F487017
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 967 | 379 | 1934 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100281820|Ga0068871_1002818202 |
| Length | 263 |
| Sequence | MLMVRRRTGTKNGICNPFEIVVALPKAFPVHRLAQEACPGCLLILNFMDDIAQLRKSYERAELDEAASRRDPIEQFELWLSQALSGQLPEPNAMTLATVGSDGRPSTRIVLIKGVDARGVVWYTNYASRKGRELADKPFAALQFHWVELERVVRIEGTVEKVSEAESDAYFASRPLDSRIGAWASPQSEVISSRAVLVANVAKYSARFLSTMLTSGPPRPPHWGGYRLVPDRWEFWQGRPSRLHDRLRYRREGDAWVRERLAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 225 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 263 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 264 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 265 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 266 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 269 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 270 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 275 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 276 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 277 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 278 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 279 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 280 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 283 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 284 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 336 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 337 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 338 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 344 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 345 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 346 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 347 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 348 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 349 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 350 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 351 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 362 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 363 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 365 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 366 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 370 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 371 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 374 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 375 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 376 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 377 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 378 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 379 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.97 |
| Metatranscriptomes | 0.31 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9 |
| Nodule | 0.41 |
| Rhizoplane | 5.69 |
| Rhizosphere | 80.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068871_100281820 | 3300006358 | Bacteria | 1454 |
| 2 | JGI25155J39150_1000105 | 3300002704 | Bacteria | 44548 |
| 3 | JGI25156J39149_1000191 | 3300002705 | Bacteria | 44047 |
| 4 | JGI25154J39366_1000195 | 3300002738 | Bacteria | 44047 |
| 5 | JGI25157J39369_1000227 | 3300002741 | Bacteria | 44047 |
| 6 | JGI25159J45721_1001565 | 3300002987 | Bacteria | 9374 |
| 7 | JGI25151J46595_10015577 | 3300003187 | Bacteria | 3345 |
| 8 | JGI25151J46595_10017387 | 3300003187 | Bacteria | 3119 |
| 9 | rootH2_10069953 | 3300003320 | Bacteria | 5965 |
| 10 | Ga0055525_1000021 | 3300003759 | Bacteria | 370802 |
| 11 | Ga0055526_1006669 | 3300003771 | Bacteria | 6194 |
| 12 | Ga0055526_1018321 | 3300003771 | Bacteria | 2618 |
| 13 | Ga0055526_1028759 | 3300003771 | Bacteria | 1671 |
| 14 | Ga0055537_1000257 | 3300003773 | Bacteria | 38816 |
| 15 | Ga0055537_1024980 | 3300003773 | Bacteria | 832 |
| 16 | Ga0055524_1000077 | 3300003775 | Bacteria | 121584 |
| 17 | Ga0055524_1000253 | 3300003775 | Bacteria | 55038 |
| 18 | Ga0055536_1000408 | 3300003781 | Bacteria | 31161 |
| 19 | Ga0055534_1000619 | 3300003784 | Bacteria | 18299 |
| 20 | Ga0055528_1001926 | 3300003790 | Bacteria | 11790 |
| 21 | Ga0055530_10000354 | 3300003791 | Bacteria | 41444 |
| 22 | Ga0055530_10004807 | 3300003791 | Bacteria | 6769 |
| 23 | Ga0055540_1000010 | 3300003792 | Bacteria | 290865 |
| 24 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 25 | Ga0055540_1023256 | 3300003792 | Bacteria | 1564 |
| 26 | Ga0055540_1040480 | 3300003792 | Bacteria | 1009 |
| 27 | Ga0055531_10000298 | 3300003794 | Bacteria | 49437 |
| 28 | Ga0055531_10000405 | 3300003794 | Bacteria | 41493 |
| 29 | Ga0055531_10000992 | 3300003794 | Bacteria | 22548 |
| 30 | Ga0055531_10038475 | 3300003794 | Bacteria | 1435 |
| 31 | Ga0065165_1009925 | 3300005262 | Bacteria | 4192 |
| 32 | Ga0065165_1012628 | 3300005262 | Bacteria | 3423 |
| 33 | Ga0065165_1043885 | 3300005262 | Bacteria | 1310 |
| 34 | Ga0070658_10024955 | 3300005327 | Bacteria | 4793 |
| 35 | Ga0070658_10250138 | 3300005327 | Bacteria | 1504 |
| 36 | Ga0070676_10003203 | 3300005328 | Bacteria | 8487 |
| 37 | Ga0070676_10071698 | 3300005328 | Bacteria | 2081 |
| 38 | Ga0070683_100115298 | 3300005329 | Bacteria | 2536 |
| 39 | Ga0070690_100030145 | 3300005330 | Bacteria | 3369 |
| 40 | Ga0070670_100003584 | 3300005331 | Bacteria | 12922 |
| 41 | Ga0070670_100031412 | 3300005331 | Bacteria | 4573 |
| 42 | Ga0070670_100051303 | 3300005331 | Bacteria | 3543 |
| 43 | Ga0070670_100052640 | 3300005331 | Bacteria | 3496 |
| 44 | Ga0070670_100063526 | 3300005331 | Bacteria | 3169 |
| 45 | Ga0070670_100075224 | 3300005331 | Bacteria | 2901 |
| 46 | Ga0070670_100130651 | 3300005331 | Bacteria | 2169 |
| 47 | Ga0070670_100149786 | 3300005331 | Bacteria | 2019 |
| 48 | Ga0070670_100328245 | 3300005331 | Bacteria | 1341 |
| 49 | Ga0070670_100351182 | 3300005331 | Bacteria | 1295 |
| 50 | Ga0070677_10004214 | 3300005333 | Bacteria | 4683 |
| 51 | Ga0070677_10006294 | 3300005333 | Bacteria | 3938 |
| 52 | Ga0070677_10006352 | 3300005333 | Bacteria | 3923 |
| 53 | Ga0070677_10016635 | 3300005333 | Bacteria | 2621 |
| 54 | Ga0070677_10022883 | 3300005333 | Bacteria | 2307 |
