F487015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 967 | 472 | 1934 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100556001|Ga0070665_1005560011 |
| Length | 291 |
| Sequence | MTSLDLRGLNPAPITPFTRDGAVDYDAIQRLGSWLGSIDGVKSLTVLGHAGEGTFLTQDEQVRVIGAFKESVDGKLPIGASAGLVYPSHGWLRFGYQDGAPQDRYRALHEGSGLPLILFQYPDVTKATYNLDTQLEIAAQDGVFATKNGVRNMRRWDREIPVLRKENPDLQILSCHDEYLLHTMFDVDGLLVGYGGLAPEPLVELIAAGKARDYPAARALHDRLLPVTATVYHRGSHMEGTVALKEGLVHRGILEHATVRSPLLPLAPGAHEEIAAALDSAGLGSVVPALV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 22 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 230 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 231 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 232 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 233 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 238 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 239 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 240 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 241 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 242 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 243 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 244 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 245 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 246 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 247 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 248 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 249 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 250 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 251 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 252 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 253 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 254 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 255 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 261 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 325 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 326 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 335 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 336 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 337 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 338 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 341 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 342 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 343 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 380 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 387 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 388 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 389 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 390 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 391 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 392 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 393 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 394 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 395 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 396 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 397 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 398 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 399 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 400 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 401 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 402 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 403 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 404 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 405 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 406 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 407 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 408 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 409 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 410 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 411 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 412 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 413 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 414 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 415 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 416 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 417 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 418 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 419 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 420 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 421 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 422 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 423 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 424 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 425 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 426 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 427 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 428 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 429 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 430 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 431 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 432 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 433 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 434 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 435 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 436 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 437 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 438 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 439 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 440 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 441 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 442 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 443 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 444 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 445 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 446 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 447 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 448 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 449 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 450 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 451 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 452 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 453 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 454 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 455 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 456 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 457 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 458 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 459 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 460 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 461 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 462 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 463 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 464 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 465 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 466 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 467 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 468 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 469 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 470 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 471 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 472 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.83 |
| Metatranscriptomes | 2.28 |
| Isolates | 8.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0 |
| Endosphere | 6.72 |
| Nodule | 1.24 |
| Rhizoplane | 6.31 |
| Rhizosphere | 74.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070665_100556001 | 3300005548 | Bacteria | 1160 |
| 2 | SwRhRL2b_contig_1024214 | 2162886007 | Bacteria | 6871 |
| 3 | SwRhRL2b_contig_1448349 | 2162886007 | Bacteria | 21841 |
| 4 | SwRhRL2b_contig_1845099 | 2162886007 | Bacteria | 4827 |
| 5 | SwRhRL2b_contig_2237776 | 2162886007 | Bacteria | 72079 |
| 6 | SwRhRL2b_contig_42532 | 2162886007 | Bacteria | 5384 |
| 7 | JGI24739J22299_10000367 | 3300001989 | Bacteria | 15471 |
| 8 | JGI24034J26672_10004338 | 3300002239 | Bacteria | 2006 |
| 9 | JGI24751J29686_10007770 | 3300002459 | Bacteria | 2191 |
| 10 | JGI25156J39149_1000365 | 3300002705 | Bacteria | 29267 |
| 11 | JGI25406J46586_10017074 | 3300003203 | Bacteria | 3007 |
| 12 | JGI25153J46596_10000751 | 3300003215 | Bacteria | 19822 |
| 13 | rootL2_10000529 | 3300003322 | Bacteria | 63830 |
| 14 | rootH1_10012306 | 3300003323 | Bacteria | 24318 |
| 15 | Ga0055533_1000469 | 3300003756 | Bacteria | 15224 |
| 16 | Ga0055532_1000577 | 3300003758 | Bacteria | 15091 |
| 17 | Ga0055527_1000866 | 3300003760 | Bacteria | 7868 |
| 18 | Ga0055535_1001178 | 3300003761 | Bacteria | 15112 |
| 19 | Ga0055535_1011754 | 3300003761 | Bacteria | 1367 |
| 20 | Ga0055542_1001170 | 3300003762 | Bacteria | 15112 |
| 21 | Ga0055529_1000817 | 3300003763 | Bacteria | 18688 |
| 22 | Ga0055524_1007666 | 3300003775 | Bacteria | 4561 |
| 23 | Ga0055528_1003975 | 3300003790 | Bacteria | 7237 |
| 24 | Ga0055528_1012987 | 3300003790 | Eukaryota | 3193 |
| 25 | Ga0055528_1016714 | 3300003790 | Bacteria | 2579 |
| 26 | Ga0055540_1000571 | 3300003792 | Bacteria | 27072 |
| 27 | Ga0055531_10008799 | 3300003794 | Bacteria | 5260 |
| 28 | Ga0058692_1000014 | 3300003856 | Bacteria | 313984 |
| 29 | Ga0058692_1000028 | 3300003856 | Bacteria | 193757 |
| 30 | Ga0058860_11916293 | 3300004801 | Bacteria | 1742 |
| 31 | Ga0065703_1000280 | 3300005272 | Bacteria | 23631 |
| 32 | Ga0065714_10002420 | 3300005288 | Bacteria | 27261 |
| 33 | Ga0065704_10000243 | 3300005289 | Bacteria | 54713 |
| 34 | Ga0065704_10000696 | 3300005289 | Bacteria | 13952 |
| 35 | Ga0065704_10070144 | 3300005289 | Bacteria | 333223 |
| 36 | Ga0065704_10070434 | 3300005289 | Bacteria | 25013 |
| 37 | Ga0065704_10070457 | 3300005289 | Bacteria | 24058 |
| 38 | Ga0070658_10015399 | 3300005327 | Bacteria | 6120 |
| 39 | Ga0070670_100011500 | 3300005331 | Bacteria | 7571 |
| 40 | Ga0070670_100019120 | 3300005331 | Bacteria | 5874 |
| 41 | Ga0070670_100021935 | 3300005331 | Bacteria | 5494 |
| 42 | Ga0070670_100074262 | 3300005331 | Bacteria | 2921 |
| 43 | Ga0070670_100113107 | 3300005331 | Bacteria | 2340 |
| 44 | Ga0070670_100117294 | 3300005331 | Bacteria | 2296 |
| 45 | Ga0070670_100175692 | 3300005331 | Bacteria | 1859 |
| 46 | Ga0068869_100174439 | 3300005334 | Bacteria | 1681 |
| 47 | Ga0070682_100074703 | 3300005337 | Bacteria | 2177 |
| 48 | Ga0068868_100022641 | 3300005338 | Bacteria | 4746 |
| 49 | Ga0068868_100320528 | 3300005338 | Bacteria | 1320 |
| 50 | Ga0070689_100015734 | 3300005340 | Bacteria | 5524 |
| 51 | Ga0070689_100211342 | 3300005340 | Bacteria | 1588 |
| 52 | Ga0070661_100127517 | 3300005344 | Bacteria | 1910 |
| 53 | Ga0070692_10123958 | 3300005345 | Bacteria | 1444 |
| 54 | Ga0070668_100004095 | 3300005347 | Bacteria | 10797 |
| 55 | Ga0070668_100013153 | 3300005347 | Bacteria | 6169 |
| 56 | Ga0070668_100014523 | 3300005347 | Bacteria | 5886 |
| 57 | Ga0070668_100017328 | 3300005347 | Bacteria | 5394 |
| 58 | Ga0070668_100017619 | 3300005347 | Bacteria | 5356 |
| 59 | Ga0070668_100046278 | 3300005347 | Bacteria | 3340 |
| 60 | Ga0070668_100062129 | 3300005347 | Bacteria | 2893 |
| 61 | Ga0070668_100109911 | 3300005347 | Bacteria | 2193 |
| 62 | Ga0070669_100000198 | 3300005353 | Bacteria | 52322 |
| 63 | Ga0070669_100008875 | 3300005353 | Bacteria | 7170 |
| 64 | Ga0070669_100010205 | 3300005353 | Bacteria | 6673 |
| 65 | Ga0070669_100010538 | 3300005353 | Bacteria | 6564 |
| 66 | Ga0070669_100020177 | 3300005353 | Bacteria | 4759 |
| 67 | Ga0070669_100031025 | 3300005353 | Bacteria | 3859 |
| 68 | Ga0070669_100137244 | 3300005353 | Bacteria | 1882 |
| 69 | Ga0070669_100353720 | 3300005353 | Bacteria | 1193 |
| 70 | Ga0070675_100035183 | 3300005354 | Bacteria | 4068 |
| 71 | Ga0070675_100074071 | 3300005354 | Bacteria | 2828 |
| 72 | Ga0070671_100000044 | 3300005355 | Bacteria | 86204 |
| 73 | Ga0070671_100001152 | 3300005355 | Bacteria | 19660 |
| 74 | Ga0070671_100014900 | 3300005355 | Bacteria | 6281 |
| 75 | Ga0070671_100023842 | 3300005355 | Bacteria | 5008 |
| 76 | Ga0070671_100053822 | 3300005355 | Bacteria | 3345 |
| 77 | Ga0070673_100014750 | 3300005364 | Bacteria | 5460 |
