11233
549 Ga0439463_001793 3300042016 Bacteria 5585
550 Ga0450919_000409 3300042121 Bacteria 5261
551 Ga0450920_000642 3300042122 Bacteria 5570
552 Ga0450898_017965 3300042134 Bacteria 1221
553 Ga0450906_002930 3300042145 Bacteria 3707
554 Ga0450908_008554 3300042184 Bacteria 1917
555 Ga0450909_001461 3300042185 Bacteria 3291
556 Ga0439434_0002748 3300042435 Bacteria 5128
557 Ga0439434_0010454 3300042435 Bacteria 2735
558 Ga0439434_0017534 3300042435 Bacteria 2143
559 Ga0439459_0018379 3300042438 Bacteria 1313
560 Ga0450918_000078 3300042531 Bacteria 20466
561 Ga0450918_006741 3300042531 Bacteria 2044
562 Ga0450893_0012673 3300042532 Bacteria 1400
563 Ga0466986_0000518 3300044650 Bacteria 13232
564 Ga0466972_0000427 3300044658 Bacteria 21891
565 Ga0466972_0011719 3300044658 Bacteria 4403
566 Ga0466965_0177323 3300044683 Bacteria 1123
567 Ga0466966_0026078 3300044684 Bacteria 3816
568 Ga0466966_0113509 3300044684 Bacteria 1669
569 Ga0466961_0000053 3300044693 Bacteria 69359
570 Ga0466961_0021527 3300044693 Bacteria 4149
571 Ga0466963_0035631 3300044694 Bacteria 3243
572 Ga0466968_0003097 3300044735 Bacteria 6135
573 Ga0466970_0000057 3300044765 Bacteria 43168
574 Ga0466970_0007989 3300044765 Bacteria 5314
575 Ga0466959_0001715 3300045049 Bacteria 13626
576 Ga0466959_0164799 3300045049 Eukaryota 1557
577 Ga0466967_0016266 3300045976 Bacteria 5859
578 Ga0495592_0009546 3300046454 Eukaryota 7301
579 Ga0495592_0012268 3300046454 Eukaryota 6505
580 Ga0495592_0031919 3300046454 Bacteria 3978
581 Ga0495592_0059500 3300046454 Bacteria 2813
582 Ga0495592_0233704 3300046454 Bacteria 1223
583 Ga0495603_0012824 3300046455 Bacteria 5068
584 Ga0495603_0059203 3300046455 Bacteria 2264
585 Ga0495590_0060064 3300046457 Bacteria 1331
586 Ga0495629_0018239 3300046459 Bacteria 5026
587 Ga0495629_0034343 3300046459 Bacteria 3586
588 Ga0495641_0003517 3300046461 Eukaryota 11659
589 Ga0495641_0014889 3300046461 Bacteria 4188
590 Ga0495651_0023866 3300046462 Bacteria 4756
591 Ga0495651_0050593 3300046462 Bacteria 3205
592 Ga0495651_0172312 3300046462 Bacteria 1540
593 Ga0495651_0197068 3300046462 Bacteria 1413
594 Ga0495653_0011267 3300046463 Bacteria 7308
595 Ga0495653_0028059 3300046463 Eukaryota 4505
596 Ga0495653_0035346 3300046463 Bacteria 3944
597 Ga0495653_0050594 3300046463 Bacteria 3195
598 Ga0495580_0010680 3300046472 Bacteria 7133
599 Ga0495580_0034339 3300046472 Bacteria 3652
600 Ga0495580_0099894 3300046472 Bacteria 2019
601 Ga0495582_0049291 3300046473 Bacteria 2319
602 Ga0495605_0140857 3300046474 Bacteria 1082
603 Ga0495639_0014797 3300046475 Bacteria 3380
604 Ga0495639_0015417 3300046475 Bacteria 3315
605 Ga0495662_0030700 3300046476 Bacteria 2594
606 Ga0495664_0268527 3300046477 Bacteria 1031
607 Ga0495594_0014756 3300046499 Bacteria 4101
608 Ga0495608_0014921 3300046511 Bacteria 5392
609 Ga0495608_0021592 3300046511 Bacteria 4418
610 Ga0495618_0009337 3300046514 Bacteria 5920
611 Ga0495628_0026376 3300046516 Bacteria 4739
612 Ga0495628_0066603 3300046516 Eukaryota 2815
613 Ga0495628_0123729 3300046516 Bacteria 1982
614 Ga0495630_0096720 3300046517 Eukaryota 2232
615 Ga0495630_0202698 3300046517 Bacteria 1514
616 Ga0495643_0019784 3300046522 Bacteria 3892
617 Ga0495666_0028998 3300046526 Bacteria 2723
618 Ga0495642_0006593 3300046528 Bacteria 4456
619 Ga0495652_0016270 3300046529 Eukaryota 6653
620 Ga0495652_0024838 3300046529 Bacteria 5302
621 Ga0495652_0036216 3300046529 Bacteria 4292
622 Ga0495652_0095683 3300046529 Eukaryota 2420
623 Ga0495665_0060245 3300046531 Bacteria 2004
624 Ga0495665_0119539 3300046531 Bacteria 1380
625 Ga0495640_0013821 3300046533 Bacteria 6131
626 Ga0495640_0019133 3300046533 Bacteria 5060
627 Ga0495587_0024465 3300046536 Bacteria 3700
628 Ga0495587_0030508 3300046536 Bacteria 3269
629 Ga0495597_0000102 3300046542 Bacteria 76204
630 Ga0495645_0019292 3300046543 Bacteria 4909
631 Ga0495667_0015567 3300046559 Bacteria 5141
632 Ga0495667_0021890 3300046559 Bacteria 4309
633 Ga0495656_0097898 3300046615 Bacteria 1352
634 Ga0495656_0213869 3300046615 Bacteria 962
635 Ga0495668_0000020 3300046616 Bacteria 411641
636 Ga0495668_0011692 3300046616 Bacteria 5243
637 Ga0495634_0012821 3300046642 Bacteria 6066
638 Ga0495634_0019336 3300046642 Bacteria 4841
639 Ga0495634_0024572 3300046642 Eukaryota 4226
640 Ga0495634_0067823 3300046642 Bacteria 2358
641 Ga0495635_0012490 3300046663 Bacteria 5949
642 Ga0495635_0030818 3300046663 Eukaryota 3726
643 Ga0495635_0042929 3300046663 Bacteria 3121
644 Ga0495661_0009296 3300046665 Bacteria 6748
645 Ga0495657_0007494 3300046675 Eukaryota 8433
646 Ga0495657_0025296 3300046675 Bacteria 4218
647 Ga0495657_0071180 3300046675 Bacteria 2271
648 Ga0495657_0168811 3300046675 Bacteria 1349
649 Ga0495599_0006520 3300046678 Bacteria 7041
650 Ga0495599_0039811 3300046678 Bacteria 2953
651 Ga0495623_0006249 3300046679 Bacteria 7746
652 Ga0495646_0027875 3300046680 Bacteria 3541
653 Ga0495646_0062282 3300046680 Bacteria 2218
654 Ga0495646_0084386 3300046680 Eukaryota 1844
655 Ga0495647_0016556 3300046681 Bacteria 2596
656 Ga0495658_0006869 3300046683 Bacteria 5609
657 Ga0495658_0092091 3300046683 Bacteria 1796
658 Ga0495613_0069830 3300046689 Bacteria 2561
659 Ga0495613_0149215 3300046689 Bacteria 1668
660 Ga0495613_0180350 3300046689 Bacteria 1496
661 Ga0495624_0001476 3300046690 Eukaryota 18250
662 Ga0495624_0002969 3300046690 Eukaryota 12676
663 Ga0495624_0024218 3300046690 Bacteria 3996