| 55 | Ga0070677_10046686 | 3300005333 | Bacteria | 1733 |
| 56 | Ga0070677_10053980 | 3300005333 | Bacteria | 1635 |
| 57 | Ga0068869_100000464 | 3300005334 | Bacteria | 22438 |
| 58 | Ga0068869_100017548 | 3300005334 | Bacteria | 4853 |
| 59 | Ga0068869_100042984 | 3300005334 | Bacteria | 3243 |
| 60 | Ga0068869_100070609 | 3300005334 | Bacteria | 2584 |
| 61 | Ga0068869_100201233 | 3300005334 | Bacteria | 1570 |
| 62 | Ga0070666_10008685 | 3300005335 | Bacteria | 6318 |
| 63 | Ga0070666_10085206 | 3300005335 | Bacteria | 2164 |
| 64 | Ga0070666_10104502 | 3300005335 | Bacteria | 1955 |
| 65 | Ga0070680_100020509 | 3300005336 | Bacteria | 5245 |
| 66 | Ga0070682_100005154 | 3300005337 | Bacteria | 7261 |
| 67 | Ga0070682_100053329 | 3300005337 | Bacteria | 2534 |
| 68 | Ga0068868_100001157 | 3300005338 | Bacteria | 18078 |
| 69 | Ga0068868_100003589 | 3300005338 | Bacteria | 10810 |
| 70 | Ga0068868_100018257 | 3300005338 | Bacteria | 5240 |
| 71 | Ga0068868_100038490 | 3300005338 | Bacteria | 3712 |
| 72 | Ga0068868_100040850 | 3300005338 | Bacteria | 3612 |
| 73 | Ga0068868_100070593 | 3300005338 | Bacteria | 2785 |
| 74 | Ga0068868_100105169 | 3300005338 | Bacteria | 2288 |
| 75 | Ga0070660_100083499 | 3300005339 | Bacteria | 2509 |
| 76 | Ga0070660_100465622 | 3300005339 | Bacteria | 1050 |
| 77 | Ga0070660_100541561 | 3300005339 | Bacteria | 971 |
| 78 | Ga0070689_100019366 | 3300005340 | Bacteria | 5033 |
| 79 | Ga0070689_100157142 | 3300005340 | Bacteria | 1836 |
| 80 | Ga0070689_100218497 | 3300005340 | Bacteria | 1562 |
| 81 | Ga0070691_10002512 | 3300005341 | Bacteria | 8162 |
| 82 | Ga0070687_100001572 | 3300005343 | Bacteria | 8114 |
| 83 | Ga0070687_100040473 | 3300005343 | Bacteria | 2348 |
| 84 | Ga0070661_100204767 | 3300005344 | Bacteria | 1509 |
| 85 | Ga0070692_10009917 | 3300005345 | Bacteria | 4314 |
| 86 | Ga0070692_10206857 | 3300005345 | Bacteria | 1153 |
| 87 | Ga0070668_100019369 | 3300005347 | Bacteria | 5122 |
| 88 | Ga0070668_100035665 | 3300005347 | Bacteria | 3794 |
| 89 | Ga0070668_100152762 | 3300005347 | Bacteria | 1868 |
| 90 | Ga0070668_100159003 | 3300005347 | Bacteria | 1832 |
| 91 | Ga0070669_100001896 | 3300005353 | Bacteria | 15091 |
| 92 | Ga0070669_100002377 | 3300005353 | Bacteria | 13608 |
| 93 | Ga0070669_100028374 | 3300005353 | Bacteria | 4031 |
| 94 | Ga0070669_100099987 | 3300005353 | Bacteria | 2186 |
| 95 | Ga0070669_100619360 | 3300005353 | Bacteria | 908 |
| 96 | Ga0070675_100001801 | 3300005354 | Bacteria | 15832 |
| 97 | Ga0070675_100001993 | 3300005354 | Bacteria | 15148 |
| 98 | Ga0070675_100022306 | 3300005354 | Bacteria | 5058 |
| 99 | Ga0070675_100026137 | 3300005354 | Bacteria | 4683 |
| 100 | Ga0070675_100029917 | 3300005354 | Bacteria | 4394 |
| 101 | Ga0070675_100072042 | 3300005354 | Bacteria | 2868 |
| 102 | Ga0070675_100084496 | 3300005354 | Bacteria | 2651 |
| 103 | Ga0070675_100179384 | 3300005354 | Bacteria | 1830 |
| 104 | Ga0070675_100347154 | 3300005354 | Bacteria | 1315 |
| 105 | Ga0070671_100006533 | 3300005355 | Bacteria | 9322 |
| 106 | Ga0070671_100020918 | 3300005355 | Bacteria | 5338 |
| 107 | Ga0070671_100045128 | 3300005355 | Bacteria | 3663 |
| 108 | Ga0070671_100055230 | 3300005355 | Bacteria | 3304 |
| 109 | Ga0070671_100071832 | 3300005355 | Bacteria | 2889 |
| 110 | Ga0070671_100155508 | 3300005355 | Bacteria | 1932 |
| 111 | Ga0070671_100455788 | 3300005355 | Bacteria | 1097 |
| 112 | Ga0070674_100001004 | 3300005356 | Bacteria | 14721 |
| 113 | Ga0070674_100028169 | 3300005356 | Bacteria | 3688 |
| 114 | Ga0070674_100035179 | 3300005356 | Bacteria | 3352 |
| 115 | Ga0070674_100462154 | 3300005356 | Bacteria | 1050 |
| 116 | Ga0070673_100002809 | 3300005364 | Bacteria | 10708 |
| 117 | Ga0070673_100003898 | 3300005364 | Bacteria | 9374 |
| 118 | Ga0070673_100037898 | 3300005364 | Bacteria | 3677 |
| 119 | Ga0070673_100078466 | 3300005364 | Bacteria | 2671 |
| 120 | Ga0070673_100126960 | 3300005364 | Bacteria | 2135 |
| 121 | Ga0070673_100127201 | 3300005364 | Bacteria | 2133 |
| 122 | Ga0070673_100142252 | 3300005364 | Bacteria | 2025 |
| 123 | Ga0070673_100163489 | 3300005364 | Bacteria | 1895 |
| 124 | Ga0070673_100332099 | 3300005364 | Bacteria | 1345 |
| 125 | Ga0070673_100408969 | 3300005364 | Bacteria | 1215 |
| 126 | Ga0070673_100823069 | 3300005364 | Bacteria | 858 |
| 127 | Ga0070659_100017714 | 3300005366 | Bacteria | 5365 |
| 128 | Ga0070659_100087482 | 3300005366 | Bacteria | 2494 |
| 129 | Ga0070667_100006750 | 3300005367 | Bacteria | 9531 |
| 130 | Ga0070667_100022158 | 3300005367 | Bacteria | 5271 |
| 131 | Ga0070667_100132813 | 3300005367 | Bacteria | 2174 |
| 132 | Ga0070709_10044004 | 3300005434 | Bacteria | 2763 |
| 133 | Ga0070714_100049718 | 3300005435 | Bacteria | 3569 |
| 134 | Ga0070713_100121718 | 3300005436 | Bacteria | 2290 |
| 135 | Ga0070710_10083778 | 3300005437 | Bacteria | 1867 |
| 136 | Ga0070701_10037308 | 3300005438 | Bacteria | 2453 |
| 137 | Ga0070701_10089688 | 3300005438 | Bacteria | 1682 |
| 138 | Ga0070701_10139535 | 3300005438 | Bacteria | 1385 |
| 139 | Ga0070711_100129900 | 3300005439 | Bacteria | 1875 |
| 140 | Ga0070700_100498752 | 3300005441 | Bacteria | 936 |
| 141 | Ga0070708_100336081 | 3300005445 | Bacteria | 1423 |
| 142 | Ga0070663_100011135 | 3300005455 | Bacteria | 5632 |
| 143 | Ga0070663_100034752 | 3300005455 | Bacteria | 3492 |
| 144 | Ga0070663_100097140 | 3300005455 | Bacteria | 2193 |
| 145 | Ga0070663_100462505 | 3300005455 | Bacteria | 1048 |
| 146 | Ga0070663_100550638 | 3300005455 | Bacteria | 964 |
| 147 | Ga0070678_100005974 | 3300005456 | Bacteria | 7092 |
| 148 | Ga0070678_100007713 | 3300005456 | Bacteria | 6400 |
| 149 | Ga0070678_100018295 | 3300005456 | Bacteria | 4540 |
| 150 | Ga0070678_100023041 | 3300005456 | Bacteria | 4141 |
| 151 | Ga0070678_100133529 | 3300005456 | Bacteria | 1976 |
| 152 | Ga0070678_100227568 | 3300005456 | Bacteria | 1553 |
| 153 | Ga0070678_100270260 | 3300005456 | Bacteria | 1433 |
| 154 | Ga0070678_100347630 | 3300005456 | Bacteria | 1274 |
| 155 | Ga0070678_100361807 | 3300005456 | Bacteria | 1250 |
| 156 | Ga0070678_100498097 | 3300005456 | Bacteria | 1074 |
