F487017

General Info

Members Datasets Scaffolds Average Seq Length
967 379 1934 214

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100281820|Ga0068871_1002818202
Length 263
Sequence MLMVRRRTGTKNGICNPFEIVVALPKAFPVHRLAQEACPGCLLILNFMDDIAQLRKSYERAELDEAASRRDPIEQFELWLSQALSGQLPEPNAMTLATVGSDGRPSTRIVLIKGVDARGVVWYTNYASRKGRELADKPFAALQFHWVELERVVRIEGTVEKVSEAESDAYFASRPLDSRIGAWASPQSEVISSRAVLVANVAKYSARFLSTMLTSGPPRPPHWGGYRLVPDRWEFWQGRPSRLHDRLRYRREGDAWVRERLAP

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
218 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
219 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
224 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
250 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
263 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
264 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
265 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
266 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
267 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
268 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
269 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
270 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
276 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
277 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
278 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
279 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
280 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
281 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
282 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
283 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
303 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
336 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
337 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
338 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
344 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
345 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
346 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
347 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
348 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
349 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
350 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
351 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
361 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
362 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
363 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
374 2643221570 Acidovorax sp. Root568 Isolate Unclassified
375 2643221609 Acidovorax sp. Root217 Isolate Unclassified
376 2643221611 Acidovorax sp. Root219 Isolate Unclassified
377 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
378 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
379 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0.31
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 0.41
Rhizoplane 5.69
Rhizosphere 80.77
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100281820 3300006358 Bacteria 1454
2 JGI25155J39150_1000105 3300002704 Bacteria 44548
3 JGI25156J39149_1000191 3300002705 Bacteria 44047
4 JGI25154J39366_1000195 3300002738 Bacteria 44047
5 JGI25157J39369_1000227 3300002741 Bacteria 44047
6 JGI25159J45721_1001565 3300002987 Bacteria 9374
7 JGI25151J46595_10015577 3300003187 Bacteria 3345
8 JGI25151J46595_10017387 3300003187 Bacteria 3119
9 rootH2_10069953 3300003320 Bacteria 5965
10 Ga0055525_1000021 3300003759 Bacteria 370802
11 Ga0055526_1006669 3300003771 Bacteria 6194
12 Ga0055526_1018321 3300003771 Bacteria 2618
13 Ga0055526_1028759 3300003771 Bacteria 1671
14 Ga0055537_1000257 3300003773 Bacteria 38816
15 Ga0055537_1024980 3300003773 Bacteria 832
16 Ga0055524_1000077 3300003775 Bacteria 121584
17 Ga0055524_1000253 3300003775 Bacteria 55038
18 Ga0055536_1000408 3300003781 Bacteria 31161
19 Ga0055534_1000619 3300003784 Bacteria 18299
20 Ga0055528_1001926 3300003790 Bacteria 11790
21 Ga0055530_10000354 3300003791 Bacteria 41444
22 Ga0055530_10004807 3300003791 Bacteria 6769
23 Ga0055540_1000010 3300003792 Bacteria 290865
24 Ga0055540_1000011 3300003792 Bacteria 282927
25 Ga0055540_1023256 3300003792 Bacteria 1564
26 Ga0055540_1040480 3300003792 Bacteria 1009
27 Ga0055531_10000298 3300003794 Bacteria 49437
28 Ga0055531_10000405 3300003794 Bacteria 41493
29 Ga0055531_10000992 3300003794 Bacteria 22548
30 Ga0055531_10038475 3300003794 Bacteria 1435
31 Ga0065165_1009925 3300005262 Bacteria 4192
32 Ga0065165_1012628 3300005262 Bacteria 3423
33 Ga0065165_1043885 3300005262 Bacteria 1310
34 Ga0070658_10024955 3300005327 Bacteria 4793
35 Ga0070658_10250138 3300005327 Bacteria 1504
36 Ga0070676_10003203 3300005328 Bacteria 8487
37 Ga0070676_10071698 3300005328 Bacteria 2081
38 Ga0070683_100115298 3300005329 Bacteria 2536
39 Ga0070690_100030145 3300005330 Bacteria 3369
40 Ga0070670_100003584 3300005331 Bacteria 12922
41 Ga0070670_100031412 3300005331 Bacteria 4573
42 Ga0070670_100051303 3300005331 Bacteria 3543
43 Ga0070670_100052640 3300005331 Bacteria 3496
44 Ga0070670_100063526 3300005331 Bacteria 3169
45 Ga0070670_100075224 3300005331 Bacteria 2901
46 Ga0070670_100130651 3300005331 Bacteria 2169
47 Ga0070670_100149786 3300005331 Bacteria 2019
48 Ga0070670_100328245 3300005331 Bacteria 1341
49 Ga0070670_100351182 3300005331 Bacteria 1295
50 Ga0070677_10004214 3300005333 Bacteria 4683
51 Ga0070677_10006294 3300005333 Bacteria 3938
52 Ga0070677_10006352 3300005333 Bacteria 3923
53 Ga0070677_10016635 3300005333 Bacteria 2621
54 Ga0070677_10022883 3300005333 Bacteria 2307
55 Ga0070677_10046686 3300005333 Bacteria 1733
56 Ga0070677_10053980 3300005333 Bacteria 1635
57 Ga0068869_100000464 3300005334 Bacteria 22438
58 Ga0068869_100017548 3300005334 Bacteria 4853
59 Ga0068869_100042984 3300005334 Bacteria 3243
60 Ga0068869_100070609 3300005334 Bacteria 2584
61 Ga0068869_100201233 3300005334 Bacteria 1570
62 Ga0070666_10008685 3300005335 Bacteria 6318
63 Ga0070666_10085206 3300005335 Bacteria 2164
64 Ga0070666_10104502 3300005335 Bacteria 1955
65 Ga0070680_100020509 3300005336 Bacteria 5245
66 Ga0070682_100005154 3300005337 Bacteria 7261
67 Ga0070682_100053329 3300005337 Bacteria 2534
68 Ga0068868_100001157 3300005338 Bacteria 18078
69 Ga0068868_100003589 3300005338 Bacteria 10810
70 Ga0068868_100018257 3300005338 Bacteria 5240
71 Ga0068868_100038490 3300005338 Bacteria 3712
72 Ga0068868_100040850 3300005338 Bacteria 3612
73 Ga0068868_100070593 3300005338 Bacteria 2785
74 Ga0068868_100105169 3300005338 Bacteria 2288
75 Ga0070660_100083499 3300005339 Bacteria 2509
76 Ga0070660_100465622 3300005339 Bacteria 1050
77 Ga0070660_100541561 3300005339 Bacteria 971
78 Ga0070689_100019366 3300005340 Bacteria 5033
79 Ga0070689_100157142 3300005340 Bacteria 1836
80 Ga0070689_100218497 3300005340 Bacteria 1562
81 Ga0070691_10002512 3300005341 Bacteria 8162
82 Ga0070687_100001572 3300005343 Bacteria 8114
83 Ga0070687_100040473 3300005343 Bacteria 2348
84 Ga0070661_100204767 3300005344 Bacteria 1509
85 Ga0070692_10009917 3300005345 Bacteria 4314
86 Ga0070692_10206857 3300005345 Bacteria 1153
87 Ga0070668_100019369 3300005347 Bacteria 5122
88 Ga0070668_100035665 3300005347 Bacteria 3794
89 Ga0070668_100152762 3300005347 Bacteria 1868
90 Ga0070668_100159003 3300005347 Bacteria 1832
91 Ga0070669_100001896 3300005353 Bacteria 15091
92 Ga0070669_100002377 3300005353 Bacteria 13608
93 Ga0070669_100028374 3300005353 Bacteria 4031
94 Ga0070669_100099987 3300005353 Bacteria 2186
95 Ga0070669_100619360 3300005353 Bacteria 908
96 Ga0070675_100001801 3300005354 Bacteria 15832
97 Ga0070675_100001993 3300005354 Bacteria 15148
98 Ga0070675_100022306 3300005354 Bacteria 5058
99 Ga0070675_100026137 3300005354 Bacteria 4683
100 Ga0070675_100029917 3300005354 Bacteria 4394
101 Ga0070675_100072042 3300005354 Bacteria 2868
102 Ga0070675_100084496 3300005354 Bacteria 2651
103 Ga0070675_100179384 3300005354 Bacteria 1830
104 Ga0070675_100347154 3300005354 Bacteria 1315
105 Ga0070671_100006533 3300005355 Bacteria 9322
106 Ga0070671_100020918 3300005355 Bacteria 5338
107 Ga0070671_100045128 3300005355 Bacteria 3663
108 Ga0070671_100055230 3300005355 Bacteria 3304
109 Ga0070671_100071832 3300005355 Bacteria 2889
110 Ga0070671_100155508 3300005355 Bacteria 1932
111 Ga0070671_100455788 3300005355 Bacteria 1097
112 Ga0070674_100001004 3300005356 Bacteria 14721
113 Ga0070674_100028169 3300005356 Bacteria 3688
114 Ga0070674_100035179 3300005356 Bacteria 3352
115 Ga0070674_100462154 3300005356 Bacteria 1050
116 Ga0070673_100002809 3300005364 Bacteria 10708
117 Ga0070673_100003898 3300005364 Bacteria 9374
118 Ga0070673_100037898 3300005364 Bacteria 3677
119 Ga0070673_100078466 3300005364 Bacteria 2671
120 Ga0070673_100126960 3300005364 Bacteria 2135
121 Ga0070673_100127201 3300005364 Bacteria 2133
122 Ga0070673_100142252 3300005364 Bacteria 2025
123 Ga0070673_100163489 3300005364 Bacteria 1895
124 Ga0070673_100332099 3300005364 Bacteria 1345
125 Ga0070673_100408969 3300005364 Bacteria 1215
126 Ga0070673_100823069 3300005364 Bacteria 858
127 Ga0070659_100017714 3300005366 Bacteria 5365
128 Ga0070659_100087482 3300005366 Bacteria 2494
129 Ga0070667_100006750 3300005367 Bacteria 9531
130 Ga0070667_100022158 3300005367 Bacteria 5271