664 Ga0495624_0042860 3300046690 Bacteria 2890
665 Ga0495589_0000091 3300046794 Bacteria 85670
666 Ga0495600_0010245 3300046809 Bacteria 5811
667 Ga0495600_0071471 3300046809 Eukaryota 2267
668 Ga0495581_0041039 3300047315 Bacteria 2677
669 Ga0495604_0006471 3300047317 Bacteria 9289
670 Ga0495604_0013652 3300047317 Eukaryota 6478
671 Ga0495604_0018787 3300047317 Bacteria 5535
672 Ga0495604_0028182 3300047317 Bacteria 4467
673 Ga0495674_0009452 3300047319 Eukaryota 9263
674 Ga0495674_0011849 3300047319 Bacteria 8220
675 Ga0495674_0014791 3300047319 Bacteria 7300
676 Ga0495674_0032997 3300047319 Bacteria 4693
677 Ga0495674_0315848 3300047319 Bacteria 1274
678 Ga0495676_0002631 3300047321 Eukaryota 16055
679 Ga0495676_0007948 3300047321 Eukaryota 9724
680 Ga0495676_0042145 3300047321 Bacteria 3750
681 Ga0495680_0024592 3300047322 Bacteria 4995
682 Ga0495680_0046045 3300047322 Bacteria 3441
683 Ga0495680_0070688 3300047322 Bacteria 2660
684 Ga0495680_0117713 3300047322 Eukaryota 1964
685 Ga0495687_014386 3300047443 Bacteria 4077
686 Ga0495675_0016865 3300047444 Bacteria 4620
687 Ga0495684_0005133 3300047471 Bacteria 10214
688 Ga0495684_0006871 3300047471 Bacteria 8835
689 Ga0495684_0020155 3300047471 Bacteria 5136
690 Ga0495684_0023268 3300047471 Bacteria 4763
691 Ga0495684_0024746 3300047471 Bacteria 4617
692 Ga0495593_0012276 3300047673 Bacteria 4896
693 Ga0495593_0035643 3300047673 Bacteria 2700
694 Ga0495602_0004743 3300048088 Eukaryota 14212
695 Ga0495602_0014752 3300048088 Eukaryota 7920
696 Ga0495602_0030617 3300048088 Eukaryota 5102
697 Ga0495602_0037302 3300048088 Bacteria 4513
698 Ga0495602_0039196 3300048088 Eukaryota 4367
699 Ga0495602_0312836 3300048088 Bacteria 1145
700 Ga0495602_0349409 3300048088 Bacteria 1068
701 Ga0495614_0058969 3300048089 Bacteria 1648
702 Ga0495614_0179865 3300048089 Eukaryota 951
703 Ga0496100_0035948 3300048903 Bacteria 3120
704 Ga0496100_0110286 3300048903 Bacteria 1910
705 Ga0496101_0000731 3300048904 Bacteria 19558
706 Ga0496101_0030130 3300048904 Bacteria 3801
707 Ga0496102_0000056 3300048905 Bacteria 172707
708 Ga0496102_0000174 3300048905 Bacteria 87691
709 Ga0496102_0000484 3300048905 Bacteria 44164
710 Ga0496102_0037136 3300048905 Bacteria 4393
711 Ga0496102_0252967 3300048905 Bacteria 1661
712 Ga0496102_0274076 3300048905 Bacteria 1591
713 Ga0496102_0563993 3300048905 Bacteria 1061
714 Ga0496103_0000040 3300048906 Bacteria 172148
715 Ga0496103_0000320 3300048906 Bacteria 43999
716 Ga0496103_0158216 3300048906 Bacteria 1452
717 Ga0496104_0000282 3300048907 Bacteria 45161
718 Ga0496104_0052036 3300048907 Bacteria 3867
719 Ga0496104_0254514 3300048907 Bacteria 1669
720 Ga0496104_0389821 3300048907 Bacteria 1305
721 Ga0496105_0000136 3300048908 Bacteria 49541
722 Ga0496105_0000423 3300048908 Bacteria 27810
723 Ga0496105_0002210 3300048908 Bacteria 14097
724 Ga0496105_0076506 3300048908 Bacteria 2763
725 Ga0496105_0104763 3300048908 Bacteria 2335
726 Ga0496106_0020159 3300048909 Bacteria 4947
727 Ga0496106_0124626 3300048909 Bacteria 2016
728 Ga0496106_0519628 3300048909 Bacteria 956
729 Ga0496107_0017622 3300048910 Bacteria 5023
730 Ga0496107_0139725 3300048910 Bacteria 1790
731 Ga0496107_0367450 3300048910 Bacteria 1070
732 Ga0496108_0003089 3300048911 Bacteria 13382
733 Ga0496108_0030847 3300048911 Bacteria 4443
734 Ga0496108_0121995 3300048911 Bacteria 2236
735 Ga0496108_0170890 3300048911 Bacteria 1880
736 Ga0496108_0216249 3300048911 Bacteria 1664
737 Ga0496109_0042830 3300048912 Bacteria 4103
738 Ga0496110_0036175 3300048913 Bacteria 4287
739 Ga0496110_0092722 3300048913 Bacteria 2703
740 Ga0496111_0015171 3300048914 Bacteria 5281
741 Ga0496112_0005743 3300048915 Bacteria 10786
742 Ga0496112_0039026 3300048915 Bacteria 4638
743 Ga0496112_0039083 3300048915 Bacteria 4635
744 Ga0496112_0269203 3300048915 Bacteria 1652
745 Ga0496113_0000119 3300048916 Bacteria 33821
746 Ga0496113_0028553 3300048916 Bacteria 4014
747 Ga0496114_0014125 3300048917 Bacteria 6403
748 Ga0496114_0441263 3300048917 Bacteria 1153
749 Ga0496115_0000009 3300048918 Bacteria 234372
750 Ga0496115_0110909 3300048918 Bacteria 2254
751 Ga0496115_0153409 3300048918 Bacteria 1902
752 Ga0496115_0179409 3300048918 Bacteria 1751
753 Ga0496116_0000056 3300048919 Bacteria 282554
754 Ga0496116_0000110 3300048919 Bacteria 185668
755 Ga0496116_0008516 3300048919 Bacteria 8889
756 Ga0496116_0014709 3300048919 Bacteria 6233
757 Ga0496116_0051874 3300048919 Bacteria 2721
758 Ga0496117_0000003 3300048920 Bacteria 1881097
759 Ga0496117_0000354 3300048920 Bacteria 80757
760 Ga0496117_0000802 3300048920 Bacteria 48832
761 Ga0496117_0005072 3300048920 Bacteria 14101
762 Ga0496117_0008930 3300048920 Bacteria 9437
763 Ga0496117_0019332 3300048920 Bacteria 5601
764 Ga0496117_0052166 3300048920 Bacteria 2883
765 Ga0496118_0000001 3300048921 Bacteria 1881100
766 Ga0496118_0000077 3300048921 Bacteria 192298
767 Ga0496118_0000310 3300048921 Bacteria 84607
768 Ga0496118_0006305 3300048921 Bacteria 13110
769 Ga0496118_0008850 3300048921 Bacteria 10301
770 Ga0496118_0009737 3300048921 Bacteria 9643
771 Ga0496118_0011094 3300048921 Bacteria 8844
772 Ga0496118_0017185 3300048921 Bacteria 6599
773 Ga0496119_0000263 3300048922 Bacteria 74497
774 Ga0496119_0000648 3300048922 Bacteria 46947
775 Ga0496119_0000754 3300048922 Bacteria 43423
776 Ga0496119_0086342 3300048922 Bacteria 1793
777 Ga0496120_0000318 3300048923 Bacteria 79637
778 Ga0496120_0000689 3300048923 Bacteria 49521