| 157 | Ga0070662_100000867 | 3300005457 | Bacteria | 18517 |
| 158 | Ga0070662_100027044 | 3300005457 | Bacteria | 3979 |
| 159 | Ga0070662_100052602 | 3300005457 | Bacteria | 2945 |
| 160 | Ga0070681_10004529 | 3300005458 | Bacteria | 13263 |
| 161 | Ga0070681_10060748 | 3300005458 | Bacteria | 3755 |
| 162 | Ga0068867_100000005 | 3300005459 | Bacteria | 174097 |
| 163 | Ga0068867_100008508 | 3300005459 | Bacteria | 7244 |
| 164 | Ga0068867_100011686 | 3300005459 | Bacteria | 6200 |
| 165 | Ga0068867_100031401 | 3300005459 | Bacteria | 3834 |
| 166 | Ga0068867_100035530 | 3300005459 | Bacteria | 3615 |
| 167 | Ga0068867_100066669 | 3300005459 | Bacteria | 2682 |
| 168 | Ga0068867_100106939 | 3300005459 | Bacteria | 2144 |
| 169 | Ga0068867_100157010 | 3300005459 | Bacteria | 1791 |
| 170 | Ga0068867_100311171 | 3300005459 | Bacteria | 1302 |
| 171 | Ga0070706_100029862 | 3300005467 | Bacteria | 5021 |
| 172 | Ga0070706_100671812 | 3300005467 | Bacteria | 961 |
| 173 | Ga0070698_100071963 | 3300005471 | Bacteria | 3466 |
| 174 | Ga0070679_100014568 | 3300005530 | Bacteria | 7555 |
| 175 | Ga0070679_100076037 | 3300005530 | Bacteria | 3347 |
| 176 | Ga0070684_100058255 | 3300005535 | Bacteria | 3375 |
| 177 | Ga0068853_100002880 | 3300005539 | Bacteria | 13055 |
| 178 | Ga0068853_100150830 | 3300005539 | Bacteria | 2092 |
| 179 | Ga0068853_100151378 | 3300005539 | Bacteria | 2089 |
| 180 | Ga0068853_100281758 | 3300005539 | Bacteria | 1532 |
| 181 | Ga0068853_100684319 | 3300005539 | Bacteria | 978 |
| 182 | Ga0070672_100000535 | 3300005543 | Bacteria | 22337 |
| 183 | Ga0070672_100002739 | 3300005543 | Bacteria | 11283 |
| 184 | Ga0070672_100015927 | 3300005543 | Bacteria | 5370 |
| 185 | Ga0070672_100057199 | 3300005543 | Bacteria | 3061 |
| 186 | Ga0070672_100059868 | 3300005543 | Bacteria | 2997 |
| 187 | Ga0070672_100180219 | 3300005543 | Bacteria | 1760 |
| 188 | Ga0070672_100294564 | 3300005543 | Bacteria | 1374 |
| 189 | Ga0070672_100295381 | 3300005543 | Bacteria | 1372 |
| 190 | Ga0070672_100306273 | 3300005543 | Bacteria | 1348 |
| 191 | Ga0070686_100231040 | 3300005544 | Bacteria | 1342 |
| 192 | Ga0070686_100371529 | 3300005544 | Bacteria | 1080 |
| 193 | Ga0070696_100201015 | 3300005546 | Bacteria | 1488 |
| 194 | Ga0070693_100008393 | 3300005547 | Bacteria | 5090 |
| 195 | Ga0070693_100019340 | 3300005547 | Bacteria | 3567 |
| 196 | Ga0070693_100022140 | 3300005547 | Bacteria | 3374 |
| 197 | Ga0070665_100143768 | 3300005548 | Bacteria | 2388 |
| 198 | Ga0070665_100231023 | 3300005548 | Bacteria | 1850 |
| 199 | Ga0070665_100514414 | 3300005548 | Bacteria | 1209 |
| 200 | Ga0068855_100058435 | 3300005563 | Bacteria | 4516 |
| 201 | Ga0068855_100165685 | 3300005563 | Bacteria | 2506 |
| 202 | Ga0070664_100081262 | 3300005564 | Bacteria | 2793 |
| 203 | Ga0070664_100082504 | 3300005564 | Bacteria | 2772 |
| 204 | Ga0070664_100444364 | 3300005564 | Bacteria | 1190 |
| 205 | Ga0070664_100785973 | 3300005564 | Bacteria | 889 |
| 206 | Ga0068854_100017820 | 3300005578 | Bacteria | 4760 |
| 207 | Ga0068854_100022161 | 3300005578 | Bacteria | 4322 |
| 208 | Ga0068854_100028660 | 3300005578 | Bacteria | 3850 |
| 209 | Ga0068854_100048963 | 3300005578 | Bacteria | 3017 |
| 210 | Ga0068854_100092539 | 3300005578 | Bacteria | 2252 |
| 211 | Ga0068854_100216016 | 3300005578 | Bacteria | 1515 |
| 212 | Ga0068856_100004035 | 3300005614 | Bacteria | 14702 |
| 213 | Ga0068856_100018011 | 3300005614 | Bacteria | 6848 |
| 214 | Ga0070702_100001510 | 3300005615 | Bacteria | 9568 |
| 215 | Ga0070702_100008822 | 3300005615 | Bacteria | 4902 |
| 216 | Ga0070702_100019205 | 3300005615 | Bacteria | 3559 |
| 217 | Ga0070702_100419295 | 3300005615 | Bacteria | 963 |
| 218 | Ga0068852_100004252 | 3300005616 | Bacteria | 10110 |
| 219 | Ga0068852_100007302 | 3300005616 | Bacteria | 8058 |
| 220 | Ga0068852_100055967 | 3300005616 | Bacteria | 3406 |
| 221 | Ga0068852_100093632 | 3300005616 | Bacteria | 2694 |
| 222 | Ga0068852_100158420 | 3300005616 | Bacteria | 2111 |
| 223 | Ga0068852_100268585 | 3300005616 | Bacteria | 1640 |
| 224 | Ga0068852_100269628 | 3300005616 | Bacteria | 1637 |
| 225 | Ga0068852_100782185 | 3300005616 | Bacteria | 968 |
| 226 | Ga0068859_100022772 | 3300005617 | Bacteria | 6282 |
| 227 | Ga0068859_100035116 | 3300005617 | Bacteria | 5030 |
| 228 | Ga0068859_100058573 | 3300005617 | Bacteria | 3880 |
| 229 | Ga0068859_100134057 | 3300005617 | Bacteria | 2549 |
| 230 | Ga0068859_100183798 | 3300005617 | Bacteria | 2174 |
| 231 | Ga0068864_100000875 | 3300005618 | Bacteria | 25325 |
| 232 | Ga0068864_100008330 | 3300005618 | Bacteria | 8554 |
| 233 | Ga0068864_100011769 | 3300005618 | Bacteria | 7227 |
| 234 | Ga0068864_100043505 | 3300005618 | Bacteria | 3845 |
| 235 | Ga0068864_100045627 | 3300005618 | Bacteria | 3759 |
| 236 | Ga0068864_100104006 | 3300005618 | Bacteria | 2522 |
| 237 | Ga0068864_100189128 | 3300005618 | Bacteria | 1886 |
| 238 | Ga0068864_100239029 | 3300005618 | Bacteria | 1682 |
| 239 | Ga0068864_100472275 | 3300005618 | Bacteria | 1203 |
| 240 | Ga0068866_10003567 | 3300005718 | Bacteria | 6373 |
| 241 | Ga0068866_10006470 | 3300005718 | Bacteria | 4880 |
| 242 | Ga0068861_100003855 | 3300005719 | Bacteria | 10017 |
| 243 | Ga0068861_100015935 | 3300005719 | Bacteria | 5306 |
| 244 | Ga0068861_100026650 | 3300005719 | Bacteria | 4204 |
| 245 | Ga0068861_100244541 | 3300005719 | Bacteria | 1528 |
| 246 | Ga0068851_10025409 | 3300005834 | Bacteria | 2905 |
| 247 | Ga0068851_10048558 | 3300005834 | Bacteria | 2151 |
| 248 | Ga0068851_10434473 | 3300005834 | Bacteria | 777 |
| 249 | Ga0068870_10007303 | 3300005840 | Bacteria | 4924 |
| 250 | Ga0068870_10196682 | 3300005840 | Bacteria | 1220 |
| 251 | Ga0068870_10219049 | 3300005840 | Bacteria | 1164 |
| 252 | Ga0068863_100002558 | 3300005841 | Bacteria | 18059 |
| 253 | Ga0068863_100010010 | 3300005841 | Bacteria | 9229 |
| 254 | Ga0068863_100010659 | 3300005841 | Bacteria | 8922 |
| 255 | Ga0068863_100035145 | 3300005841 | Bacteria | 4774 |
| 256 | Ga0068863_100051014 | 3300005841 | Bacteria | 3922 |
| 257 | Ga0068863_100081499 | 3300005841 | Bacteria | 3065 |