| 78 | Ga0070673_100108118 | 3300005364 | Bacteria | 2302 |
| 79 | Ga0070667_100000485 | 3300005367 | Bacteria | 40311 |
| 80 | Ga0070667_100004482 | 3300005367 | Bacteria | 11779 |
| 81 | Ga0070709_10448100 | 3300005434 | Bacteria | 972 |
| 82 | Ga0070713_100000289 | 3300005436 | Bacteria | 33226 |
| 83 | Ga0070713_100072441 | 3300005436 | Bacteria | 2914 |
| 84 | Ga0070713_100075934 | 3300005436 | Bacteria | 2852 |
| 85 | Ga0070710_10027841 | 3300005437 | Bacteria | 3018 |
| 86 | Ga0070711_100056576 | 3300005439 | Bacteria | 2713 |
| 87 | Ga0070711_100058341 | 3300005439 | Bacteria | 2676 |
| 88 | Ga0070711_100064195 | 3300005439 | Bacteria | 2565 |
| 89 | Ga0070708_100066790 | 3300005445 | Bacteria | 3228 |
| 90 | Ga0070663_100028759 | 3300005455 | Bacteria | 3788 |
| 91 | Ga0070663_100100255 | 3300005455 | Bacteria | 2160 |
| 92 | Ga0070663_100185400 | 3300005455 | Bacteria | 1617 |
| 93 | Ga0070662_100128344 | 3300005457 | Eukaryota | 1952 |
| 94 | Ga0070662_100198505 | 3300005457 | Bacteria | 1590 |
| 95 | Ga0068867_100026629 | 3300005459 | Bacteria | 4153 |
| 96 | Ga0070685_10072180 | 3300005466 | Bacteria | 2048 |
| 97 | Ga0070685_10174814 | 3300005466 | Bacteria | 1378 |
| 98 | Ga0070706_100025076 | 3300005467 | Bacteria | 5488 |
| 99 | Ga0070699_100053313 | 3300005518 | Bacteria | 3500 |
| 100 | Ga0070672_100036248 | 3300005543 | Bacteria | 3757 |
| 101 | Ga0070672_100059975 | 3300005543 | Bacteria | 2995 |
| 102 | Ga0070693_100119230 | 3300005547 | Bacteria | 1634 |
| 103 | Ga0070665_100000878 | 3300005548 | Bacteria | 38691 |
| 104 | Ga0070665_100003594 | 3300005548 | Bacteria | 16417 |
| 105 | Ga0070665_100034401 | 3300005548 | Bacteria | 5096 |
| 106 | Ga0070665_100097495 | 3300005548 | Bacteria | 2945 |
| 107 | Ga0070665_100141383 | 3300005548 | Bacteria | 2410 |
| 108 | Ga0070665_100191133 | 3300005548 | Bacteria | 2048 |
| 109 | Ga0070665_100205038 | 3300005548 | Bacteria | 1972 |
| 110 | Ga0070665_100299023 | 3300005548 | Bacteria | 1612 |
| 111 | Ga0068855_100000037 | 3300005563 | Bacteria | 158161 |
| 112 | Ga0068855_100020370 | 3300005563 | Bacteria | 7956 |
| 113 | Ga0070664_100032779 | 3300005564 | Bacteria | 4346 |
| 114 | Ga0068857_100002837 | 3300005577 | Bacteria | 14244 |
| 115 | Ga0068854_100357091 | 3300005578 | Bacteria | 1198 |
| 116 | Ga0068856_100154509 | 3300005614 | Bacteria | 2304 |
| 117 | Ga0068852_100273399 | 3300005616 | Bacteria | 1626 |
| 118 | Ga0068859_100042732 | 3300005617 | Bacteria | 4553 |
| 119 | Ga0068859_100098143 | 3300005617 | Bacteria | 2983 |
| 120 | Ga0068859_100251484 | 3300005617 | Bacteria | 1858 |
| 121 | Ga0068859_100411617 | 3300005617 | Bacteria | 1448 |
| 122 | Ga0068864_100010805 | 3300005618 | Bacteria | 7543 |
| 123 | Ga0068864_100083125 | 3300005618 | Bacteria | 2811 |
| 124 | Ga0068864_100169922 | 3300005618 | Bacteria | 1987 |
| 125 | Ga0068861_100269451 | 3300005719 | Bacteria | 1461 |
| 126 | Ga0068861_100341983 | 3300005719 | Bacteria | 1310 |
| 127 | Ga0068870_10023888 | 3300005840 | Bacteria | 3020 |
| 128 | Ga0068863_100009249 | 3300005841 | Bacteria | 9610 |
| 129 | Ga0068863_100010052 | 3300005841 | Bacteria | 9209 |
| 130 | Ga0068863_100040210 | 3300005841 | Bacteria | 4447 |
| 131 | Ga0068863_100065603 | 3300005841 | Bacteria | 3435 |
| 132 | Ga0068858_100006378 | 3300005842 | Bacteria | 11490 |
| 133 | Ga0068858_100038154 | 3300005842 | Bacteria | 4456 |
| 134 | Ga0068858_100063792 | 3300005842 | Bacteria | 3408 |
| 135 | Ga0068860_100004982 | 3300005843 | Bacteria | 13534 |
| 136 | Ga0068860_100007867 | 3300005843 | Bacteria | 10642 |
| 137 | Ga0068860_100050953 | 3300005843 | Bacteria | 3940 |
| 138 | Ga0068860_100151415 | 3300005843 | Bacteria | 2234 |
| 139 | Ga0068860_100251985 | 3300005843 | Bacteria | 1720 |
| 140 | Ga0068860_100467543 | 3300005843 | Bacteria | 1256 |
| 141 | Ga0068862_100011964 | 3300005844 | Bacteria | 7167 |
| 142 | Ga0068862_100012903 | 3300005844 | Bacteria | 6911 |
| 143 | Ga0068862_100030283 | 3300005844 | Bacteria | 4560 |
| 144 | Ga0068862_100073070 | 3300005844 | Bacteria | 2964 |
| 145 | Ga0068862_100076885 | 3300005844 | Bacteria | 2889 |
| 146 | Ga0068862_100084915 | 3300005844 | Bacteria | 2750 |
| 147 | Ga0081455_10015596 | 3300005937 | Bacteria | 7374 |
| 148 | Ga0081540_1000175 | 3300005983 | Bacteria | 67078 |
| 149 | Ga0081540_1022037 | 3300005983 | Bacteria | 3770 |
| 150 | Ga0081539_10004485 | 3300005985 | Bacteria | 15365 |
| 151 | Ga0081539_10073243 | 3300005985 | Bacteria | 1828 |
| 152 | Ga0075363_100014851 | 3300006048 | Bacteria | 3817 |
| 153 | Ga0075363_100040205 | 3300006048 | Bacteria | 2464 |
| 154 | Ga0075363_100125773 | 3300006048 | Bacteria | 1435 |
| 155 | Ga0075364_10050785 | 3300006051 | Bacteria | 2707 |
| 156 | Ga0075432_10009478 | 3300006058 | Bacteria | 3315 |
| 157 | Ga0075432_10010009 | 3300006058 | Bacteria | 3221 |
| 158 | Ga0070716_100035078 | 3300006173 | Bacteria | 2756 |
| 159 | Ga0075362_10017169 | 3300006177 | Bacteria | 2978 |
| 160 | Ga0075367_10020906 | 3300006178 | Bacteria | 3651 |
| 161 | Ga0075367_10053954 | 3300006178 | Bacteria | 2383 |
| 162 | Ga0075369_10016219 | 3300006186 | Bacteria | 3003 |
| 163 | Ga0075369_10019958 | 3300006186 | Bacteria | 2741 |
| 164 | Ga0075366_10000419 | 3300006195 | Bacteria | 19896 |
| 165 | Ga0075366_10011020 | 3300006195 | Bacteria | 5090 |
| 166 | Ga0075366_10015917 | 3300006195 | Bacteria | 4317 |
| 167 | Ga0075366_10054373 | 3300006195 | Bacteria | 2378 |
| 168 | Ga0075370_10035756 | 3300006353 | Bacteria | 2789 |
| 169 | Ga0075370_10211532 | 3300006353 | Bacteria | 1145 |
| 170 | Ga0075428_100068666 | 3300006844 | Bacteria | 3877 |
| 171 | Ga0075430_100011408 | 3300006846 | Bacteria | 7543 |
| 172 | Ga0075430_100129615 | 3300006846 | Bacteria | 2102 |
| 173 | Ga0075430_100138678 | 3300006846 | Bacteria | 2025 |
| 174 | Ga0075431_100300468 | 3300006847 | Bacteria | 1622 |
| 175 | Ga0075433_10016630 | 3300006852 | Bacteria | 6070 |
| 176 | Ga0075434_100001356 | 3300006871 | Bacteria | 20544 |
| 177 | Ga0075434_100296667 | 3300006871 | Bacteria | 1636 |
| 178 | Ga0075429_100016836 | 3300006880 | Bacteria | 6326 |
| 179 | Ga0097620_100042731 | 3300006931 | Bacteria | 4553 |
| 180 | Ga0097620_100098144 | 3300006931 | Bacteria | 2983 |
| 181 | Ga0097620_100251475 | 3300006931 | Bacteria | 1858 |
| 182 | Ga0097620_100411614 | 3300006931 | Bacteria | 1448 |
| 183 | Ga0099823_1000033 | 3300006944 | Bacteria | 68228 |
| 184 | Ga0099794_10002464 | 3300007265 | Bacteria | 6823 |
| 185 | Ga0105251_10000075 | 3300009011 | Bacteria | 94904 |
| 186 | Ga0105251_10000239 | 3300009011 | Bacteria | 54956 |
| 187 | Ga0105251_10001294 | 3300009011 | Bacteria | 21632 |
| 188 | Ga0105251_10001422 | 3300009011 | Bacteria | 20620 |
| 189 | Ga0105251_10001607 | 3300009011 | Bacteria | 19211 |
| 190 | Ga0105251_10002112 | 3300009011 | Bacteria | 16005 |
| 191 | Ga0105251_10013543 | 3300009011 | Bacteria | 4558 |
| 192 | Ga0105251_10024951 | 3300009011 | Bacteria | 3064 |
| 193 | Ga0105251_10025991 | 3300009011 | Bacteria | 2986 |
| 194 | Ga0105251_10032576 | 3300009011 | Bacteria | 2596 |
| 195 | Ga0105244_10005583 | 3300009036 | Bacteria | 8324 |
| 196 | Ga0105250_10002874 | 3300009092 | Bacteria | 8414 |
| 197 | Ga0105250_10003656 | 3300009092 | Bacteria | 7239 |
| 198 | Ga0105240_10023443 | 3300009093 | Bacteria | 8160 |
| 199 | Ga0111539_10562013 | 3300009094 | Bacteria | 1329 |
| 200 | Ga0105245_10037563 | 3300009098 | Bacteria | 4306 |
| 201 | Ga0105247_10004686 | 3300009101 | Bacteria | 8713 |
| 202 | Ga0105247_10034631 | 3300009101 | Bacteria | 3076 |
| 203 | Ga0105243_10000249 | 3300009148 | Bacteria | 61872 |
| 204 | Ga0105243_10015538 | 3300009148 | Bacteria | 5754 |
| 205 | Ga0105243_10023100 | 3300009148 | Bacteria | 4730 |
| 206 | Ga0105243_10023311 | 3300009148 | Bacteria | 4711 |
| 207 | Ga0105248_10003673 | 3300009177 | Bacteria | 16996 |
| 208 | Ga0105248_10014957 | 3300009177 | Bacteria | 8542 |
| 209 | Ga0105248_10042429 | 3300009177 | Bacteria | 5102 |
| 210 | Ga0105248_10126471 | 3300009177 | Bacteria | 2883 |
| 211 | Ga0105248_10156962 | 3300009177 | Bacteria | 2567 |
| 212 | Ga0105248_10157398 | 3300009177 | Bacteria | 2563 |
| 213 | Ga0105248_10403316 | 3300009177 | Bacteria | 1539 |
| 214 | Ga0105237_10024655 | 3300009545 | Bacteria | 6152 |
| 215 | Ga0105237_10509750 | 3300009545 | Bacteria | 1210 |
| 216 | Ga0105238_10028042 | 3300009551 | Bacteria | 5737 |
| 217 | Ga0105249_10010654 | 3300009553 | Bacteria | 8076 |
| 218 | Ga0105249_10226790 | 3300009553 | Bacteria | 1841 |
| 219 | Ga0105148_100125 | 3300009978 | Bacteria | 11767 |
| 220 | Ga0105148_102481 | 3300009978 | Bacteria | 1299 |
| 221 | Ga0099796_10021889 | 3300010159 | Bacteria | 1976 |
| 222 | Ga0105239_10001024 | 3300010375 | Eukaryota | 39022 |
| 223 | Ga0105239_10200367 | 3300010375 | Bacteria | 2236 |
| 224 | Ga0105239_10339797 | 3300010375 | Bacteria | 1694 |
| 225 | Ga0105246_10019597 | 3300011119 | Bacteria | 4326 |
| 226 | Ga0157370_10007312 | 3300013104 | Bacteria | 12048 |
| 227 | Ga0157369_10196540 | 3300013105 | Eukaryota | 2118 |
| 228 | Ga0157369_10405814 | 3300013105 | Bacteria | 1413 |
| 229 | Ga0157374_10159694 | 3300013296 | Bacteria | 2195 |
| 230 | Ga0157374_10431268 | 3300013296 | Bacteria | 1318 |
| 231 | Ga0157374_10626342 | 3300013296 | Bacteria | 1087 |
| 232 | Ga0163162_10000398 | 3300013306 | Bacteria | 39865 |
| 233 | Ga0163162_10014417 | 3300013306 | Bacteria | 7724 |
| 234 | Ga0163162_10037551 | 3300013306 | Bacteria | 4834 |
| 235 | Ga0163162_10107352 | 3300013306 | Bacteria | 2887 |
| 236 | Ga0163162_10172008 | 3300013306 | Bacteria | 2291 |
| 237 | Ga0163162_10340260 | 3300013306 | Bacteria | 1633 |
| 238 | Ga0157372_10274997 | 3300013307 | Bacteria | 1958 |
| 239 | Ga0157375_10039196 | 3300013308 | Bacteria | 4558 |
| 240 | Ga0163163_10026334 | 3300014325 | Bacteria | 5558 |
| 241 | Ga0163163_10096555 | 3300014325 | Bacteria | 2976 |
| 242 | Ga0157380_10000081 | 3300014326 | Bacteria | 53155 |
| 243 | Ga0157380_10114610 | 3300014326 | Bacteria | 2272 |
| 244 | Ga0157377_10195811 | 3300014745 | Bacteria | 1280 |
| 245 | Ga0157379_10140333 | 3300014968 | Bacteria | 2178 |
| 246 | Ga0157379_10194644 | 3300014968 | Bacteria | 1832 |
| 247 | Ga0182007_10004297 | 3300015262 | Bacteria | 6489 |
| 248 | Ga0163161_10000427 | 3300017792 | Bacteria | 35484 |
| 249 | Ga0163161_10011170 | 3300017792 | Bacteria | 6221 |
| 250 | Ga0163161_10028287 | 3300017792 | Bacteria | 3980 |
| 251 | Ga0163161_10181101 | 3300017792 | Bacteria | 1616 |
| 252 | Ga0163161_10213310 | 3300017792 | Bacteria | 1492 |
| 253 | Ga0206355_1050631 | 3300020076 | Bacteria | 1024 |
| 254 | Ga0206354_11554051 | 3300020081 | Bacteria | 1043 |
| 255 | Ga0224712_10150079 | 3300022467 | Eukaryota | 1032 |
| 256 | Ga0209674_100049 | 3300025226 | Bacteria | 346969 |
| 257 | Ga0209672_100097 | 3300025228 | Bacteria | 110837 |
| 258 | Ga0209147_100106 | 3300025229 | Bacteria | 156899 |
| 259 | Ga0209258_100157 | 3300025242 | Bacteria | 156898 |
| 260 | Ga0209258_101138 | 3300025242 | Bacteria | 10991 |
| 261 | Ga0209258_107071 | 3300025242 | Bacteria | 1695 |
| 262 | Ga0209148_1000150 | 3300025254 | Bacteria | 156898 |
| 263 | Ga0209759_1000041 | 3300025256 | Bacteria | 252893 |
| 264 | Ga0209455_1000132 | 3300025272 | Bacteria | 156899 |
| 265 | Ga0209673_1000324 | 3300025273 | Eukaryota | 87582 |
| 266 | Ga0209673_1001616 | 3300025273 | Bacteria | 19667 |
| 267 | Ga0209673_1003540 | 3300025273 | Bacteria | 9118 |
| 268 | Ga0209673_1003939 | 3300025273 | Bacteria | 8301 |
| 269 | Ga0209564_1011053 | 3300025295 | Bacteria | 4082 |
| 270 | Ga0209758_1000382 | 3300025297 | Bacteria | 76653 |
| 271 | Ga0209758_1004836 | 3300025297 | Bacteria | 10869 |
| 272 | Ga0209050_1002396 | 3300025298 | Bacteria | 16244 |
| 273 | Ga0209050_1021597 | 3300025298 | Bacteria | 2340 |
| 274 | Ga0209256_1001786 | 3300025299 | Bacteria | 20365 |
| 275 | Ga0209051_1000462 | 3300025303 | Bacteria | 53349 |
| 276 | Ga0209051_1002774 | 3300025303 | Bacteria | 12094 |
| 277 | Ga0209257_1001143 | 3300025304 | Bacteria | 33909 |
| 278 | Ga0209257_1009675 | 3300025304 | Bacteria | 5092 |
| 279 | Ga0207696_1001489 | 3300025711 | Bacteria | 12622 |
| 280 | Ga0207696_1002726 | 3300025711 | Bacteria | 8415 |
| 281 | Ga0207696_1025010 | 3300025711 | Bacteria | 1867 |