779 Ga0496120_0000749 3300048923 Bacteria 47044
780 Ga0496120_0090099 3300048923 Eukaryota 1641
781 Ga0496121_0000121 3300048924 Bacteria 172480
782 Ga0496121_0000432 3300048924 Bacteria 82444
783 Ga0496121_0000984 3300048924 Bacteria 51021
784 Ga0496121_0002135 3300048924 Bacteria 31064
785 Ga0496121_0005637 3300048924 Bacteria 15932
786 Ga0496121_0005718 3300048924 Bacteria 15795
787 Ga0496121_0007340 3300048924 Bacteria 13328
788 Ga0496121_0012058 3300048924 Bacteria 9496
789 Ga0496122_0001087 3300048925 Bacteria 47227
790 Ga0496122_0001497 3300048925 Bacteria 37328
791 Ga0496122_0008986 3300048925 Bacteria 10623
792 Ga0496122_0090011 3300048925 Bacteria 2096
793 Ga0496122_0197494 3300048925 Bacteria 1180
794 Ga0496123_0000889 3300048926 Bacteria 47309
795 Ga0496123_0001632 3300048926 Bacteria 30225
796 Ga0496124_0000050 3300048927 Bacteria 258041
797 Ga0496124_0000219 3300048927 Bacteria 111562
798 Ga0496124_0001992 3300048927 Bacteria 27833
799 Ga0496124_0003260 3300048927 Bacteria 20044
800 Ga0496124_0006361 3300048927 Bacteria 12884
801 Ga0496124_0012220 3300048927 Bacteria 8493
802 Ga0496124_0036067 3300048927 Bacteria 4318
803 Ga0496124_0062622 3300048927 Bacteria 3112
804 Ga0496124_0080025 3300048927 Bacteria 2690
805 Ga0496125_0000114 3300048928 Bacteria 182012
806 Ga0496125_0000796 3300048928 Bacteria 51436
807 Ga0496125_0001252 3300048928 Bacteria 37872
808 Ga0496125_0005292 3300048928 Bacteria 14432
809 Ga0496125_0006057 3300048928 Bacteria 13218
810 Ga0496125_0025241 3300048928 Bacteria 5447
811 Ga0496125_0030371 3300048928 Bacteria 4836
812 Ga0496125_0089350 3300048928 Bacteria 2317
813 Ga0496125_0156461 3300048928 Bacteria 1556
814 Ga0496126_0000113 3300048929 Bacteria 192212
815 Ga0496126_0000837 3300048929 Bacteria 54604
816 Ga0496126_0001389 3300048929 Bacteria 38297
817 Ga0496126_0001447 3300048929 Bacteria 37214
818 Ga0496126_0063154 3300048929 Bacteria 3320
819 Ga0496126_0093310 3300048929 Bacteria 2643
820 Ga0496126_0141114 3300048929 Bacteria 2074
821 Ga0496126_0379222 3300048929 Bacteria 1151
822 Ga0501306_011306 3300049127 Bacteria 1137
823 Ga0501310_008254 3300049130 Bacteria 1128
824 Ga0501304_004913 3300049160 Bacteria 1031
825 Ga0501307_011885 3300049162 Bacteria 1028
826 Ga0495682_0002192 3300049460 Bacteria 9453
827 Ga0501315_016195 3300049531 Bacteria 963
828 Ga0501324_002633 3300049540 Bacteria 1314
829 Ga0501324_003666 3300049540 Bacteria 1189
830 Ga0501036_0064815 3300049572 Bacteria 3092
831 Ga0501039_0221374 3300049575 Bacteria 1488
832 Ga0501042_0110916 3300049578 Bacteria 1975
833 Ga0501046_0060300 3300049580 Bacteria 2969
834 Ga0501075_0012498 3300049591 Bacteria 6036
835 Ga0501076_0002231 3300049592 Bacteria 13277
836 Ga0501077_0044776 3300049593 Bacteria 2811
837 Ga0501079_0005429 3300049741 Bacteria 9499
838 Ga0501080_0334394 3300049742 Bacteria 1369
839 nmdc:mga03n38_24630_c1 3300050490 Bacteria 2462
840 nmdc:mga00v17_231581_c1 3300050491 Bacteria 1197
841 nmdc:mga0k408_23202_c1 3300050493 Bacteria 3498
842 nmdc:mga0k408_2991_c1 3300050493 Bacteria 8962
843 nmdc:mga0k408_35008_c1 3300050493 Bacteria 2878
844 nmdc:mga06z11_17720_c1 3300050494 Bacteria 3239
845 nmdc:mga07m45_23200_c1 3300050496 Bacteria 3390
846 nmdc:mga05p37_559607_c1 3300050507 Bacteria 1300
847 nmdc:mga09592_11987_c1 3300050508 Bacteria 7051
848 nmdc:mga09592_70455_c1 3300050508 Bacteria 2967
849 nmdc:mga0qj67_106602_c1 3300050509 Bacteria 2261
850 nmdc:mga06r32_138352_c1 3300050510 Bacteria 2410
851 nmdc:mga08y16_493360_c1 3300050511 Bacteria 1245
852 nmdc:mga08y16_63983_c1 3300050511 Bacteria 3841
853 nmdc:mga0rr50_212668_c1 3300050513 Bacteria 1594
854 nmdc:mga0a205_10045_c1 3300050515 Bacteria 8686
855 nmdc:mga0a205_353408_c1 3300050515 Bacteria 1337
856 nmdc:mga0sz30_15904_c1 3300050516 Bacteria 2978
857 nmdc:mga0sz30_24420_c2 3300050516 Bacteria 1528
858 Ga0495601_0012010 3300053077 Bacteria 5189
859 Ga0495601_0013485 3300053077 Bacteria 4915
860 Ga0495601_0029907 3300053077 Bacteria 3381
861 Ga0495601_0041517 3300053077 Bacteria 2884
862 Ga0495601_0189851 3300053077 Bacteria 1343
863 Ga0495612_0008448 3300053078 Bacteria 4176
864 Ga0495595_0022118 3300053084 Bacteria 2787
865 Ga0495619_0004470 3300053085 Bacteria 8926
866 Ga0495619_0005558 3300053085 Bacteria 7999
867 Ga0495619_0007982 3300053085 Bacteria 6697
868 Ga0495619_0015724 3300053085 Bacteria 4791
869 Ga0495619_0124124 3300053085 Bacteria 1771
870 Ga0500595_000176 3300053119 Bacteria 42910
871 Ga0500595_000351 3300053119 Bacteria 30073
872 Ga0500616_0000002 3300053153 Bacteria 1611257
873 Ga0500616_0003816 3300053153 Bacteria 11177
874 Ga0500636_0024960 3300053177 Bacteria 3533
875 Ga0501084_0011217 3300054114 Bacteria 7421
876 Ga0501084_0457518 3300054114 Bacteria 1079
877 Ga0587093_001988 3300059478 Bacteria 1832
878 Ga0587090_005294 3300059510 Bacteria 1611
879 Ga0587071_001577 3300060344 Bacteria 2890
880 Ga0501082_0002439 3300060353 Bacteria 16314
881 Ga0530510_0000677 3300061734 Bacteria 21951
882 2508725853 2508501050 Bacteria 9633614
883 2511136520 2510917022 Bacteria 6504556
884 2511365544 2511231022 Bacteria 6719296
885 2552746356 2551306352 Bacteria 3873115
886 2555230674 2554235227 Bacteria 3637389
887 2555259590 2554235234 Bacteria 5762085
888 2585274321 2582581307 Bacteria 6597605
889 2585560770 2585427531 Bacteria 6992870
890 2586004351 2585427634 Bacteria 6455027
891 2599448446 2599185178 Bacteria 5365746