| 258 | Ga0068863_100085929 | 3300005841 | Bacteria | 2980 |
| 259 | Ga0068863_100096825 | 3300005841 | Bacteria | 2802 |
| 260 | Ga0068863_100152978 | 3300005841 | Bacteria | 2208 |
| 261 | Ga0068863_100429801 | 3300005841 | Bacteria | 1294 |
| 262 | Ga0068858_100000703 | 3300005842 | Bacteria | 34923 |
| 263 | Ga0068858_100013992 | 3300005842 | Bacteria | 7571 |
| 264 | Ga0068858_100032986 | 3300005842 | Bacteria | 4809 |
| 265 | Ga0068858_100107651 | 3300005842 | Bacteria | 2602 |
| 266 | Ga0068858_100279942 | 3300005842 | Bacteria | 1588 |
| 267 | Ga0068858_100568689 | 3300005842 | Bacteria | 1098 |
| 268 | Ga0068860_100003734 | 3300005843 | Bacteria | 15664 |
| 269 | Ga0068860_100033660 | 3300005843 | Bacteria | 4916 |
| 270 | Ga0068860_100043222 | 3300005843 | Bacteria | 4300 |
| 271 | Ga0068860_100092901 | 3300005843 | Bacteria | 2875 |
| 272 | Ga0068860_100187154 | 3300005843 | Bacteria | 2002 |
| 273 | Ga0068860_100228313 | 3300005843 | Bacteria | 1809 |
| 274 | Ga0068862_100084701 | 3300005844 | Bacteria | 2754 |
| 275 | Ga0068862_100917475 | 3300005844 | Bacteria | 862 |
| 276 | Ga0075365_10016275 | 3300006038 | Bacteria | 4520 |
| 277 | Ga0075365_10321986 | 3300006038 | Bacteria | 1089 |
| 278 | Ga0075432_10005363 | 3300006058 | Bacteria | 4370 |
| 279 | Ga0075432_10042669 | 3300006058 | Bacteria | 1587 |
| 280 | Ga0070715_10034025 | 3300006163 | Bacteria | 2086 |
| 281 | Ga0070715_10385188 | 3300006163 | Bacteria | 775 |
| 282 | Ga0070716_100224101 | 3300006173 | Bacteria | 1265 |
| 283 | Ga0070712_100152684 | 3300006175 | Bacteria | 1775 |
| 284 | Ga0075367_10086708 | 3300006178 | Bacteria | 1900 |
| 285 | Ga0097621_100001230 | 3300006237 | Bacteria | 17739 |
| 286 | Ga0097621_100006734 | 3300006237 | Bacteria | 8163 |
| 287 | Ga0097621_100011335 | 3300006237 | Bacteria | 6558 |
| 288 | Ga0097621_100063536 | 3300006237 | Bacteria | 3034 |
| 289 | Ga0097621_100141688 | 3300006237 | Bacteria | 2055 |
| 290 | Ga0097621_100191600 | 3300006237 | Bacteria | 1771 |
| 291 | Ga0075370_10066213 | 3300006353 | Bacteria | 2061 |
| 292 | Ga0075370_10252413 | 3300006353 | Bacteria | 1045 |
| 293 | Ga0075370_10367260 | 3300006353 | Bacteria | 861 |
| 294 | Ga0068871_100012983 | 3300006358 | Bacteria | 6169 |
| 295 | Ga0068871_100017138 | 3300006358 | Bacteria | 5475 |
| 296 | Ga0068871_100069683 | 3300006358 | Bacteria | 2889 |
| 297 | Ga0068871_100098522 | 3300006358 | Bacteria | 2446 |
| 298 | Ga0068871_100427472 | 3300006358 | Bacteria | 1184 |
| 299 | Ga0075431_100193574 | 3300006847 | Bacteria | 2083 |
| 300 | Ga0075433_10016370 | 3300006852 | Bacteria | 6109 |
| 301 | Ga0075434_100005990 | 3300006871 | Bacteria | 11127 |
| 302 | Ga0075434_100485172 | 3300006871 | Bacteria | 1257 |
| 303 | Ga0068865_100001470 | 3300006881 | Bacteria | 13711 |
| 304 | Ga0068865_100007997 | 3300006881 | Bacteria | 6529 |
| 305 | Ga0068865_100730434 | 3300006881 | Bacteria | 849 |
| 306 | Ga0075436_100033151 | 3300006914 | Bacteria | 3559 |
| 307 | Ga0097620_100022772 | 3300006931 | Bacteria | 6282 |
| 308 | Ga0097620_100035114 | 3300006931 | Bacteria | 5030 |
| 309 | Ga0097620_100058574 | 3300006931 | Bacteria | 3880 |
| 310 | Ga0097620_100134048 | 3300006931 | Bacteria | 2549 |
| 311 | Ga0097620_100183805 | 3300006931 | Bacteria | 2174 |
| 312 | Ga0079104_1000040 | 3300006946 | Bacteria | 187962 |
| 313 | Ga0075435_100003754 | 3300007076 | Bacteria | 10346 |
| 314 | Ga0105240_10145647 | 3300009093 | Bacteria | 2827 |
| 315 | Ga0105240_10216771 | 3300009093 | Bacteria | 2233 |
| 316 | Ga0105245_10059383 | 3300009098 | Bacteria | 3444 |
| 317 | Ga0105245_10065787 | 3300009098 | Bacteria | 3279 |
| 318 | Ga0105245_10135159 | 3300009098 | Bacteria | 2317 |
| 319 | Ga0105245_10329311 | 3300009098 | Bacteria | 1507 |
| 320 | Ga0105247_10006783 | 3300009101 | Bacteria | 7061 |
| 321 | Ga0105247_10628123 | 3300009101 | Bacteria | 800 |
| 322 | Ga0114129_10000114 | 3300009147 | Bacteria | 80730 |
| 323 | Ga0114129_10175873 | 3300009147 | Bacteria | 2915 |
| 324 | Ga0114129_10210660 | 3300009147 | Bacteria | 2627 |
| 325 | Ga0114129_10568288 | 3300009147 | Bacteria | 1473 |
| 326 | Ga0114129_11046435 | 3300009147 | Bacteria | 1025 |
| 327 | Ga0114129_11060650 | 3300009147 | Bacteria | 1017 |
| 328 | Ga0105243_10014299 | 3300009148 | Bacteria | 6006 |
| 329 | Ga0105243_10058093 | 3300009148 | Bacteria | 3082 |
| 330 | Ga0105243_10078734 | 3300009148 | Bacteria | 2685 |
| 331 | Ga0105243_10118359 | 3300009148 | Bacteria | 2229 |
| 332 | Ga0105241_10007301 | 3300009174 | Bacteria | 8131 |
| 333 | Ga0105241_10024754 | 3300009174 | Bacteria | 4459 |
| 334 | Ga0105241_10175746 | 3300009174 | Bacteria | 1772 |
| 335 | Ga0105241_10443225 | 3300009174 | Bacteria | 1147 |
| 336 | Ga0105242_10014074 | 3300009176 | Bacteria | 6191 |
| 337 | Ga0105242_10276195 | 3300009176 | Unclassified | 1524 |
| 338 | Ga0105242_10740995 | 3300009176 | Bacteria | 966 |
| 339 | Ga0105248_10016659 | 3300009177 | Bacteria | 8090 |
| 340 | Ga0105248_10026400 | 3300009177 | Bacteria | 6460 |
| 341 | Ga0105248_10037374 | 3300009177 | Bacteria | 5433 |
| 342 | Ga0105248_10050259 | 3300009177 | Bacteria | 4675 |
| 343 | Ga0105248_10152200 | 3300009177 | Bacteria | 2610 |
| 344 | Ga0105248_10465756 | 3300009177 | Bacteria | 1425 |
| 345 | Ga0105237_10001971 | 3300009545 | Bacteria | 26114 |
| 346 | Ga0105237_10184040 | 3300009545 | Bacteria | 2089 |
| 347 | Ga0105238_10022974 | 3300009551 | Bacteria | 6358 |
| 348 | Ga0105238_10026817 | 3300009551 | Bacteria | 5873 |
| 349 | Ga0105238_10085150 | 3300009551 | Bacteria | 3150 |
| 350 | Ga0105249_10101261 | 3300009553 | Bacteria | 2709 |
| 351 | Ga0105249_10197204 | 3300009553 | Bacteria | 1968 |
| 352 | Ga0105249_10254939 | 3300009553 | Bacteria | 1741 |
| 353 | Ga0105239_10000531 | 3300010375 | Bacteria | 55121 |
| 354 | Ga0105246_10007831 | 3300011119 | Bacteria | 6554 |
| 355 | Ga0157316_1004889 | 3300012510 | Bacteria | 1037 |
| 356 | Ga0157373_10041996 | 3300013100 | Bacteria | 3270 |
| 357 | Ga0157373_10063675 | 3300013100 | Bacteria | 2611 |
| 358 | Ga0157371_10049369 | 3300013102 | Bacteria | 2989 |
| 359 | Ga0157370_10028511 | 3300013104 | Bacteria | 5490 |