| 282 | Ga0207655_1000327 | 3300025728 | Bacteria | 70037 |
| 283 | Ga0207655_1000339 | 3300025728 | Bacteria | 68128 |
| 284 | Ga0207713_1000038 | 3300025735 | Bacteria | 247609 |
| 285 | Ga0207713_1001016 | 3300025735 | Bacteria | 24447 |
| 286 | Ga0207713_1003536 | 3300025735 | Bacteria | 10585 |
| 287 | Ga0207713_1006052 | 3300025735 | Bacteria | 7460 |
| 288 | Ga0207713_1007177 | 3300025735 | Bacteria | 6639 |
| 289 | Ga0207713_1007672 | 3300025735 | Bacteria | 6314 |
| 290 | Ga0207713_1010855 | 3300025735 | Bacteria | 5007 |
| 291 | Ga0207710_10001632 | 3300025900 | Bacteria | 10954 |
| 292 | Ga0207710_10052925 | 3300025900 | Bacteria | 1826 |
| 293 | Ga0207680_10057312 | 3300025903 | Bacteria | 2357 |
| 294 | Ga0207680_10315771 | 3300025903 | Bacteria | 1092 |
| 295 | Ga0207685_10018230 | 3300025905 | Bacteria | 2287 |
| 296 | Ga0207645_10089515 | 3300025907 | Bacteria | 1979 |
| 297 | Ga0207645_10131205 | 3300025907 | Bacteria | 1631 |
| 298 | Ga0207643_10031355 | 3300025908 | Bacteria | 2963 |
| 299 | Ga0207705_10005976 | 3300025909 | Bacteria | 9055 |
| 300 | Ga0207705_10249496 | 3300025909 | Bacteria | 1353 |
| 301 | Ga0207695_10014875 | 3300025913 | Bacteria | 9185 |
| 302 | Ga0207695_10064490 | 3300025913 | Bacteria | 3771 |
| 303 | Ga0207671_10017485 | 3300025914 | Bacteria | 5526 |
| 304 | Ga0207671_10133716 | 3300025914 | Eukaryota | 1906 |
| 305 | Ga0207671_10366936 | 3300025914 | Bacteria | 1143 |
| 306 | Ga0207693_10033688 | 3300025915 | Bacteria | 4041 |
| 307 | Ga0207693_10058144 | 3300025915 | Bacteria | 3029 |
| 308 | Ga0207693_10351693 | 3300025915 | Bacteria | 1153 |
| 309 | Ga0207663_10074208 | 3300025916 | Bacteria | 2204 |
| 310 | Ga0207663_10205893 | 3300025916 | Bacteria | 1422 |
| 311 | Ga0207662_10018677 | 3300025918 | Bacteria | 3938 |
| 312 | Ga0207657_10088952 | 3300025919 | Bacteria | 2580 |
| 313 | Ga0207649_10301479 | 3300025920 | Bacteria | 1171 |
| 314 | Ga0207681_10000177 | 3300025923 | Bacteria | 52335 |
| 315 | Ga0207681_10010161 | 3300025923 | Bacteria | 5763 |
| 316 | Ga0207681_10036366 | 3300025923 | Bacteria | 3248 |
| 317 | Ga0207681_10052906 | 3300025923 | Bacteria | 2755 |
| 318 | Ga0207694_10202000 | 3300025924 | Bacteria | 1617 |
| 319 | Ga0207694_10329011 | 3300025924 | Bacteria | 1262 |
| 320 | Ga0207650_10002502 | 3300025925 | Bacteria | 12761 |
| 321 | Ga0207650_10011955 | 3300025925 | Bacteria | 5984 |
| 322 | Ga0207650_10012392 | 3300025925 | Bacteria | 5886 |
| 323 | Ga0207650_10038911 | 3300025925 | Bacteria | 3475 |
| 324 | Ga0207650_10208193 | 3300025925 | Bacteria | 1570 |
| 325 | Ga0207659_10011480 | 3300025926 | Bacteria | 5597 |
| 326 | Ga0207659_10138200 | 3300025926 | Bacteria | 1888 |
| 327 | Ga0207687_10017974 | 3300025927 | Bacteria | 4665 |
| 328 | Ga0207700_10000071 | 3300025928 | Bacteria | 62757 |
| 329 | Ga0207700_10057725 | 3300025928 | Bacteria | 2928 |
| 330 | Ga0207644_10000080 | 3300025931 | Bacteria | 70312 |
| 331 | Ga0207644_10000766 | 3300025931 | Bacteria | 20334 |
| 332 | Ga0207644_10002305 | 3300025931 | Bacteria | 12382 |
| 333 | Ga0207644_10017094 | 3300025931 | Bacteria | 4892 |
| 334 | Ga0207644_10040520 | 3300025931 | Bacteria | 3292 |
| 335 | Ga0207644_10056327 | 3300025931 | Bacteria | 2837 |
| 336 | Ga0207690_10225262 | 3300025932 | Bacteria | 1437 |
| 337 | Ga0207706_10022990 | 3300025933 | Bacteria | 5598 |
| 338 | Ga0207706_10081730 | 3300025933 | Bacteria | 2839 |
| 339 | Ga0207706_10379492 | 3300025933 | Eukaryota | 1227 |
| 340 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 341 | Ga0207709_10003040 | 3300025935 | Bacteria | 10173 |
| 342 | Ga0207709_10032763 | 3300025935 | Bacteria | 3045 |
| 343 | Ga0207709_10034026 | 3300025935 | Bacteria | 2999 |
| 344 | Ga0207670_10074057 | 3300025936 | Bacteria | 2363 |
| 345 | Ga0207670_10113520 | 3300025936 | Bacteria | 1957 |
| 346 | Ga0207669_10035112 | 3300025937 | Bacteria | 2849 |
| 347 | Ga0207669_10084002 | 3300025937 | Bacteria | 2050 |
| 348 | Ga0207691_10070957 | 3300025940 | Bacteria | 3145 |
| 349 | Ga0207691_10407052 | 3300025940 | Bacteria | 1160 |
| 350 | Ga0207711_10003533 | 3300025941 | Bacteria | 13532 |
| 351 | Ga0207711_10009758 | 3300025941 | Bacteria | 7986 |
| 352 | Ga0207711_10020446 | 3300025941 | Bacteria | 5518 |
| 353 | Ga0207711_10282102 | 3300025941 | Bacteria | 1530 |
| 354 | Ga0207689_10138058 | 3300025942 | Bacteria | 2007 |
| 355 | Ga0207689_10373778 | 3300025942 | Bacteria | 1186 |
| 356 | Ga0207679_10077238 | 3300025945 | Bacteria | 2532 |
| 357 | Ga0207679_10536605 | 3300025945 | Bacteria | 1048 |
| 358 | Ga0207667_10000053 | 3300025949 | Bacteria | 226712 |
| 359 | Ga0207667_10001176 | 3300025949 | Bacteria | 32896 |
| 360 | Ga0207651_10038654 | 3300025960 | Bacteria | 3139 |
| 361 | Ga0207651_10070979 | 3300025960 | Bacteria | 2466 |
| 362 | Ga0207651_10233357 | 3300025960 | Bacteria | 1495 |
| 363 | Ga0207712_10005748 | 3300025961 | Bacteria | 7818 |
| 364 | Ga0207712_10101710 | 3300025961 | Bacteria | 2138 |
| 365 | Ga0207668_10004844 | 3300025972 | Bacteria | 7922 |
| 366 | Ga0207668_10021228 | 3300025972 | Bacteria | 4139 |
| 367 | Ga0207668_10021701 | 3300025972 | Bacteria | 4098 |
| 368 | Ga0207668_10034036 | 3300025972 | Bacteria | 3380 |
| 369 | Ga0207668_10082720 | 3300025972 | Bacteria | 2333 |
| 370 | Ga0207640_10246346 | 3300025981 | Bacteria | 1384 |
| 371 | Ga0207658_10000213 | 3300025986 | Bacteria | 60739 |
| 372 | Ga0207658_10003133 | 3300025986 | Bacteria | 11830 |
| 373 | Ga0207703_10035852 | 3300026035 | Bacteria | 3944 |
| 374 | Ga0207703_10052382 | 3300026035 | Bacteria | 3314 |
| 375 | Ga0207639_10274664 | 3300026041 | Bacteria | 1480 |
| 376 | Ga0207678_10124403 | 3300026067 | Bacteria | 2200 |
| 377 | Ga0207678_10130582 | 3300026067 | Bacteria | 2143 |
| 378 | Ga0207678_10210463 | 3300026067 | Bacteria | 1663 |
| 379 | Ga0207641_10003981 | 3300026088 | Bacteria | 12894 |
| 380 | Ga0207641_10020272 | 3300026088 | Bacteria | 5460 |
| 381 | Ga0207641_10032484 | 3300026088 | Bacteria | 4333 |
| 382 | Ga0207641_10050190 | 3300026088 | Bacteria | 3529 |
| 383 | Ga0207648_10093070 | 3300026089 | Bacteria | 2636 |
| 384 | Ga0207648_10477397 | 3300026089 | Bacteria | 1138 |
| 385 | Ga0207676_10014487 | 3300026095 | Bacteria | 5675 |
| 386 | Ga0207676_10068794 | 3300026095 | Bacteria | 2833 |
| 387 | Ga0207674_10022818 | 3300026116 | Bacteria | 6715 |
| 388 | Ga0207674_10179237 | 3300026116 | Bacteria | 2070 |
| 389 | Ga0207675_100001472 | 3300026118 | Bacteria | 23626 |
| 390 | Ga0207675_100052226 | 3300026118 | Bacteria | 3814 |
| 391 | Ga0207675_100126177 | 3300026118 | Bacteria | 2424 |
| 392 | Ga0207675_100245502 | 3300026118 | Bacteria | 1731 |
| 393 | Ga0207683_10221060 | 3300026121 | Bacteria | 1726 |
| 394 | Ga0207683_10259477 | 3300026121 | Bacteria | 1587 |
| 395 | Ga0207698_10200048 | 3300026142 | Bacteria | 1788 |
| 396 | Ga0207698_10256724 | 3300026142 | Bacteria | 1603 |
| 397 | Ga0209389_1005072 | 3300027296 | Bacteria | 11128 |
| 398 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 399 | Ga0209371_1000040 | 3300027312 | Bacteria | 340804 |
| 400 | Ga0209371_1000259 | 3300027312 | Bacteria | 64107 |
| 401 | Ga0209371_1000604 | 3300027312 | Bacteria | 32202 |
| 402 | Ga0209588_1000642 | 3300027671 | Bacteria | 8805 |
| 403 | Ga0268266_10001045 | 3300028379 | Bacteria | 34723 |
| 404 | Ga0268266_10002815 | 3300028379 | Bacteria | 18142 |
| 405 | Ga0268266_10042995 | 3300028379 | Bacteria | 3860 |
| 406 | Ga0268266_10074285 | 3300028379 | Bacteria | 2952 |
| 407 | Ga0268266_10211819 | 3300028379 | Bacteria | 1777 |
| 408 | Ga0268266_10258706 | 3300028379 | Bacteria | 1612 |
| 409 | Ga0268266_10418653 | 3300028379 | Bacteria | 1269 |
| 410 | Ga0268265_10000218 | 3300028380 | Bacteria | 66258 |
| 411 | Ga0268265_10026965 | 3300028380 | Bacteria | 4094 |
| 412 | Ga0268265_10045029 | 3300028380 | Bacteria | 3289 |
| 413 | Ga0268265_10047013 | 3300028380 | Bacteria | 3230 |
| 414 | Ga0268265_10058166 | 3300028380 | Bacteria | 2950 |
| 415 | Ga0268265_10080942 | 3300028380 | Bacteria | 2563 |
| 416 | Ga0268265_10309660 | 3300028380 | Bacteria | 1425 |
| 417 | Ga0268264_10002221 | 3300028381 | Bacteria | 17217 |
| 418 | Ga0268264_10003005 | 3300028381 | Bacteria | 14622 |
| 419 | Ga0268264_10028441 | 3300028381 | Bacteria | 4573 |
| 420 | Ga0268264_10546447 | 3300028381 | Bacteria | 1136 |
| 421 | Ga0307515_10001534 | 3300028794 | Bacteria | 51647 |
| 422 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 423 | Ga0268256_1000041 | 3300030500 | Bacteria | 340725 |
| 424 | Ga0268256_1000233 | 3300030500 | Bacteria | 58915 |
| 425 | Ga0268256_1000510 | 3300030500 | Bacteria | 32695 |
| 426 | Ga0265330_10051485 | 3300031235 | Bacteria | 1805 |
| 427 | Ga0265332_10011181 | 3300031238 | Bacteria | 3988 |
| 428 | Ga0307513_10440403 | 3300031456 | Bacteria | 1029 |
| 429 | Ga0307408_100002383 | 3300031548 | Bacteria | 13264 |
| 430 | Ga0307408_100016611 | 3300031548 | Bacteria | 4916 |
| 431 | Ga0307408_100057979 | 3300031548 | Bacteria | 2813 |
| 432 | Ga0307408_100071439 | 3300031548 | Bacteria | 2566 |
| 433 | Ga0307408_100132766 | 3300031548 | Bacteria | 1944 |
| 434 | Ga0307408_100268014 | 3300031548 | Bacteria | 1416 |
| 435 | Ga0307405_10051184 | 3300031731 | Bacteria | 2561 |
| 436 | Ga0307405_10134869 | 3300031731 | Bacteria | 1712 |
| 437 | Ga0307413_10030443 | 3300031824 | Bacteria | 3032 |
| 438 | Ga0307413_10058751 | 3300031824 | Bacteria | 2359 |
| 439 | Ga0307413_10076889 | 3300031824 | Bacteria | 2123 |
| 440 | Ga0307413_10386825 | 3300031824 | Bacteria | 1092 |
| 441 | Ga0307410_10008484 | 3300031852 | Bacteria | 5699 |
| 442 | Ga0307410_10028554 | 3300031852 | Bacteria | 3541 |
| 443 | Ga0307410_10085192 | 3300031852 | Bacteria | 2229 |
| 444 | Ga0307410_10223043 | 3300031852 | Bacteria | 1451 |
| 445 | Ga0307410_10264875 | 3300031852 | Bacteria | 1342 |
| 446 | Ga0307410_10287293 | 3300031852 | Bacteria | 1293 |
| 447 | Ga0307406_10232960 | 3300031901 | Bacteria | 1376 |
| 448 | Ga0307406_10461950 | 3300031901 | Bacteria | 1021 |
| 449 | Ga0307407_10008019 | 3300031903 | Bacteria | 4819 |
| 450 | Ga0307407_10031390 | 3300031903 | Bacteria | 2877 |
| 451 | Ga0307407_10354241 | 3300031903 | Bacteria | 1040 |
| 452 | Ga0307412_10000015 | 3300031911 | Bacteria | 333589 |
| 453 | Ga0307412_10017164 | 3300031911 | Bacteria | 4329 |
| 454 | Ga0307412_10104590 | 3300031911 | Bacteria | 2009 |
| 455 | Ga0307412_10257455 | 3300031911 | Bacteria | 1358 |
| 456 | Ga0307409_100026764 | 3300031995 | Bacteria | 4074 |
| 457 | Ga0307409_100176283 | 3300031995 | Bacteria | 1887 |
| 458 | Ga0307409_100339081 | 3300031995 | Bacteria | 1414 |
| 459 | Ga0307409_100417644 | 3300031995 | Bacteria | 1286 |
| 460 | Ga0307416_100013635 | 3300032002 | Bacteria | 5534 |
| 461 | Ga0307416_100091117 | 3300032002 | Bacteria | 2617 |
| 462 | Ga0307414_10544612 | 3300032004 | Bacteria | 1033 |
| 463 | Ga0307415_100009223 | 3300032126 | Bacteria | 5516 |
| 464 | Ga0316593_10002636 | 3300032168 | Bacteria | 4302 |
| 465 | Ga0316593_10012634 | 3300032168 | Bacteria | 2482 |
| 466 | Ga0316593_10094855 | 3300032168 | Unclassified | 1053 |
| 467 | Ga0316592_1001937 | 3300033524 | Bacteria | 3488 |
| 468 | Ga0316592_1007064 | 3300033524 | Bacteria | 2181 |
| 469 | Ga0316592_1008227 | 3300033524 | Bacteria | 2054 |
| 470 | Ga0316588_1015147 | 3300033528 | Bacteria | 1695 |
| 471 | Ga0316596_1011671 | 3300033541 | Bacteria | 2152 |
| 472 | Ga0373926_0048813 | 3300035083 | Bacteria | 1523 |
| 473 | Ga0373926_0101378 | 3300035083 | Bacteria | 1077 |
| 474 | Ga0373923_0027239 | 3300035111 | Bacteria | 2279 |
| 475 | Ga0373936_0019183 | 3300035113 | Bacteria | 2649 |
| 476 | Ga0373945_0011383 | 3300035116 | Bacteria | 2942 |
| 477 | Ga0373953_0009240 | 3300035117 | Bacteria | 3383 |
| 478 | Ga0373954_0003072 | 3300035118 | Bacteria | 7049 |
| 479 | Ga0373954_0067827 | 3300035118 | Bacteria | 1691 |
| 480 | Ga0373943_0016830 | 3300035170 | Bacteria | 3340 |
| 481 | Ga0373946_0011243 | 3300035171 | Bacteria | 3334 |
| 482 | Ga0373946_0034050 | 3300035171 | Bacteria | 2054 |
| 483 | Ga0373955_0004841 | 3300035172 | Bacteria | 6000 |
| 484 | Ga0316574_0002172 | 3300035398 | Bacteria | 9728 |
| 485 | Ga0316574_0058353 | 3300035398 | Bacteria | 2418 |
| 486 | Ga0373935_0027481 | 3300035692 | Bacteria | 3516 |
| 487 | Ga0373935_0045369 | 3300035692 | Bacteria | 2773 |