131 Ga0070667_100132813 3300005367 Bacteria 2174
132 Ga0070709_10044004 3300005434 Bacteria 2763
133 Ga0070714_100049718 3300005435 Bacteria 3569
134 Ga0070713_100121718 3300005436 Bacteria 2290
135 Ga0070710_10083778 3300005437 Bacteria 1867
136 Ga0070701_10037308 3300005438 Bacteria 2453
137 Ga0070701_10089688 3300005438 Bacteria 1682
138 Ga0070701_10139535 3300005438 Bacteria 1385
139 Ga0070711_100129900 3300005439 Bacteria 1875
140 Ga0070700_100498752 3300005441 Bacteria 936
141 Ga0070708_100336081 3300005445 Bacteria 1423
142 Ga0070663_100011135 3300005455 Bacteria 5632
143 Ga0070663_100034752 3300005455 Bacteria 3492
144 Ga0070663_100097140 3300005455 Bacteria 2193
145 Ga0070663_100462505 3300005455 Bacteria 1048
146 Ga0070663_100550638 3300005455 Bacteria 964
147 Ga0070678_100005974 3300005456 Bacteria 7092
148 Ga0070678_100007713 3300005456 Bacteria 6400
149 Ga0070678_100018295 3300005456 Bacteria 4540
150 Ga0070678_100023041 3300005456 Bacteria 4141
151 Ga0070678_100133529 3300005456 Bacteria 1976
152 Ga0070678_100227568 3300005456 Bacteria 1553
153 Ga0070678_100270260 3300005456 Bacteria 1433
154 Ga0070678_100347630 3300005456 Bacteria 1274
155 Ga0070678_100361807 3300005456 Bacteria 1250
156 Ga0070678_100498097 3300005456 Bacteria 1074
157 Ga0070662_100000867 3300005457 Bacteria 18517
158 Ga0070662_100027044 3300005457 Bacteria 3979
159 Ga0070662_100052602 3300005457 Bacteria 2945
160 Ga0070681_10004529 3300005458 Bacteria 13263
161 Ga0070681_10060748 3300005458 Bacteria 3755
162 Ga0068867_100000005 3300005459 Bacteria 174097
163 Ga0068867_100008508 3300005459 Bacteria 7244
164 Ga0068867_100011686 3300005459 Bacteria 6200
165 Ga0068867_100031401 3300005459 Bacteria 3834
166 Ga0068867_100035530 3300005459 Bacteria 3615
167 Ga0068867_100066669 3300005459 Bacteria 2682
168 Ga0068867_100106939 3300005459 Bacteria 2144
169 Ga0068867_100157010 3300005459 Bacteria 1791
170 Ga0068867_100311171 3300005459 Bacteria 1302
171 Ga0070706_100029862 3300005467 Bacteria 5021
172 Ga0070706_100671812 3300005467 Bacteria 961
173 Ga0070698_100071963 3300005471 Bacteria 3466
174 Ga0070679_100014568 3300005530 Bacteria 7555
175 Ga0070679_100076037 3300005530 Bacteria 3347
176 Ga0070684_100058255 3300005535 Bacteria 3375
177 Ga0068853_100002880 3300005539 Bacteria 13055
178 Ga0068853_100150830 3300005539 Bacteria 2092
179 Ga0068853_100151378 3300005539 Bacteria 2089
180 Ga0068853_100281758 3300005539 Bacteria 1532
181 Ga0068853_100684319 3300005539 Bacteria 978
182 Ga0070672_100000535 3300005543 Bacteria 22337
183 Ga0070672_100002739 3300005543 Bacteria 11283
184 Ga0070672_100015927 3300005543 Bacteria 5370
185 Ga0070672_100057199 3300005543 Bacteria 3061
186 Ga0070672_100059868 3300005543 Bacteria 2997
187 Ga0070672_100180219 3300005543 Bacteria 1760
188 Ga0070672_100294564 3300005543 Bacteria 1374
189 Ga0070672_100295381 3300005543 Bacteria 1372
190 Ga0070672_100306273 3300005543 Bacteria 1348
191 Ga0070686_100231040 3300005544 Bacteria 1342
192 Ga0070686_100371529 3300005544 Bacteria 1080
193 Ga0070696_100201015 3300005546 Bacteria 1488
194 Ga0070693_100008393 3300005547 Bacteria 5090
195 Ga0070693_100019340 3300005547 Bacteria 3567
196 Ga0070693_100022140 3300005547 Bacteria 3374
197 Ga0070665_100143768 3300005548 Bacteria 2388
198 Ga0070665_100231023 3300005548 Bacteria 1850
199 Ga0070665_100514414 3300005548 Bacteria 1209
200 Ga0068855_100058435 3300005563 Bacteria 4516
201 Ga0068855_100165685 3300005563 Bacteria 2506
202 Ga0070664_100081262 3300005564 Bacteria 2793
203 Ga0070664_100082504 3300005564 Bacteria 2772
204 Ga0070664_100444364 3300005564 Bacteria 1190
205 Ga0070664_100785973 3300005564 Bacteria 889
206 Ga0068854_100017820 3300005578 Bacteria 4760
207 Ga0068854_100022161 3300005578 Bacteria 4322
208 Ga0068854_100028660 3300005578 Bacteria 3850
209 Ga0068854_100048963 3300005578 Bacteria 3017
210 Ga0068854_100092539 3300005578 Bacteria 2252
211 Ga0068854_100216016 3300005578 Bacteria 1515
212 Ga0068856_100004035 3300005614 Bacteria 14702
213 Ga0068856_100018011 3300005614 Bacteria 6848
214 Ga0070702_100001510 3300005615 Bacteria 9568
215 Ga0070702_100008822 3300005615 Bacteria 4902
216 Ga0070702_100019205 3300005615 Bacteria 3559
217 Ga0070702_100419295 3300005615 Bacteria 963
218 Ga0068852_100004252 3300005616 Bacteria 10110
219 Ga0068852_100007302 3300005616 Bacteria 8058
220 Ga0068852_100055967 3300005616 Bacteria 3406
221 Ga0068852_100093632 3300005616 Bacteria 2694
222 Ga0068852_100158420 3300005616 Bacteria 2111
223 Ga0068852_100268585 3300005616 Bacteria 1640
224 Ga0068852_100269628 3300005616 Bacteria 1637
225 Ga0068852_100782185 3300005616 Bacteria 968
226 Ga0068859_100022772 3300005617 Bacteria 6282
227 Ga0068859_100035116 3300005617 Bacteria 5030
228 Ga0068859_100058573 3300005617 Bacteria 3880
229 Ga0068859_100134057 3300005617 Bacteria 2549
230 Ga0068859_100183798 3300005617 Bacteria 2174
231 Ga0068864_100000875 3300005618 Bacteria 25325
232 Ga0068864_100008330 3300005618 Bacteria 8554
233 Ga0068864_100011769 3300005618 Bacteria 7227
234 Ga0068864_100043505 3300005618 Bacteria 3845
235 Ga0068864_100045627 3300005618 Bacteria 3759
236 Ga0068864_100104006 3300005618 Bacteria 2522
237 Ga0068864_100189128 3300005618 Bacteria 1886
238 Ga0068864_100239029 3300005618 Bacteria 1682
239 Ga0068864_100472275 3300005618 Bacteria 1203
240 Ga0068866_10003567 3300005718 Bacteria 6373
241 Ga0068866_10006470 3300005718 Bacteria 4880
242 Ga0068861_100003855 3300005719 Bacteria 10017
243 Ga0068861_100015935 3300005719 Bacteria 5306
244 Ga0068861_100026650 3300005719 Bacteria 4204
245 Ga0068861_100244541 3300005719 Bacteria 1528
246 Ga0068851_10025409 3300005834 Bacteria 2905
247 Ga0068851_10048558 3300005834 Bacteria 2151
248 Ga0068851_10434473 3300005834 Bacteria 777
249 Ga0068870_10007303 3300005840 Bacteria 4924
250 Ga0068870_10196682 3300005840 Bacteria 1220
251 Ga0068870_10219049 3300005840 Bacteria 1164
252 Ga0068863_100002558 3300005841 Bacteria 18059
253 Ga0068863_100010010 3300005841 Bacteria 9229
254 Ga0068863_100010659 3300005841 Bacteria 8922
255 Ga0068863_100035145 3300005841 Bacteria 4774
256 Ga0068863_100051014 3300005841 Bacteria 3922
257 Ga0068863_100081499 3300005841 Bacteria 3065
258 Ga0068863_100085929 3300005841 Bacteria 2980
259 Ga0068863_100096825 3300005841 Bacteria 2802
260 Ga0068863_100152978 3300005841 Bacteria 2208
261 Ga0068863_100429801 3300005841 Bacteria 1294
262 Ga0068858_100000703 3300005842 Bacteria 34923
263 Ga0068858_100013992 3300005842 Bacteria 7571
264 Ga0068858_100032986 3300005842 Bacteria 4809
265 Ga0068858_100107651 3300005842 Bacteria 2602
266 Ga0068858_100279942 3300005842 Bacteria 1588
267 Ga0068858_100568689 3300005842 Bacteria 1098
268 Ga0068860_100003734 3300005843 Bacteria 15664
269 Ga0068860_100033660 3300005843 Bacteria 4916
270 Ga0068860_100043222 3300005843 Bacteria 4300
271 Ga0068860_100092901 3300005843 Bacteria 2875
272 Ga0068860_100187154 3300005843 Bacteria 2002
273 Ga0068860_100228313 3300005843 Bacteria 1809
274 Ga0068862_100084701 3300005844 Bacteria 2754
275 Ga0068862_100917475 3300005844 Bacteria 862
276 Ga0075365_10016275 3300006038 Bacteria 4520
277 Ga0075365_10321986 3300006038 Bacteria 1089
278 Ga0075432_10005363 3300006058 Bacteria 4370
279 Ga0075432_10042669 3300006058 Bacteria 1587
280 Ga0070715_10034025 3300006163 Bacteria 2086
281 Ga0070715_10385188 3300006163 Bacteria 775
282 Ga0070716_100224101 3300006173 Bacteria 1265
283 Ga0070712_100152684 3300006175 Bacteria 1775
284 Ga0075367_10086708 3300006178 Bacteria 1900
285 Ga0097621_100001230 3300006237 Bacteria 17739
286 Ga0097621_100006734 3300006237 Bacteria 8163
287 Ga0097621_100011335 3300006237 Bacteria 6558
288 Ga0097621_100063536 3300006237 Bacteria 3034
289 Ga0097621_100141688 3300006237 Bacteria 2055
290 Ga0097621_100191600 3300006237 Bacteria 1771
291 Ga0075370_10066213 3300006353 Bacteria 2061
292 Ga0075370_10252413 3300006353 Bacteria 1045
293 Ga0075370_10367260 3300006353 Bacteria 861
294 Ga0068871_100012983 3300006358 Bacteria 6169
295 Ga0068871_100017138 3300006358 Bacteria 5475
296 Ga0068871_100069683 3300006358 Bacteria 2889
297 Ga0068871_100098522 3300006358 Bacteria 2446
298 Ga0068871_100427472 3300006358 Bacteria 1184
299 Ga0075431_100193574 3300006847 Bacteria 2083
300 Ga0075433_10016370 3300006852 Bacteria 6109
301 Ga0075434_100005990 3300006871 Bacteria 11127
302 Ga0075434_100485172 3300006871 Bacteria 1257
303 Ga0068865_100001470 3300006881 Bacteria 13711
304 Ga0068865_100007997 3300006881 Bacteria 6529
305 Ga0068865_100730434 3300006881 Bacteria 849
306 Ga0075436_100033151 3300006914 Bacteria 3559
307 Ga0097620_100022772 3300006931 Bacteria 6282
308 Ga0097620_100035114 3300006931 Bacteria 5030
309 Ga0097620_100058574 3300006931 Bacteria 3880
310 Ga0097620_100134048 3300006931 Bacteria 2549
311 Ga0097620_100183805 3300006931 Bacteria 2174
312 Ga0079104_1000040 3300006946 Bacteria 187962
313 Ga0075435_100003754 3300007076 Bacteria 10346
314 Ga0105240_10145647 3300009093 Bacteria 2827
315 Ga0105240_10216771 3300009093 Bacteria 2233
316 Ga0105245_10059383 3300009098 Bacteria 3444
317 Ga0105245_10065787 3300009098 Bacteria 3279
318 Ga0105245_10135159 3300009098 Bacteria 2317
319 Ga0105245_10329311 3300009098 Bacteria 1507
320 Ga0105247_10006783 3300009101 Bacteria 7061