| 360 | Ga0157370_10503974 | 3300013104 | Bacteria | 1111 |
| 361 | Ga0157369_10027535 | 3300013105 | Bacteria | 6299 |
| 362 | Ga0157369_10418734 | 3300013105 | Bacteria | 1389 |
| 363 | Ga0157374_10035458 | 3300013296 | Bacteria | 4564 |
| 364 | Ga0157374_10071381 | 3300013296 | Bacteria | 3274 |
| 365 | Ga0157374_10117491 | 3300013296 | Bacteria | 2563 |
| 366 | Ga0157374_10376948 | 3300013296 | Bacteria | 1413 |
| 367 | Ga0157374_10639801 | 3300013296 | Bacteria | 1075 |
| 368 | Ga0157374_10810223 | 3300013296 | Bacteria | 952 |
| 369 | Ga0157378_10038089 | 3300013297 | Bacteria | 4260 |
| 370 | Ga0157378_10825634 | 3300013297 | Bacteria | 954 |
| 371 | Ga0163162_10016188 | 3300013306 | Bacteria | 7293 |
| 372 | Ga0163162_10069089 | 3300013306 | Bacteria | 3585 |
| 373 | Ga0163162_10086356 | 3300013306 | Bacteria | 3215 |
| 374 | Ga0163162_10204736 | 3300013306 | Bacteria | 2102 |
| 375 | Ga0163162_10228300 | 3300013306 | Bacteria | 1992 |
| 376 | Ga0163162_10820953 | 3300013306 | Bacteria | 1046 |
| 377 | Ga0163162_11451725 | 3300013306 | Bacteria | 781 |
| 378 | Ga0157372_10028330 | 3300013307 | Bacteria | 6112 |
| 379 | Ga0157372_10100758 | 3300013307 | Bacteria | 3296 |
| 380 | Ga0157372_10187981 | 3300013307 | Bacteria | 2392 |
| 381 | Ga0157372_10282825 | 3300013307 | Bacteria | 1929 |
| 382 | Ga0157375_10005937 | 3300013308 | Bacteria | 10642 |
| 383 | Ga0157375_10039133 | 3300013308 | Bacteria | 4561 |
| 384 | Ga0157375_10094763 | 3300013308 | Bacteria | 3055 |
| 385 | Ga0157375_10096018 | 3300013308 | Bacteria | 3036 |
| 386 | Ga0157375_10220688 | 3300013308 | Bacteria | 2054 |
| 387 | Ga0157375_10265562 | 3300013308 | Bacteria | 1878 |
| 388 | Ga0157375_10427534 | 3300013308 | Bacteria | 1490 |
| 389 | Ga0157375_10432144 | 3300013308 | Bacteria | 1482 |
| 390 | Ga0157375_10675732 | 3300013308 | Bacteria | 1187 |
| 391 | Ga0157375_10734819 | 3300013308 | Bacteria | 1139 |
| 392 | Ga0163163_10005258 | 3300014325 | Bacteria | 11165 |
| 393 | Ga0163163_10090065 | 3300014325 | Bacteria | 3081 |
| 394 | Ga0163163_10503704 | 3300014325 | Bacteria | 1273 |
| 395 | Ga0163163_10542633 | 3300014325 | Bacteria | 1225 |
| 396 | Ga0157380_10004961 | 3300014326 | Bacteria | 9272 |
| 397 | Ga0157380_10010895 | 3300014326 | Bacteria | 6555 |
| 398 | Ga0157380_10079110 | 3300014326 | Bacteria | 2684 |
| 399 | Ga0157380_10099648 | 3300014326 | Bacteria | 2417 |
| 400 | Ga0157380_10117345 | 3300014326 | Bacteria | 2248 |
| 401 | Ga0157380_10775725 | 3300014326 | Bacteria | 973 |
| 402 | Ga0157380_10905994 | 3300014326 | Bacteria | 908 |
| 403 | Ga0157377_10000022 | 3300014745 | Bacteria | 146702 |
| 404 | Ga0157377_10001663 | 3300014745 | Bacteria | 9688 |
| 405 | Ga0157377_10002890 | 3300014745 | Bacteria | 7677 |
| 406 | Ga0157377_10210438 | 3300014745 | Bacteria | 1240 |
| 407 | Ga0157379_10010626 | 3300014968 | Bacteria | 8024 |
| 408 | Ga0157379_10010802 | 3300014968 | Bacteria | 7961 |
| 409 | Ga0157379_10022405 | 3300014968 | Bacteria | 5596 |
| 410 | Ga0157379_10027535 | 3300014968 | Bacteria | 5061 |
| 411 | Ga0157379_10044121 | 3300014968 | Bacteria | 3980 |
| 412 | Ga0157379_10051355 | 3300014968 | Bacteria | 3683 |
| 413 | Ga0157379_10053977 | 3300014968 | Bacteria | 3591 |
| 414 | Ga0157379_10057691 | 3300014968 | Bacteria | 3469 |
| 415 | Ga0157379_10063401 | 3300014968 | Bacteria | 3304 |
| 416 | Ga0157379_10137731 | 3300014968 | Bacteria | 2200 |
| 417 | Ga0157376_10009598 | 3300014969 | Bacteria | 7038 |
| 418 | Ga0157376_10012290 | 3300014969 | Bacteria | 6350 |
| 419 | Ga0157376_10127296 | 3300014969 | Bacteria | 2267 |
| 420 | Ga0157376_10232269 | 3300014969 | Bacteria | 1714 |
| 421 | Ga0157376_10383852 | 3300014969 | Bacteria | 1354 |
| 422 | Ga0157376_10510605 | 3300014969 | Bacteria | 1183 |
| 423 | Ga0157376_10637851 | 3300014969 | Bacteria | 1064 |
| 424 | Ga0157376_10693663 | 3300014969 | Bacteria | 1022 |
| 425 | Ga0182007_10139375 | 3300015262 | Bacteria | 819 |
| 426 | Ga0163161_10010482 | 3300017792 | Bacteria | 6417 |
| 427 | Ga0163161_10061902 | 3300017792 | Bacteria | 2725 |
| 428 | Ga0163161_10085889 | 3300017792 | Bacteria | 2322 |
| 429 | Ga0163161_10321773 | 3300017792 | Bacteria | 1223 |
| 430 | Ga0206356_11249198 | 3300020070 | Bacteria | 3691 |
| 431 | Ga0206354_11204485 | 3300020081 | Bacteria | 3259 |
| 432 | Ga0206353_10288226 | 3300020082 | Bacteria | 1849 |
| 433 | Ga0213876_10032532 | 3300021384 | Unclassified | 2750 |
| 434 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 435 | Ga0209674_108306 | 3300025226 | Bacteria | 1239 |
| 436 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 437 | Ga0207425_1000774 | 3300025245 | Bacteria | 16436 |
| 438 | Ga0207425_1002031 | 3300025245 | Bacteria | 7537 |
| 439 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 440 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 441 | Ga0209129_1011340 | 3300025258 | Bacteria | 2136 |
| 442 | Ga0209565_1000036 | 3300025263 | Bacteria | 293334 |
| 443 | Ga0209565_1001584 | 3300025263 | Bacteria | 9698 |
| 444 | Ga0209565_1006670 | 3300025263 | Bacteria | 3209 |
| 445 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 446 | Ga0209130_1000622 | 3300025284 | Bacteria | 33932 |
| 447 | Ga0209130_1047807 | 3300025284 | Bacteria | 792 |
| 448 | Ga0209675_1000106 | 3300025291 | Bacteria | 120459 |
| 449 | Ga0209675_1003163 | 3300025291 | Bacteria | 7998 |
| 450 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 451 | Ga0209676_1003255 | 3300025292 | Bacteria | 10228 |
| 452 | Ga0209025_1002522 | 3300025294 | Bacteria | 19157 |
| 453 | Ga0209025_1008912 | 3300025294 | Bacteria | 7102 |
| 454 | Ga0209025_1012221 | 3300025294 | Bacteria | 5534 |
| 455 | Ga0209025_1063541 | 3300025294 | Bacteria | 1362 |
| 456 | Ga0209564_1000487 | 3300025295 | Bacteria | 65983 |
| 457 | Ga0209564_1001215 | 3300025295 | Bacteria | 29254 |
| 458 | Ga0209564_1001602 | 3300025295 | Bacteria | 22034 |
| 459 | Ga0209758_1016244 | 3300025297 | Bacteria | 3794 |
| 460 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 461 | Ga0209050_1004196 | 3300025298 | Bacteria | 9969 |