| 488 | Ga0373935_0128848 | 3300035692 | Bacteria | 1698 |
| 489 | Ga0373927_0018924 | 3300035695 | Bacteria | 4518 |
| 490 | Ga0373927_0024801 | 3300035695 | Bacteria | 3919 |
| 491 | Ga0373927_0185870 | 3300035695 | Bacteria | 1363 |
| 492 | Ga0373933_0058601 | 3300035724 | Bacteria | 2317 |
| 493 | Ga0373947_0011648 | 3300035725 | Bacteria | 5044 |
| 494 | Ga0373947_0045708 | 3300035725 | Bacteria | 2620 |
| 495 | Ga0373937_0022427 | 3300036401 | Bacteria | 5676 |
| 496 | Ga0373937_0040021 | 3300036401 | Bacteria | 4273 |
| 497 | Ga0373937_0316220 | 3300036401 | Bacteria | 1477 |
| 498 | Ga0395899_0002992 | 3300037312 | Bacteria | 13497 |
| 499 | Ga0395899_0024573 | 3300037312 | Bacteria | 4555 |
| 500 | Ga0395899_0047828 | 3300037312 | Bacteria | 3184 |
| 501 | Ga0395899_0057145 | 3300037312 | Bacteria | 2881 |
| 502 | Ga0395899_0218317 | 3300037312 | Bacteria | 1322 |
| 503 | Ga0395900_0008700 | 3300037418 | Bacteria | 10428 |
| 504 | Ga0395900_0017614 | 3300037418 | Bacteria | 7289 |
| 505 | Ga0395900_0072067 | 3300037418 | Bacteria | 3552 |
| 506 | Ga0395900_0173016 | 3300037418 | Bacteria | 2197 |
| 507 | Ga0395900_0254885 | 3300037418 | Bacteria | 1754 |
| 508 | Ga0395898_0006782 | 3300037466 | Bacteria | 12189 |
| 509 | Ga0395898_0014126 | 3300037466 | Bacteria | 8208 |
| 510 | Ga0395898_0083465 | 3300037466 | Bacteria | 3079 |
| 511 | Ga0395898_0181688 | 3300037466 | Bacteria | 2010 |
| 512 | Ga0395898_0390286 | 3300037466 | Bacteria | 1327 |
| 513 | Ga0395905_0002322 | 3300037471 | Bacteria | 21290 |
| 514 | Ga0395905_0003918 | 3300037471 | Bacteria | 15668 |
| 515 | Ga0395905_0009494 | 3300037471 | Bacteria | 9509 |
| 516 | Ga0395905_0109828 | 3300037471 | Bacteria | 2589 |
| 517 | Ga0395901_0005411 | 3300038443 | Bacteria | 12918 |
| 518 | Ga0395901_0066588 | 3300038443 | Bacteria | 3751 |
| 519 | Ga0395901_0347415 | 3300038443 | Bacteria | 1531 |
| 520 | Ga0436361_0370358 | 3300039447 | Bacteria | 2121 |
| 521 | Ga0436363_0686554 | 3300039450 | Bacteria | 3209 |
| 522 | Ga0439436_0005519 | 3300041404 | Bacteria | 3874 |
| 523 | Ga0439436_0005596 | 3300041404 | Bacteria | 3852 |
| 524 | Ga0439436_0051288 | 3300041404 | Bacteria | 1165 |
| 525 | Ga0439436_0056261 | 3300041404 | Bacteria | 1105 |
| 526 | Ga0439438_005139 | 3300041405 | Bacteria | 4871 |
| 527 | Ga0439438_022614 | 3300041405 | Bacteria | 1742 |
| 528 | Ga0439439_0000787 | 3300041406 | Bacteria | 5749 |
| 529 | Ga0439439_0010348 | 3300041406 | Bacteria | 2227 |
| 530 | Ga0439466_0007836 | 3300041411 | Bacteria | 4034 |
| 531 | Ga0439466_0009017 | 3300041411 | Bacteria | 3745 |
| 532 | Ga0451793_1176449 | 3300041452 | Bacteria | 1613 |
| 533 | Ga0451795_1559355 | 3300041456 | Bacteria | 1463 |
| 534 | Ga0451839_0004112 | 3300041496 | Bacteria | 1670 |
| 535 | Ga0439433_0002116 | 3300041999 | Bacteria | 4176 |
| 536 | Ga0439433_0004175 | 3300041999 | Bacteria | 3104 |
| 537 | Ga0439433_0013928 | 3300041999 | Bacteria | 1769 |
| 538 | Ga0439432_000130 | 3300042006 | Bacteria | 24966 |
| 539 | Ga0439449_0010688 | 3300042007 | Bacteria | 3468 |
| 540 | Ga0439449_0069846 | 3300042007 | Bacteria | 1294 |
| 541 | Ga0439451_000493 | 3300042009 | Bacteria | 7615 |
| 542 | Ga0439451_004046 | 3300042009 | Bacteria | 2982 |
| 543 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 544 | Ga0439452_042071 | 3300042010 | Bacteria | 1072 |
| 545 | Ga0439456_000597 | 3300042013 | Bacteria | 7573 |
| 546 | Ga0439456_001303 | 3300042013 | Bacteria | 4969 |
| 547 | Ga0439457_003680 | 3300042014 | Bacteria | 4137 |
| 548 | Ga0439463_000469 | 3300042016 | Bacteria | 11233 |
| 549 | Ga0439463_001793 | 3300042016 | Bacteria | 5585 |
| 550 | Ga0450919_000409 | 3300042121 | Bacteria | 5261 |
| 551 | Ga0450920_000642 | 3300042122 | Bacteria | 5570 |
| 552 | Ga0450898_017965 | 3300042134 | Bacteria | 1221 |
| 553 | Ga0450906_002930 | 3300042145 | Bacteria | 3707 |
| 554 | Ga0450908_008554 | 3300042184 | Bacteria | 1917 |
| 555 | Ga0450909_001461 | 3300042185 | Bacteria | 3291 |
| 556 | Ga0439434_0002748 | 3300042435 | Bacteria | 5128 |
| 557 | Ga0439434_0010454 | 3300042435 | Bacteria | 2735 |
| 558 | Ga0439434_0017534 | 3300042435 | Bacteria | 2143 |
| 559 | Ga0439459_0018379 | 3300042438 | Bacteria | 1313 |
| 560 | Ga0450918_000078 | 3300042531 | Bacteria | 20466 |
| 561 | Ga0450918_006741 | 3300042531 | Bacteria | 2044 |
| 562 | Ga0450893_0012673 | 3300042532 | Bacteria | 1400 |
| 563 | Ga0466986_0000518 | 3300044650 | Bacteria | 13232 |
| 564 | Ga0466972_0000427 | 3300044658 | Bacteria | 21891 |
| 565 | Ga0466972_0011719 | 3300044658 | Bacteria | 4403 |
| 566 | Ga0466965_0177323 | 3300044683 | Bacteria | 1123 |
| 567 | Ga0466966_0026078 | 3300044684 | Bacteria | 3816 |
| 568 | Ga0466966_0113509 | 3300044684 | Bacteria | 1669 |
| 569 | Ga0466961_0000053 | 3300044693 | Bacteria | 69359 |
| 570 | Ga0466961_0021527 | 3300044693 | Bacteria | 4149 |
| 571 | Ga0466963_0035631 | 3300044694 | Bacteria | 3243 |
| 572 | Ga0466968_0003097 | 3300044735 | Bacteria | 6135 |
| 573 | Ga0466970_0000057 | 3300044765 | Bacteria | 43168 |
| 574 | Ga0466970_0007989 | 3300044765 | Bacteria | 5314 |
| 575 | Ga0466959_0001715 | 3300045049 | Bacteria | 13626 |
| 576 | Ga0466959_0164799 | 3300045049 | Eukaryota | 1557 |
| 577 | Ga0466967_0016266 | 3300045976 | Bacteria | 5859 |
| 578 | Ga0495592_0009546 | 3300046454 | Eukaryota | 7301 |
| 579 | Ga0495592_0012268 | 3300046454 | Eukaryota | 6505 |
| 580 | Ga0495592_0031919 | 3300046454 | Bacteria | 3978 |
| 581 | Ga0495592_0059500 | 3300046454 | Bacteria | 2813 |
| 582 | Ga0495592_0233704 | 3300046454 | Bacteria | 1223 |
| 583 | Ga0495603_0012824 | 3300046455 | Bacteria | 5068 |
| 584 | Ga0495603_0059203 | 3300046455 | Bacteria | 2264 |
| 585 | Ga0495590_0060064 | 3300046457 | Bacteria | 1331 |
| 586 | Ga0495629_0018239 | 3300046459 | Bacteria | 5026 |
| 587 | Ga0495629_0034343 | 3300046459 | Bacteria | 3586 |
| 588 | Ga0495641_0003517 | 3300046461 | Eukaryota | 11659 |
| 589 | Ga0495641_0014889 | 3300046461 | Bacteria | 4188 |
| 590 | Ga0495651_0023866 | 3300046462 | Bacteria | 4756 |
| 591 | Ga0495651_0050593 | 3300046462 | Bacteria | 3205 |
| 592 | Ga0495651_0172312 | 3300046462 | Bacteria | 1540 |
| 593 | Ga0495651_0197068 | 3300046462 | Bacteria | 1413 |
| 594 | Ga0495653_0011267 | 3300046463 | Bacteria | 7308 |
| 595 | Ga0495653_0028059 | 3300046463 | Eukaryota | 4505 |
| 596 | Ga0495653_0035346 | 3300046463 | Bacteria | 3944 |
| 597 | Ga0495653_0050594 | 3300046463 | Bacteria | 3195 |
| 598 | Ga0495580_0010680 | 3300046472 | Bacteria | 7133 |
| 599 | Ga0495580_0034339 | 3300046472 | Bacteria | 3652 |
| 600 | Ga0495580_0099894 | 3300046472 | Bacteria | 2019 |
| 601 | Ga0495582_0049291 | 3300046473 | Bacteria | 2319 |
| 602 | Ga0495605_0140857 | 3300046474 | Bacteria | 1082 |
| 603 | Ga0495639_0014797 | 3300046475 | Bacteria | 3380 |
| 604 | Ga0495639_0015417 | 3300046475 | Bacteria | 3315 |
| 605 | Ga0495662_0030700 | 3300046476 | Bacteria | 2594 |
| 606 | Ga0495664_0268527 | 3300046477 | Bacteria | 1031 |
| 607 | Ga0495594_0014756 | 3300046499 | Bacteria | 4101 |
| 608 | Ga0495608_0014921 | 3300046511 | Bacteria | 5392 |
| 609 | Ga0495608_0021592 | 3300046511 | Bacteria | 4418 |
| 610 | Ga0495618_0009337 | 3300046514 | Bacteria | 5920 |
| 611 | Ga0495628_0026376 | 3300046516 | Bacteria | 4739 |
| 612 | Ga0495628_0066603 | 3300046516 | Eukaryota | 2815 |
| 613 | Ga0495628_0123729 | 3300046516 | Bacteria | 1982 |
| 614 | Ga0495630_0096720 | 3300046517 | Eukaryota | 2232 |
| 615 | Ga0495630_0202698 | 3300046517 | Bacteria | 1514 |
| 616 | Ga0495643_0019784 | 3300046522 | Bacteria | 3892 |
| 617 | Ga0495666_0028998 | 3300046526 | Bacteria | 2723 |
| 618 | Ga0495642_0006593 | 3300046528 | Bacteria | 4456 |
| 619 | Ga0495652_0016270 | 3300046529 | Eukaryota | 6653 |
| 620 | Ga0495652_0024838 | 3300046529 | Bacteria | 5302 |
| 621 | Ga0495652_0036216 | 3300046529 | Bacteria | 4292 |
| 622 | Ga0495652_0095683 | 3300046529 | Eukaryota | 2420 |
| 623 | Ga0495665_0060245 | 3300046531 | Bacteria | 2004 |
| 624 | Ga0495665_0119539 | 3300046531 | Bacteria | 1380 |
| 625 | Ga0495640_0013821 | 3300046533 | Bacteria | 6131 |
| 626 | Ga0495640_0019133 | 3300046533 | Bacteria | 5060 |
| 627 | Ga0495587_0024465 | 3300046536 | Bacteria | 3700 |
| 628 | Ga0495587_0030508 | 3300046536 | Bacteria | 3269 |
| 629 | Ga0495597_0000102 | 3300046542 | Bacteria | 76204 |
| 630 | Ga0495645_0019292 | 3300046543 | Bacteria | 4909 |
| 631 | Ga0495667_0015567 | 3300046559 | Bacteria | 5141 |
| 632 | Ga0495667_0021890 | 3300046559 | Bacteria | 4309 |
| 633 | Ga0495656_0097898 | 3300046615 | Bacteria | 1352 |
| 634 | Ga0495656_0213869 | 3300046615 | Bacteria | 962 |
| 635 | Ga0495668_0000020 | 3300046616 | Bacteria | 411641 |
| 636 | Ga0495668_0011692 | 3300046616 | Bacteria | 5243 |
| 637 | Ga0495634_0012821 | 3300046642 | Bacteria | 6066 |
| 638 | Ga0495634_0019336 | 3300046642 | Bacteria | 4841 |
| 639 | Ga0495634_0024572 | 3300046642 | Eukaryota | 4226 |
| 640 | Ga0495634_0067823 | 3300046642 | Bacteria | 2358 |
| 641 | Ga0495635_0012490 | 3300046663 | Bacteria | 5949 |
| 642 | Ga0495635_0030818 | 3300046663 | Eukaryota | 3726 |
| 643 | Ga0495635_0042929 | 3300046663 | Bacteria | 3121 |
| 644 | Ga0495661_0009296 | 3300046665 | Bacteria | 6748 |
| 645 | Ga0495657_0007494 | 3300046675 | Eukaryota | 8433 |
| 646 | Ga0495657_0025296 | 3300046675 | Bacteria | 4218 |
| 647 | Ga0495657_0071180 | 3300046675 | Bacteria | 2271 |
| 648 | Ga0495657_0168811 | 3300046675 | Bacteria | 1349 |
| 649 | Ga0495599_0006520 | 3300046678 | Bacteria | 7041 |
| 650 | Ga0495599_0039811 | 3300046678 | Bacteria | 2953 |
| 651 | Ga0495623_0006249 | 3300046679 | Bacteria | 7746 |
| 652 | Ga0495646_0027875 | 3300046680 | Bacteria | 3541 |
| 653 | Ga0495646_0062282 | 3300046680 | Bacteria | 2218 |
| 654 | Ga0495646_0084386 | 3300046680 | Eukaryota | 1844 |
| 655 | Ga0495647_0016556 | 3300046681 | Bacteria | 2596 |
| 656 | Ga0495658_0006869 | 3300046683 | Bacteria | 5609 |
| 657 | Ga0495658_0092091 | 3300046683 | Bacteria | 1796 |
| 658 | Ga0495613_0069830 | 3300046689 | Bacteria | 2561 |
| 659 | Ga0495613_0149215 | 3300046689 | Bacteria | 1668 |
| 660 | Ga0495613_0180350 | 3300046689 | Bacteria | 1496 |
| 661 | Ga0495624_0001476 | 3300046690 | Eukaryota | 18250 |
| 662 | Ga0495624_0002969 | 3300046690 | Eukaryota | 12676 |
| 663 | Ga0495624_0024218 | 3300046690 | Bacteria | 3996 |
| 664 | Ga0495624_0042860 | 3300046690 | Bacteria | 2890 |
| 665 | Ga0495589_0000091 | 3300046794 | Bacteria | 85670 |
| 666 | Ga0495600_0010245 | 3300046809 | Bacteria | 5811 |
| 667 | Ga0495600_0071471 | 3300046809 | Eukaryota | 2267 |
| 668 | Ga0495581_0041039 | 3300047315 | Bacteria | 2677 |
| 669 | Ga0495604_0006471 | 3300047317 | Bacteria | 9289 |
| 670 | Ga0495604_0013652 | 3300047317 | Eukaryota | 6478 |
| 671 | Ga0495604_0018787 | 3300047317 | Bacteria | 5535 |
| 672 | Ga0495604_0028182 | 3300047317 | Bacteria | 4467 |
| 673 | Ga0495674_0009452 | 3300047319 | Eukaryota | 9263 |
| 674 | Ga0495674_0011849 | 3300047319 | Bacteria | 8220 |
| 675 | Ga0495674_0014791 | 3300047319 | Bacteria | 7300 |
| 676 | Ga0495674_0032997 | 3300047319 | Bacteria | 4693 |
| 677 | Ga0495674_0315848 | 3300047319 | Bacteria | 1274 |
| 678 | Ga0495676_0002631 | 3300047321 | Eukaryota | 16055 |
| 679 | Ga0495676_0007948 | 3300047321 | Eukaryota | 9724 |
| 680 | Ga0495676_0042145 | 3300047321 | Bacteria | 3750 |
| 681 | Ga0495680_0024592 | 3300047322 | Bacteria | 4995 |
| 682 | Ga0495680_0046045 | 3300047322 | Bacteria | 3441 |
| 683 | Ga0495680_0070688 | 3300047322 | Bacteria | 2660 |
| 684 | Ga0495680_0117713 | 3300047322 | Eukaryota | 1964 |
| 685 | Ga0495687_014386 | 3300047443 | Bacteria | 4077 |
| 686 | Ga0495675_0016865 | 3300047444 | Bacteria | 4620 |
| 687 | Ga0495684_0005133 | 3300047471 | Bacteria | 10214 |
| 688 | Ga0495684_0006871 | 3300047471 | Bacteria | 8835 |
| 689 | Ga0495684_0020155 | 3300047471 | Bacteria | 5136 |
| 690 | Ga0495684_0023268 | 3300047471 | Bacteria | 4763 |
| 691 | Ga0495684_0024746 | 3300047471 | Bacteria | 4617 |
| 692 | Ga0495593_0012276 | 3300047673 | Bacteria | 4896 |
| 693 | Ga0495593_0035643 | 3300047673 | Bacteria | 2700 |
| 694 | Ga0495602_0004743 | 3300048088 | Eukaryota | 14212 |
| 695 | Ga0495602_0014752 | 3300048088 | Eukaryota | 7920 |
| 696 | Ga0495602_0030617 | 3300048088 | Eukaryota | 5102 |