321 Ga0105247_10628123 3300009101 Bacteria 800
322 Ga0114129_10000114 3300009147 Bacteria 80730
323 Ga0114129_10175873 3300009147 Bacteria 2915
324 Ga0114129_10210660 3300009147 Bacteria 2627
325 Ga0114129_10568288 3300009147 Bacteria 1473
326 Ga0114129_11046435 3300009147 Bacteria 1025
327 Ga0114129_11060650 3300009147 Bacteria 1017
328 Ga0105243_10014299 3300009148 Bacteria 6006
329 Ga0105243_10058093 3300009148 Bacteria 3082
330 Ga0105243_10078734 3300009148 Bacteria 2685
331 Ga0105243_10118359 3300009148 Bacteria 2229
332 Ga0105241_10007301 3300009174 Bacteria 8131
333 Ga0105241_10024754 3300009174 Bacteria 4459
334 Ga0105241_10175746 3300009174 Bacteria 1772
335 Ga0105241_10443225 3300009174 Bacteria 1147
336 Ga0105242_10014074 3300009176 Bacteria 6191
337 Ga0105242_10276195 3300009176 Unclassified 1524
338 Ga0105242_10740995 3300009176 Bacteria 966
339 Ga0105248_10016659 3300009177 Bacteria 8090
340 Ga0105248_10026400 3300009177 Bacteria 6460
341 Ga0105248_10037374 3300009177 Bacteria 5433
342 Ga0105248_10050259 3300009177 Bacteria 4675
343 Ga0105248_10152200 3300009177 Bacteria 2610
344 Ga0105248_10465756 3300009177 Bacteria 1425
345 Ga0105237_10001971 3300009545 Bacteria 26114
346 Ga0105237_10184040 3300009545 Bacteria 2089
347 Ga0105238_10022974 3300009551 Bacteria 6358
348 Ga0105238_10026817 3300009551 Bacteria 5873
349 Ga0105238_10085150 3300009551 Bacteria 3150
350 Ga0105249_10101261 3300009553 Bacteria 2709
351 Ga0105249_10197204 3300009553 Bacteria 1968
352 Ga0105249_10254939 3300009553 Bacteria 1741
353 Ga0105239_10000531 3300010375 Bacteria 55121
354 Ga0105246_10007831 3300011119 Bacteria 6554
355 Ga0157316_1004889 3300012510 Bacteria 1037
356 Ga0157373_10041996 3300013100 Bacteria 3270
357 Ga0157373_10063675 3300013100 Bacteria 2611
358 Ga0157371_10049369 3300013102 Bacteria 2989
359 Ga0157370_10028511 3300013104 Bacteria 5490
360 Ga0157370_10503974 3300013104 Bacteria 1111
361 Ga0157369_10027535 3300013105 Bacteria 6299
362 Ga0157369_10418734 3300013105 Bacteria 1389
363 Ga0157374_10035458 3300013296 Bacteria 4564
364 Ga0157374_10071381 3300013296 Bacteria 3274
365 Ga0157374_10117491 3300013296 Bacteria 2563
366 Ga0157374_10376948 3300013296 Bacteria 1413
367 Ga0157374_10639801 3300013296 Bacteria 1075
368 Ga0157374_10810223 3300013296 Bacteria 952
369 Ga0157378_10038089 3300013297 Bacteria 4260
370 Ga0157378_10825634 3300013297 Bacteria 954
371 Ga0163162_10016188 3300013306 Bacteria 7293
372 Ga0163162_10069089 3300013306 Bacteria 3585
373 Ga0163162_10086356 3300013306 Bacteria 3215
374 Ga0163162_10204736 3300013306 Bacteria 2102
375 Ga0163162_10228300 3300013306 Bacteria 1992
376 Ga0163162_10820953 3300013306 Bacteria 1046
377 Ga0163162_11451725 3300013306 Bacteria 781
378 Ga0157372_10028330 3300013307 Bacteria 6112
379 Ga0157372_10100758 3300013307 Bacteria 3296
380 Ga0157372_10187981 3300013307 Bacteria 2392
381 Ga0157372_10282825 3300013307 Bacteria 1929
382 Ga0157375_10005937 3300013308 Bacteria 10642
383 Ga0157375_10039133 3300013308 Bacteria 4561
384 Ga0157375_10094763 3300013308 Bacteria 3055
385 Ga0157375_10096018 3300013308 Bacteria 3036
386 Ga0157375_10220688 3300013308 Bacteria 2054
387 Ga0157375_10265562 3300013308 Bacteria 1878
388 Ga0157375_10427534 3300013308 Bacteria 1490
389 Ga0157375_10432144 3300013308 Bacteria 1482
390 Ga0157375_10675732 3300013308 Bacteria 1187
391 Ga0157375_10734819 3300013308 Bacteria 1139
392 Ga0163163_10005258 3300014325 Bacteria 11165
393 Ga0163163_10090065 3300014325 Bacteria 3081
394 Ga0163163_10503704 3300014325 Bacteria 1273
395 Ga0163163_10542633 3300014325 Bacteria 1225
396 Ga0157380_10004961 3300014326 Bacteria 9272
397 Ga0157380_10010895 3300014326 Bacteria 6555
398 Ga0157380_10079110 3300014326 Bacteria 2684
399 Ga0157380_10099648 3300014326 Bacteria 2417
400 Ga0157380_10117345 3300014326 Bacteria 2248
401 Ga0157380_10775725 3300014326 Bacteria 973
402 Ga0157380_10905994 3300014326 Bacteria 908
403 Ga0157377_10000022 3300014745 Bacteria 146702
404 Ga0157377_10001663 3300014745 Bacteria 9688
405 Ga0157377_10002890 3300014745 Bacteria 7677
406 Ga0157377_10210438 3300014745 Bacteria 1240
407 Ga0157379_10010626 3300014968 Bacteria 8024
408 Ga0157379_10010802 3300014968 Bacteria 7961
409 Ga0157379_10022405 3300014968 Bacteria 5596
410 Ga0157379_10027535 3300014968 Bacteria 5061
411 Ga0157379_10044121 3300014968 Bacteria 3980
412 Ga0157379_10051355 3300014968 Bacteria 3683
413 Ga0157379_10053977 3300014968 Bacteria 3591
414 Ga0157379_10057691 3300014968 Bacteria 3469
415 Ga0157379_10063401 3300014968 Bacteria 3304
416 Ga0157379_10137731 3300014968 Bacteria 2200
417 Ga0157376_10009598 3300014969 Bacteria 7038
418 Ga0157376_10012290 3300014969 Bacteria 6350
419 Ga0157376_10127296 3300014969 Bacteria 2267
420 Ga0157376_10232269 3300014969 Bacteria 1714
421 Ga0157376_10383852 3300014969 Bacteria 1354
422 Ga0157376_10510605 3300014969 Bacteria 1183
423 Ga0157376_10637851 3300014969 Bacteria 1064
424 Ga0157376_10693663 3300014969 Bacteria 1022
425 Ga0182007_10139375 3300015262 Bacteria 819
426 Ga0163161_10010482 3300017792 Bacteria 6417
427 Ga0163161_10061902 3300017792 Bacteria 2725
428 Ga0163161_10085889 3300017792 Bacteria 2322
429 Ga0163161_10321773 3300017792 Bacteria 1223
430 Ga0206356_11249198 3300020070 Bacteria 3691
431 Ga0206354_11204485 3300020081 Bacteria 3259
432 Ga0206353_10288226 3300020082 Bacteria 1849
433 Ga0213876_10032532 3300021384 Unclassified 2750
434 Ga0209435_100010 3300025206 Bacteria 475373
435 Ga0209674_108306 3300025226 Bacteria 1239
436 Ga0209563_100005 3300025230 Bacteria 1774893
437 Ga0207425_1000774 3300025245 Bacteria 16436
438 Ga0207425_1002031 3300025245 Bacteria 7537
439 Ga0209646_1000001 3300025246 Bacteria 3092932
440 Ga0209759_1000001 3300025256 Bacteria 2799452
441 Ga0209129_1011340 3300025258 Bacteria 2136
442 Ga0209565_1000036 3300025263 Bacteria 293334
443 Ga0209565_1001584 3300025263 Bacteria 9698
444 Ga0209565_1006670 3300025263 Bacteria 3209
445 Ga0209673_1000008 3300025273 Bacteria 626013
446 Ga0209130_1000622 3300025284 Bacteria 33932
447 Ga0209130_1047807 3300025284 Bacteria 792
448 Ga0209675_1000106 3300025291 Bacteria 120459
449 Ga0209675_1003163 3300025291 Bacteria 7998
450 Ga0209676_1000007 3300025292 Bacteria 1029371
451 Ga0209676_1003255 3300025292 Bacteria 10228
452 Ga0209025_1002522 3300025294 Bacteria 19157
453 Ga0209025_1008912 3300025294 Bacteria 7102
454 Ga0209025_1012221 3300025294 Bacteria 5534
455 Ga0209025_1063541 3300025294 Bacteria 1362
456 Ga0209564_1000487 3300025295 Bacteria 65983
457 Ga0209564_1001215 3300025295 Bacteria 29254
458 Ga0209564_1001602 3300025295 Bacteria 22034
459 Ga0209758_1016244 3300025297 Bacteria 3794
460 Ga0209050_1000003 3300025298 Bacteria 1609245
461 Ga0209050_1004196 3300025298 Bacteria 9969
462 Ga0209256_1000001 3300025299 Bacteria 2166974
463 Ga0209256_1000113 3300025299 Bacteria 175296
464 Ga0207426_1000988 3300025302 Bacteria 27876
465 Ga0209051_1000003 3300025303 Bacteria 1609245
466 Ga0209051_1000020 3300025303 Bacteria 508628
467 Ga0209051_1000281 3300025303 Bacteria 83196
468 Ga0209051_1014881 3300025303 Bacteria 3609
469 Ga0209257_1000020 3300025304 Bacteria 773356
470 Ga0209257_1000039 3300025304 Bacteria 591694
471 Ga0209257_1000085 3300025304 Bacteria 291117
472 Ga0207697_10017271 3300025315 Bacteria 2966
473 Ga0207656_10016593 3300025321 Bacteria 2869
474 Ga0207656_10036064 3300025321 Bacteria 2074
475 Ga0207656_10132169 3300025321 Bacteria 1170
476 Ga0207682_10000158 3300025893 Bacteria 30682
477 Ga0207682_10002043 3300025893 Bacteria 9135
478 Ga0207682_10006828 3300025893 Bacteria 4579
479 Ga0207682_10024321 3300025893 Bacteria 2397
480 Ga0207682_10103131 3300025893 Bacteria 1249
481 Ga0207692_10044183 3300025898 Bacteria 2222
482 Ga0207642_10002232 3300025899 Bacteria 6017
483 Ga0207642_10011633 3300025899 Bacteria 3147
484 Ga0207710_10016966 3300025900 Bacteria 3085
485 Ga0207688_10010279 3300025901 Bacteria 5093
486 Ga0207688_10025807 3300025901 Bacteria 3229
487 Ga0207688_10135796 3300025901 Bacteria 1444
488 Ga0207680_10013624 3300025903 Bacteria 4184
489 Ga0207680_10028229 3300025903 Bacteria 3136
490 Ga0207680_10073448 3300025903 Bacteria 2127
491 Ga0207645_10005861 3300025907 Bacteria 8853
492 Ga0207645_10010859 3300025907 Bacteria 6240
493 Ga0207645_10012965 3300025907 Bacteria 5636
494 Ga0207643_10000126 3300025908 Bacteria 52316
495 Ga0207643_10032526 3300025908 Bacteria 2914
496 Ga0207643_10150704 3300025908 Bacteria 1394
497 Ga0207643_10170818 3300025908 Bacteria 1312
498 Ga0207705_10057712 3300025909 Bacteria 2800
499 Ga0207705_10209948 3300025909 Bacteria 1477
500 Ga0207705_10291073 3300025909 Bacteria 1251
501 Ga0207684_10034594 3300025910 Bacteria 4293
502 Ga0207654_10031438 3300025911 Bacteria 2924
503 Ga0207654_10242835 3300025911 Bacteria 1204
504 Ga0207707_10025955 3300025912 Bacteria 5122
505 Ga0207707_10070363 3300025912 Bacteria 3049
506 Ga0207695_10182479 3300025913 Bacteria 2019
507 Ga0207671_10010045 3300025914 Bacteria 7847
508 Ga0207663_10115051 3300025916 Bacteria 1832
509 Ga0207660_10111562 3300025917 Bacteria 2058
510 Ga0207662_10002506 3300025918 Bacteria 9229
511 Ga0207662_10022676 3300025918 Bacteria 3602
512 Ga0207657_10020055 3300025919 Bacteria 6332
513 Ga0207657_10029332 3300025919 Bacteria 5010