892 2599612082 2599185212 Bacteria 6765997
893 2599926441 2599185299 Bacteria 4854625
894 2599993028 2599185311 Bacteria 6354990
895 2600045346 2599185319 Bacteria 6637840
896 2600058108 2599185322 Bacteria 6763055
897 2600067832 2599185323 Bacteria 6688755
898 2603865580 2602042109 Bacteria 5152801
899 2616293067 2615840624 Bacteria 6557588
900 2637227415 2636415599 Bacteria 5718434
901 2640733298 2639762793 Bacteria 3943681
902 2644244039 2643221644 Bacteria 6865017
903 2650897185 2648501693 Bacteria 5069560
904 2678230339 2675903507 Bacteria 3737791
905 2686354093 2684622997 Bacteria 4624240
906 2691515519 2690315906 Bacteria 4517044
907 2707098147 2706794495 Bacteria 4536932
908 2739197266 2738543004 Bacteria 6381073
909 2753767746 2751185897 Bacteria 5322941
910 2774389113 2773857761 Bacteria 3837365
911 2774439304 2773857770 Bacteria 3911866
912 2776264921 2775506901 Bacteria 9631051
913 2777021785 2775507074 Bacteria 5532402
914 2793367600 2791355267 Bacteria 7222458
915 2809125646 2808606414 Bacteria 4917181
916 2809146961 2808606418 Bacteria 6724496
917 2812349100 2811994878 Bacteria 5992952
918 2817490222 2816332298 Bacteria 6852809
919 2819550701 2818991438 Bacteria 5793701
920 2819637267 2818991452 Bacteria 8442785
921 2819661446 2818991457 Bacteria 5323295
922 2825656979 2825651385 Bacteria 6715909
923 2834030485 2834028612 Bacteria 6354979
924 2840768215 2840764183 Bacteria 6358399
925 2847799052 2847797336 Bacteria 5176640
926 2852687308 2852684882 Bacteria 5463342
927 2863428056 2863421361 Bacteria 7300805
928 2891973150 2891968417 Bacteria 5821697
929 2894235509 2894232714 Bacteria 8834183
930 2900580474 2900577576 Bacteria 5438534
931 2902796426 2902792274 Bacteria 7270173
932 2904437097 2904434214 Bacteria 6230908
933 2904515755 2904513164 Bacteria 5476410
934 2904616196 2904615490 Bacteria 10047340
935 2904767151 2904765812 Bacteria 5369154
936 2904773903 2904770941 Bacteria 5580202
937 2913040572 2913036834 Bacteria 6704877
938 2919110088 2919108558 Bacteria 5897419
939 2919130925 2919130084 Bacteria 5301837
940 2919185376 2919182534 Bacteria 3907101
941 2919420407 2919420072 Bacteria 5390363
942 2919433835 2919432681 Bacteria 5390474
943 2919483417 2919481497 Bacteria 6907839
944 2919505036 2919501602 Bacteria 5286340
945 2926066713 2926063275 Bacteria 5285848
946 2928177934 2928170801 Bacteria 8785406
947 2928526439 2928521798 Bacteria 4960112
948 2929196162 2929195423 Bacteria 5325372
949 2945938975 2945934425 Bacteria 7444609
950 2969084454 2969079654 Bacteria 5439582
951 2971825381 2971820967 Bacteria 5823634
952 2984497456 2984494565 Bacteria 5000175
953 2984561569 2984559226 Bacteria 5683096
954 2984599634 2984595703 Bacteria 5682994
955 2990261407 2990261002 Bacteria 4919493
956 2990708975 2990703756 Bacteria 7715990
957 8002747519 8002745576 Bacteria 4840272
958 8004028256 8004025490 Bacteria 4327753
959 8018127435 8018127388 Bacteria 7351159
960 8021127151 8021120328 Bacteria 8782274
961 8021623681 8021622325 Bacteria 4844743
962 8021628705 8021626552 Bacteria 4665214
963 8021651535 8021648035 Bacteria 4772378
964 8055273068 8055266321 Bacteria 7999742
965 8055306949 8055301274 Bacteria 8587385
966 8056377545 8056375014 Bacteria 7006639
967 8057161172 8057160832 Bacteria 3268302
968 Ga0070665_100556001
969 SwRhRL2b_contig_1024214
970 SwRhRL2b_contig_1448349
971 SwRhRL2b_contig_1845099
972 SwRhRL2b_contig_2237776
973 SwRhRL2b_contig_42532
974 JGI24739J22299_10000367
975 JGI24034J26672_10004338
976 JGI24751J29686_10007770
977 JGI25156J39149_1000365
978 JGI25406J46586_10017074
979 JGI25153J46596_10000751
980 rootL2_10000529
981 rootH1_10012306
982 Ga0055533_1000469
983 Ga0055532_1000577
984 Ga0055527_1000866
985 Ga0055535_1001178
986 Ga0055535_1011754
987 Ga0055542_1001170
988 Ga0055529_1000817
989 Ga0055524_1007666
990 Ga0055528_1003975
991 Ga0055528_1012987
992 Ga0055528_1016714
993 Ga0055540_1000571
994 Ga0055531_10008799
995 Ga0058692_1000014
996 Ga0058692_1000028
997 Ga0058860_11916293
998 Ga0065703_1000280
999 Ga0065714_10002420
1000 Ga0065704_10000243
1001 Ga0065704_10000696
1002 Ga0065704_10070144
1003 Ga0065704_10070434
1004 Ga0065704_10070457
1005 Ga0070658_10015399
1006 Ga0070670_100011500
1007 Ga0070670_100019120
1008 Ga0070670_100021935
1009 Ga0070670_100074262
1010 Ga0070670_100113107
1011 Ga0070670_100117294
1012 Ga0070670_100175692
1013 Ga0068869_100174439
1014 Ga0070682_100074703
1015 Ga0068868_100022641
1016 Ga0068868_100320528
1017 Ga0070689_100015734
1018 Ga0070689_100211342
1019 Ga0070661_100127517
1020 Ga0070692_10123958
1021 Ga0070668_100004095
1022 Ga0070668_100013153
1023 Ga0070668_100014523
1024 Ga0070668_100017328
1025 Ga0070668_100017619
1026 Ga0070668_100046278
1027 Ga0070668_100062129
1028 Ga0070668_100109911
1029 Ga0070669_100000198
1030 Ga0070669_100008875
1031 Ga0070669_100010205
1032 Ga0070669_100010538
1033 Ga0070669_100020177
1034 Ga0070669_100031025
1035 Ga0070669_100137244
1036 Ga0070669_100353720
1037 Ga0070675_100035183
1038 Ga0070675_100074071
1039 Ga0070671_100000044
1040 Ga0070671_100001152
1041 Ga0070671_100014900
1042 Ga0070671_100023842
1043 Ga0070671_100053822
1044 Ga0070673_100014750
1045 Ga0070673_100108118
1046 Ga0070667_100000485
1047 Ga0070667_100004482
1048 Ga0070709_10448100
1049 Ga0070713_100000289
1050 Ga0070713_100072441
1051 Ga0070713_100075934
1052 Ga0070710_10027841
1053 Ga0070711_100056576
1054 Ga0070711_100058341
1055 Ga0070711_100064195