| 697 | Ga0495602_0037302 | 3300048088 | Bacteria | 4513 |
| 698 | Ga0495602_0039196 | 3300048088 | Eukaryota | 4367 |
| 699 | Ga0495602_0312836 | 3300048088 | Bacteria | 1145 |
| 700 | Ga0495602_0349409 | 3300048088 | Bacteria | 1068 |
| 701 | Ga0495614_0058969 | 3300048089 | Bacteria | 1648 |
| 702 | Ga0495614_0179865 | 3300048089 | Eukaryota | 951 |
| 703 | Ga0496100_0035948 | 3300048903 | Bacteria | 3120 |
| 704 | Ga0496100_0110286 | 3300048903 | Bacteria | 1910 |
| 705 | Ga0496101_0000731 | 3300048904 | Bacteria | 19558 |
| 706 | Ga0496101_0030130 | 3300048904 | Bacteria | 3801 |
| 707 | Ga0496102_0000056 | 3300048905 | Bacteria | 172707 |
| 708 | Ga0496102_0000174 | 3300048905 | Bacteria | 87691 |
| 709 | Ga0496102_0000484 | 3300048905 | Bacteria | 44164 |
| 710 | Ga0496102_0037136 | 3300048905 | Bacteria | 4393 |
| 711 | Ga0496102_0252967 | 3300048905 | Bacteria | 1661 |
| 712 | Ga0496102_0274076 | 3300048905 | Bacteria | 1591 |
| 713 | Ga0496102_0563993 | 3300048905 | Bacteria | 1061 |
| 714 | Ga0496103_0000040 | 3300048906 | Bacteria | 172148 |
| 715 | Ga0496103_0000320 | 3300048906 | Bacteria | 43999 |
| 716 | Ga0496103_0158216 | 3300048906 | Bacteria | 1452 |
| 717 | Ga0496104_0000282 | 3300048907 | Bacteria | 45161 |
| 718 | Ga0496104_0052036 | 3300048907 | Bacteria | 3867 |
| 719 | Ga0496104_0254514 | 3300048907 | Bacteria | 1669 |
| 720 | Ga0496104_0389821 | 3300048907 | Bacteria | 1305 |
| 721 | Ga0496105_0000136 | 3300048908 | Bacteria | 49541 |
| 722 | Ga0496105_0000423 | 3300048908 | Bacteria | 27810 |
| 723 | Ga0496105_0002210 | 3300048908 | Bacteria | 14097 |
| 724 | Ga0496105_0076506 | 3300048908 | Bacteria | 2763 |
| 725 | Ga0496105_0104763 | 3300048908 | Bacteria | 2335 |
| 726 | Ga0496106_0020159 | 3300048909 | Bacteria | 4947 |
| 727 | Ga0496106_0124626 | 3300048909 | Bacteria | 2016 |
| 728 | Ga0496106_0519628 | 3300048909 | Bacteria | 956 |
| 729 | Ga0496107_0017622 | 3300048910 | Bacteria | 5023 |
| 730 | Ga0496107_0139725 | 3300048910 | Bacteria | 1790 |
| 731 | Ga0496107_0367450 | 3300048910 | Bacteria | 1070 |
| 732 | Ga0496108_0003089 | 3300048911 | Bacteria | 13382 |
| 733 | Ga0496108_0030847 | 3300048911 | Bacteria | 4443 |
| 734 | Ga0496108_0121995 | 3300048911 | Bacteria | 2236 |
| 735 | Ga0496108_0170890 | 3300048911 | Bacteria | 1880 |
| 736 | Ga0496108_0216249 | 3300048911 | Bacteria | 1664 |
| 737 | Ga0496109_0042830 | 3300048912 | Bacteria | 4103 |
| 738 | Ga0496110_0036175 | 3300048913 | Bacteria | 4287 |
| 739 | Ga0496110_0092722 | 3300048913 | Bacteria | 2703 |
| 740 | Ga0496111_0015171 | 3300048914 | Bacteria | 5281 |
| 741 | Ga0496112_0005743 | 3300048915 | Bacteria | 10786 |
| 742 | Ga0496112_0039026 | 3300048915 | Bacteria | 4638 |
| 743 | Ga0496112_0039083 | 3300048915 | Bacteria | 4635 |
| 744 | Ga0496112_0269203 | 3300048915 | Bacteria | 1652 |
| 745 | Ga0496113_0000119 | 3300048916 | Bacteria | 33821 |
| 746 | Ga0496113_0028553 | 3300048916 | Bacteria | 4014 |
| 747 | Ga0496114_0014125 | 3300048917 | Bacteria | 6403 |
| 748 | Ga0496114_0441263 | 3300048917 | Bacteria | 1153 |
| 749 | Ga0496115_0000009 | 3300048918 | Bacteria | 234372 |
| 750 | Ga0496115_0110909 | 3300048918 | Bacteria | 2254 |
| 751 | Ga0496115_0153409 | 3300048918 | Bacteria | 1902 |
| 752 | Ga0496115_0179409 | 3300048918 | Bacteria | 1751 |
| 753 | Ga0496116_0000056 | 3300048919 | Bacteria | 282554 |
| 754 | Ga0496116_0000110 | 3300048919 | Bacteria | 185668 |
| 755 | Ga0496116_0008516 | 3300048919 | Bacteria | 8889 |
| 756 | Ga0496116_0014709 | 3300048919 | Bacteria | 6233 |
| 757 | Ga0496116_0051874 | 3300048919 | Bacteria | 2721 |
| 758 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 759 | Ga0496117_0000354 | 3300048920 | Bacteria | 80757 |
| 760 | Ga0496117_0000802 | 3300048920 | Bacteria | 48832 |
| 761 | Ga0496117_0005072 | 3300048920 | Bacteria | 14101 |
| 762 | Ga0496117_0008930 | 3300048920 | Bacteria | 9437 |
| 763 | Ga0496117_0019332 | 3300048920 | Bacteria | 5601 |
| 764 | Ga0496117_0052166 | 3300048920 | Bacteria | 2883 |
| 765 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 766 | Ga0496118_0000077 | 3300048921 | Bacteria | 192298 |
| 767 | Ga0496118_0000310 | 3300048921 | Bacteria | 84607 |
| 768 | Ga0496118_0006305 | 3300048921 | Bacteria | 13110 |
| 769 | Ga0496118_0008850 | 3300048921 | Bacteria | 10301 |
| 770 | Ga0496118_0009737 | 3300048921 | Bacteria | 9643 |
| 771 | Ga0496118_0011094 | 3300048921 | Bacteria | 8844 |
| 772 | Ga0496118_0017185 | 3300048921 | Bacteria | 6599 |
| 773 | Ga0496119_0000263 | 3300048922 | Bacteria | 74497 |
| 774 | Ga0496119_0000648 | 3300048922 | Bacteria | 46947 |
| 775 | Ga0496119_0000754 | 3300048922 | Bacteria | 43423 |
| 776 | Ga0496119_0086342 | 3300048922 | Bacteria | 1793 |
| 777 | Ga0496120_0000318 | 3300048923 | Bacteria | 79637 |
| 778 | Ga0496120_0000689 | 3300048923 | Bacteria | 49521 |
| 779 | Ga0496120_0000749 | 3300048923 | Bacteria | 47044 |
| 780 | Ga0496120_0090099 | 3300048923 | Eukaryota | 1641 |
| 781 | Ga0496121_0000121 | 3300048924 | Bacteria | 172480 |
| 782 | Ga0496121_0000432 | 3300048924 | Bacteria | 82444 |
| 783 | Ga0496121_0000984 | 3300048924 | Bacteria | 51021 |
| 784 | Ga0496121_0002135 | 3300048924 | Bacteria | 31064 |
| 785 | Ga0496121_0005637 | 3300048924 | Bacteria | 15932 |
| 786 | Ga0496121_0005718 | 3300048924 | Bacteria | 15795 |
| 787 | Ga0496121_0007340 | 3300048924 | Bacteria | 13328 |
| 788 | Ga0496121_0012058 | 3300048924 | Bacteria | 9496 |
| 789 | Ga0496122_0001087 | 3300048925 | Bacteria | 47227 |
| 790 | Ga0496122_0001497 | 3300048925 | Bacteria | 37328 |
| 791 | Ga0496122_0008986 | 3300048925 | Bacteria | 10623 |
| 792 | Ga0496122_0090011 | 3300048925 | Bacteria | 2096 |
| 793 | Ga0496122_0197494 | 3300048925 | Bacteria | 1180 |
| 794 | Ga0496123_0000889 | 3300048926 | Bacteria | 47309 |
| 795 | Ga0496123_0001632 | 3300048926 | Bacteria | 30225 |
| 796 | Ga0496124_0000050 | 3300048927 | Bacteria | 258041 |
| 797 | Ga0496124_0000219 | 3300048927 | Bacteria | 111562 |
| 798 | Ga0496124_0001992 | 3300048927 | Bacteria | 27833 |
| 799 | Ga0496124_0003260 | 3300048927 | Bacteria | 20044 |
| 800 | Ga0496124_0006361 | 3300048927 | Bacteria | 12884 |
| 801 | Ga0496124_0012220 | 3300048927 | Bacteria | 8493 |
| 802 | Ga0496124_0036067 | 3300048927 | Bacteria | 4318 |
| 803 | Ga0496124_0062622 | 3300048927 | Bacteria | 3112 |
| 804 | Ga0496124_0080025 | 3300048927 | Bacteria | 2690 |
| 805 | Ga0496125_0000114 | 3300048928 | Bacteria | 182012 |
| 806 | Ga0496125_0000796 | 3300048928 | Bacteria | 51436 |
| 807 | Ga0496125_0001252 | 3300048928 | Bacteria | 37872 |
| 808 | Ga0496125_0005292 | 3300048928 | Bacteria | 14432 |
| 809 | Ga0496125_0006057 | 3300048928 | Bacteria | 13218 |
| 810 | Ga0496125_0025241 | 3300048928 | Bacteria | 5447 |
| 811 | Ga0496125_0030371 | 3300048928 | Bacteria | 4836 |
| 812 | Ga0496125_0089350 | 3300048928 | Bacteria | 2317 |
| 813 | Ga0496125_0156461 | 3300048928 | Bacteria | 1556 |
| 814 | Ga0496126_0000113 | 3300048929 | Bacteria | 192212 |
| 815 | Ga0496126_0000837 | 3300048929 | Bacteria | 54604 |
| 816 | Ga0496126_0001389 | 3300048929 | Bacteria | 38297 |
| 817 | Ga0496126_0001447 | 3300048929 | Bacteria | 37214 |
| 818 | Ga0496126_0063154 | 3300048929 | Bacteria | 3320 |
| 819 | Ga0496126_0093310 | 3300048929 | Bacteria | 2643 |
| 820 | Ga0496126_0141114 | 3300048929 | Bacteria | 2074 |
| 821 | Ga0496126_0379222 | 3300048929 | Bacteria | 1151 |
| 822 | Ga0501306_011306 | 3300049127 | Bacteria | 1137 |
| 823 | Ga0501310_008254 | 3300049130 | Bacteria | 1128 |
| 824 | Ga0501304_004913 | 3300049160 | Bacteria | 1031 |
| 825 | Ga0501307_011885 | 3300049162 | Bacteria | 1028 |
| 826 | Ga0495682_0002192 | 3300049460 | Bacteria | 9453 |
| 827 | Ga0501315_016195 | 3300049531 | Bacteria | 963 |
| 828 | Ga0501324_002633 | 3300049540 | Bacteria | 1314 |
| 829 | Ga0501324_003666 | 3300049540 | Bacteria | 1189 |
| 830 | Ga0501036_0064815 | 3300049572 | Bacteria | 3092 |
| 831 | Ga0501039_0221374 | 3300049575 | Bacteria | 1488 |
| 832 | Ga0501042_0110916 | 3300049578 | Bacteria | 1975 |
| 833 | Ga0501046_0060300 | 3300049580 | Bacteria | 2969 |
| 834 | Ga0501075_0012498 | 3300049591 | Bacteria | 6036 |
| 835 | Ga0501076_0002231 | 3300049592 | Bacteria | 13277 |
| 836 | Ga0501077_0044776 | 3300049593 | Bacteria | 2811 |
| 837 | Ga0501079_0005429 | 3300049741 | Bacteria | 9499 |
| 838 | Ga0501080_0334394 | 3300049742 | Bacteria | 1369 |
| 839 | nmdc:mga03n38_24630_c1 | 3300050490 | Bacteria | 2462 |
| 840 | nmdc:mga00v17_231581_c1 | 3300050491 | Bacteria | 1197 |
| 841 | nmdc:mga0k408_23202_c1 | 3300050493 | Bacteria | 3498 |
| 842 | nmdc:mga0k408_2991_c1 | 3300050493 | Bacteria | 8962 |
| 843 | nmdc:mga0k408_35008_c1 | 3300050493 | Bacteria | 2878 |
| 844 | nmdc:mga06z11_17720_c1 | 3300050494 | Bacteria | 3239 |
| 845 | nmdc:mga07m45_23200_c1 | 3300050496 | Bacteria | 3390 |
| 846 | nmdc:mga05p37_559607_c1 | 3300050507 | Bacteria | 1300 |
| 847 | nmdc:mga09592_11987_c1 | 3300050508 | Bacteria | 7051 |
| 848 | nmdc:mga09592_70455_c1 | 3300050508 | Bacteria | 2967 |
| 849 | nmdc:mga0qj67_106602_c1 | 3300050509 | Bacteria | 2261 |
| 850 | nmdc:mga06r32_138352_c1 | 3300050510 | Bacteria | 2410 |
| 851 | nmdc:mga08y16_493360_c1 | 3300050511 | Bacteria | 1245 |
| 852 | nmdc:mga08y16_63983_c1 | 3300050511 | Bacteria | 3841 |
| 853 | nmdc:mga0rr50_212668_c1 | 3300050513 | Bacteria | 1594 |
| 854 | nmdc:mga0a205_10045_c1 | 3300050515 | Bacteria | 8686 |
| 855 | nmdc:mga0a205_353408_c1 | 3300050515 | Bacteria | 1337 |
| 856 | nmdc:mga0sz30_15904_c1 | 3300050516 | Bacteria | 2978 |
| 857 | nmdc:mga0sz30_24420_c2 | 3300050516 | Bacteria | 1528 |
| 858 | Ga0495601_0012010 | 3300053077 | Bacteria | 5189 |
| 859 | Ga0495601_0013485 | 3300053077 | Bacteria | 4915 |
| 860 | Ga0495601_0029907 | 3300053077 | Bacteria | 3381 |
| 861 | Ga0495601_0041517 | 3300053077 | Bacteria | 2884 |
| 862 | Ga0495601_0189851 | 3300053077 | Bacteria | 1343 |
| 863 | Ga0495612_0008448 | 3300053078 | Bacteria | 4176 |
| 864 | Ga0495595_0022118 | 3300053084 | Bacteria | 2787 |
| 865 | Ga0495619_0004470 | 3300053085 | Bacteria | 8926 |
| 866 | Ga0495619_0005558 | 3300053085 | Bacteria | 7999 |
| 867 | Ga0495619_0007982 | 3300053085 | Bacteria | 6697 |
| 868 | Ga0495619_0015724 | 3300053085 | Bacteria | 4791 |
| 869 | Ga0495619_0124124 | 3300053085 | Bacteria | 1771 |
| 870 | Ga0500595_000176 | 3300053119 | Bacteria | 42910 |
| 871 | Ga0500595_000351 | 3300053119 | Bacteria | 30073 |
| 872 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 873 | Ga0500616_0003816 | 3300053153 | Bacteria | 11177 |
| 874 | Ga0500636_0024960 | 3300053177 | Bacteria | 3533 |
| 875 | Ga0501084_0011217 | 3300054114 | Bacteria | 7421 |
| 876 | Ga0501084_0457518 | 3300054114 | Bacteria | 1079 |
| 877 | Ga0587093_001988 | 3300059478 | Bacteria | 1832 |
| 878 | Ga0587090_005294 | 3300059510 | Bacteria | 1611 |
| 879 | Ga0587071_001577 | 3300060344 | Bacteria | 2890 |
| 880 | Ga0501082_0002439 | 3300060353 | Bacteria | 16314 |
| 881 | Ga0530510_0000677 | 3300061734 | Bacteria | 21951 |
| 882 | 2508725853 | 2508501050 | Bacteria | 9633614 |
| 883 | 2511136520 | 2510917022 | Bacteria | 6504556 |
| 884 | 2511365544 | 2511231022 | Bacteria | 6719296 |
| 885 | 2552746356 | 2551306352 | Bacteria | 3873115 |
| 886 | 2555230674 | 2554235227 | Bacteria | 3637389 |
| 887 | 2555259590 | 2554235234 | Bacteria | 5762085 |
| 888 | 2585274321 | 2582581307 | Bacteria | 6597605 |
| 889 | 2585560770 | 2585427531 | Bacteria | 6992870 |
| 890 | 2586004351 | 2585427634 | Bacteria | 6455027 |
| 891 | 2599448446 | 2599185178 | Bacteria | 5365746 |
| 892 | 2599612082 | 2599185212 | Bacteria | 6765997 |
| 893 | 2599926441 | 2599185299 | Bacteria | 4854625 |
| 894 | 2599993028 | 2599185311 | Bacteria | 6354990 |
| 895 | 2600045346 | 2599185319 | Bacteria | 6637840 |
| 896 | 2600058108 | 2599185322 | Bacteria | 6763055 |
| 897 | 2600067832 | 2599185323 | Bacteria | 6688755 |
| 898 | 2603865580 | 2602042109 | Bacteria | 5152801 |
| 899 | 2616293067 | 2615840624 | Bacteria | 6557588 |
| 900 | 2637227415 | 2636415599 | Bacteria | 5718434 |
| 901 | 2640733298 | 2639762793 | Bacteria | 3943681 |
| 902 | 2644244039 | 2643221644 | Bacteria | 6865017 |
| 903 | 2650897185 | 2648501693 | Bacteria | 5069560 |
| 904 | 2678230339 | 2675903507 | Bacteria | 3737791 |