514 Ga0207657_10093594 3300025919 Bacteria 2503
515 Ga0207657_10522372 3300025919 Bacteria 929
516 Ga0207649_10014470 3300025920 Bacteria 4419
517 Ga0207649_10213427 3300025920 Bacteria 1370
518 Ga0207649_10534607 3300025920 Bacteria 895
519 Ga0207652_10020046 3300025921 Bacteria 5506
520 Ga0207652_10075067 3300025921 Bacteria 2945
521 Ga0207652_10921281 3300025921 Bacteria 771
522 Ga0207681_10000205 3300025923 Bacteria 47034
523 Ga0207681_10018140 3300025923 Bacteria 4431
524 Ga0207681_10022630 3300025923 Bacteria 4011
525 Ga0207681_10063447 3300025923 Bacteria 2548
526 Ga0207681_10468195 3300025923 Bacteria 1028
527 Ga0207694_10072035 3300025924 Bacteria 2701
528 Ga0207694_10085702 3300025924 Bacteria 2480
529 Ga0207650_10000480 3300025925 Bacteria 33274
530 Ga0207650_10003292 3300025925 Bacteria 11116
531 Ga0207650_10021208 3300025925 Bacteria 4593
532 Ga0207650_10091213 3300025925 Bacteria 2328
533 Ga0207650_10167785 3300025925 Bacteria 1743
534 Ga0207650_10228028 3300025925 Bacteria 1501
535 Ga0207659_10000118 3300025926 Bacteria 46531
536 Ga0207659_10001268 3300025926 Bacteria 15123
537 Ga0207659_10003663 3300025926 Bacteria 9257
538 Ga0207659_10015369 3300025926 Bacteria 4958
539 Ga0207659_10027958 3300025926 Bacteria 3826
540 Ga0207659_10047812 3300025926 Bacteria 3027
541 Ga0207659_10059678 3300025926 Bacteria 2743
542 Ga0207659_10136785 3300025926 Bacteria 1897
543 Ga0207659_10298987 3300025926 Bacteria 1321
544 Ga0207687_10121766 3300025927 Bacteria 1952
545 Ga0207687_10250901 3300025927 Bacteria 1407
546 Ga0207687_10335716 3300025927 Bacteria 1227
547 Ga0207687_10413634 3300025927 Bacteria 1111
548 Ga0207687_10850893 3300025927 Bacteria 779
549 Ga0207700_10066304 3300025928 Bacteria 2759
550 Ga0207700_10070045 3300025928 Bacteria 2694
551 Ga0207644_10003975 3300025931 Bacteria 9600
552 Ga0207644_10019508 3300025931 Bacteria 4600
553 Ga0207644_10104590 3300025931 Bacteria 2131
554 Ga0207644_10133954 3300025931 Bacteria 1900
555 Ga0207644_10168230 3300025931 Bacteria 1709
556 Ga0207644_10297784 3300025931 Bacteria 1299
557 Ga0207644_10457128 3300025931 Bacteria 1049
558 Ga0207690_10028353 3300025932 Bacteria 3549
559 Ga0207690_10241539 3300025932 Bacteria 1391
560 Ga0207706_10000933 3300025933 Bacteria 29885
561 Ga0207706_10019724 3300025933 Bacteria 6065
562 Ga0207706_10025747 3300025933 Bacteria 5270
563 Ga0207706_10036217 3300025933 Bacteria 4384
564 Ga0207706_10169666 3300025933 Bacteria 1917
565 Ga0207706_10321995 3300025933 Bacteria 1345
566 Ga0207686_10217585 3300025934 Bacteria 1377
567 Ga0207709_10013768 3300025935 Bacteria 4464
568 Ga0207709_10198844 3300025935 Bacteria 1430
569 Ga0207670_10167890 3300025936 Bacteria 1643
570 Ga0207669_10000706 3300025937 Bacteria 14412
571 Ga0207669_10007121 3300025937 Bacteria 5151
572 Ga0207669_10050204 3300025937 Bacteria 2492
573 Ga0207669_10084058 3300025937 Bacteria 2049
574 Ga0207669_10103604 3300025937 Bacteria 1888
575 Ga0207669_10203135 3300025937 Bacteria 1440
576 Ga0207704_10001897 3300025938 Bacteria 9361
577 Ga0207704_10003903 3300025938 Bacteria 6778
578 Ga0207704_10192055 3300025938 Bacteria 1486
579 Ga0207704_10240048 3300025938 Bacteria 1353
580 Ga0207691_10000238 3300025940 Bacteria 53833
581 Ga0207691_10008515 3300025940 Bacteria 9852
582 Ga0207691_10027884 3300025940 Bacteria 5292
583 Ga0207691_10038127 3300025940 Bacteria 4447
584 Ga0207691_10047509 3300025940 Bacteria 3938
585 Ga0207691_10062672 3300025940 Bacteria 3373
586 Ga0207691_10083361 3300025940 Bacteria 2870
587 Ga0207691_10097071 3300025940 Bacteria 2634
588 Ga0207691_10132362 3300025940 Bacteria 2202
589 Ga0207691_10158640 3300025940 Bacteria 1986
590 Ga0207691_10291174 3300025940 Bacteria 1404
591 Ga0207691_10345436 3300025940 Bacteria 1273
592 Ga0207711_10031004 3300025941 Bacteria 4511
593 Ga0207711_10031635 3300025941 Bacteria 4468
594 Ga0207711_10035637 3300025941 Bacteria 4219
595 Ga0207711_10054798 3300025941 Bacteria 3423
596 Ga0207711_10083057 3300025941 Bacteria 2801
597 Ga0207711_10105794 3300025941 Bacteria 2496
598 Ga0207711_10228744 3300025941 Bacteria 1703
599 Ga0207689_10000150 3300025942 Bacteria 60037
600 Ga0207689_10006391 3300025942 Bacteria 10431
601 Ga0207689_10012442 3300025942 Bacteria 7271
602 Ga0207689_10019637 3300025942 Bacteria 5695
603 Ga0207661_10018031 3300025944 Bacteria 5240
604 Ga0207679_10022926 3300025945 Bacteria 4259
605 Ga0207679_10099825 3300025945 Bacteria 2267
606 Ga0207679_10283325 3300025945 Bacteria 1422
607 Ga0207667_10148644 3300025949 Bacteria 2412
608 Ga0207651_10001131 3300025960 Bacteria 11895
609 Ga0207651_10018265 3300025960 Bacteria 4168
610 Ga0207651_10043471 3300025960 Bacteria 2999
611 Ga0207651_10078593 3300025960 Bacteria 2367
612 Ga0207651_10134222 3300025960 Bacteria 1900
613 Ga0207651_10180917 3300025960 Bacteria 1672
614 Ga0207651_10333218 3300025960 Bacteria 1272
615 Ga0207651_10669978 3300025960 Bacteria 912
616 Ga0207651_10715977 3300025960 Bacteria 883
617 Ga0207712_10052734 3300025961 Bacteria 2850
618 Ga0207712_10070221 3300025961 Bacteria 2515
619 Ga0207668_10028131 3300025972 Bacteria 3672
620 Ga0207668_10033237 3300025972 Bacteria 3415
621 Ga0207640_10031917 3300025981 Bacteria 3261
622 Ga0207640_10042745 3300025981 Bacteria 2892
623 Ga0207640_10061281 3300025981 Bacteria 2491
624 Ga0207658_10014469 3300025986 Bacteria 5402
625 Ga0207658_10065840 3300025986 Bacteria 2723
626 Ga0207658_10073115 3300025986 Bacteria 2601
627 Ga0207658_10239220 3300025986 Bacteria 1537
628 Ga0207658_10651525 3300025986 Bacteria 949
629 Ga0207677_10005476 3300026023 Bacteria 6890
630 Ga0207677_10009321 3300026023 Bacteria 5521
631 Ga0207677_10132024 3300026023 Bacteria 1898
632 Ga0207677_10137224 3300026023 Bacteria 1867
633 Ga0207677_10141682 3300026023 Bacteria 1841
634 Ga0207677_10305244 3300026023 Bacteria 1316
635 Ga0207677_10464460 3300026023 Bacteria 1087
636 Ga0207703_10002955 3300026035 Bacteria 14418
637 Ga0207703_10008624 3300026035 Bacteria 8044
638 Ga0207703_10016069 3300026035 Bacteria 5838
639 Ga0207703_10030511 3300026035 Bacteria 4262
640 Ga0207703_10297844 3300026035 Bacteria 1470
641 Ga0207639_10245631 3300026041 Bacteria 1559
642 Ga0207639_10584088 3300026041 Bacteria 1029
643 Ga0207678_10000821 3300026067 Bacteria 28462
644 Ga0207678_10002944 3300026067 Bacteria 15425
645 Ga0207678_10028904 3300026067 Bacteria 4839
646 Ga0207678_10071519 3300026067 Bacteria 2974
647 Ga0207708_10022773 3300026075 Bacteria 4731
648 Ga0207708_10429113 3300026075 Bacteria 1097
649 Ga0207702_10002877 3300026078 Bacteria 16096
650 Ga0207702_10021046 3300026078 Bacteria 5397
651 Ga0207702_10024026 3300026078 Bacteria 5057
652 Ga0207702_10228894 3300026078 Bacteria 1736
653 Ga0207702_10564109 3300026078 Bacteria 1114
654 Ga0207641_10003621 3300026088 Bacteria 13635
655 Ga0207641_10016238 3300026088 Bacteria 6097
656 Ga0207641_10025306 3300026088 Bacteria 4894
657 Ga0207641_10042640 3300026088 Bacteria 3807
658 Ga0207641_10047000 3300026088 Bacteria 3639
659 Ga0207641_10055755 3300026088 Bacteria 3356
660 Ga0207641_10097217 3300026088 Bacteria 2588
661 Ga0207641_10813152 3300026088 Bacteria 925
662 Ga0207648_10000032 3300026089 Bacteria 128009
663 Ga0207648_10003526 3300026089 Bacteria 16384
664 Ga0207648_10005311 3300026089 Bacteria 12992
665 Ga0207648_10029392 3300026089 Bacteria 4874
666 Ga0207648_10042712 3300026089 Bacteria 3980
667 Ga0207648_10044866 3300026089 Bacteria 3879
668 Ga0207648_10185127 3300026089 Bacteria 1844
669 Ga0207648_10364231 3300026089 Bacteria 1305
670 Ga0207648_10974953 3300026089 Bacteria 793
671 Ga0207676_10012629 3300026095 Bacteria 6058
672 Ga0207676_10019318 3300026095 Bacteria 4969
673 Ga0207676_10020581 3300026095 Bacteria 4829
674 Ga0207676_10020892 3300026095 Bacteria 4797
675 Ga0207676_10020980 3300026095 Bacteria 4788
676 Ga0207676_10034951 3300026095 Bacteria 3809
677 Ga0207676_10058347 3300026095 Bacteria 3044
678 Ga0207676_10096496 3300026095 Bacteria 2440
679 Ga0207675_100001131 3300026118 Bacteria 26465
680 Ga0207675_100040389 3300026118 Bacteria 4357
681 Ga0207675_100099102 3300026118 Bacteria 2745
682 Ga0207675_100840349 3300026118 Bacteria 933
683 Ga0207683_10000079 3300026121 Bacteria 76688
684 Ga0207683_10000844 3300026121 Bacteria 28105
685 Ga0207683_10013866 3300026121 Bacteria 6873
686 Ga0207683_10044919 3300026121 Bacteria 3863
687 Ga0207683_10045569 3300026121 Bacteria 3835
688 Ga0207683_10112850 3300026121 Bacteria 2434
689 Ga0207683_10160593 3300026121 Bacteria 2031
690 Ga0207683_10168636 3300026121 Bacteria 1982
691 Ga0207683_10336385 3300026121 Bacteria 1384
692 Ga0207683_10403392 3300026121 Bacteria 1258
693 Ga0207683_10433701 3300026121 Bacteria 1211
694 Ga0207698_10005102 3300026142 Bacteria 8064
695 Ga0207698_10011027 3300026142 Bacteria 5842
696 Ga0207698_10016930 3300026142 Bacteria 4930
697 Ga0207698_10017008 3300026142 Bacteria 4922
698 Ga0207698_10017398 3300026142 Bacteria 4875
699 Ga0207698_10041127 3300026142 Bacteria 3441
700 Ga0207698_10063780 3300026142 Bacteria 2885
701 Ga0207698_10428754 3300026142 Bacteria 1271
702 Ga0207698_10825519 3300026142 Bacteria 931
703 Ga0209281_1000074 3300027111 Bacteria 267848
704 Ga0209281_1015948 3300027111 Bacteria 1555
705 Ga0207428_10493521 3300027907 Bacteria 890
706 Ga0268266_10018888 3300028379 Bacteria 5872