1056 Ga0070708_100066790
1057 Ga0070663_100028759
1058 Ga0070663_100100255
1059 Ga0070663_100185400
1060 Ga0070662_100128344
1061 Ga0070662_100198505
1062 Ga0068867_100026629
1063 Ga0070685_10072180
1064 Ga0070685_10174814
1065 Ga0070706_100025076
1066 Ga0070699_100053313
1067 Ga0070672_100036248
1068 Ga0070672_100059975
1069 Ga0070693_100119230
1070 Ga0070665_100000878
1071 Ga0070665_100003594
1072 Ga0070665_100034401
1073 Ga0070665_100097495
1074 Ga0070665_100141383
1075 Ga0070665_100191133
1076 Ga0070665_100205038
1077 Ga0070665_100299023
1078 Ga0068855_100000037
1079 Ga0068855_100020370
1080 Ga0070664_100032779
1081 Ga0068857_100002837
1082 Ga0068854_100357091
1083 Ga0068856_100154509
1084 Ga0068852_100273399
1085 Ga0068859_100042732
1086 Ga0068859_100098143
1087 Ga0068859_100251484
1088 Ga0068859_100411617
1089 Ga0068864_100010805
1090 Ga0068864_100083125
1091 Ga0068864_100169922
1092 Ga0068861_100269451
1093 Ga0068861_100341983
1094 Ga0068870_10023888
1095 Ga0068863_100009249
1096 Ga0068863_100010052
1097 Ga0068863_100040210
1098 Ga0068863_100065603
1099 Ga0068858_100006378
1100 Ga0068858_100038154
1101 Ga0068858_100063792
1102 Ga0068860_100004982
1103 Ga0068860_100007867
1104 Ga0068860_100050953
1105 Ga0068860_100151415
1106 Ga0068860_100251985
1107 Ga0068860_100467543
1108 Ga0068862_100011964
1109 Ga0068862_100012903
1110 Ga0068862_100030283
1111 Ga0068862_100073070
1112 Ga0068862_100076885
1113 Ga0068862_100084915
1114 Ga0081455_10015596
1115 Ga0081540_1000175
1116 Ga0081540_1022037
1117 Ga0081539_10004485
1118 Ga0081539_10073243
1119 Ga0075363_100014851
1120 Ga0075363_100040205
1121 Ga0075363_100125773
1122 Ga0075364_10050785
1123 Ga0075432_10009478
1124 Ga0075432_10010009
1125 Ga0070716_100035078
1126 Ga0075362_10017169
1127 Ga0075367_10020906
1128 Ga0075367_10053954
1129 Ga0075369_10016219
1130 Ga0075369_10019958
1131 Ga0075366_10000419
1132 Ga0075366_10011020
1133 Ga0075366_10015917
1134 Ga0075366_10054373
1135 Ga0075370_10035756
1136 Ga0075370_10211532
1137 Ga0075428_100068666
1138 Ga0075430_100011408
1139 Ga0075430_100129615
1140 Ga0075430_100138678
1141 Ga0075431_100300468
1142 Ga0075433_10016630
1143 Ga0075434_100001356
1144 Ga0075434_100296667
1145 Ga0075429_100016836
1146 Ga0097620_100042731
1147 Ga0097620_100098144
1148 Ga0097620_100251475
1149 Ga0097620_100411614
1150 Ga0099823_1000033
1151 Ga0099794_10002464
1152 Ga0105251_10000075
1153 Ga0105251_10000239
1154 Ga0105251_10001294
1155 Ga0105251_10001422
1156 Ga0105251_10001607
1157 Ga0105251_10002112
1158 Ga0105251_10013543
1159 Ga0105251_10024951
1160 Ga0105251_10025991
1161 Ga0105251_10032576
1162 Ga0105244_10005583
1163 Ga0105250_10002874
1164 Ga0105250_10003656
1165 Ga0105240_10023443
1166 Ga0111539_10562013
1167 Ga0105245_10037563
1168 Ga0105247_10004686
1169 Ga0105247_10034631
1170 Ga0105243_10000249
1171 Ga0105243_10015538
1172 Ga0105243_10023100
1173 Ga0105243_10023311
1174 Ga0105248_10003673
1175 Ga0105248_10014957
1176 Ga0105248_10042429
1177 Ga0105248_10126471
1178 Ga0105248_10156962
1179 Ga0105248_10157398
1180 Ga0105248_10403316
1181 Ga0105237_10024655
1182 Ga0105237_10509750
1183 Ga0105238_10028042
1184 Ga0105249_10010654
1185 Ga0105249_10226790
1186 Ga0105148_100125
1187 Ga0105148_102481
1188 Ga0099796_10021889
1189 Ga0105239_10001024
1190 Ga0105239_10200367
1191 Ga0105239_10339797
1192 Ga0105246_10019597
1193 Ga0157370_10007312
1194 Ga0157369_10196540
1195 Ga0157369_10405814
1196 Ga0157374_10159694
1197 Ga0157374_10431268
1198 Ga0157374_10626342
1199 Ga0163162_10000398
1200 Ga0163162_10014417
1201 Ga0163162_10037551
1202 Ga0163162_10107352
1203 Ga0163162_10172008
1204 Ga0163162_10340260
1205 Ga0157372_10274997
1206 Ga0157375_10039196
1207 Ga0163163_10026334
1208 Ga0163163_10096555
1209 Ga0157380_10000081
1210 Ga0157380_10114610
1211 Ga0157377_10195811
1212 Ga0157379_10140333
1213 Ga0157379_10194644
1214 Ga0182007_10004297
1215 Ga0163161_10000427
1216 Ga0163161_10011170
1217 Ga0163161_10028287
1218 Ga0163161_10181101
1219 Ga0163161_10213310
1220 Ga0206355_1050631
1221 Ga0206354_11554051
1222 Ga0224712_10150079
1223 Ga0209674_100049
1224 Ga0209672_100097
1225 Ga0209147_100106
1226 Ga0209258_100157
1227 Ga0209258_101138
1228 Ga0209258_107071
1229 Ga0209148_1000150
1230 Ga0209759_1000041
1231 Ga0209455_1000132
1232 Ga0209673_1000324
1233 Ga0209673_1001616
1234 Ga0209673_1003540
1235 Ga0209673_1003939
1236 Ga0209564_1011053
1237 Ga0209758_1000382
1238 Ga0209758_1004836
1239 Ga0209050_1002396
1240 Ga0209050_1021597
1241 Ga0209256_1001786
1242 Ga0209051_1000462
1243 Ga0209051_1002774
1244 Ga0209257_1001143
1245 Ga0209257_1009675
1246 Ga0207696_1001489
1247 Ga0207696_1002726
1248 Ga0207696_1025010
1249 Ga0207655_1000327
1250 Ga0207655_1000339
1251 Ga0207713_1000038
1252 Ga0207713_1001016
1253 Ga0207713_1003536
1254 Ga0207713_1006052
1255 Ga0207713_1007177
1256 Ga0207713_1007672
1257 Ga0207713_1010855
1258 Ga0207710_10001632
1259 Ga0207710_10052925
1260 Ga0207680_10057312
1261 Ga0207680_10315771
1262 Ga0207685_10018230
1263 Ga0207645_10089515
1264 Ga0207645_10131205
1265 Ga0207643_10031355
1266 Ga0207705_10005976
1267 Ga0207705_10249496
1268 Ga0207695_10014875
1269 Ga0207695_10064490
1270 Ga0207671_10017485
1271 Ga0207671_10133716
1272 Ga0207671_10366936
1273 Ga0207693_10033688
1274 Ga0207693_10058144
1275 Ga0207693_10351693
1276 Ga0207663_10074208
1277 Ga0207663_10205893
1278 Ga0207662_10018677
1279 Ga0207657_10088952
1280 Ga0207649_10301479
1281 Ga0207681_10000177