| 905 | 2686354093 | 2684622997 | Bacteria | 4624240 |
| 906 | 2691515519 | 2690315906 | Bacteria | 4517044 |
| 907 | 2707098147 | 2706794495 | Bacteria | 4536932 |
| 908 | 2739197266 | 2738543004 | Bacteria | 6381073 |
| 909 | 2753767746 | 2751185897 | Bacteria | 5322941 |
| 910 | 2774389113 | 2773857761 | Bacteria | 3837365 |
| 911 | 2774439304 | 2773857770 | Bacteria | 3911866 |
| 912 | 2776264921 | 2775506901 | Bacteria | 9631051 |
| 913 | 2777021785 | 2775507074 | Bacteria | 5532402 |
| 914 | 2793367600 | 2791355267 | Bacteria | 7222458 |
| 915 | 2809125646 | 2808606414 | Bacteria | 4917181 |
| 916 | 2809146961 | 2808606418 | Bacteria | 6724496 |
| 917 | 2812349100 | 2811994878 | Bacteria | 5992952 |
| 918 | 2817490222 | 2816332298 | Bacteria | 6852809 |
| 919 | 2819550701 | 2818991438 | Bacteria | 5793701 |
| 920 | 2819637267 | 2818991452 | Bacteria | 8442785 |
| 921 | 2819661446 | 2818991457 | Bacteria | 5323295 |
| 922 | 2825656979 | 2825651385 | Bacteria | 6715909 |
| 923 | 2834030485 | 2834028612 | Bacteria | 6354979 |
| 924 | 2840768215 | 2840764183 | Bacteria | 6358399 |
| 925 | 2847799052 | 2847797336 | Bacteria | 5176640 |
| 926 | 2852687308 | 2852684882 | Bacteria | 5463342 |
| 927 | 2863428056 | 2863421361 | Bacteria | 7300805 |
| 928 | 2891973150 | 2891968417 | Bacteria | 5821697 |
| 929 | 2894235509 | 2894232714 | Bacteria | 8834183 |
| 930 | 2900580474 | 2900577576 | Bacteria | 5438534 |
| 931 | 2902796426 | 2902792274 | Bacteria | 7270173 |
| 932 | 2904437097 | 2904434214 | Bacteria | 6230908 |
| 933 | 2904515755 | 2904513164 | Bacteria | 5476410 |
| 934 | 2904616196 | 2904615490 | Bacteria | 10047340 |
| 935 | 2904767151 | 2904765812 | Bacteria | 5369154 |
| 936 | 2904773903 | 2904770941 | Bacteria | 5580202 |
| 937 | 2913040572 | 2913036834 | Bacteria | 6704877 |
| 938 | 2919110088 | 2919108558 | Bacteria | 5897419 |
| 939 | 2919130925 | 2919130084 | Bacteria | 5301837 |
| 940 | 2919185376 | 2919182534 | Bacteria | 3907101 |
| 941 | 2919420407 | 2919420072 | Bacteria | 5390363 |
| 942 | 2919433835 | 2919432681 | Bacteria | 5390474 |
| 943 | 2919483417 | 2919481497 | Bacteria | 6907839 |
| 944 | 2919505036 | 2919501602 | Bacteria | 5286340 |
| 945 | 2926066713 | 2926063275 | Bacteria | 5285848 |
| 946 | 2928177934 | 2928170801 | Bacteria | 8785406 |
| 947 | 2928526439 | 2928521798 | Bacteria | 4960112 |
| 948 | 2929196162 | 2929195423 | Bacteria | 5325372 |
| 949 | 2945938975 | 2945934425 | Bacteria | 7444609 |
| 950 | 2969084454 | 2969079654 | Bacteria | 5439582 |
| 951 | 2971825381 | 2971820967 | Bacteria | 5823634 |
| 952 | 2984497456 | 2984494565 | Bacteria | 5000175 |
| 953 | 2984561569 | 2984559226 | Bacteria | 5683096 |
| 954 | 2984599634 | 2984595703 | Bacteria | 5682994 |
| 955 | 2990261407 | 2990261002 | Bacteria | 4919493 |
| 956 | 2990708975 | 2990703756 | Bacteria | 7715990 |
| 957 | 8002747519 | 8002745576 | Bacteria | 4840272 |
| 958 | 8004028256 | 8004025490 | Bacteria | 4327753 |
| 959 | 8018127435 | 8018127388 | Bacteria | 7351159 |
| 960 | 8021127151 | 8021120328 | Bacteria | 8782274 |
| 961 | 8021623681 | 8021622325 | Bacteria | 4844743 |
| 962 | 8021628705 | 8021626552 | Bacteria | 4665214 |
| 963 | 8021651535 | 8021648035 | Bacteria | 4772378 |
| 964 | 8055273068 | 8055266321 | Bacteria | 7999742 |
| 965 | 8055306949 | 8055301274 | Bacteria | 8587385 |
| 966 | 8056377545 | 8056375014 | Bacteria | 7006639 |
| 967 | 8057161172 | 8057160832 | Bacteria | 3268302 |
| 968 | Ga0070665_100556001 | |||
| 969 | SwRhRL2b_contig_1024214 | |||
| 970 | SwRhRL2b_contig_1448349 | |||
| 971 | SwRhRL2b_contig_1845099 | |||
| 972 | SwRhRL2b_contig_2237776 | |||
| 973 | SwRhRL2b_contig_42532 | |||
| 974 | JGI24739J22299_10000367 | |||
| 975 | JGI24034J26672_10004338 | |||
| 976 | JGI24751J29686_10007770 | |||
| 977 | JGI25156J39149_1000365 | |||
| 978 | JGI25406J46586_10017074 | |||
| 979 | JGI25153J46596_10000751 | |||
| 980 | rootL2_10000529 | |||
| 981 | rootH1_10012306 | |||
| 982 | Ga0055533_1000469 | |||
| 983 | Ga0055532_1000577 | |||
| 984 | Ga0055527_1000866 | |||
| 985 | Ga0055535_1001178 | |||
| 986 | Ga0055535_1011754 | |||
| 987 | Ga0055542_1001170 | |||
| 988 | Ga0055529_1000817 | |||
| 989 | Ga0055524_1007666 | |||
| 990 | Ga0055528_1003975 | |||
| 991 | Ga0055528_1012987 | |||
| 992 | Ga0055528_1016714 | |||
| 993 | Ga0055540_1000571 | |||
| 994 | Ga0055531_10008799 | |||
| 995 | Ga0058692_1000014 | |||
| 996 | Ga0058692_1000028 | |||
| 997 | Ga0058860_11916293 | |||
| 998 | Ga0065703_1000280 | |||
| 999 | Ga0065714_10002420 | |||
| 1000 | Ga0065704_10000243 | |||
| 1001 | Ga0065704_10000696 | |||
| 1002 | Ga0065704_10070144 | |||
| 1003 | Ga0065704_10070434 | |||
| 1004 | Ga0065704_10070457 | |||
| 1005 | Ga0070658_10015399 | |||
| 1006 | Ga0070670_100011500 | |||
| 1007 | Ga0070670_100019120 | |||
| 1008 | Ga0070670_100021935 | |||
| 1009 | Ga0070670_100074262 | |||
| 1010 | Ga0070670_100113107 | |||
| 1011 | Ga0070670_100117294 | |||
| 1012 | Ga0070670_100175692 | |||
| 1013 | Ga0068869_100174439 | |||
| 1014 | Ga0070682_100074703 | |||
| 1015 | Ga0068868_100022641 | |||
| 1016 | Ga0068868_100320528 | |||
| 1017 | Ga0070689_100015734 | |||
| 1018 | Ga0070689_100211342 | |||
| 1019 | Ga0070661_100127517 | |||
| 1020 | Ga0070692_10123958 | |||
| 1021 | Ga0070668_100004095 | |||
| 1022 | Ga0070668_100013153 | |||
| 1023 | Ga0070668_100014523 | |||
| 1024 | Ga0070668_100017328 | |||
| 1025 | Ga0070668_100017619 | |||
| 1026 | Ga0070668_100046278 | |||
| 1027 | Ga0070668_100062129 | |||
| 1028 | Ga0070668_100109911 | |||
| 1029 | Ga0070669_100000198 | |||
| 1030 | Ga0070669_100008875 | |||
| 1031 | Ga0070669_100010205 | |||
| 1032 | Ga0070669_100010538 | |||
| 1033 | Ga0070669_100020177 | |||
| 1034 | Ga0070669_100031025 | |||
| 1035 | Ga0070669_100137244 | |||
| 1036 | Ga0070669_100353720 | |||
| 1037 | Ga0070675_100035183 | |||
| 1038 | Ga0070675_100074071 | |||
| 1039 | Ga0070671_100000044 | |||
| 1040 | Ga0070671_100001152 | |||
| 1041 | Ga0070671_100014900 | |||
| 1042 | Ga0070671_100023842 | |||
| 1043 | Ga0070671_100053822 | |||
| 1044 | Ga0070673_100014750 | |||
| 1045 | Ga0070673_100108118 | |||
| 1046 | Ga0070667_100000485 | |||
| 1047 | Ga0070667_100004482 | |||
| 1048 | Ga0070709_10448100 | |||
| 1049 | Ga0070713_100000289 | |||
| 1050 | Ga0070713_100072441 | |||
| 1051 | Ga0070713_100075934 | |||
| 1052 | Ga0070710_10027841 | |||
| 1053 | Ga0070711_100056576 | |||
| 1054 | Ga0070711_100058341 | |||
| 1055 | Ga0070711_100064195 | |||
| 1056 | Ga0070708_100066790 | |||
| 1057 | Ga0070663_100028759 | |||
| 1058 | Ga0070663_100100255 | |||
| 1059 | Ga0070663_100185400 | |||
| 1060 | Ga0070662_100128344 | |||
| 1061 | Ga0070662_100198505 | |||
| 1062 | Ga0068867_100026629 | |||
| 1063 | Ga0070685_10072180 | |||
| 1064 | Ga0070685_10174814 | |||
| 1065 | Ga0070706_100025076 | |||
| 1066 | Ga0070699_100053313 | |||
| 1067 | Ga0070672_100036248 | |||
| 1068 | Ga0070672_100059975 | |||
| 1069 | Ga0070693_100119230 | |||
| 1070 | Ga0070665_100000878 | |||
| 1071 | Ga0070665_100003594 | |||
| 1072 | Ga0070665_100034401 | |||
| 1073 | Ga0070665_100097495 | |||
| 1074 | Ga0070665_100141383 | |||
| 1075 | Ga0070665_100191133 | |||
| 1076 | Ga0070665_100205038 | |||
| 1077 | Ga0070665_100299023 | |||
| 1078 | Ga0068855_100000037 | |||
| 1079 | Ga0068855_100020370 | |||
| 1080 | Ga0070664_100032779 | |||
| 1081 | Ga0068857_100002837 | |||
| 1082 | Ga0068854_100357091 | |||
| 1083 | Ga0068856_100154509 | |||
| 1084 | Ga0068852_100273399 | |||
| 1085 | Ga0068859_100042732 | |||
| 1086 | Ga0068859_100098143 | |||
| 1087 | Ga0068859_100251484 | |||
| 1088 | Ga0068859_100411617 | |||
| 1089 | Ga0068864_100010805 | |||
| 1090 | Ga0068864_100083125 | |||
| 1091 | Ga0068864_100169922 | |||
| 1092 | Ga0068861_100269451 | |||
| 1093 | Ga0068861_100341983 | |||
| 1094 | Ga0068870_10023888 | |||
| 1095 | Ga0068863_100009249 | |||
| 1096 | Ga0068863_100010052 | |||
| 1097 | Ga0068863_100040210 | |||
| 1098 | Ga0068863_100065603 | |||
| 1099 | Ga0068858_100006378 | |||
| 1100 | Ga0068858_100038154 | |||
| 1101 | Ga0068858_100063792 | |||
| 1102 | Ga0068860_100004982 | |||
| 1103 | Ga0068860_100007867 | |||
| 1104 | Ga0068860_100050953 | |||
| 1105 | Ga0068860_100151415 | |||
| 1106 | Ga0068860_100251985 | |||
| 1107 | Ga0068860_100467543 | |||
| 1108 | Ga0068862_100011964 | |||
| 1109 | Ga0068862_100012903 | |||
| 1110 | Ga0068862_100030283 | |||
| 1111 | Ga0068862_100073070 | |||
| 1112 | Ga0068862_100076885 | |||
| 1113 | Ga0068862_100084915 | |||
| 1114 | Ga0081455_10015596 | |||
| 1115 | Ga0081540_1000175 | |||
| 1116 | Ga0081540_1022037 | |||
| 1117 | Ga0081539_10004485 | |||
| 1118 | Ga0081539_10073243 | |||
| 1119 | Ga0075363_100014851 | |||
| 1120 | Ga0075363_100040205 | |||
| 1121 | Ga0075363_100125773 | |||
| 1122 | Ga0075364_10050785 | |||
| 1123 | Ga0075432_10009478 | |||
| 1124 | Ga0075432_10010009 | |||
| 1125 | Ga0070716_100035078 | |||
| 1126 | Ga0075362_10017169 | |||
| 1127 | Ga0075367_10020906 | |||
| 1128 | Ga0075367_10053954 | |||
| 1129 | Ga0075369_10016219 | |||
| 1130 | Ga0075369_10019958 | |||
| 1131 | Ga0075366_10000419 | |||
| 1132 | Ga0075366_10011020 | |||
| 1133 | Ga0075366_10015917 | |||
| 1134 | Ga0075366_10054373 | |||
| 1135 | Ga0075370_10035756 | |||
| 1136 | Ga0075370_10211532 | |||
| 1137 | Ga0075428_100068666 | |||
| 1138 | Ga0075430_100011408 | |||
| 1139 | Ga0075430_100129615 | |||
| 1140 | Ga0075430_100138678 | |||
| 1141 | Ga0075431_100300468 | |||
| 1142 | Ga0075433_10016630 | |||
| 1143 | Ga0075434_100001356 | |||
| 1144 | Ga0075434_100296667 | |||
| 1145 | Ga0075429_100016836 | |||
| 1146 | Ga0097620_100042731 | |||
| 1147 | Ga0097620_100098144 | |||
| 1148 | Ga0097620_100251475 | |||
| 1149 | Ga0097620_100411614 | |||
| 1150 | Ga0099823_1000033 | |||
| 1151 | Ga0099794_10002464 | |||
| 1152 | Ga0105251_10000075 | |||
| 1153 | Ga0105251_10000239 | |||
| 1154 | Ga0105251_10001294 | |||
| 1155 | Ga0105251_10001422 | |||
| 1156 | Ga0105251_10001607 | |||
| 1157 | Ga0105251_10002112 | |||
| 1158 | Ga0105251_10013543 | |||
| 1159 | Ga0105251_10024951 | |||
| 1160 | Ga0105251_10025991 | |||
| 1161 | Ga0105251_10032576 | |||
| 1162 | Ga0105244_10005583 | |||
| 1163 | Ga0105250_10002874 | |||
| 1164 | Ga0105250_10003656 | |||
| 1165 | Ga0105240_10023443 | |||
| 1166 | Ga0111539_10562013 | |||
| 1167 | Ga0105245_10037563 | |||
| 1168 | Ga0105247_10004686 | |||
| 1169 | Ga0105247_10034631 | |||
| 1170 | Ga0105243_10000249 | |||
| 1171 | Ga0105243_10015538 | |||
| 1172 | Ga0105243_10023100 | |||
| 1173 | Ga0105243_10023311 | |||
| 1174 | Ga0105248_10003673 | |||
| 1175 | Ga0105248_10014957 | |||
| 1176 | Ga0105248_10042429 | |||
| 1177 | Ga0105248_10126471 | |||
| 1178 | Ga0105248_10156962 | |||
| 1179 | Ga0105248_10157398 | |||
| 1180 | Ga0105248_10403316 | |||
| 1181 | Ga0105237_10024655 | |||
| 1182 | Ga0105237_10509750 | |||
| 1183 | Ga0105238_10028042 | |||
| 1184 | Ga0105249_10010654 | |||
| 1185 | Ga0105249_10226790 | |||
| 1186 | Ga0105148_100125 | |||
| 1187 | Ga0105148_102481 | |||
| 1188 | Ga0099796_10021889 | |||
| 1189 | Ga0105239_10001024 | |||
| 1190 | Ga0105239_10200367 | |||
| 1191 | Ga0105239_10339797 | |||
| 1192 | Ga0105246_10019597 | |||
| 1193 | Ga0157370_10007312 | |||
| 1194 | Ga0157369_10196540 | |||
| 1195 | Ga0157369_10405814 | |||
| 1196 | Ga0157374_10159694 | |||
| 1197 | Ga0157374_10431268 | |||
| 1198 | Ga0157374_10626342 | |||
| 1199 | Ga0163162_10000398 | |||
| 1200 | Ga0163162_10014417 | |||
| 1201 | Ga0163162_10037551 | |||
| 1202 | Ga0163162_10107352 | |||
| 1203 | Ga0163162_10172008 | |||
| 1204 | Ga0163162_10340260 | |||
| 1205 | Ga0157372_10274997 | |||
| 1206 | Ga0157375_10039196 | |||
| 1207 | Ga0163163_10026334 | |||
| 1208 | Ga0163163_10096555 | |||
| 1209 | Ga0157380_10000081 | |||
| 1210 | Ga0157380_10114610 | |||
| 1211 | Ga0157377_10195811 | |||
| 1212 | Ga0157379_10140333 | |||
| 1213 | Ga0157379_10194644 | |||
| 1214 | Ga0182007_10004297 | |||
| 1215 | Ga0163161_10000427 | |||
| 1216 | Ga0163161_10011170 | |||
| 1217 | Ga0163161_10028287 | |||
| 1218 | Ga0163161_10181101 | |||
| 1219 | Ga0163161_10213310 | |||
| 1220 | Ga0206355_1050631 | |||
| 1221 | Ga0206354_11554051 | |||
| 1222 | Ga0224712_10150079 | |||
| 1223 | Ga0209674_100049 | |||
| 1224 | Ga0209672_100097 | |||
| 1225 | Ga0209147_100106 | |||
| 1226 | Ga0209258_100157 | |||