| 462 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 463 | Ga0209256_1000113 | 3300025299 | Bacteria | 175296 |
| 464 | Ga0207426_1000988 | 3300025302 | Bacteria | 27876 |
| 465 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 466 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 467 | Ga0209051_1000281 | 3300025303 | Bacteria | 83196 |
| 468 | Ga0209051_1014881 | 3300025303 | Bacteria | 3609 |
| 469 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 470 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 471 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 472 | Ga0207697_10017271 | 3300025315 | Bacteria | 2966 |
| 473 | Ga0207656_10016593 | 3300025321 | Bacteria | 2869 |
| 474 | Ga0207656_10036064 | 3300025321 | Bacteria | 2074 |
| 475 | Ga0207656_10132169 | 3300025321 | Bacteria | 1170 |
| 476 | Ga0207682_10000158 | 3300025893 | Bacteria | 30682 |
| 477 | Ga0207682_10002043 | 3300025893 | Bacteria | 9135 |
| 478 | Ga0207682_10006828 | 3300025893 | Bacteria | 4579 |
| 479 | Ga0207682_10024321 | 3300025893 | Bacteria | 2397 |
| 480 | Ga0207682_10103131 | 3300025893 | Bacteria | 1249 |
| 481 | Ga0207692_10044183 | 3300025898 | Bacteria | 2222 |
| 482 | Ga0207642_10002232 | 3300025899 | Bacteria | 6017 |
| 483 | Ga0207642_10011633 | 3300025899 | Bacteria | 3147 |
| 484 | Ga0207710_10016966 | 3300025900 | Bacteria | 3085 |
| 485 | Ga0207688_10010279 | 3300025901 | Bacteria | 5093 |
| 486 | Ga0207688_10025807 | 3300025901 | Bacteria | 3229 |
| 487 | Ga0207688_10135796 | 3300025901 | Bacteria | 1444 |
| 488 | Ga0207680_10013624 | 3300025903 | Bacteria | 4184 |
| 489 | Ga0207680_10028229 | 3300025903 | Bacteria | 3136 |
| 490 | Ga0207680_10073448 | 3300025903 | Bacteria | 2127 |
| 491 | Ga0207645_10005861 | 3300025907 | Bacteria | 8853 |
| 492 | Ga0207645_10010859 | 3300025907 | Bacteria | 6240 |
| 493 | Ga0207645_10012965 | 3300025907 | Bacteria | 5636 |
| 494 | Ga0207643_10000126 | 3300025908 | Bacteria | 52316 |
| 495 | Ga0207643_10032526 | 3300025908 | Bacteria | 2914 |
| 496 | Ga0207643_10150704 | 3300025908 | Bacteria | 1394 |
| 497 | Ga0207643_10170818 | 3300025908 | Bacteria | 1312 |
| 498 | Ga0207705_10057712 | 3300025909 | Bacteria | 2800 |
| 499 | Ga0207705_10209948 | 3300025909 | Bacteria | 1477 |
| 500 | Ga0207705_10291073 | 3300025909 | Bacteria | 1251 |
| 501 | Ga0207684_10034594 | 3300025910 | Bacteria | 4293 |
| 502 | Ga0207654_10031438 | 3300025911 | Bacteria | 2924 |
| 503 | Ga0207654_10242835 | 3300025911 | Bacteria | 1204 |
| 504 | Ga0207707_10025955 | 3300025912 | Bacteria | 5122 |
| 505 | Ga0207707_10070363 | 3300025912 | Bacteria | 3049 |
| 506 | Ga0207695_10182479 | 3300025913 | Bacteria | 2019 |
| 507 | Ga0207671_10010045 | 3300025914 | Bacteria | 7847 |
| 508 | Ga0207663_10115051 | 3300025916 | Bacteria | 1832 |
| 509 | Ga0207660_10111562 | 3300025917 | Bacteria | 2058 |
| 510 | Ga0207662_10002506 | 3300025918 | Bacteria | 9229 |
| 511 | Ga0207662_10022676 | 3300025918 | Bacteria | 3602 |
| 512 | Ga0207657_10020055 | 3300025919 | Bacteria | 6332 |
| 513 | Ga0207657_10029332 | 3300025919 | Bacteria | 5010 |
| 514 | Ga0207657_10093594 | 3300025919 | Bacteria | 2503 |
| 515 | Ga0207657_10522372 | 3300025919 | Bacteria | 929 |
| 516 | Ga0207649_10014470 | 3300025920 | Bacteria | 4419 |
| 517 | Ga0207649_10213427 | 3300025920 | Bacteria | 1370 |
| 518 | Ga0207649_10534607 | 3300025920 | Bacteria | 895 |
| 519 | Ga0207652_10020046 | 3300025921 | Bacteria | 5506 |
| 520 | Ga0207652_10075067 | 3300025921 | Bacteria | 2945 |
| 521 | Ga0207652_10921281 | 3300025921 | Bacteria | 771 |
| 522 | Ga0207681_10000205 | 3300025923 | Bacteria | 47034 |
| 523 | Ga0207681_10018140 | 3300025923 | Bacteria | 4431 |
| 524 | Ga0207681_10022630 | 3300025923 | Bacteria | 4011 |
| 525 | Ga0207681_10063447 | 3300025923 | Bacteria | 2548 |
| 526 | Ga0207681_10468195 | 3300025923 | Bacteria | 1028 |
| 527 | Ga0207694_10072035 | 3300025924 | Bacteria | 2701 |
| 528 | Ga0207694_10085702 | 3300025924 | Bacteria | 2480 |
| 529 | Ga0207650_10000480 | 3300025925 | Bacteria | 33274 |
| 530 | Ga0207650_10003292 | 3300025925 | Bacteria | 11116 |
| 531 | Ga0207650_10021208 | 3300025925 | Bacteria | 4593 |
| 532 | Ga0207650_10091213 | 3300025925 | Bacteria | 2328 |
| 533 | Ga0207650_10167785 | 3300025925 | Bacteria | 1743 |
| 534 | Ga0207650_10228028 | 3300025925 | Bacteria | 1501 |
| 535 | Ga0207659_10000118 | 3300025926 | Bacteria | 46531 |
| 536 | Ga0207659_10001268 | 3300025926 | Bacteria | 15123 |
| 537 | Ga0207659_10003663 | 3300025926 | Bacteria | 9257 |
| 538 | Ga0207659_10015369 | 3300025926 | Bacteria | 4958 |
| 539 | Ga0207659_10027958 | 3300025926 | Bacteria | 3826 |
| 540 | Ga0207659_10047812 | 3300025926 | Bacteria | 3027 |
| 541 | Ga0207659_10059678 | 3300025926 | Bacteria | 2743 |
| 542 | Ga0207659_10136785 | 3300025926 | Bacteria | 1897 |
| 543 | Ga0207659_10298987 | 3300025926 | Bacteria | 1321 |
| 544 | Ga0207687_10121766 | 3300025927 | Bacteria | 1952 |
| 545 | Ga0207687_10250901 | 3300025927 | Bacteria | 1407 |
| 546 | Ga0207687_10335716 | 3300025927 | Bacteria | 1227 |
| 547 | Ga0207687_10413634 | 3300025927 | Bacteria | 1111 |
| 548 | Ga0207687_10850893 | 3300025927 | Bacteria | 779 |
| 549 | Ga0207700_10066304 | 3300025928 | Bacteria | 2759 |
| 550 | Ga0207700_10070045 | 3300025928 | Bacteria | 2694 |
| 551 | Ga0207644_10003975 | 3300025931 | Bacteria | 9600 |
| 552 | Ga0207644_10019508 | 3300025931 | Bacteria | 4600 |
| 553 | Ga0207644_10104590 | 3300025931 | Bacteria | 2131 |
| 554 | Ga0207644_10133954 | 3300025931 | Bacteria | 1900 |
| 555 | Ga0207644_10168230 | 3300025931 | Bacteria | 1709 |
| 556 | Ga0207644_10297784 | 3300025931 | Bacteria | 1299 |
| 557 | Ga0207644_10457128 | 3300025931 | Bacteria | 1049 |
| 558 | Ga0207690_10028353 | 3300025932 | Bacteria | 3549 |
| 559 | Ga0207690_10241539 | 3300025932 | Bacteria | 1391 |
| 560 | Ga0207706_10000933 | 3300025933 | Bacteria | 29885 |
| 561 | Ga0207706_10019724 | 3300025933 | Bacteria | 6065 |
| 562 | Ga0207706_10025747 | 3300025933 | Bacteria | 5270 |
| 563 | Ga0207706_10036217 | 3300025933 | Bacteria | 4384 |
| 564 | Ga0207706_10169666 | 3300025933 | Bacteria | 1917 |