1282 Ga0207681_10010161
1283 Ga0207681_10036366
1284 Ga0207681_10052906
1285 Ga0207694_10202000
1286 Ga0207694_10329011
1287 Ga0207650_10002502
1288 Ga0207650_10011955
1289 Ga0207650_10012392
1290 Ga0207650_10038911
1291 Ga0207650_10208193
1292 Ga0207659_10011480
1293 Ga0207659_10138200
1294 Ga0207687_10017974
1295 Ga0207700_10000071
1296 Ga0207700_10057725
1297 Ga0207644_10000080
1298 Ga0207644_10000766
1299 Ga0207644_10002305
1300 Ga0207644_10017094
1301 Ga0207644_10040520
1302 Ga0207644_10056327
1303 Ga0207690_10225262
1304 Ga0207706_10022990
1305 Ga0207706_10081730
1306 Ga0207706_10379492
1307 Ga0207709_10000001
1308 Ga0207709_10003040
1309 Ga0207709_10032763
1310 Ga0207709_10034026
1311 Ga0207670_10074057
1312 Ga0207670_10113520
1313 Ga0207669_10035112
1314 Ga0207669_10084002
1315 Ga0207691_10070957
1316 Ga0207691_10407052
1317 Ga0207711_10003533
1318 Ga0207711_10009758
1319 Ga0207711_10020446
1320 Ga0207711_10282102
1321 Ga0207689_10138058
1322 Ga0207689_10373778
1323 Ga0207679_10077238
1324 Ga0207679_10536605
1325 Ga0207667_10000053
1326 Ga0207667_10001176
1327 Ga0207651_10038654
1328 Ga0207651_10070979
1329 Ga0207651_10233357
1330 Ga0207712_10005748
1331 Ga0207712_10101710
1332 Ga0207668_10004844
1333 Ga0207668_10021228
1334 Ga0207668_10021701
1335 Ga0207668_10034036
1336 Ga0207668_10082720
1337 Ga0207640_10246346
1338 Ga0207658_10000213
1339 Ga0207658_10003133
1340 Ga0207703_10035852
1341 Ga0207703_10052382
1342 Ga0207639_10274664
1343 Ga0207678_10124403
1344 Ga0207678_10130582
1345 Ga0207678_10210463
1346 Ga0207641_10003981
1347 Ga0207641_10020272
1348 Ga0207641_10032484
1349 Ga0207641_10050190
1350 Ga0207648_10093070
1351 Ga0207648_10477397
1352 Ga0207676_10014487
1353 Ga0207676_10068794
1354 Ga0207674_10022818
1355 Ga0207674_10179237
1356 Ga0207675_100001472
1357 Ga0207675_100052226
1358 Ga0207675_100126177
1359 Ga0207675_100245502
1360 Ga0207683_10221060
1361 Ga0207683_10259477
1362 Ga0207698_10200048
1363 Ga0207698_10256724
1364 Ga0209389_1005072
1365 Ga0209371_1000025
1366 Ga0209371_1000040
1367 Ga0209371_1000259
1368 Ga0209371_1000604
1369 Ga0209588_1000642
1370 Ga0268266_10001045
1371 Ga0268266_10002815
1372 Ga0268266_10042995
1373 Ga0268266_10074285
1374 Ga0268266_10211819
1375 Ga0268266_10258706
1376 Ga0268266_10418653
1377 Ga0268265_10000218
1378 Ga0268265_10026965
1379 Ga0268265_10045029
1380 Ga0268265_10047013
1381 Ga0268265_10058166
1382 Ga0268265_10080942
1383 Ga0268265_10309660
1384 Ga0268264_10002221
1385 Ga0268264_10003005
1386 Ga0268264_10028441
1387 Ga0268264_10546447
1388 Ga0307515_10001534
1389 Ga0268256_1000027
1390 Ga0268256_1000041
1391 Ga0268256_1000233
1392 Ga0268256_1000510
1393 Ga0265330_10051485
1394 Ga0265332_10011181
1395 Ga0307513_10440403
1396 Ga0307408_100002383
1397 Ga0307408_100016611
1398 Ga0307408_100057979
1399 Ga0307408_100071439
1400 Ga0307408_100132766
1401 Ga0307408_100268014
1402 Ga0307405_10051184
1403 Ga0307405_10134869
1404 Ga0307413_10030443
1405 Ga0307413_10058751
1406 Ga0307413_10076889
1407 Ga0307413_10386825
1408 Ga0307410_10008484
1409 Ga0307410_10028554
1410 Ga0307410_10085192
1411 Ga0307410_10223043
1412 Ga0307410_10264875
1413 Ga0307410_10287293
1414 Ga0307406_10232960
1415 Ga0307406_10461950
1416 Ga0307407_10008019
1417 Ga0307407_10031390
1418 Ga0307407_10354241
1419 Ga0307412_10000015
1420 Ga0307412_10017164
1421 Ga0307412_10104590
1422 Ga0307412_10257455
1423 Ga0307409_100026764
1424 Ga0307409_100176283
1425 Ga0307409_100339081
1426 Ga0307409_100417644
1427 Ga0307416_100013635
1428 Ga0307416_100091117
1429 Ga0307414_10544612
1430 Ga0307415_100009223
1431 Ga0316593_10002636
1432 Ga0316593_10012634
1433 Ga0316593_10094855
1434 Ga0316592_1001937
1435 Ga0316592_1007064
1436 Ga0316592_1008227
1437 Ga0316588_1015147
1438 Ga0316596_1011671
1439 Ga0373926_0048813
1440 Ga0373926_0101378
1441 Ga0373923_0027239
1442 Ga0373936_0019183
1443 Ga0373945_0011383
1444 Ga0373953_0009240
1445 Ga0373954_0003072
1446 Ga0373954_0067827
1447 Ga0373943_0016830
1448 Ga0373946_0011243
1449 Ga0373946_0034050
1450 Ga0373955_0004841
1451 Ga0316574_0002172
1452 Ga0316574_0058353
1453 Ga0373935_0027481
1454 Ga0373935_0045369
1455 Ga0373935_0128848
1456 Ga0373927_0018924
1457 Ga0373927_0024801
1458 Ga0373927_0185870
1459 Ga0373933_0058601
1460 Ga0373947_0011648
1461 Ga0373947_0045708
1462 Ga0373937_0022427
1463 Ga0373937_0040021
1464 Ga0373937_0316220
1465 Ga0395899_0002992
1466 Ga0395899_0024573
1467 Ga0395899_0047828
1468 Ga0395899_0057145
1469 Ga0395899_0218317
1470 Ga0395900_0008700
1471 Ga0395900_0017614
1472 Ga0395900_0072067
1473 Ga0395900_0173016
1474 Ga0395900_0254885
1475 Ga0395898_0006782
1476 Ga0395898_0014126
1477 Ga0395898_0083465
1478 Ga0395898_0181688
1479 Ga0395898_0390286
1480 Ga0395905_0002322
1481 Ga0395905_0003918
1482 Ga0395905_0009494
1483 Ga0395905_0109828
1484 Ga0395901_0005411
1485 Ga0395901_0066588
1486 Ga0395901_0347415
1487 Ga0436361_0370358
1488 Ga0436363_0686554
1489 Ga0439436_0005519
1490 Ga0439436_0005596
1491 Ga0439436_0051288
1492 Ga0439436_0056261
1493 Ga0439438_005139
1494 Ga0439438_022614
1495 Ga0439439_0000787
1496 Ga0439439_0010348
1497 Ga0439466_0007836
1498 Ga0439466_0009017
1499 Ga0451793_1176449
1500 Ga0451795_1559355
1501 Ga0451839_0004112
1502 Ga0439433_0002116
1503 Ga0439433_0004175
1504 Ga0439433_0013928
1505 Ga0439432_000130
1506 Ga0439449_0010688
1507 Ga0439449_0069846
1508 Ga0439451_000493
1509 Ga0439451_004046
1510 Ga0439452_000001