707 Ga0268264_10004410 3300028381 Bacteria 12007
708 Ga0268264_10056204 3300028381 Bacteria 3290
709 Ga0268264_10143525 3300028381 Bacteria 2132
710 Ga0265318_10063423 3300028577 Bacteria 1375
711 Ga0265323_10003257 3300028653 Bacteria 7232
712 Ga0265323_10010912 3300028653 Bacteria 3679
713 Ga0265322_10000199 3300028654 Bacteria 26538
714 Ga0265336_10000003 3300028666 Bacteria 423158
715 Ga0307517_10000810 3300028786 Bacteria 53724
716 Ga0307515_10000110 3300028794 Bacteria 195560
717 Ga0307515_10015338 3300028794 Bacteria 14123
718 Ga0307515_10117740 3300028794 Bacteria 3038
719 Ga0307515_10278698 3300028794 Bacteria 1382
720 Ga0265324_10000908 3300029957 Bacteria 18733
721 Ga0307512_10004629 3300030522 Bacteria 14941
722 Ga0265329_10017929 3300031242 Bacteria 2428
723 Ga0265316_10000456 3300031344 Bacteria 46381
724 Ga0265316_10026553 3300031344 Bacteria 4813
725 Ga0307513_10000011 3300031456 Bacteria 354929
726 Ga0307513_10001586 3300031456 Bacteria 32634
727 Ga0307513_10126205 3300031456 Bacteria 2514
728 Ga0307513_10158342 3300031456 Bacteria 2161
729 Ga0307509_10000802 3300031507 Bacteria 53907
730 Ga0307509_10003238 3300031507 Bacteria 25133
731 Ga0307509_10012626 3300031507 Bacteria 10090
732 Ga0307509_10022383 3300031507 Bacteria 7125
733 Ga0307509_10023332 3300031507 Bacteria 6953
734 Ga0307509_10030645 3300031507 Bacteria 5946
735 Ga0307509_10178615 3300031507 Bacteria 1992
736 Ga0307408_100022685 3300031548 Bacteria 4268
737 Ga0307508_10002132 3300031616 Bacteria 21213
738 Ga0307508_10033344 3300031616 Bacteria 4646
739 Ga0307508_10409992 3300031616 Bacteria 946
740 Ga0307514_10018100 3300031649 Bacteria 5787
741 Ga0265314_10047501 3300031711 Bacteria 3020
742 Ga0265342_10007343 3300031712 Bacteria 8085
743 Ga0307516_10001054 3300031730 Bacteria 38370
744 Ga0307405_10005514 3300031731 Bacteria 6111
745 Ga0307405_10007548 3300031731 Bacteria 5447
746 Ga0307413_10004470 3300031824 Bacteria 6091
747 Ga0307410_10041255 3300031852 Bacteria 3043
748 Ga0307410_10268228 3300031852 Bacteria 1334
749 Ga0307406_10007622 3300031901 Bacteria 6009
750 Ga0307406_10048836 3300031901 Bacteria 2675
751 Ga0307407_10020188 3300031903 Bacteria 3408
752 Ga0307407_10129209 3300031903 Bacteria 1614
753 Ga0307412_10015518 3300031911 Bacteria 4519
754 Ga0307412_10490239 3300031911 Bacteria 1021
755 Ga0307409_100118378 3300031995 Bacteria 2237
756 Ga0307409_100234675 3300031995 Bacteria 1665
757 Ga0307409_100392134 3300031995 Bacteria 1323
758 Ga0307409_100832013 3300031995 Bacteria 933
759 Ga0307416_100054349 3300032002 Bacteria 3218
760 Ga0307416_100069120 3300032002 Bacteria 2921
761 Ga0307416_100585444 3300032002 Bacteria 1194
762 Ga0307416_100723826 3300032002 Bacteria 1086
763 Ga0307414_10019903 3300032004 Bacteria 4170
764 Ga0307411_10001107 3300032005 Bacteria 10491
765 Ga0307411_10155863 3300032005 Bacteria 1703
766 Ga0307411_10878998 3300032005 Bacteria 795
767 Ga0307415_100010508 3300032126 Bacteria 5247
768 Ga0307415_100112857 3300032126 Bacteria 2020
769 Ga0307415_100279896 3300032126 Bacteria 1371
770 Ga0307510_10009294 3300033180 Bacteria 11718
771 Ga0307510_10009432 3300033180 Bacteria 11626
772 Ga0307510_10122397 3300033180 Bacteria 2301
773 Ga0373929_0011337 3300035085 Bacteria 1679
774 Ga0373940_0027381 3300035088 Bacteria 1498
775 Ga0373932_0038750 3300035112 Bacteria 1364
776 Ga0373936_0207513 3300035113 Bacteria 866
777 Ga0373943_0206506 3300035170 Bacteria 1089
778 Ga0373955_0135855 3300035172 Bacteria 1438
779 Ga0373931_0004895 3300035691 Bacteria 6157
780 Ga0373931_0014121 3300035691 Bacteria 3900
781 Ga0373931_0018946 3300035691 Bacteria 3429
782 Ga0373931_0104620 3300035691 Bacteria 1597
783 Ga0373927_0282930 3300035695 Bacteria 1091
784 Ga0373933_0046455 3300035724 Bacteria 2579
785 Ga0373937_0058064 3300036401 Bacteria 3555
786 Ga0373937_0177093 3300036401 Bacteria 2002
787 Ga0373925_0111737 3300037068 Bacteria 2112
788 Ga0373925_0431086 3300037068 Bacteria 1078
789 Ga0395900_0243828 3300037418 Bacteria 1802
790 Ga0395905_0000026 3300037471 Bacteria 315051
791 Ga0395905_0055676 3300037471 Bacteria 3701
792 Ga0395905_0248099 3300037471 Bacteria 1663
793 Ga0395905_0307890 3300037471 Bacteria 1472
794 Ga0395905_0568640 3300037471 Bacteria 1035
795 Ga0395905_0748583 3300037471 Bacteria 879
796 Ga0395901_0132121 3300038443 Bacteria 2623
797 Ga0436365_0361177 3300039437 Bacteria 4074
798 Ga0439436_0000086 3300041404 Bacteria 22153
799 Ga0439439_0008548 3300041406 Bacteria 2421
800 Ga0439466_0005453 3300041411 Bacteria 4858
801 Ga0439465_0000464 3300041413 Bacteria 11950
802 Ga0451800_0010811 3300041459 Bacteria 840
803 Ga0451807_0017675 3300041486 Bacteria 990
804 Ga0451853_1666867 3300041512 Bacteria 931
805 Ga0439431_0007902 3300041997 Bacteria 2379
806 Ga0439445_0000486 3300042004 Bacteria 8048
807 Ga0439448_0012659 3300042005 Bacteria 2528
808 Ga0439432_005058 3300042006 Bacteria 4768
809 Ga0439432_018316 3300042006 Bacteria 2341
810 Ga0439449_0000300 3300042007 Bacteria 17778
811 Ga0439452_001494 3300042010 Bacteria 9486
812 Ga0439457_020155 3300042014 Bacteria 1480
813 Ga0439462_0001329 3300042015 Bacteria 5451
814 Ga0439462_0002187 3300042015 Bacteria 4506
815 Ga0450919_000456 3300042121 Bacteria 5084
816 Ga0439446_0000332 3300042156 Bacteria 9108
817 Ga0439458_0012656 3300042157 Bacteria 1896
818 Ga0439459_0048958 3300042438 Bacteria 922
819 Ga0439464_0147910 3300042439 Bacteria 734
820 Ga0450918_002380 3300042531 Bacteria 3554
821 Ga0453683_0004804 3300044673 Bacteria 9512
822 Ga0466965_0027812 3300044683 Bacteria 2745
823 Ga0453684_0007800 3300044712 Bacteria 19522
824 Ga0453684_0151671 3300044712 Bacteria 2753
825 Ga0466970_0081755 3300044765 Bacteria 1747
826 Ga0466960_0015324 3300044901 Bacteria 3302
827 Ga0466967_0022959 3300045976 Bacteria 5103
828 Ga0466967_0068005 3300045976 Bacteria 3179
829 Ga0466967_0463031 3300045976 Bacteria 1240
830 Ga0495592_0000272 3300046454 Bacteria 44189
831 Ga0495603_0370864 3300046455 Unclassified 821
832 Ga0495629_0141305 3300046459 Bacteria 1675
833 Ga0495629_0204716 3300046459 Bacteria 1364
834 Ga0495580_0380850 3300046472 Bacteria 953
835 Ga0495639_0072671 3300046475 Bacteria 1591
836 Ga0495585_0240405 3300046492 Bacteria 907
837 Ga0495594_0172390 3300046499 Bacteria 1231
838 Ga0495610_0101621 3300046512 Bacteria 1287
839 Ga0495620_0085972 3300046515 Bacteria 1267
840 Ga0495628_0342193 3300046516 Bacteria 1101
841 Ga0495630_0240583 3300046517 Bacteria 1383
842 Ga0495643_0028708 3300046522 Bacteria 3116
843 Ga0495648_0092742 3300046524 Bacteria 1686
844 Ga0495586_0212541 3300046535 Bacteria 1098
845 Ga0495598_0091642 3300046537 Bacteria 992
846 Ga0495645_0352094 3300046543 Bacteria 948
847 Ga0495667_0206930 3300046559 Bacteria 1255
848 Ga0495656_0003749 3300046615 Bacteria 5160
849 Ga0495599_0246634 3300046678 Bacteria 1088
850 Ga0495646_0061312 3300046680 Bacteria 2240
851 Ga0495647_0188710 3300046681 Bacteria 900
852 Ga0495658_0060520 3300046683 Bacteria 2172
853 Ga0495658_0094143 3300046683 Bacteria 1779
854 Ga0495613_0153308 3300046689 Bacteria 1642
855 Ga0495624_0409286 3300046690 Bacteria 814
856 Ga0495604_0375788 3300047317 Bacteria 940
857 Ga0495636_0132374 3300047318 Bacteria 1110
858 Ga0495681_0166474 3300047470 Bacteria 915
859 Ga0495684_0406835 3300047471 Bacteria 954
860 Ga0495686_0003640 3300047472 Bacteria 13199
861 Ga0495686_0083309 3300047472 Bacteria 1951
862 Ga0495615_0030324 3300048090 Bacteria 1290
863 Ga0496100_0002898 3300048903 Bacteria 8803
864 Ga0496100_0128746 3300048903 Bacteria 1780
865 Ga0496100_0378677 3300048903 Bacteria 1074
866 Ga0496100_0542201 3300048903 Bacteria 899
867 Ga0496100_0640813 3300048903 Bacteria 827
868 Ga0496101_0002087 3300048904 Bacteria 12163
869 Ga0496101_0011436 3300048904 Bacteria 5889
870 Ga0496101_0022835 3300048904 Bacteria 4313
871 Ga0496101_0344501 3300048904 Bacteria 1171
872 Ga0496102_0001109 3300048905 Bacteria 24710
873 Ga0496102_0010119 3300048905 Bacteria 8113
874 Ga0496102_0048432 3300048905 Bacteria 3864
875 Ga0496103_0011381 3300048906 Bacteria 5270
876 Ga0496103_0140546 3300048906 Bacteria 1544
877 Ga0496104_0005004 3300048907 Bacteria 11562
878 Ga0496104_0022800 3300048907 Bacteria 5751
879 Ga0496104_0182487 3300048907 Bacteria 2009
880 Ga0496104_0297480 3300048907 Bacteria 1526
881 Ga0496105_0020021 3300048908 Bacteria 5401
882 Ga0496105_0035471 3300048908 Bacteria 4104
883 Ga0496105_0079410 3300048908 Bacteria 2709
884 Ga0496105_0519307 3300048908 Bacteria 933
885 Ga0496106_0009849 3300048909 Bacteria 7057
886 Ga0496106_0009864 3300048909 Bacteria 7050
887 Ga0496106_0021246 3300048909 Bacteria 4819
888 Ga0496107_0002258 3300048910 Bacteria 12431
889 Ga0496107_0021980 3300048910 Bacteria 4506
890 Ga0496107_0600618 3300048910 Bacteria 813
891 Ga0496108_0009344 3300048911 Bacteria 7939
892 Ga0496108_0026830 3300048911 Bacteria 4754
893 Ga0496108_0058254 3300048911 Bacteria 3246
894 Ga0496108_0180337 3300048911 Bacteria 1829
895 Ga0496108_0298480 3300048911 Bacteria 1403
896 Ga0496108_0459634 3300048911 Bacteria 1112
897 Ga0496109_0111943 3300048912 Bacteria 2538
898 Ga0496109_0113761 3300048912 Bacteria 2517
899 Ga0496109_0182361 3300048912 Bacteria 1972
900 Ga0496109_0226342 3300048912 Bacteria 1759
901 Ga0496110_0001863 3300048913 Bacteria 15575