| 1227 | Ga0209258_101138 | |||
| 1228 | Ga0209258_107071 | |||
| 1229 | Ga0209148_1000150 | |||
| 1230 | Ga0209759_1000041 | |||
| 1231 | Ga0209455_1000132 | |||
| 1232 | Ga0209673_1000324 | |||
| 1233 | Ga0209673_1001616 | |||
| 1234 | Ga0209673_1003540 | |||
| 1235 | Ga0209673_1003939 | |||
| 1236 | Ga0209564_1011053 | |||
| 1237 | Ga0209758_1000382 | |||
| 1238 | Ga0209758_1004836 | |||
| 1239 | Ga0209050_1002396 | |||
| 1240 | Ga0209050_1021597 | |||
| 1241 | Ga0209256_1001786 | |||
| 1242 | Ga0209051_1000462 | |||
| 1243 | Ga0209051_1002774 | |||
| 1244 | Ga0209257_1001143 | |||
| 1245 | Ga0209257_1009675 | |||
| 1246 | Ga0207696_1001489 | |||
| 1247 | Ga0207696_1002726 | |||
| 1248 | Ga0207696_1025010 | |||
| 1249 | Ga0207655_1000327 | |||
| 1250 | Ga0207655_1000339 | |||
| 1251 | Ga0207713_1000038 | |||
| 1252 | Ga0207713_1001016 | |||
| 1253 | Ga0207713_1003536 | |||
| 1254 | Ga0207713_1006052 | |||
| 1255 | Ga0207713_1007177 | |||
| 1256 | Ga0207713_1007672 | |||
| 1257 | Ga0207713_1010855 | |||
| 1258 | Ga0207710_10001632 | |||
| 1259 | Ga0207710_10052925 | |||
| 1260 | Ga0207680_10057312 | |||
| 1261 | Ga0207680_10315771 | |||
| 1262 | Ga0207685_10018230 | |||
| 1263 | Ga0207645_10089515 | |||
| 1264 | Ga0207645_10131205 | |||
| 1265 | Ga0207643_10031355 | |||
| 1266 | Ga0207705_10005976 | |||
| 1267 | Ga0207705_10249496 | |||
| 1268 | Ga0207695_10014875 | |||
| 1269 | Ga0207695_10064490 | |||
| 1270 | Ga0207671_10017485 | |||
| 1271 | Ga0207671_10133716 | |||
| 1272 | Ga0207671_10366936 | |||
| 1273 | Ga0207693_10033688 | |||
| 1274 | Ga0207693_10058144 | |||
| 1275 | Ga0207693_10351693 | |||
| 1276 | Ga0207663_10074208 | |||
| 1277 | Ga0207663_10205893 | |||
| 1278 | Ga0207662_10018677 | |||
| 1279 | Ga0207657_10088952 | |||
| 1280 | Ga0207649_10301479 | |||
| 1281 | Ga0207681_10000177 | |||
| 1282 | Ga0207681_10010161 | |||
| 1283 | Ga0207681_10036366 | |||
| 1284 | Ga0207681_10052906 | |||
| 1285 | Ga0207694_10202000 | |||
| 1286 | Ga0207694_10329011 | |||
| 1287 | Ga0207650_10002502 | |||
| 1288 | Ga0207650_10011955 | |||
| 1289 | Ga0207650_10012392 | |||
| 1290 | Ga0207650_10038911 | |||
| 1291 | Ga0207650_10208193 | |||
| 1292 | Ga0207659_10011480 | |||
| 1293 | Ga0207659_10138200 | |||
| 1294 | Ga0207687_10017974 | |||
| 1295 | Ga0207700_10000071 | |||
| 1296 | Ga0207700_10057725 | |||
| 1297 | Ga0207644_10000080 | |||
| 1298 | Ga0207644_10000766 | |||
| 1299 | Ga0207644_10002305 | |||
| 1300 | Ga0207644_10017094 | |||
| 1301 | Ga0207644_10040520 | |||
| 1302 | Ga0207644_10056327 | |||
| 1303 | Ga0207690_10225262 | |||
| 1304 | Ga0207706_10022990 | |||
| 1305 | Ga0207706_10081730 | |||
| 1306 | Ga0207706_10379492 | |||
| 1307 | Ga0207709_10000001 | |||
| 1308 | Ga0207709_10003040 | |||
| 1309 | Ga0207709_10032763 | |||
| 1310 | Ga0207709_10034026 | |||
| 1311 | Ga0207670_10074057 | |||
| 1312 | Ga0207670_10113520 | |||
| 1313 | Ga0207669_10035112 | |||
| 1314 | Ga0207669_10084002 | |||
| 1315 | Ga0207691_10070957 | |||
| 1316 | Ga0207691_10407052 | |||
| 1317 | Ga0207711_10003533 | |||
| 1318 | Ga0207711_10009758 | |||
| 1319 | Ga0207711_10020446 | |||
| 1320 | Ga0207711_10282102 | |||
| 1321 | Ga0207689_10138058 | |||
| 1322 | Ga0207689_10373778 | |||
| 1323 | Ga0207679_10077238 | |||
| 1324 | Ga0207679_10536605 | |||
| 1325 | Ga0207667_10000053 | |||
| 1326 | Ga0207667_10001176 | |||
| 1327 | Ga0207651_10038654 | |||
| 1328 | Ga0207651_10070979 | |||
| 1329 | Ga0207651_10233357 | |||
| 1330 | Ga0207712_10005748 | |||
| 1331 | Ga0207712_10101710 | |||
| 1332 | Ga0207668_10004844 | |||
| 1333 | Ga0207668_10021228 | |||
| 1334 | Ga0207668_10021701 | |||
| 1335 | Ga0207668_10034036 | |||
| 1336 | Ga0207668_10082720 | |||
| 1337 | Ga0207640_10246346 | |||
| 1338 | Ga0207658_10000213 | |||
| 1339 | Ga0207658_10003133 | |||
| 1340 | Ga0207703_10035852 | |||
| 1341 | Ga0207703_10052382 | |||
| 1342 | Ga0207639_10274664 | |||
| 1343 | Ga0207678_10124403 | |||
| 1344 | Ga0207678_10130582 | |||
| 1345 | Ga0207678_10210463 | |||
| 1346 | Ga0207641_10003981 | |||
| 1347 | Ga0207641_10020272 | |||
| 1348 | Ga0207641_10032484 | |||
| 1349 | Ga0207641_10050190 | |||
| 1350 | Ga0207648_10093070 | |||
| 1351 | Ga0207648_10477397 | |||
| 1352 | Ga0207676_10014487 | |||
| 1353 | Ga0207676_10068794 | |||
| 1354 | Ga0207674_10022818 | |||
| 1355 | Ga0207674_10179237 | |||
| 1356 | Ga0207675_100001472 | |||
| 1357 | Ga0207675_100052226 | |||
| 1358 | Ga0207675_100126177 | |||
| 1359 | Ga0207675_100245502 | |||
| 1360 | Ga0207683_10221060 | |||
| 1361 | Ga0207683_10259477 | |||
| 1362 | Ga0207698_10200048 | |||
| 1363 | Ga0207698_10256724 | |||
| 1364 | Ga0209389_1005072 | |||
| 1365 | Ga0209371_1000025 | |||
| 1366 | Ga0209371_1000040 | |||
| 1367 | Ga0209371_1000259 | |||
| 1368 | Ga0209371_1000604 | |||
| 1369 | Ga0209588_1000642 | |||
| 1370 | Ga0268266_10001045 | |||
| 1371 | Ga0268266_10002815 | |||
| 1372 | Ga0268266_10042995 | |||
| 1373 | Ga0268266_10074285 | |||
| 1374 | Ga0268266_10211819 | |||
| 1375 | Ga0268266_10258706 | |||
| 1376 | Ga0268266_10418653 | |||
| 1377 | Ga0268265_10000218 | |||
| 1378 | Ga0268265_10026965 | |||
| 1379 | Ga0268265_10045029 | |||
| 1380 | Ga0268265_10047013 | |||
| 1381 | Ga0268265_10058166 | |||
| 1382 | Ga0268265_10080942 | |||
| 1383 | Ga0268265_10309660 | |||
| 1384 | Ga0268264_10002221 | |||
| 1385 | Ga0268264_10003005 | |||
| 1386 | Ga0268264_10028441 | |||
| 1387 | Ga0268264_10546447 | |||
| 1388 | Ga0307515_10001534 | |||
| 1389 | Ga0268256_1000027 | |||
| 1390 | Ga0268256_1000041 | |||
| 1391 | Ga0268256_1000233 | |||
| 1392 | Ga0268256_1000510 | |||
| 1393 | Ga0265330_10051485 | |||
| 1394 | Ga0265332_10011181 | |||
| 1395 | Ga0307513_10440403 | |||
| 1396 | Ga0307408_100002383 | |||
| 1397 | Ga0307408_100016611 | |||
| 1398 | Ga0307408_100057979 | |||
| 1399 | Ga0307408_100071439 | |||
| 1400 | Ga0307408_100132766 | |||
| 1401 | Ga0307408_100268014 | |||
| 1402 | Ga0307405_10051184 | |||
| 1403 | Ga0307405_10134869 | |||
| 1404 | Ga0307413_10030443 | |||
| 1405 | Ga0307413_10058751 | |||
| 1406 | Ga0307413_10076889 | |||
| 1407 | Ga0307413_10386825 | |||
| 1408 | Ga0307410_10008484 | |||
| 1409 | Ga0307410_10028554 | |||
| 1410 | Ga0307410_10085192 | |||
| 1411 | Ga0307410_10223043 | |||
| 1412 | Ga0307410_10264875 | |||
| 1413 | Ga0307410_10287293 | |||
| 1414 | Ga0307406_10232960 | |||
| 1415 | Ga0307406_10461950 | |||
| 1416 | Ga0307407_10008019 | |||
| 1417 | Ga0307407_10031390 | |||
| 1418 | Ga0307407_10354241 | |||
| 1419 | Ga0307412_10000015 | |||
| 1420 | Ga0307412_10017164 | |||
| 1421 | Ga0307412_10104590 | |||
| 1422 | Ga0307412_10257455 | |||
| 1423 | Ga0307409_100026764 | |||
| 1424 | Ga0307409_100176283 | |||
| 1425 | Ga0307409_100339081 | |||
| 1426 | Ga0307409_100417644 | |||
| 1427 | Ga0307416_100013635 | |||
| 1428 | Ga0307416_100091117 | |||
| 1429 | Ga0307414_10544612 | |||
| 1430 | Ga0307415_100009223 | |||
| 1431 | Ga0316593_10002636 | |||
| 1432 | Ga0316593_10012634 | |||
| 1433 | Ga0316593_10094855 | |||
| 1434 | Ga0316592_1001937 | |||
| 1435 | Ga0316592_1007064 | |||
| 1436 | Ga0316592_1008227 | |||
| 1437 | Ga0316588_1015147 | |||
| 1438 | Ga0316596_1011671 | |||
| 1439 | Ga0373926_0048813 | |||
| 1440 | Ga0373926_0101378 | |||
| 1441 | Ga0373923_0027239 | |||
| 1442 | Ga0373936_0019183 | |||
| 1443 | Ga0373945_0011383 | |||
| 1444 | Ga0373953_0009240 | |||
| 1445 | Ga0373954_0003072 | |||
| 1446 | Ga0373954_0067827 | |||
| 1447 | Ga0373943_0016830 | |||
| 1448 | Ga0373946_0011243 | |||
| 1449 | Ga0373946_0034050 | |||
| 1450 | Ga0373955_0004841 | |||
| 1451 | Ga0316574_0002172 | |||
| 1452 | Ga0316574_0058353 | |||
| 1453 | Ga0373935_0027481 | |||
| 1454 | Ga0373935_0045369 | |||
| 1455 | Ga0373935_0128848 | |||
| 1456 | Ga0373927_0018924 | |||
| 1457 | Ga0373927_0024801 | |||
| 1458 | Ga0373927_0185870 | |||
| 1459 | Ga0373933_0058601 | |||
| 1460 | Ga0373947_0011648 | |||
| 1461 | Ga0373947_0045708 | |||
| 1462 | Ga0373937_0022427 | |||
| 1463 | Ga0373937_0040021 | |||
| 1464 | Ga0373937_0316220 | |||
| 1465 | Ga0395899_0002992 | |||
| 1466 | Ga0395899_0024573 | |||
| 1467 | Ga0395899_0047828 | |||
| 1468 | Ga0395899_0057145 | |||
| 1469 | Ga0395899_0218317 | |||
| 1470 | Ga0395900_0008700 | |||
| 1471 | Ga0395900_0017614 | |||
| 1472 | Ga0395900_0072067 | |||
| 1473 | Ga0395900_0173016 | |||
| 1474 | Ga0395900_0254885 | |||
| 1475 | Ga0395898_0006782 | |||
| 1476 | Ga0395898_0014126 | |||
| 1477 | Ga0395898_0083465 | |||
| 1478 | Ga0395898_0181688 | |||
| 1479 | Ga0395898_0390286 | |||
| 1480 | Ga0395905_0002322 | |||
| 1481 | Ga0395905_0003918 | |||
| 1482 | Ga0395905_0009494 | |||
| 1483 | Ga0395905_0109828 | |||
| 1484 | Ga0395901_0005411 | |||
| 1485 | Ga0395901_0066588 | |||
| 1486 | Ga0395901_0347415 | |||
| 1487 | Ga0436361_0370358 | |||
| 1488 | Ga0436363_0686554 | |||
| 1489 | Ga0439436_0005519 | |||
| 1490 | Ga0439436_0005596 | |||
| 1491 | Ga0439436_0051288 | |||
| 1492 | Ga0439436_0056261 | |||
| 1493 | Ga0439438_005139 | |||
| 1494 | Ga0439438_022614 | |||
| 1495 | Ga0439439_0000787 | |||
| 1496 | Ga0439439_0010348 | |||
| 1497 | Ga0439466_0007836 | |||
| 1498 | Ga0439466_0009017 | |||
| 1499 | Ga0451793_1176449 | |||
| 1500 | Ga0451795_1559355 | |||
| 1501 | Ga0451839_0004112 | |||
| 1502 | Ga0439433_0002116 | |||
| 1503 | Ga0439433_0004175 | |||
| 1504 | Ga0439433_0013928 | |||
| 1505 | Ga0439432_000130 | |||
| 1506 | Ga0439449_0010688 | |||
| 1507 | Ga0439449_0069846 | |||
| 1508 | Ga0439451_000493 | |||
| 1509 | Ga0439451_004046 | |||
| 1510 | Ga0439452_000001 | |||
| 1511 | Ga0439452_042071 | |||
| 1512 | Ga0439456_000597 | |||
| 1513 | Ga0439456_001303 | |||
| 1514 | Ga0439457_003680 | |||
| 1515 | Ga0439463_000469 | |||
| 1516 | Ga0439463_001793 | |||
| 1517 | Ga0450919_000409 | |||
| 1518 | Ga0450920_000642 | |||
| 1519 | Ga0450898_017965 | |||
| 1520 | Ga0450906_002930 | |||
| 1521 | Ga0450908_008554 | |||
| 1522 | Ga0450909_001461 | |||
| 1523 | Ga0439434_0002748 | |||
| 1524 | Ga0439434_0010454 | |||
| 1525 | Ga0439434_0017534 | |||
| 1526 | Ga0439459_0018379 | |||
| 1527 | Ga0450918_000078 | |||
| 1528 | Ga0450918_006741 | |||
| 1529 | Ga0450893_0012673 | |||
| 1530 | Ga0466986_0000518 | |||
| 1531 | Ga0466972_0000427 | |||
| 1532 | Ga0466972_0011719 | |||
| 1533 | Ga0466965_0177323 | |||
| 1534 | Ga0466966_0026078 | |||
| 1535 | Ga0466966_0113509 | |||
| 1536 | Ga0466961_0000053 | |||
| 1537 | Ga0466961_0021527 | |||
| 1538 | Ga0466963_0035631 | |||
| 1539 | Ga0466968_0003097 | |||
| 1540 | Ga0466970_0000057 | |||
| 1541 | Ga0466970_0007989 | |||
| 1542 | Ga0466959_0001715 | |||
| 1543 | Ga0466959_0164799 | |||
| 1544 | Ga0466967_0016266 | |||
| 1545 | Ga0495592_0009546 | |||
| 1546 | Ga0495592_0012268 | |||
| 1547 | Ga0495592_0031919 | |||
| 1548 | Ga0495592_0059500 | |||
| 1549 | Ga0495592_0233704 | |||
| 1550 | Ga0495603_0012824 | |||
| 1551 | Ga0495603_0059203 | |||
| 1552 | Ga0495590_0060064 | |||
| 1553 | Ga0495629_0018239 | |||
| 1554 | Ga0495629_0034343 | |||
| 1555 | Ga0495641_0003517 | |||
| 1556 | Ga0495641_0014889 | |||
| 1557 | Ga0495651_0023866 | |||
| 1558 | Ga0495651_0050593 | |||
| 1559 | Ga0495651_0172312 | |||
| 1560 | Ga0495651_0197068 | |||
| 1561 | Ga0495653_0011267 | |||
| 1562 | Ga0495653_0028059 | |||
| 1563 | Ga0495653_0035346 | |||
| 1564 | Ga0495653_0050594 | |||
| 1565 | Ga0495580_0010680 | |||
| 1566 | Ga0495580_0034339 | |||
| 1567 | Ga0495580_0099894 | |||
| 1568 | Ga0495582_0049291 | |||
| 1569 | Ga0495605_0140857 | |||
| 1570 | Ga0495639_0014797 | |||
| 1571 | Ga0495639_0015417 | |||
| 1572 | Ga0495662_0030700 | |||
| 1573 | Ga0495664_0268527 | |||
| 1574 | Ga0495594_0014756 | |||
| 1575 | Ga0495608_0014921 | |||
| 1576 | Ga0495608_0021592 | |||
| 1577 | Ga0495618_0009337 | |||
| 1578 | Ga0495628_0026376 | |||
| 1579 | Ga0495628_0066603 | |||
| 1580 | Ga0495628_0123729 | |||
| 1581 | Ga0495630_0096720 | |||
| 1582 | Ga0495630_0202698 | |||
| 1583 | Ga0495643_0019784 | |||
| 1584 | Ga0495666_0028998 | |||
| 1585 | Ga0495642_0006593 | |||
| 1586 | Ga0495652_0016270 | |||
| 1587 | Ga0495652_0024838 | |||
| 1588 | Ga0495652_0036216 | |||
| 1589 | Ga0495652_0095683 | |||
| 1590 | Ga0495665_0060245 | |||
| 1591 | Ga0495665_0119539 | |||
| 1592 | Ga0495640_0013821 | |||
| 1593 | Ga0495640_0019133 | |||
| 1594 | Ga0495587_0024465 | |||
| 1595 | Ga0495587_0030508 | |||