1511 Ga0439452_042071
1512 Ga0439456_000597
1513 Ga0439456_001303
1514 Ga0439457_003680
1515 Ga0439463_000469
1516 Ga0439463_001793
1517 Ga0450919_000409
1518 Ga0450920_000642
1519 Ga0450898_017965
1520 Ga0450906_002930
1521 Ga0450908_008554
1522 Ga0450909_001461
1523 Ga0439434_0002748
1524 Ga0439434_0010454
1525 Ga0439434_0017534
1526 Ga0439459_0018379
1527 Ga0450918_000078
1528 Ga0450918_006741
1529 Ga0450893_0012673
1530 Ga0466986_0000518
1531 Ga0466972_0000427
1532 Ga0466972_0011719
1533 Ga0466965_0177323
1534 Ga0466966_0026078
1535 Ga0466966_0113509
1536 Ga0466961_0000053
1537 Ga0466961_0021527
1538 Ga0466963_0035631
1539 Ga0466968_0003097
1540 Ga0466970_0000057
1541 Ga0466970_0007989
1542 Ga0466959_0001715
1543 Ga0466959_0164799
1544 Ga0466967_0016266
1545 Ga0495592_0009546
1546 Ga0495592_0012268
1547 Ga0495592_0031919
1548 Ga0495592_0059500
1549 Ga0495592_0233704
1550 Ga0495603_0012824
1551 Ga0495603_0059203
1552 Ga0495590_0060064
1553 Ga0495629_0018239
1554 Ga0495629_0034343
1555 Ga0495641_0003517
1556 Ga0495641_0014889
1557 Ga0495651_0023866
1558 Ga0495651_0050593
1559 Ga0495651_0172312
1560 Ga0495651_0197068
1561 Ga0495653_0011267
1562 Ga0495653_0028059
1563 Ga0495653_0035346
1564 Ga0495653_0050594
1565 Ga0495580_0010680
1566 Ga0495580_0034339
1567 Ga0495580_0099894
1568 Ga0495582_0049291
1569 Ga0495605_0140857
1570 Ga0495639_0014797
1571 Ga0495639_0015417
1572 Ga0495662_0030700
1573 Ga0495664_0268527
1574 Ga0495594_0014756
1575 Ga0495608_0014921
1576 Ga0495608_0021592
1577 Ga0495618_0009337
1578 Ga0495628_0026376
1579 Ga0495628_0066603
1580 Ga0495628_0123729
1581 Ga0495630_0096720
1582 Ga0495630_0202698
1583 Ga0495643_0019784
1584 Ga0495666_0028998
1585 Ga0495642_0006593
1586 Ga0495652_0016270
1587 Ga0495652_0024838
1588 Ga0495652_0036216
1589 Ga0495652_0095683
1590 Ga0495665_0060245
1591 Ga0495665_0119539
1592 Ga0495640_0013821
1593 Ga0495640_0019133
1594 Ga0495587_0024465
1595 Ga0495587_0030508
1596 Ga0495597_0000102
1597 Ga0495645_0019292
1598 Ga0495667_0015567
1599 Ga0495667_0021890
1600 Ga0495656_0097898
1601 Ga0495656_0213869
1602 Ga0495668_0000020
1603 Ga0495668_0011692
1604 Ga0495634_0012821
1605 Ga0495634_0019336
1606 Ga0495634_0024572
1607 Ga0495634_0067823
1608 Ga0495635_0012490
1609 Ga0495635_0030818
1610 Ga0495635_0042929
1611 Ga0495661_0009296
1612 Ga0495657_0007494
1613 Ga0495657_0025296
1614 Ga0495657_0071180
1615 Ga0495657_0168811
1616 Ga0495599_0006520
1617 Ga0495599_0039811
1618 Ga0495623_0006249
1619 Ga0495646_0027875
1620 Ga0495646_0062282
1621 Ga0495646_0084386
1622 Ga0495647_0016556
1623 Ga0495658_0006869
1624 Ga0495658_0092091
1625 Ga0495613_0069830
1626 Ga0495613_0149215
1627 Ga0495613_0180350
1628 Ga0495624_0001476
1629 Ga0495624_0002969
1630 Ga0495624_0024218
1631 Ga0495624_0042860
1632 Ga0495589_0000091
1633 Ga0495600_0010245
1634 Ga0495600_0071471
1635 Ga0495581_0041039
1636 Ga0495604_0006471
1637 Ga0495604_0013652
1638 Ga0495604_0018787
1639 Ga0495604_0028182
1640 Ga0495674_0009452
1641 Ga0495674_0011849
1642 Ga0495674_0014791
1643 Ga0495674_0032997
1644 Ga0495674_0315848
1645 Ga0495676_0002631
1646 Ga0495676_0007948
1647 Ga0495676_0042145
1648 Ga0495680_0024592
1649 Ga0495680_0046045
1650 Ga0495680_0070688
1651 Ga0495680_0117713
1652 Ga0495687_014386
1653 Ga0495675_0016865
1654 Ga0495684_0005133
1655 Ga0495684_0006871
1656 Ga0495684_0020155
1657 Ga0495684_0023268
1658 Ga0495684_0024746
1659 Ga0495593_0012276
1660 Ga0495593_0035643
1661 Ga0495602_0004743
1662 Ga0495602_0014752
1663 Ga0495602_0030617
1664 Ga0495602_0037302
1665 Ga0495602_0039196
1666 Ga0495602_0312836
1667 Ga0495602_0349409
1668 Ga0495614_0058969
1669 Ga0495614_0179865
1670 Ga0496100_0035948
1671 Ga0496100_0110286
1672 Ga0496101_0000731
1673 Ga0496101_0030130
1674 Ga0496102_0000056
1675 Ga0496102_0000174
1676 Ga0496102_0000484
1677 Ga0496102_0037136
1678 Ga0496102_0252967
1679 Ga0496102_0274076
1680 Ga0496102_0563993
1681 Ga0496103_0000040
1682 Ga0496103_0000320
1683 Ga0496103_0158216
1684 Ga0496104_0000282
1685 Ga0496104_0052036
1686 Ga0496104_0254514
1687 Ga0496104_0389821
1688 Ga0496105_0000136
1689 Ga0496105_0000423
1690 Ga0496105_0002210
1691 Ga0496105_0076506
1692 Ga0496105_0104763
1693 Ga0496106_0020159
1694 Ga0496106_0124626
1695 Ga0496106_0519628
1696 Ga0496107_0017622
1697 Ga0496107_0139725
1698 Ga0496107_0367450
1699 Ga0496108_0003089
1700 Ga0496108_0030847
1701 Ga0496108_0121995
1702 Ga0496108_0170890
1703 Ga0496108_0216249
1704 Ga0496109_0042830
1705 Ga0496110_0036175
1706 Ga0496110_0092722
1707 Ga0496111_0015171
1708 Ga0496112_0005743
1709 Ga0496112_0039026
1710 Ga0496112_0039083
1711 Ga0496112_0269203
1712 Ga0496113_0000119
1713 Ga0496113_0028553
1714 Ga0496114_0014125
1715 Ga0496114_0441263
1716 Ga0496115_0000009
1717 Ga0496115_0110909
1718 Ga0496115_0153409
1719 Ga0496115_0179409
1720 Ga0496116_0000056
1721 Ga0496116_0000110
1722 Ga0496116_0008516
1723 Ga0496116_0014709
1724 Ga0496116_0051874
1725 Ga0496117_0000003
1726 Ga0496117_0000354
1727 Ga0496117_0000802
1728 Ga0496117_0005072
1729 Ga0496117_0008930
1730 Ga0496117_0019332
1731 Ga0496117_0052166
1732 Ga0496118_0000001
1733 Ga0496118_0000077
1734 Ga0496118_0000310
1735 Ga0496118_0006305
1736 Ga0496118_0008850
1737 Ga0496118_0009737
1738 Ga0496118_0011094
1739 Ga0496118_0017185
1740 Ga0496119_0000263
1741 Ga0496119_0000648
1742 Ga0496119_0000754
1743 Ga0496119_0086342
1744 Ga0496120_0000318
1745 Ga0496120_0000689
1746 Ga0496120_0000749
1747 Ga0496120_0090099