902 Ga0496110_0063219 3300048913 Bacteria 3270
903 Ga0496111_0010154 3300048914 Bacteria 6304
904 Ga0496111_0083712 3300048914 Bacteria 2331
905 Ga0496112_0043821 3300048915 Bacteria 4381
906 Ga0496112_0663212 3300048915 Bacteria 972
907 Ga0496113_0059891 3300048916 Bacteria 2869
908 Ga0496114_0001480 3300048917 Bacteria 17833
909 Ga0496114_0002558 3300048917 Bacteria 13895
910 Ga0496114_0003140 3300048917 Bacteria 12679
911 Ga0496114_0029841 3300048917 Bacteria 4483
912 Ga0496114_0080624 3300048917 Bacteria 2749
913 Ga0496114_0622929 3300048917 Bacteria 950
914 Ga0496115_0028775 3300048918 Bacteria 4358
915 Ga0496115_0339912 3300048918 Bacteria 1225
916 Ga0501292_002626 3300049515 Bacteria 2333
917 Ga0501297_015612 3300049520 Bacteria 910
918 Ga0501298_009377 3300049521 Bacteria 1664
919 Ga0501301_000987 3300049524 Bacteria 1779
920 Ga0501034_0250905 3300049571 Bacteria 1714
921 Ga0501034_0595995 3300049571 Bacteria 1011
922 Ga0501039_0260484 3300049575 Bacteria 1363
923 Ga0501067_0002689 3300049583 Bacteria 9815
924 Ga0501067_0185792 3300049583 Bacteria 1157
925 Ga0501069_0015079 3300049585 Bacteria 4140
926 Ga0501198_000004 3300049649 Bacteria 175146
927 Ga0501206_008319 3300049653 Bacteria 1370
928 Ga0501207_018567 3300049654 Bacteria 1095
929 Ga0501222_000038 3300049662 Bacteria 51424
930 Ga0501252_000809 3300049682 Bacteria 2632
931 Ga0501257_009870 3300049686 Bacteria 2160
932 Ga0501221_109755 3300049704 Bacteria 694
933 Ga0501265_001086 3300049762 Bacteria 3062
934 nmdc:mga03683_193645_c1 3300050489 Bacteria 931
935 nmdc:mga0yw44_156079_c1 3300050492 Bacteria 1491
936 nmdc:mga0yw44_206316_c1 3300050492 Bacteria 1299
937 nmdc:mga07m45_352965_c1 3300050496 Bacteria 854
938 nmdc:mga05p37_1507_c1 3300050507 Bacteria 27071
939 nmdc:mga05p37_343680_c1 3300050507 Bacteria 1759
940 nmdc:mga08y16_593114_c1 3300050511 Bacteria 1117
941 nmdc:mga0n895_3433_c1 3300050512 Bacteria 12787
942 nmdc:mga0a205_65042_c1 3300050515 Bacteria 3523
943 Ga0495612_0023758 3300053078 Bacteria 2461
944 Ga0495619_0097206 3300053085 Bacteria 2000
945 Ga0500644_0001734 3300053088 Bacteria 5662
946 Ga0500644_0014473 3300053088 Bacteria 2228
947 Ga0500583_0019283 3300053092 Bacteria 2793
948 Ga0500651_0014926 3300053093 Bacteria 4760
949 Ga0500566_0379699 3300053094 Bacteria 639
950 Ga0500593_004651 3300053117 Bacteria 5342
951 Ga0500652_102749 3300053131 Bacteria 1195
952 Ga0500559_0000022 3300053136 Bacteria 128071
953 Ga0500559_0125696 3300053136 Bacteria 1195
954 Ga0500564_041112 3300053138 Bacteria 2128
955 Ga0500568_0012032 3300053139 Bacteria 3989
956 Ga0500590_000246 3300053148 Bacteria 16671
957 Ga0500622_0000498 3300053156 Bacteria 36624
958 Ga0500645_000114 3300053730 Bacteria 64351
959 Ga0500645_002232 3300053730 Bacteria 8833
960 Ga0501084_0096638 3300054114 Bacteria 2481
961 2511243286 2511231002 Bacteria 5042903
962 2643865843 2643221570 Bacteria 5103772
963 2644060466 2643221609 Bacteria 6756331
964 2644073788 2643221611 Bacteria 6820941
965 2644248278 2643221644 Bacteria 6865017
966 2885195931 2885192300 Bacteria 5882526
967 2894025595 2894023352 Bacteria 5167372
968 Ga0068871_100281820
969 JGI25155J39150_1000105
970 JGI25156J39149_1000191
971 JGI25154J39366_1000195
972 JGI25157J39369_1000227
973 JGI25159J45721_1001565
974 JGI25151J46595_10015577
975 JGI25151J46595_10017387
976 rootH2_10069953
977 Ga0055525_1000021
978 Ga0055526_1006669
979 Ga0055526_1018321
980 Ga0055526_1028759
981 Ga0055537_1000257
982 Ga0055537_1024980
983 Ga0055524_1000077
984 Ga0055524_1000253
985 Ga0055536_1000408
986 Ga0055534_1000619
987 Ga0055528_1001926
988 Ga0055530_10000354
989 Ga0055530_10004807
990 Ga0055540_1000010
991 Ga0055540_1000011
992 Ga0055540_1023256
993 Ga0055540_1040480
994 Ga0055531_10000298
995 Ga0055531_10000405
996 Ga0055531_10000992
997 Ga0055531_10038475
998 Ga0065165_1009925
999 Ga0065165_1012628
1000 Ga0065165_1043885
1001 Ga0070658_10024955
1002 Ga0070658_10250138
1003 Ga0070676_10003203
1004 Ga0070676_10071698
1005 Ga0070683_100115298
1006 Ga0070690_100030145
1007 Ga0070670_100003584
1008 Ga0070670_100031412
1009 Ga0070670_100051303
1010 Ga0070670_100052640
1011 Ga0070670_100063526
1012 Ga0070670_100075224
1013 Ga0070670_100130651
1014 Ga0070670_100149786
1015 Ga0070670_100328245
1016 Ga0070670_100351182
1017 Ga0070677_10004214
1018 Ga0070677_10006294
1019 Ga0070677_10006352
1020 Ga0070677_10016635
1021 Ga0070677_10022883
1022 Ga0070677_10046686
1023 Ga0070677_10053980
1024 Ga0068869_100000464
1025 Ga0068869_100017548
1026 Ga0068869_100042984
1027 Ga0068869_100070609
1028 Ga0068869_100201233
1029 Ga0070666_10008685
1030 Ga0070666_10085206
1031 Ga0070666_10104502
1032 Ga0070680_100020509
1033 Ga0070682_100005154
1034 Ga0070682_100053329
1035 Ga0068868_100001157
1036 Ga0068868_100003589
1037 Ga0068868_100018257
1038 Ga0068868_100038490
1039 Ga0068868_100040850
1040 Ga0068868_100070593
1041 Ga0068868_100105169
1042 Ga0070660_100083499
1043 Ga0070660_100465622
1044 Ga0070660_100541561
1045 Ga0070689_100019366
1046 Ga0070689_100157142
1047 Ga0070689_100218497
1048 Ga0070691_10002512
1049 Ga0070687_100001572
1050 Ga0070687_100040473
1051 Ga0070661_100204767
1052 Ga0070692_10009917
1053 Ga0070692_10206857
1054 Ga0070668_100019369
1055 Ga0070668_100035665
1056 Ga0070668_100152762
1057 Ga0070668_100159003
1058 Ga0070669_100001896
1059 Ga0070669_100002377
1060 Ga0070669_100028374
1061 Ga0070669_100099987
1062 Ga0070669_100619360
1063 Ga0070675_100001801
1064 Ga0070675_100001993
1065 Ga0070675_100022306
1066 Ga0070675_100026137
1067 Ga0070675_100029917
1068 Ga0070675_100072042
1069 Ga0070675_100084496
1070 Ga0070675_100179384
1071 Ga0070675_100347154
1072 Ga0070671_100006533
1073 Ga0070671_100020918
1074 Ga0070671_100045128
1075 Ga0070671_100055230
1076 Ga0070671_100071832
1077 Ga0070671_100155508
1078 Ga0070671_100455788
1079 Ga0070674_100001004
1080 Ga0070674_100028169
1081 Ga0070674_100035179
1082 Ga0070674_100462154
1083 Ga0070673_100002809
1084 Ga0070673_100003898
1085 Ga0070673_100037898
1086 Ga0070673_100078466
1087 Ga0070673_100126960
1088 Ga0070673_100127201
1089 Ga0070673_100142252
1090 Ga0070673_100163489
1091 Ga0070673_100332099
1092 Ga0070673_100408969
1093 Ga0070673_100823069
1094 Ga0070659_100017714
1095 Ga0070659_100087482
1096 Ga0070667_100006750
1097 Ga0070667_100022158
1098 Ga0070667_100132813
1099 Ga0070709_10044004
1100 Ga0070714_100049718
1101 Ga0070713_100121718
1102 Ga0070710_10083778
1103 Ga0070701_10037308
1104 Ga0070701_10089688
1105 Ga0070701_10139535
1106 Ga0070711_100129900
1107 Ga0070700_100498752
1108 Ga0070708_100336081
1109 Ga0070663_100011135
1110 Ga0070663_100034752
1111 Ga0070663_100097140
1112 Ga0070663_100462505
1113 Ga0070663_100550638
1114 Ga0070678_100005974
1115 Ga0070678_100007713
1116 Ga0070678_100018295
1117 Ga0070678_100023041
1118 Ga0070678_100133529
1119 Ga0070678_100227568
1120 Ga0070678_100270260
1121 Ga0070678_100347630
1122 Ga0070678_100361807
1123 Ga0070678_100498097
1124 Ga0070662_100000867
1125 Ga0070662_100027044
1126 Ga0070662_100052602
1127 Ga0070681_10004529
1128 Ga0070681_10060748
1129 Ga0068867_100000005
1130 Ga0068867_100008508
1131 Ga0068867_100011686
1132 Ga0068867_100031401
1133 Ga0068867_100035530
1134 Ga0068867_100066669
1135 Ga0068867_100106939
1136 Ga0068867_100157010
1137 Ga0068867_100311171
1138 Ga0070706_100029862
1139 Ga0070706_100671812
1140 Ga0070698_100071963
1141 Ga0070679_100014568
1142 Ga0070679_100076037
1143 Ga0070684_100058255
1144 Ga0068853_100002880
1145 Ga0068853_100150830
1146 Ga0068853_100151378
1147 Ga0068853_100281758
1148 Ga0068853_100684319
1149 Ga0070672_100000535
1150 Ga0070672_100002739
1151 Ga0070672_100015927
1152 Ga0070672_100057199
1153 Ga0070672_100059868
1154 Ga0070672_100180219
1155 Ga0070672_100294564
1156 Ga0070672_100295381
1157 Ga0070672_100306273
1158 Ga0070686_100231040
1159 Ga0070686_100371529
1160 Ga0070696_100201015
1161 Ga0070693_100008393
1162 Ga0070693_100019340
1163 Ga0070693_100022140
1164 Ga0070665_100143768
1165 Ga0070665_100231023
1166 Ga0070665_100514414
1167 Ga0068855_100058435
1168 Ga0068855_100165685
1169 Ga0070664_100081262
1170 Ga0070664_100082504
1171 Ga0070664_100444364
1172 Ga0070664_100785973
1173 Ga0068854_100017820
1174 Ga0068854_100022161
1175 Ga0068854_100028660
1176 Ga0068854_100048963
1177 Ga0068854_100092539
1178 Ga0068854_100216016
1179 Ga0068856_100004035
1180 Ga0068856_100018011
1181 Ga0070702_100001510
1182 Ga0070702_100008822
1183 Ga0070702_100019205
1184 Ga0070702_100419295
1185 Ga0068852_100004252
1186 Ga0068852_100007302
1187 Ga0068852_100055967
1188 Ga0068852_100093632
1189 Ga0068852_100158420
1190 Ga0068852_100268585
1191 Ga0068852_100269628
1192 Ga0068852_100782185
1193 Ga0068859_100022772
1194 Ga0068859_100035116
1195 Ga0068859_100058573
1196 Ga0068859_100134057
1197 Ga0068859_100183798
1198 Ga0068864_100000875
1199 Ga0068864_100008330
1200 Ga0068864_100011769
1201 Ga0068864_100043505
1202 Ga0068864_100045627
1203 Ga0068864_100104006
1204 Ga0068864_100189128
1205 Ga0068864_100239029
1206 Ga0068864_100472275
1207 Ga0068866_10003567
1208 Ga0068866_10006470
1209 Ga0068861_100003855
1210 Ga0068861_100015935
1211 Ga0068861_100026650
1212 Ga0068861_100244541
1213 Ga0068851_10025409
1214 Ga0068851_10048558
1215 Ga0068851_10434473
1216 Ga0068870_10007303
1217 Ga0068870_10196682
1218 Ga0068870_10219049