| 565 | Ga0207706_10321995 | 3300025933 | Bacteria | 1345 |
| 566 | Ga0207686_10217585 | 3300025934 | Bacteria | 1377 |
| 567 | Ga0207709_10013768 | 3300025935 | Bacteria | 4464 |
| 568 | Ga0207709_10198844 | 3300025935 | Bacteria | 1430 |
| 569 | Ga0207670_10167890 | 3300025936 | Bacteria | 1643 |
| 570 | Ga0207669_10000706 | 3300025937 | Bacteria | 14412 |
| 571 | Ga0207669_10007121 | 3300025937 | Bacteria | 5151 |
| 572 | Ga0207669_10050204 | 3300025937 | Bacteria | 2492 |
| 573 | Ga0207669_10084058 | 3300025937 | Bacteria | 2049 |
| 574 | Ga0207669_10103604 | 3300025937 | Bacteria | 1888 |
| 575 | Ga0207669_10203135 | 3300025937 | Bacteria | 1440 |
| 576 | Ga0207704_10001897 | 3300025938 | Bacteria | 9361 |
| 577 | Ga0207704_10003903 | 3300025938 | Bacteria | 6778 |
| 578 | Ga0207704_10192055 | 3300025938 | Bacteria | 1486 |
| 579 | Ga0207704_10240048 | 3300025938 | Bacteria | 1353 |
| 580 | Ga0207691_10000238 | 3300025940 | Bacteria | 53833 |
| 581 | Ga0207691_10008515 | 3300025940 | Bacteria | 9852 |
| 582 | Ga0207691_10027884 | 3300025940 | Bacteria | 5292 |
| 583 | Ga0207691_10038127 | 3300025940 | Bacteria | 4447 |
| 584 | Ga0207691_10047509 | 3300025940 | Bacteria | 3938 |
| 585 | Ga0207691_10062672 | 3300025940 | Bacteria | 3373 |
| 586 | Ga0207691_10083361 | 3300025940 | Bacteria | 2870 |
| 587 | Ga0207691_10097071 | 3300025940 | Bacteria | 2634 |
| 588 | Ga0207691_10132362 | 3300025940 | Bacteria | 2202 |
| 589 | Ga0207691_10158640 | 3300025940 | Bacteria | 1986 |
| 590 | Ga0207691_10291174 | 3300025940 | Bacteria | 1404 |
| 591 | Ga0207691_10345436 | 3300025940 | Bacteria | 1273 |
| 592 | Ga0207711_10031004 | 3300025941 | Bacteria | 4511 |
| 593 | Ga0207711_10031635 | 3300025941 | Bacteria | 4468 |
| 594 | Ga0207711_10035637 | 3300025941 | Bacteria | 4219 |
| 595 | Ga0207711_10054798 | 3300025941 | Bacteria | 3423 |
| 596 | Ga0207711_10083057 | 3300025941 | Bacteria | 2801 |
| 597 | Ga0207711_10105794 | 3300025941 | Bacteria | 2496 |
| 598 | Ga0207711_10228744 | 3300025941 | Bacteria | 1703 |
| 599 | Ga0207689_10000150 | 3300025942 | Bacteria | 60037 |
| 600 | Ga0207689_10006391 | 3300025942 | Bacteria | 10431 |
| 601 | Ga0207689_10012442 | 3300025942 | Bacteria | 7271 |
| 602 | Ga0207689_10019637 | 3300025942 | Bacteria | 5695 |
| 603 | Ga0207661_10018031 | 3300025944 | Bacteria | 5240 |
| 604 | Ga0207679_10022926 | 3300025945 | Bacteria | 4259 |
| 605 | Ga0207679_10099825 | 3300025945 | Bacteria | 2267 |
| 606 | Ga0207679_10283325 | 3300025945 | Bacteria | 1422 |
| 607 | Ga0207667_10148644 | 3300025949 | Bacteria | 2412 |
| 608 | Ga0207651_10001131 | 3300025960 | Bacteria | 11895 |
| 609 | Ga0207651_10018265 | 3300025960 | Bacteria | 4168 |
| 610 | Ga0207651_10043471 | 3300025960 | Bacteria | 2999 |
| 611 | Ga0207651_10078593 | 3300025960 | Bacteria | 2367 |
| 612 | Ga0207651_10134222 | 3300025960 | Bacteria | 1900 |
| 613 | Ga0207651_10180917 | 3300025960 | Bacteria | 1672 |
| 614 | Ga0207651_10333218 | 3300025960 | Bacteria | 1272 |
| 615 | Ga0207651_10669978 | 3300025960 | Bacteria | 912 |
| 616 | Ga0207651_10715977 | 3300025960 | Bacteria | 883 |
| 617 | Ga0207712_10052734 | 3300025961 | Bacteria | 2850 |
| 618 | Ga0207712_10070221 | 3300025961 | Bacteria | 2515 |
| 619 | Ga0207668_10028131 | 3300025972 | Bacteria | 3672 |
| 620 | Ga0207668_10033237 | 3300025972 | Bacteria | 3415 |
| 621 | Ga0207640_10031917 | 3300025981 | Bacteria | 3261 |
| 622 | Ga0207640_10042745 | 3300025981 | Bacteria | 2892 |
| 623 | Ga0207640_10061281 | 3300025981 | Bacteria | 2491 |
| 624 | Ga0207658_10014469 | 3300025986 | Bacteria | 5402 |
| 625 | Ga0207658_10065840 | 3300025986 | Bacteria | 2723 |
| 626 | Ga0207658_10073115 | 3300025986 | Bacteria | 2601 |
| 627 | Ga0207658_10239220 | 3300025986 | Bacteria | 1537 |
| 628 | Ga0207658_10651525 | 3300025986 | Bacteria | 949 |
| 629 | Ga0207677_10005476 | 3300026023 | Bacteria | 6890 |
| 630 | Ga0207677_10009321 | 3300026023 | Bacteria | 5521 |
| 631 | Ga0207677_10132024 | 3300026023 | Bacteria | 1898 |
| 632 | Ga0207677_10137224 | 3300026023 | Bacteria | 1867 |
| 633 | Ga0207677_10141682 | 3300026023 | Bacteria | 1841 |
| 634 | Ga0207677_10305244 | 3300026023 | Bacteria | 1316 |
| 635 | Ga0207677_10464460 | 3300026023 | Bacteria | 1087 |
| 636 | Ga0207703_10002955 | 3300026035 | Bacteria | 14418 |
| 637 | Ga0207703_10008624 | 3300026035 | Bacteria | 8044 |
| 638 | Ga0207703_10016069 | 3300026035 | Bacteria | 5838 |
| 639 | Ga0207703_10030511 | 3300026035 | Bacteria | 4262 |
| 640 | Ga0207703_10297844 | 3300026035 | Bacteria | 1470 |
| 641 | Ga0207639_10245631 | 3300026041 | Bacteria | 1559 |
| 642 | Ga0207639_10584088 | 3300026041 | Bacteria | 1029 |
| 643 | Ga0207678_10000821 | 3300026067 | Bacteria | 28462 |
| 644 | Ga0207678_10002944 | 3300026067 | Bacteria | 15425 |
| 645 | Ga0207678_10028904 | 3300026067 | Bacteria | 4839 |
| 646 | Ga0207678_10071519 | 3300026067 | Bacteria | 2974 |
| 647 | Ga0207708_10022773 | 3300026075 | Bacteria | 4731 |
| 648 | Ga0207708_10429113 | 3300026075 | Bacteria | 1097 |
| 649 | Ga0207702_10002877 | 3300026078 | Bacteria | 16096 |
| 650 | Ga0207702_10021046 | 3300026078 | Bacteria | 5397 |
| 651 | Ga0207702_10024026 | 3300026078 | Bacteria | 5057 |
| 652 | Ga0207702_10228894 | 3300026078 | Bacteria | 1736 |
| 653 | Ga0207702_10564109 | 3300026078 | Bacteria | 1114 |
| 654 | Ga0207641_10003621 | 3300026088 | Bacteria | 13635 |
| 655 | Ga0207641_10016238 | 3300026088 | Bacteria | 6097 |
| 656 | Ga0207641_10025306 | 3300026088 | Bacteria | 4894 |
| 657 | Ga0207641_10042640 | 3300026088 | Bacteria | 3807 |
| 658 | Ga0207641_10047000 | 3300026088 | Bacteria | 3639 |
| 659 | Ga0207641_10055755 | 3300026088 | Bacteria | 3356 |
| 660 | Ga0207641_10097217 | 3300026088 | Bacteria | 2588 |
| 661 | Ga0207641_10813152 | 3300026088 | Bacteria | 925 |
| 662 | Ga0207648_10000032 | 3300026089 | Bacteria | 128009 |
| 663 | Ga0207648_10003526 | 3300026089 | Bacteria | 16384 |
| 664 | Ga0207648_10005311 | 3300026089 | Bacteria | 12992 |
| 665 | Ga0207648_10029392 | 3300026089 | Bacteria | 4874 |
| 666 | Ga0207648_10042712 | 3300026089 | Bacteria | 3980 |
| 667 | Ga0207648_10044866 | 3300026089 | Bacteria | 3879 |