| 1596 | Ga0495597_0000102 | |||
| 1597 | Ga0495645_0019292 | |||
| 1598 | Ga0495667_0015567 | |||
| 1599 | Ga0495667_0021890 | |||
| 1600 | Ga0495656_0097898 | |||
| 1601 | Ga0495656_0213869 | |||
| 1602 | Ga0495668_0000020 | |||
| 1603 | Ga0495668_0011692 | |||
| 1604 | Ga0495634_0012821 | |||
| 1605 | Ga0495634_0019336 | |||
| 1606 | Ga0495634_0024572 | |||
| 1607 | Ga0495634_0067823 | |||
| 1608 | Ga0495635_0012490 | |||
| 1609 | Ga0495635_0030818 | |||
| 1610 | Ga0495635_0042929 | |||
| 1611 | Ga0495661_0009296 | |||
| 1612 | Ga0495657_0007494 | |||
| 1613 | Ga0495657_0025296 | |||
| 1614 | Ga0495657_0071180 | |||
| 1615 | Ga0495657_0168811 | |||
| 1616 | Ga0495599_0006520 | |||
| 1617 | Ga0495599_0039811 | |||
| 1618 | Ga0495623_0006249 | |||
| 1619 | Ga0495646_0027875 | |||
| 1620 | Ga0495646_0062282 | |||
| 1621 | Ga0495646_0084386 | |||
| 1622 | Ga0495647_0016556 | |||
| 1623 | Ga0495658_0006869 | |||
| 1624 | Ga0495658_0092091 | |||
| 1625 | Ga0495613_0069830 | |||
| 1626 | Ga0495613_0149215 | |||
| 1627 | Ga0495613_0180350 | |||
| 1628 | Ga0495624_0001476 | |||
| 1629 | Ga0495624_0002969 | |||
| 1630 | Ga0495624_0024218 | |||
| 1631 | Ga0495624_0042860 | |||
| 1632 | Ga0495589_0000091 | |||
| 1633 | Ga0495600_0010245 | |||
| 1634 | Ga0495600_0071471 | |||
| 1635 | Ga0495581_0041039 | |||
| 1636 | Ga0495604_0006471 | |||
| 1637 | Ga0495604_0013652 | |||
| 1638 | Ga0495604_0018787 | |||
| 1639 | Ga0495604_0028182 | |||
| 1640 | Ga0495674_0009452 | |||
| 1641 | Ga0495674_0011849 | |||
| 1642 | Ga0495674_0014791 | |||
| 1643 | Ga0495674_0032997 | |||
| 1644 | Ga0495674_0315848 | |||
| 1645 | Ga0495676_0002631 | |||
| 1646 | Ga0495676_0007948 | |||
| 1647 | Ga0495676_0042145 | |||
| 1648 | Ga0495680_0024592 | |||
| 1649 | Ga0495680_0046045 | |||
| 1650 | Ga0495680_0070688 | |||
| 1651 | Ga0495680_0117713 | |||
| 1652 | Ga0495687_014386 | |||
| 1653 | Ga0495675_0016865 | |||
| 1654 | Ga0495684_0005133 | |||
| 1655 | Ga0495684_0006871 | |||
| 1656 | Ga0495684_0020155 | |||
| 1657 | Ga0495684_0023268 | |||
| 1658 | Ga0495684_0024746 | |||
| 1659 | Ga0495593_0012276 | |||
| 1660 | Ga0495593_0035643 | |||
| 1661 | Ga0495602_0004743 | |||
| 1662 | Ga0495602_0014752 | |||
| 1663 | Ga0495602_0030617 | |||
| 1664 | Ga0495602_0037302 | |||
| 1665 | Ga0495602_0039196 | |||
| 1666 | Ga0495602_0312836 | |||
| 1667 | Ga0495602_0349409 | |||
| 1668 | Ga0495614_0058969 | |||
| 1669 | Ga0495614_0179865 | |||
| 1670 | Ga0496100_0035948 | |||
| 1671 | Ga0496100_0110286 | |||
| 1672 | Ga0496101_0000731 | |||
| 1673 | Ga0496101_0030130 | |||
| 1674 | Ga0496102_0000056 | |||
| 1675 | Ga0496102_0000174 | |||
| 1676 | Ga0496102_0000484 | |||
| 1677 | Ga0496102_0037136 | |||
| 1678 | Ga0496102_0252967 | |||
| 1679 | Ga0496102_0274076 | |||
| 1680 | Ga0496102_0563993 | |||
| 1681 | Ga0496103_0000040 | |||
| 1682 | Ga0496103_0000320 | |||
| 1683 | Ga0496103_0158216 | |||
| 1684 | Ga0496104_0000282 | |||
| 1685 | Ga0496104_0052036 | |||
| 1686 | Ga0496104_0254514 | |||
| 1687 | Ga0496104_0389821 | |||
| 1688 | Ga0496105_0000136 | |||
| 1689 | Ga0496105_0000423 | |||
| 1690 | Ga0496105_0002210 | |||
| 1691 | Ga0496105_0076506 | |||
| 1692 | Ga0496105_0104763 | |||
| 1693 | Ga0496106_0020159 | |||
| 1694 | Ga0496106_0124626 | |||
| 1695 | Ga0496106_0519628 | |||
| 1696 | Ga0496107_0017622 | |||
| 1697 | Ga0496107_0139725 | |||
| 1698 | Ga0496107_0367450 | |||
| 1699 | Ga0496108_0003089 | |||
| 1700 | Ga0496108_0030847 | |||
| 1701 | Ga0496108_0121995 | |||
| 1702 | Ga0496108_0170890 | |||
| 1703 | Ga0496108_0216249 | |||
| 1704 | Ga0496109_0042830 | |||
| 1705 | Ga0496110_0036175 | |||
| 1706 | Ga0496110_0092722 | |||
| 1707 | Ga0496111_0015171 | |||
| 1708 | Ga0496112_0005743 | |||
| 1709 | Ga0496112_0039026 | |||
| 1710 | Ga0496112_0039083 | |||
| 1711 | Ga0496112_0269203 | |||
| 1712 | Ga0496113_0000119 | |||
| 1713 | Ga0496113_0028553 | |||
| 1714 | Ga0496114_0014125 | |||
| 1715 | Ga0496114_0441263 | |||
| 1716 | Ga0496115_0000009 | |||
| 1717 | Ga0496115_0110909 | |||
| 1718 | Ga0496115_0153409 | |||
| 1719 | Ga0496115_0179409 | |||
| 1720 | Ga0496116_0000056 | |||
| 1721 | Ga0496116_0000110 | |||
| 1722 | Ga0496116_0008516 | |||
| 1723 | Ga0496116_0014709 | |||
| 1724 | Ga0496116_0051874 | |||
| 1725 | Ga0496117_0000003 | |||
| 1726 | Ga0496117_0000354 | |||
| 1727 | Ga0496117_0000802 | |||
| 1728 | Ga0496117_0005072 | |||
| 1729 | Ga0496117_0008930 | |||
| 1730 | Ga0496117_0019332 | |||
| 1731 | Ga0496117_0052166 | |||
| 1732 | Ga0496118_0000001 | |||
| 1733 | Ga0496118_0000077 | |||
| 1734 | Ga0496118_0000310 | |||
| 1735 | Ga0496118_0006305 | |||
| 1736 | Ga0496118_0008850 | |||
| 1737 | Ga0496118_0009737 | |||
| 1738 | Ga0496118_0011094 | |||
| 1739 | Ga0496118_0017185 | |||
| 1740 | Ga0496119_0000263 | |||
| 1741 | Ga0496119_0000648 | |||
| 1742 | Ga0496119_0000754 | |||
| 1743 | Ga0496119_0086342 | |||
| 1744 | Ga0496120_0000318 | |||
| 1745 | Ga0496120_0000689 | |||
| 1746 | Ga0496120_0000749 | |||
| 1747 | Ga0496120_0090099 | |||
| 1748 | Ga0496121_0000121 | |||
| 1749 | Ga0496121_0000432 | |||
| 1750 | Ga0496121_0000984 | |||
| 1751 | Ga0496121_0002135 | |||
| 1752 | Ga0496121_0005637 | |||
| 1753 | Ga0496121_0005718 | |||
| 1754 | Ga0496121_0007340 | |||
| 1755 | Ga0496121_0012058 | |||
| 1756 | Ga0496122_0001087 | |||
| 1757 | Ga0496122_0001497 | |||
| 1758 | Ga0496122_0008986 | |||
| 1759 | Ga0496122_0090011 | |||
| 1760 | Ga0496122_0197494 | |||
| 1761 | Ga0496123_0000889 | |||
| 1762 | Ga0496123_0001632 | |||
| 1763 | Ga0496124_0000050 | |||
| 1764 | Ga0496124_0000219 | |||
| 1765 | Ga0496124_0001992 | |||
| 1766 | Ga0496124_0003260 | |||
| 1767 | Ga0496124_0006361 | |||
| 1768 | Ga0496124_0012220 | |||
| 1769 | Ga0496124_0036067 | |||
| 1770 | Ga0496124_0062622 | |||
| 1771 | Ga0496124_0080025 | |||
| 1772 | Ga0496125_0000114 | |||
| 1773 | Ga0496125_0000796 | |||
| 1774 | Ga0496125_0001252 | |||
| 1775 | Ga0496125_0005292 | |||
| 1776 | Ga0496125_0006057 | |||
| 1777 | Ga0496125_0025241 | |||
| 1778 | Ga0496125_0030371 | |||
| 1779 | Ga0496125_0089350 | |||
| 1780 | Ga0496125_0156461 | |||
| 1781 | Ga0496126_0000113 | |||
| 1782 | Ga0496126_0000837 | |||
| 1783 | Ga0496126_0001389 | |||
| 1784 | Ga0496126_0001447 | |||
| 1785 | Ga0496126_0063154 | |||
| 1786 | Ga0496126_0093310 | |||
| 1787 | Ga0496126_0141114 | |||
| 1788 | Ga0496126_0379222 | |||
| 1789 | Ga0501306_011306 | |||
| 1790 | Ga0501310_008254 | |||
| 1791 | Ga0501304_004913 | |||
| 1792 | Ga0501307_011885 | |||
| 1793 | Ga0495682_0002192 | |||
| 1794 | Ga0501315_016195 | |||
| 1795 | Ga0501324_002633 | |||
| 1796 | Ga0501324_003666 | |||
| 1797 | Ga0501036_0064815 | |||
| 1798 | Ga0501039_0221374 | |||
| 1799 | Ga0501042_0110916 | |||
| 1800 | Ga0501046_0060300 | |||
| 1801 | Ga0501075_0012498 | |||
| 1802 | Ga0501076_0002231 | |||
| 1803 | Ga0501077_0044776 | |||
| 1804 | Ga0501079_0005429 | |||
| 1805 | Ga0501080_0334394 | |||
| 1806 | nmdc:mga03n38_24630_c1 | |||
| 1807 | nmdc:mga00v17_231581_c1 | |||
| 1808 | nmdc:mga0k408_23202_c1 | |||
| 1809 | nmdc:mga0k408_2991_c1 | |||
| 1810 | nmdc:mga0k408_35008_c1 | |||
| 1811 | nmdc:mga06z11_17720_c1 | |||
| 1812 | nmdc:mga07m45_23200_c1 | |||
| 1813 | nmdc:mga05p37_559607_c1 | |||
| 1814 | nmdc:mga09592_11987_c1 | |||
| 1815 | nmdc:mga09592_70455_c1 | |||
| 1816 | nmdc:mga0qj67_106602_c1 | |||
| 1817 | nmdc:mga06r32_138352_c1 | |||
| 1818 | nmdc:mga08y16_493360_c1 | |||
| 1819 | nmdc:mga08y16_63983_c1 | |||
| 1820 | nmdc:mga0rr50_212668_c1 | |||
| 1821 | nmdc:mga0a205_10045_c1 | |||
| 1822 | nmdc:mga0a205_353408_c1 | |||
| 1823 | nmdc:mga0sz30_15904_c1 | |||
| 1824 | nmdc:mga0sz30_24420_c2 | |||
| 1825 | Ga0495601_0012010 | |||
| 1826 | Ga0495601_0013485 | |||
| 1827 | Ga0495601_0029907 | |||
| 1828 | Ga0495601_0041517 | |||
| 1829 | Ga0495601_0189851 | |||
| 1830 | Ga0495612_0008448 | |||
| 1831 | Ga0495595_0022118 | |||
| 1832 | Ga0495619_0004470 | |||
| 1833 | Ga0495619_0005558 | |||
| 1834 | Ga0495619_0007982 | |||
| 1835 | Ga0495619_0015724 | |||
| 1836 | Ga0495619_0124124 | |||
| 1837 | Ga0500595_000176 | |||
| 1838 | Ga0500595_000351 | |||
| 1839 | Ga0500616_0000002 | |||
| 1840 | Ga0500616_0003816 | |||
| 1841 | Ga0500636_0024960 | |||
| 1842 | Ga0501084_0011217 | |||
| 1843 | Ga0501084_0457518 | |||
| 1844 | Ga0587093_001988 | |||
| 1845 | Ga0587090_005294 | |||
| 1846 | Ga0587071_001577 | |||
| 1847 | Ga0501082_0002439 | |||
| 1848 | Ga0530510_0000677 | |||
| 1849 | 2508725853 | |||
| 1850 | 2511136520 | |||
| 1851 | 2511365544 | |||
| 1852 | 2552746356 | |||
| 1853 | 2555230674 | |||
| 1854 | 2555259590 | |||
| 1855 | 2585274321 | |||
| 1856 | 2585560770 | |||
| 1857 | 2586004351 | |||
| 1858 | 2599448446 | |||
| 1859 | 2599612082 | |||
| 1860 | 2599926441 | |||
| 1861 | 2599993028 | |||
| 1862 | 2600045346 | |||
| 1863 | 2600058108 | |||
| 1864 | 2600067832 | |||
| 1865 | 2603865580 | |||
| 1866 | 2616293067 | |||
| 1867 | 2637227415 | |||
| 1868 | 2640733298 | |||
| 1869 | 2644244039 | |||
| 1870 | 2650897185 | |||
| 1871 | 2678230339 | |||
| 1872 | 2686354093 | |||
| 1873 | 2691515519 | |||
| 1874 | 2707098147 | |||
| 1875 | 2739197266 | |||
| 1876 | 2753767746 | |||
| 1877 | 2774389113 | |||
| 1878 | 2774439304 | |||
| 1879 | 2776264921 | |||
| 1880 | 2777021785 | |||
| 1881 | 2793367600 | |||
| 1882 | 2809125646 | |||
| 1883 | 2809146961 | |||
| 1884 | 2812349100 | |||
| 1885 | 2817490222 | |||
| 1886 | 2819550701 | |||
| 1887 | 2819637267 | |||
| 1888 | 2819661446 | |||
| 1889 | 2825656979 | |||
| 1890 | 2834030485 | |||
| 1891 | 2840768215 | |||
| 1892 | 2847799052 | |||
| 1893 | 2852687308 | |||
| 1894 | 2863428056 | |||
| 1895 | 2891973150 | |||
| 1896 | 2894235509 | |||
| 1897 | 2900580474 | |||
| 1898 | 2902796426 | |||
| 1899 | 2904437097 | |||
| 1900 | 2904515755 | |||
| 1901 | 2904616196 | |||
| 1902 | 2904767151 | |||
| 1903 | 2904773903 | |||
| 1904 | 2913040572 | |||
| 1905 | 2919110088 | |||
| 1906 | 2919130925 | |||
| 1907 | 2919185376 | |||
| 1908 | 2919420407 | |||
| 1909 | 2919433835 | |||
| 1910 | 2919483417 | |||
| 1911 | 2919505036 | |||
| 1912 | 2926066713 | |||
| 1913 | 2928177934 | |||
| 1914 | 2928526439 | |||
| 1915 | 2929196162 | |||
| 1916 | 2945938975 | |||
| 1917 | 2969084454 | |||
| 1918 | 2971825381 | |||
| 1919 | 2984497456 | |||
| 1920 | 2984561569 | |||
| 1921 | 2984599634 | |||
| 1922 | 2990261407 | |||
| 1923 | 2990708975 | |||
| 1924 | 8002747519 | |||
| 1925 | 8004028256 | |||
| 1926 | 8018127435 | |||
| 1927 | 8021127151 | |||
| 1928 | 8021623681 | |||
| 1929 | 8021628705 | |||
| 1930 | 8021651535 | |||
| 1931 | 8055273068 | |||
| 1932 | 8055306949 | |||
| 1933 | 8056377545 | |||
| 1934 | 8057161172 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5c54-assembly2.cif.gz_G | crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum | 0.8461 | 28 | 290 |
| 5c55-assembly1.cif.gz_A | crystal structure of the y138f mutant of c.glutamicum n-acetylneuraminic acid lyase in complex with pyruvate | 0.8331 | 28 | 290 |
| 3pb0-assembly4.cif.gz_D | characterisation of the first monomeric dihydrodipicolinate synthase variant reveals evolutionary insights | 0.8319 | 28 | 294 |
| 1f5z-assembly1.cif.gz_C | crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i | 0.8257 | 24 | 289 |
| 5c54-assembly1.cif.gz_D | crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum | 0.8236 | 28 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5c54C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8456 | 28 | 290 | 3.20.20.70 |
| 4xkyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8143 | 29 | 292 | 3.20.20.70 |
| 3pb2D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8015 | 28 | 294 | 3.20.20.70 |
| 3s5oA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7952 | 28 | 294 | 3.20.20.70 |
| 4ah7B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7951 | 27 | 292 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0FUD8-F1-model_v4 | Dihydrodipicolinate synthetase | 0.952 | 204 | 292 |
|
| AF-A0A4S9Y1N8-F1-model_v4 | Aldolase | 0.9363 | 142 | 293 |
GO:0008840
|
| AF-A0A0K2RB42-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase | 0.936 | 214 | 294 |
GO:0016829
|
| AF-A0A354Y9G7-F1-model_v4 | Dihydrodipicolinate synthase family protein | 0.9267 | 146 | 262 |
GO:0008840
|
| AF-A0A6H9SBS6-F1-model_v4 | Dihydrodipicolinate synthase family protein | 0.9262 | 95 | 266 |
GO:0008840
|