1219 Ga0068863_100002558
1220 Ga0068863_100010010
1221 Ga0068863_100010659
1222 Ga0068863_100035145
1223 Ga0068863_100051014
1224 Ga0068863_100081499
1225 Ga0068863_100085929
1226 Ga0068863_100096825
1227 Ga0068863_100152978
1228 Ga0068863_100429801
1229 Ga0068858_100000703
1230 Ga0068858_100013992
1231 Ga0068858_100032986
1232 Ga0068858_100107651
1233 Ga0068858_100279942
1234 Ga0068858_100568689
1235 Ga0068860_100003734
1236 Ga0068860_100033660
1237 Ga0068860_100043222
1238 Ga0068860_100092901
1239 Ga0068860_100187154
1240 Ga0068860_100228313
1241 Ga0068862_100084701
1242 Ga0068862_100917475
1243 Ga0075365_10016275
1244 Ga0075365_10321986
1245 Ga0075432_10005363
1246 Ga0075432_10042669
1247 Ga0070715_10034025
1248 Ga0070715_10385188
1249 Ga0070716_100224101
1250 Ga0070712_100152684
1251 Ga0075367_10086708
1252 Ga0097621_100001230
1253 Ga0097621_100006734
1254 Ga0097621_100011335
1255 Ga0097621_100063536
1256 Ga0097621_100141688
1257 Ga0097621_100191600
1258 Ga0075370_10066213
1259 Ga0075370_10252413
1260 Ga0075370_10367260
1261 Ga0068871_100012983
1262 Ga0068871_100017138
1263 Ga0068871_100069683
1264 Ga0068871_100098522
1265 Ga0068871_100427472
1266 Ga0075431_100193574
1267 Ga0075433_10016370
1268 Ga0075434_100005990
1269 Ga0075434_100485172
1270 Ga0068865_100001470
1271 Ga0068865_100007997
1272 Ga0068865_100730434
1273 Ga0075436_100033151
1274 Ga0097620_100022772
1275 Ga0097620_100035114
1276 Ga0097620_100058574
1277 Ga0097620_100134048
1278 Ga0097620_100183805
1279 Ga0079104_1000040
1280 Ga0075435_100003754
1281 Ga0105240_10145647
1282 Ga0105240_10216771
1283 Ga0105245_10059383
1284 Ga0105245_10065787
1285 Ga0105245_10135159
1286 Ga0105245_10329311
1287 Ga0105247_10006783
1288 Ga0105247_10628123
1289 Ga0114129_10000114
1290 Ga0114129_10175873
1291 Ga0114129_10210660
1292 Ga0114129_10568288
1293 Ga0114129_11046435
1294 Ga0114129_11060650
1295 Ga0105243_10014299
1296 Ga0105243_10058093
1297 Ga0105243_10078734
1298 Ga0105243_10118359
1299 Ga0105241_10007301
1300 Ga0105241_10024754
1301 Ga0105241_10175746
1302 Ga0105241_10443225
1303 Ga0105242_10014074
1304 Ga0105242_10276195
1305 Ga0105242_10740995
1306 Ga0105248_10016659
1307 Ga0105248_10026400
1308 Ga0105248_10037374
1309 Ga0105248_10050259
1310 Ga0105248_10152200
1311 Ga0105248_10465756
1312 Ga0105237_10001971
1313 Ga0105237_10184040
1314 Ga0105238_10022974
1315 Ga0105238_10026817
1316 Ga0105238_10085150
1317 Ga0105249_10101261
1318 Ga0105249_10197204
1319 Ga0105249_10254939
1320 Ga0105239_10000531
1321 Ga0105246_10007831
1322 Ga0157316_1004889
1323 Ga0157373_10041996
1324 Ga0157373_10063675
1325 Ga0157371_10049369
1326 Ga0157370_10028511
1327 Ga0157370_10503974
1328 Ga0157369_10027535
1329 Ga0157369_10418734
1330 Ga0157374_10035458
1331 Ga0157374_10071381
1332 Ga0157374_10117491
1333 Ga0157374_10376948
1334 Ga0157374_10639801
1335 Ga0157374_10810223
1336 Ga0157378_10038089
1337 Ga0157378_10825634
1338 Ga0163162_10016188
1339 Ga0163162_10069089
1340 Ga0163162_10086356
1341 Ga0163162_10204736
1342 Ga0163162_10228300
1343 Ga0163162_10820953
1344 Ga0163162_11451725
1345 Ga0157372_10028330
1346 Ga0157372_10100758
1347 Ga0157372_10187981
1348 Ga0157372_10282825
1349 Ga0157375_10005937
1350 Ga0157375_10039133
1351 Ga0157375_10094763
1352 Ga0157375_10096018
1353 Ga0157375_10220688
1354 Ga0157375_10265562
1355 Ga0157375_10427534
1356 Ga0157375_10432144
1357 Ga0157375_10675732
1358 Ga0157375_10734819
1359 Ga0163163_10005258
1360 Ga0163163_10090065
1361 Ga0163163_10503704
1362 Ga0163163_10542633
1363 Ga0157380_10004961
1364 Ga0157380_10010895
1365 Ga0157380_10079110
1366 Ga0157380_10099648
1367 Ga0157380_10117345
1368 Ga0157380_10775725
1369 Ga0157380_10905994
1370 Ga0157377_10000022
1371 Ga0157377_10001663
1372 Ga0157377_10002890
1373 Ga0157377_10210438
1374 Ga0157379_10010626
1375 Ga0157379_10010802
1376 Ga0157379_10022405
1377 Ga0157379_10027535
1378 Ga0157379_10044121
1379 Ga0157379_10051355
1380 Ga0157379_10053977
1381 Ga0157379_10057691
1382 Ga0157379_10063401
1383 Ga0157379_10137731
1384 Ga0157376_10009598
1385 Ga0157376_10012290
1386 Ga0157376_10127296
1387 Ga0157376_10232269
1388 Ga0157376_10383852
1389 Ga0157376_10510605
1390 Ga0157376_10637851
1391 Ga0157376_10693663
1392 Ga0182007_10139375
1393 Ga0163161_10010482
1394 Ga0163161_10061902
1395 Ga0163161_10085889
1396 Ga0163161_10321773
1397 Ga0206356_11249198
1398 Ga0206354_11204485
1399 Ga0206353_10288226
1400 Ga0213876_10032532
1401 Ga0209435_100010
1402 Ga0209674_108306
1403 Ga0209563_100005
1404 Ga0207425_1000774
1405 Ga0207425_1002031
1406 Ga0209646_1000001
1407 Ga0209759_1000001
1408 Ga0209129_1011340
1409 Ga0209565_1000036
1410 Ga0209565_1001584
1411 Ga0209565_1006670
1412 Ga0209673_1000008
1413 Ga0209130_1000622
1414 Ga0209130_1047807
1415 Ga0209675_1000106
1416 Ga0209675_1003163
1417 Ga0209676_1000007
1418 Ga0209676_1003255
1419 Ga0209025_1002522
1420 Ga0209025_1008912
1421 Ga0209025_1012221
1422 Ga0209025_1063541
1423 Ga0209564_1000487
1424 Ga0209564_1001215
1425 Ga0209564_1001602
1426 Ga0209758_1016244
1427 Ga0209050_1000003
1428 Ga0209050_1004196
1429 Ga0209256_1000001
1430 Ga0209256_1000113
1431 Ga0207426_1000988
1432 Ga0209051_1000003
1433 Ga0209051_1000020
1434 Ga0209051_1000281
1435 Ga0209051_1014881
1436 Ga0209257_1000020
1437 Ga0209257_1000039
1438 Ga0209257_1000085
1439 Ga0207697_10017271
1440 Ga0207656_10016593
1441 Ga0207656_10036064
1442 Ga0207656_10132169
1443 Ga0207682_10000158
1444 Ga0207682_10002043
1445 Ga0207682_10006828
1446 Ga0207682_10024321
1447 Ga0207682_10103131
1448 Ga0207692_10044183
1449 Ga0207642_10002232
1450 Ga0207642_10011633
1451 Ga0207710_10016966
1452 Ga0207688_10010279
1453 Ga0207688_10025807
1454 Ga0207688_10135796
1455 Ga0207680_10013624
1456 Ga0207680_10028229
1457 Ga0207680_10073448
1458 Ga0207645_10005861
1459 Ga0207645_10010859
1460 Ga0207645_10012965
1461 Ga0207643_10000126
1462 Ga0207643_10032526
1463 Ga0207643_10150704
1464 Ga0207643_10170818
1465 Ga0207705_10057712
1466 Ga0207705_10209948
1467 Ga0207705_10291073
1468 Ga0207684_10034594
1469 Ga0207654_10031438
1470 Ga0207654_10242835
1471 Ga0207707_10025955
1472 Ga0207707_10070363
1473 Ga0207695_10182479
1474 Ga0207671_10010045
1475 Ga0207663_10115051
1476 Ga0207660_10111562
1477 Ga0207662_10002506
1478 Ga0207662_10022676
1479 Ga0207657_10020055
1480 Ga0207657_10029332
1481 Ga0207657_10093594
1482 Ga0207657_10522372
1483 Ga0207649_10014470
1484 Ga0207649_10213427
1485 Ga0207649_10534607
1486 Ga0207652_10020046
1487 Ga0207652_10075067
1488 Ga0207652_10921281
1489 Ga0207681_10000205
1490 Ga0207681_10018140
1491 Ga0207681_10022630
1492 Ga0207681_10063447
1493 Ga0207681_10468195
1494 Ga0207694_10072035
1495 Ga0207694_10085702
1496 Ga0207650_10000480
1497 Ga0207650_10003292
1498 Ga0207650_10021208
1499 Ga0207650_10091213
1500 Ga0207650_10167785
1501 Ga0207650_10228028
1502 Ga0207659_10000118
1503 Ga0207659_10001268
1504 Ga0207659_10003663
1505 Ga0207659_10015369
1506 Ga0207659_10027958
1507 Ga0207659_10047812
1508 Ga0207659_10059678
1509 Ga0207659_10136785
1510 Ga0207659_10298987
1511 Ga0207687_10121766
1512 Ga0207687_10250901
1513 Ga0207687_10335716
1514 Ga0207687_10413634
1515 Ga0207687_10850893
1516 Ga0207700_10066304
1517 Ga0207700_10070045
1518 Ga0207644_10003975
1519 Ga0207644_10019508
1520 Ga0207644_10104590
1521 Ga0207644_10133954
1522 Ga0207644_10168230
1523 Ga0207644_10297784
1524 Ga0207644_10457128
1525 Ga0207690_10028353
1526 Ga0207690_10241539
1527 Ga0207706_10000933
1528 Ga0207706_10019724
1529 Ga0207706_10025747
1530 Ga0207706_10036217
1531 Ga0207706_10169666
1532 Ga0207706_10321995
1533 Ga0207686_10217585
1534 Ga0207709_10013768
1535 Ga0207709_10198844
1536 Ga0207670_10167890
1537 Ga0207669_10000706
1538 Ga0207669_10007121
1539 Ga0207669_10050204
1540 Ga0207669_10084058
1541 Ga0207669_10103604
1542 Ga0207669_10203135
1543 Ga0207704_10001897
1544 Ga0207704_10003903
1545 Ga0207704_10192055
1546 Ga0207704_10240048
1547 Ga0207691_10000238
1548 Ga0207691_10008515
1549 Ga0207691_10027884
1550 Ga0207691_10038127
1551 Ga0207691_10047509
1552 Ga0207691_10062672
1553 Ga0207691_10083361
1554 Ga0207691_10097071
1555 Ga0207691_10132362
1556 Ga0207691_10158640
1557 Ga0207691_10291174
1558 Ga0207691_10345436
1559 Ga0207711_10031004
1560 Ga0207711_10031635
1561 Ga0207711_10035637
1562 Ga0207711_10054798
1563 Ga0207711_10083057
1564 Ga0207711_10105794
1565 Ga0207711_10228744
1566 Ga0207689_10000150
1567 Ga0207689_10006391
1568 Ga0207689_10012442
1569 Ga0207689_10019637
1570 Ga0207661_10018031
1571 Ga0207679_10022926
1572 Ga0207679_10099825
1573 Ga0207679_10283325
1574 Ga0207667_10148644
1575 Ga0207651_10001131
1576 Ga0207651_10018265
1577 Ga0207651_10043471
1578 Ga0207651_10078593
1579 Ga0207651_10134222
1580 Ga0207651_10180917
1581 Ga0207651_10333218
1582 Ga0207651_10669978
1583 Ga0207651_10715977
1584 Ga0207712_10052734
1585 Ga0207712_10070221
1586 Ga0207668_10028131
1587 Ga0207668_10033237
1588 Ga0207640_10031917
1589 Ga0207640_10042745
1590 Ga0207640_10061281
1591 Ga0207658_10014469
1592 Ga0207658_10065840
1593 Ga0207658_10073115
1594 Ga0207658_10239220
1595 Ga0207658_10651525
1596 Ga0207677_10005476
1597 Ga0207677_10009321
1598 Ga0207677_10132024
1599 Ga0207677_10137224
1600 Ga0207677_10141682
1601 Ga0207677_10305244
1602 Ga0207677_10464460
1603 Ga0207703_10002955
1604 Ga0207703_10008624