1748 Ga0496121_0000121
1749 Ga0496121_0000432
1750 Ga0496121_0000984
1751 Ga0496121_0002135
1752 Ga0496121_0005637
1753 Ga0496121_0005718
1754 Ga0496121_0007340
1755 Ga0496121_0012058
1756 Ga0496122_0001087
1757 Ga0496122_0001497
1758 Ga0496122_0008986
1759 Ga0496122_0090011
1760 Ga0496122_0197494
1761 Ga0496123_0000889
1762 Ga0496123_0001632
1763 Ga0496124_0000050
1764 Ga0496124_0000219
1765 Ga0496124_0001992
1766 Ga0496124_0003260
1767 Ga0496124_0006361
1768 Ga0496124_0012220
1769 Ga0496124_0036067
1770 Ga0496124_0062622
1771 Ga0496124_0080025
1772 Ga0496125_0000114
1773 Ga0496125_0000796
1774 Ga0496125_0001252
1775 Ga0496125_0005292
1776 Ga0496125_0006057
1777 Ga0496125_0025241
1778 Ga0496125_0030371
1779 Ga0496125_0089350
1780 Ga0496125_0156461
1781 Ga0496126_0000113
1782 Ga0496126_0000837
1783 Ga0496126_0001389
1784 Ga0496126_0001447
1785 Ga0496126_0063154
1786 Ga0496126_0093310
1787 Ga0496126_0141114
1788 Ga0496126_0379222
1789 Ga0501306_011306
1790 Ga0501310_008254
1791 Ga0501304_004913
1792 Ga0501307_011885
1793 Ga0495682_0002192
1794 Ga0501315_016195
1795 Ga0501324_002633
1796 Ga0501324_003666
1797 Ga0501036_0064815
1798 Ga0501039_0221374
1799 Ga0501042_0110916
1800 Ga0501046_0060300
1801 Ga0501075_0012498
1802 Ga0501076_0002231
1803 Ga0501077_0044776
1804 Ga0501079_0005429
1805 Ga0501080_0334394
1806 nmdc:mga03n38_24630_c1
1807 nmdc:mga00v17_231581_c1
1808 nmdc:mga0k408_23202_c1
1809 nmdc:mga0k408_2991_c1
1810 nmdc:mga0k408_35008_c1
1811 nmdc:mga06z11_17720_c1
1812 nmdc:mga07m45_23200_c1
1813 nmdc:mga05p37_559607_c1
1814 nmdc:mga09592_11987_c1
1815 nmdc:mga09592_70455_c1
1816 nmdc:mga0qj67_106602_c1
1817 nmdc:mga06r32_138352_c1
1818 nmdc:mga08y16_493360_c1
1819 nmdc:mga08y16_63983_c1
1820 nmdc:mga0rr50_212668_c1
1821 nmdc:mga0a205_10045_c1
1822 nmdc:mga0a205_353408_c1
1823 nmdc:mga0sz30_15904_c1
1824 nmdc:mga0sz30_24420_c2
1825 Ga0495601_0012010
1826 Ga0495601_0013485
1827 Ga0495601_0029907
1828 Ga0495601_0041517
1829 Ga0495601_0189851
1830 Ga0495612_0008448
1831 Ga0495595_0022118
1832 Ga0495619_0004470
1833 Ga0495619_0005558
1834 Ga0495619_0007982
1835 Ga0495619_0015724
1836 Ga0495619_0124124
1837 Ga0500595_000176
1838 Ga0500595_000351
1839 Ga0500616_0000002
1840 Ga0500616_0003816
1841 Ga0500636_0024960
1842 Ga0501084_0011217
1843 Ga0501084_0457518
1844 Ga0587093_001988
1845 Ga0587090_005294
1846 Ga0587071_001577
1847 Ga0501082_0002439
1848 Ga0530510_0000677
1849 2508725853
1850 2511136520
1851 2511365544
1852 2552746356
1853 2555230674
1854 2555259590
1855 2585274321
1856 2585560770
1857 2586004351
1858 2599448446
1859 2599612082
1860 2599926441
1861 2599993028
1862 2600045346
1863 2600058108
1864 2600067832
1865 2603865580
1866 2616293067
1867 2637227415
1868 2640733298
1869 2644244039
1870 2650897185
1871 2678230339
1872 2686354093
1873 2691515519
1874 2707098147
1875 2739197266
1876 2753767746
1877 2774389113
1878 2774439304
1879 2776264921
1880 2777021785
1881 2793367600
1882 2809125646
1883 2809146961
1884 2812349100
1885 2817490222
1886 2819550701
1887 2819637267
1888 2819661446
1889 2825656979
1890 2834030485
1891 2840768215
1892 2847799052
1893 2852687308
1894 2863428056
1895 2891973150
1896 2894235509
1897 2900580474
1898 2902796426
1899 2904437097
1900 2904515755
1901 2904616196
1902 2904767151
1903 2904773903
1904 2913040572
1905 2919110088
1906 2919130925
1907 2919185376
1908 2919420407
1909 2919433835
1910 2919483417
1911 2919505036
1912 2926066713
1913 2928177934
1914 2928526439
1915 2929196162
1916 2945938975
1917 2969084454
1918 2971825381
1919 2984497456
1920 2984561569
1921 2984599634
1922 2990261407
1923 2990708975
1924 8002747519
1925 8004028256
1926 8018127435
1927 8021127151
1928 8021623681
1929 8021628705
1930 8021651535
1931 8055273068
1932 8055306949
1933 8056377545
1934 8057161172

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

5

88

0.93

PF00701

DHDPS

Dihydrodipicolinate synthetase family

97

281

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c54-assembly2.cif.gz_G crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum 0.8461 28 290
5c55-assembly1.cif.gz_A crystal structure of the y138f mutant of c.glutamicum n-acetylneuraminic acid lyase in complex with pyruvate 0.8331 28 290
3pb0-assembly4.cif.gz_D characterisation of the first monomeric dihydrodipicolinate synthase variant reveals evolutionary insights 0.8319 28 294
1f5z-assembly1.cif.gz_C crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i 0.8257 24 289
5c54-assembly1.cif.gz_D crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum 0.8236 28 290
ID Description Score Start End Superfamily
5c54C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8456 28 290 3.20.20.70
4xkyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8143 29 292 3.20.20.70
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8015 28 294 3.20.20.70
3s5oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7952 28 294 3.20.20.70
4ah7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7951 27 292 3.20.20.70
ID Description Score Start End GO Terms
AF-H0FUD8-F1-model_v4 Dihydrodipicolinate synthetase 0.952 204 292
AF-A0A4S9Y1N8-F1-model_v4 Aldolase 0.9363 142 293 GO:0008840
AF-A0A0K2RB42-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.936 214 294 GO:0016829
AF-A0A354Y9G7-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9267 146 262 GO:0008840
AF-A0A6H9SBS6-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9262 95 266 GO:0008840

Map