1605 Ga0207703_10016069
1606 Ga0207703_10030511
1607 Ga0207703_10297844
1608 Ga0207639_10245631
1609 Ga0207639_10584088
1610 Ga0207678_10000821
1611 Ga0207678_10002944
1612 Ga0207678_10028904
1613 Ga0207678_10071519
1614 Ga0207708_10022773
1615 Ga0207708_10429113
1616 Ga0207702_10002877
1617 Ga0207702_10021046
1618 Ga0207702_10024026
1619 Ga0207702_10228894
1620 Ga0207702_10564109
1621 Ga0207641_10003621
1622 Ga0207641_10016238
1623 Ga0207641_10025306
1624 Ga0207641_10042640
1625 Ga0207641_10047000
1626 Ga0207641_10055755
1627 Ga0207641_10097217
1628 Ga0207641_10813152
1629 Ga0207648_10000032
1630 Ga0207648_10003526
1631 Ga0207648_10005311
1632 Ga0207648_10029392
1633 Ga0207648_10042712
1634 Ga0207648_10044866
1635 Ga0207648_10185127
1636 Ga0207648_10364231
1637 Ga0207648_10974953
1638 Ga0207676_10012629
1639 Ga0207676_10019318
1640 Ga0207676_10020581
1641 Ga0207676_10020892
1642 Ga0207676_10020980
1643 Ga0207676_10034951
1644 Ga0207676_10058347
1645 Ga0207676_10096496
1646 Ga0207675_100001131
1647 Ga0207675_100040389
1648 Ga0207675_100099102
1649 Ga0207675_100840349
1650 Ga0207683_10000079
1651 Ga0207683_10000844
1652 Ga0207683_10013866
1653 Ga0207683_10044919
1654 Ga0207683_10045569
1655 Ga0207683_10112850
1656 Ga0207683_10160593
1657 Ga0207683_10168636
1658 Ga0207683_10336385
1659 Ga0207683_10403392
1660 Ga0207683_10433701
1661 Ga0207698_10005102
1662 Ga0207698_10011027
1663 Ga0207698_10016930
1664 Ga0207698_10017008
1665 Ga0207698_10017398
1666 Ga0207698_10041127
1667 Ga0207698_10063780
1668 Ga0207698_10428754
1669 Ga0207698_10825519
1670 Ga0209281_1000074
1671 Ga0209281_1015948
1672 Ga0207428_10493521
1673 Ga0268266_10018888
1674 Ga0268264_10004410
1675 Ga0268264_10056204
1676 Ga0268264_10143525
1677 Ga0265318_10063423
1678 Ga0265323_10003257
1679 Ga0265323_10010912
1680 Ga0265322_10000199
1681 Ga0265336_10000003
1682 Ga0307517_10000810
1683 Ga0307515_10000110
1684 Ga0307515_10015338
1685 Ga0307515_10117740
1686 Ga0307515_10278698
1687 Ga0265324_10000908
1688 Ga0307512_10004629
1689 Ga0265329_10017929
1690 Ga0265316_10000456
1691 Ga0265316_10026553
1692 Ga0307513_10000011
1693 Ga0307513_10001586
1694 Ga0307513_10126205
1695 Ga0307513_10158342
1696 Ga0307509_10000802
1697 Ga0307509_10003238
1698 Ga0307509_10012626
1699 Ga0307509_10022383
1700 Ga0307509_10023332
1701 Ga0307509_10030645
1702 Ga0307509_10178615
1703 Ga0307408_100022685
1704 Ga0307508_10002132
1705 Ga0307508_10033344
1706 Ga0307508_10409992
1707 Ga0307514_10018100
1708 Ga0265314_10047501
1709 Ga0265342_10007343
1710 Ga0307516_10001054
1711 Ga0307405_10005514
1712 Ga0307405_10007548
1713 Ga0307413_10004470
1714 Ga0307410_10041255
1715 Ga0307410_10268228
1716 Ga0307406_10007622
1717 Ga0307406_10048836
1718 Ga0307407_10020188
1719 Ga0307407_10129209
1720 Ga0307412_10015518
1721 Ga0307412_10490239
1722 Ga0307409_100118378
1723 Ga0307409_100234675
1724 Ga0307409_100392134
1725 Ga0307409_100832013
1726 Ga0307416_100054349
1727 Ga0307416_100069120
1728 Ga0307416_100585444
1729 Ga0307416_100723826
1730 Ga0307414_10019903
1731 Ga0307411_10001107
1732 Ga0307411_10155863
1733 Ga0307411_10878998
1734 Ga0307415_100010508
1735 Ga0307415_100112857
1736 Ga0307415_100279896
1737 Ga0307510_10009294
1738 Ga0307510_10009432
1739 Ga0307510_10122397
1740 Ga0373929_0011337
1741 Ga0373940_0027381
1742 Ga0373932_0038750
1743 Ga0373936_0207513
1744 Ga0373943_0206506
1745 Ga0373955_0135855
1746 Ga0373931_0004895
1747 Ga0373931_0014121
1748 Ga0373931_0018946
1749 Ga0373931_0104620
1750 Ga0373927_0282930
1751 Ga0373933_0046455
1752 Ga0373937_0058064
1753 Ga0373937_0177093
1754 Ga0373925_0111737
1755 Ga0373925_0431086
1756 Ga0395900_0243828
1757 Ga0395905_0000026
1758 Ga0395905_0055676
1759 Ga0395905_0248099
1760 Ga0395905_0307890
1761 Ga0395905_0568640
1762 Ga0395905_0748583
1763 Ga0395901_0132121
1764 Ga0436365_0361177
1765 Ga0439436_0000086
1766 Ga0439439_0008548
1767 Ga0439466_0005453
1768 Ga0439465_0000464
1769 Ga0451800_0010811
1770 Ga0451807_0017675
1771 Ga0451853_1666867
1772 Ga0439431_0007902
1773 Ga0439445_0000486
1774 Ga0439448_0012659
1775 Ga0439432_005058
1776 Ga0439432_018316
1777 Ga0439449_0000300
1778 Ga0439452_001494
1779 Ga0439457_020155
1780 Ga0439462_0001329
1781 Ga0439462_0002187
1782 Ga0450919_000456
1783 Ga0439446_0000332
1784 Ga0439458_0012656
1785 Ga0439459_0048958
1786 Ga0439464_0147910
1787 Ga0450918_002380
1788 Ga0453683_0004804
1789 Ga0466965_0027812
1790 Ga0453684_0007800
1791 Ga0453684_0151671
1792 Ga0466970_0081755
1793 Ga0466960_0015324
1794 Ga0466967_0022959
1795 Ga0466967_0068005
1796 Ga0466967_0463031
1797 Ga0495592_0000272
1798 Ga0495603_0370864
1799 Ga0495629_0141305
1800 Ga0495629_0204716
1801 Ga0495580_0380850
1802 Ga0495639_0072671
1803 Ga0495585_0240405
1804 Ga0495594_0172390
1805 Ga0495610_0101621
1806 Ga0495620_0085972
1807 Ga0495628_0342193
1808 Ga0495630_0240583
1809 Ga0495643_0028708
1810 Ga0495648_0092742
1811 Ga0495586_0212541
1812 Ga0495598_0091642
1813 Ga0495645_0352094
1814 Ga0495667_0206930
1815 Ga0495656_0003749
1816 Ga0495599_0246634
1817 Ga0495646_0061312
1818 Ga0495647_0188710
1819 Ga0495658_0060520
1820 Ga0495658_0094143
1821 Ga0495613_0153308
1822 Ga0495624_0409286
1823 Ga0495604_0375788
1824 Ga0495636_0132374
1825 Ga0495681_0166474
1826 Ga0495684_0406835
1827 Ga0495686_0003640
1828 Ga0495686_0083309
1829 Ga0495615_0030324
1830 Ga0496100_0002898
1831 Ga0496100_0128746
1832 Ga0496100_0378677
1833 Ga0496100_0542201
1834 Ga0496100_0640813
1835 Ga0496101_0002087
1836 Ga0496101_0011436
1837 Ga0496101_0022835
1838 Ga0496101_0344501
1839 Ga0496102_0001109
1840 Ga0496102_0010119
1841 Ga0496102_0048432
1842 Ga0496103_0011381
1843 Ga0496103_0140546
1844 Ga0496104_0005004
1845 Ga0496104_0022800
1846 Ga0496104_0182487
1847 Ga0496104_0297480
1848 Ga0496105_0020021
1849 Ga0496105_0035471
1850 Ga0496105_0079410
1851 Ga0496105_0519307
1852 Ga0496106_0009849
1853 Ga0496106_0009864
1854 Ga0496106_0021246
1855 Ga0496107_0002258
1856 Ga0496107_0021980
1857 Ga0496107_0600618
1858 Ga0496108_0009344
1859 Ga0496108_0026830
1860 Ga0496108_0058254
1861 Ga0496108_0180337
1862 Ga0496108_0298480
1863 Ga0496108_0459634
1864 Ga0496109_0111943
1865 Ga0496109_0113761
1866 Ga0496109_0182361
1867 Ga0496109_0226342
1868 Ga0496110_0001863
1869 Ga0496110_0063219
1870 Ga0496111_0010154
1871 Ga0496111_0083712
1872 Ga0496112_0043821
1873 Ga0496112_0663212
1874 Ga0496113_0059891
1875 Ga0496114_0001480
1876 Ga0496114_0002558
1877 Ga0496114_0003140
1878 Ga0496114_0029841
1879 Ga0496114_0080624
1880 Ga0496114_0622929
1881 Ga0496115_0028775
1882 Ga0496115_0339912
1883 Ga0501292_002626
1884 Ga0501297_015612
1885 Ga0501298_009377
1886 Ga0501301_000987
1887 Ga0501034_0250905
1888 Ga0501034_0595995
1889 Ga0501039_0260484
1890 Ga0501067_0002689
1891 Ga0501067_0185792
1892 Ga0501069_0015079
1893 Ga0501198_000004
1894 Ga0501206_008319
1895 Ga0501207_018567
1896 Ga0501222_000038
1897 Ga0501252_000809
1898 Ga0501257_009870
1899 Ga0501221_109755
1900 Ga0501265_001086
1901 nmdc:mga03683_193645_c1
1902 nmdc:mga0yw44_156079_c1
1903 nmdc:mga0yw44_206316_c1
1904 nmdc:mga07m45_352965_c1
1905 nmdc:mga05p37_1507_c1
1906 nmdc:mga05p37_343680_c1
1907 nmdc:mga08y16_593114_c1
1908 nmdc:mga0n895_3433_c1
1909 nmdc:mga0a205_65042_c1
1910 Ga0495612_0023758
1911 Ga0495619_0097206
1912 Ga0500644_0001734
1913 Ga0500644_0014473
1914 Ga0500583_0019283
1915 Ga0500651_0014926
1916 Ga0500566_0379699
1917 Ga0500593_004651
1918 Ga0500652_102749
1919 Ga0500559_0000022
1920 Ga0500559_0125696
1921 Ga0500564_041112
1922 Ga0500568_0012032
1923 Ga0500590_000246
1924 Ga0500622_0000498
1925 Ga0500645_000114
1926 Ga0500645_002232
1927 Ga0501084_0096638
1928 2511243286
1929 2643865843
1930 2644060466
1931 2644073788
1932 2644248278
1933 2885195931
1934 2894025595

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10590

PNP_phzG_C

Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

223

263

0.99

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

80

166

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9758 7 216
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.9588 18 216
6ylz-assembly1.cif.gz_AAA-2 x-ray structure of the k72i,y129f,r133l, h199a quadruple mutant of pnp-oxidase from e. coli 0.9586 18 216
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.9541 18 216
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9535 7 216
ID Description Score Start End Superfamily
af_Q9LTX3_323_519_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9842 15 204 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9759 15 166 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.97 18 216 2.30.110.10
1g78A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9651 18 216 2.30.110.10
af_Q54YS6_26_227_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9602 18 216 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7V2T6Z1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9907 8 179 GO:0004733
GO:0008615
GO:0010181
AF-A0A538P7C7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9893 7 216 GO:0004733
GO:0008615
GO:0010181
AF-A0A4Y9SP62-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9892 8 216 GO:0004733
GO:0008615
GO:0010181
AF-A0A836UTG3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9889 18 165 GO:0004733
GO:0008615
GO:0010181
AF-A0A519I4P0-F1-model_v4 deleted 0.988 45 216

Map