| 668 | Ga0207648_10185127 | 3300026089 | Bacteria | 1844 |
| 669 | Ga0207648_10364231 | 3300026089 | Bacteria | 1305 |
| 670 | Ga0207648_10974953 | 3300026089 | Bacteria | 793 |
| 671 | Ga0207676_10012629 | 3300026095 | Bacteria | 6058 |
| 672 | Ga0207676_10019318 | 3300026095 | Bacteria | 4969 |
| 673 | Ga0207676_10020581 | 3300026095 | Bacteria | 4829 |
| 674 | Ga0207676_10020892 | 3300026095 | Bacteria | 4797 |
| 675 | Ga0207676_10020980 | 3300026095 | Bacteria | 4788 |
| 676 | Ga0207676_10034951 | 3300026095 | Bacteria | 3809 |
| 677 | Ga0207676_10058347 | 3300026095 | Bacteria | 3044 |
| 678 | Ga0207676_10096496 | 3300026095 | Bacteria | 2440 |
| 679 | Ga0207675_100001131 | 3300026118 | Bacteria | 26465 |
| 680 | Ga0207675_100040389 | 3300026118 | Bacteria | 4357 |
| 681 | Ga0207675_100099102 | 3300026118 | Bacteria | 2745 |
| 682 | Ga0207675_100840349 | 3300026118 | Bacteria | 933 |
| 683 | Ga0207683_10000079 | 3300026121 | Bacteria | 76688 |
| 684 | Ga0207683_10000844 | 3300026121 | Bacteria | 28105 |
| 685 | Ga0207683_10013866 | 3300026121 | Bacteria | 6873 |
| 686 | Ga0207683_10044919 | 3300026121 | Bacteria | 3863 |
| 687 | Ga0207683_10045569 | 3300026121 | Bacteria | 3835 |
| 688 | Ga0207683_10112850 | 3300026121 | Bacteria | 2434 |
| 689 | Ga0207683_10160593 | 3300026121 | Bacteria | 2031 |
| 690 | Ga0207683_10168636 | 3300026121 | Bacteria | 1982 |
| 691 | Ga0207683_10336385 | 3300026121 | Bacteria | 1384 |
| 692 | Ga0207683_10403392 | 3300026121 | Bacteria | 1258 |
| 693 | Ga0207683_10433701 | 3300026121 | Bacteria | 1211 |
| 694 | Ga0207698_10005102 | 3300026142 | Bacteria | 8064 |
| 695 | Ga0207698_10011027 | 3300026142 | Bacteria | 5842 |
| 696 | Ga0207698_10016930 | 3300026142 | Bacteria | 4930 |
| 697 | Ga0207698_10017008 | 3300026142 | Bacteria | 4922 |
| 698 | Ga0207698_10017398 | 3300026142 | Bacteria | 4875 |
| 699 | Ga0207698_10041127 | 3300026142 | Bacteria | 3441 |
| 700 | Ga0207698_10063780 | 3300026142 | Bacteria | 2885 |
| 701 | Ga0207698_10428754 | 3300026142 | Bacteria | 1271 |
| 702 | Ga0207698_10825519 | 3300026142 | Bacteria | 931 |
| 703 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 704 | Ga0209281_1015948 | 3300027111 | Bacteria | 1555 |
| 705 | Ga0207428_10493521 | 3300027907 | Bacteria | 890 |
| 706 | Ga0268266_10018888 | 3300028379 | Bacteria | 5872 |
| 707 | Ga0268264_10004410 | 3300028381 | Bacteria | 12007 |
| 708 | Ga0268264_10056204 | 3300028381 | Bacteria | 3290 |
| 709 | Ga0268264_10143525 | 3300028381 | Bacteria | 2132 |
| 710 | Ga0265318_10063423 | 3300028577 | Bacteria | 1375 |
| 711 | Ga0265323_10003257 | 3300028653 | Bacteria | 7232 |
| 712 | Ga0265323_10010912 | 3300028653 | Bacteria | 3679 |
| 713 | Ga0265322_10000199 | 3300028654 | Bacteria | 26538 |
| 714 | Ga0265336_10000003 | 3300028666 | Bacteria | 423158 |
| 715 | Ga0307517_10000810 | 3300028786 | Bacteria | 53724 |
| 716 | Ga0307515_10000110 | 3300028794 | Bacteria | 195560 |
| 717 | Ga0307515_10015338 | 3300028794 | Bacteria | 14123 |
| 718 | Ga0307515_10117740 | 3300028794 | Bacteria | 3038 |
| 719 | Ga0307515_10278698 | 3300028794 | Bacteria | 1382 |
| 720 | Ga0265324_10000908 | 3300029957 | Bacteria | 18733 |
| 721 | Ga0307512_10004629 | 3300030522 | Bacteria | 14941 |
| 722 | Ga0265329_10017929 | 3300031242 | Bacteria | 2428 |
| 723 | Ga0265316_10000456 | 3300031344 | Bacteria | 46381 |
| 724 | Ga0265316_10026553 | 3300031344 | Bacteria | 4813 |
| 725 | Ga0307513_10000011 | 3300031456 | Bacteria | 354929 |
| 726 | Ga0307513_10001586 | 3300031456 | Bacteria | 32634 |
| 727 | Ga0307513_10126205 | 3300031456 | Bacteria | 2514 |
| 728 | Ga0307513_10158342 | 3300031456 | Bacteria | 2161 |
| 729 | Ga0307509_10000802 | 3300031507 | Bacteria | 53907 |
| 730 | Ga0307509_10003238 | 3300031507 | Bacteria | 25133 |
| 731 | Ga0307509_10012626 | 3300031507 | Bacteria | 10090 |
| 732 | Ga0307509_10022383 | 3300031507 | Bacteria | 7125 |
| 733 | Ga0307509_10023332 | 3300031507 | Bacteria | 6953 |
| 734 | Ga0307509_10030645 | 3300031507 | Bacteria | 5946 |
| 735 | Ga0307509_10178615 | 3300031507 | Bacteria | 1992 |
| 736 | Ga0307408_100022685 | 3300031548 | Bacteria | 4268 |
| 737 | Ga0307508_10002132 | 3300031616 | Bacteria | 21213 |
| 738 | Ga0307508_10033344 | 3300031616 | Bacteria | 4646 |
| 739 | Ga0307508_10409992 | 3300031616 | Bacteria | 946 |
| 740 | Ga0307514_10018100 | 3300031649 | Bacteria | 5787 |
| 741 | Ga0265314_10047501 | 3300031711 | Bacteria | 3020 |
| 742 | Ga0265342_10007343 | 3300031712 | Bacteria | 8085 |
| 743 | Ga0307516_10001054 | 3300031730 | Bacteria | 38370 |
| 744 | Ga0307405_10005514 | 3300031731 | Bacteria | 6111 |
| 745 | Ga0307405_10007548 | 3300031731 | Bacteria | 5447 |
| 746 | Ga0307413_10004470 | 3300031824 | Bacteria | 6091 |
| 747 | Ga0307410_10041255 | 3300031852 | Bacteria | 3043 |
| 748 | Ga0307410_10268228 | 3300031852 | Bacteria | 1334 |
| 749 | Ga0307406_10007622 | 3300031901 | Bacteria | 6009 |
| 750 | Ga0307406_10048836 | 3300031901 | Bacteria | 2675 |
| 751 | Ga0307407_10020188 | 3300031903 | Bacteria | 3408 |
| 752 | Ga0307407_10129209 | 3300031903 | Bacteria | 1614 |
| 753 | Ga0307412_10015518 | 3300031911 | Bacteria | 4519 |
| 754 | Ga0307412_10490239 | 3300031911 | Bacteria | 1021 |
| 755 | Ga0307409_100118378 | 3300031995 | Bacteria | 2237 |
| 756 | Ga0307409_100234675 | 3300031995 | Bacteria | 1665 |
| 757 | Ga0307409_100392134 | 3300031995 | Bacteria | 1323 |
| 758 | Ga0307409_100832013 | 3300031995 | Bacteria | 933 |
| 759 | Ga0307416_100054349 | 3300032002 | Bacteria | 3218 |
| 760 | Ga0307416_100069120 | 3300032002 | Bacteria | 2921 |
| 761 | Ga0307416_100585444 | 3300032002 | Bacteria | 1194 |
| 762 | Ga0307416_100723826 | 3300032002 | Bacteria | 1086 |
| 763 | Ga0307414_10019903 | 3300032004 | Bacteria | 4170 |
| 764 | Ga0307411_10001107 | 3300032005 | Bacteria | 10491 |
| 765 | Ga0307411_10155863 | 3300032005 | Bacteria | 1703 |
| 766 | Ga0307411_10878998 | 3300032005 | Bacteria | 795 |
| 767 | Ga0307415_100010508 | 3300032126 | Bacteria | 5247 |
| 768 | Ga0307415_100112857 | 3300032126 | Bacteria | 2020 |
| 769 | Ga0307415_100279896 | 3300032126 | Bacteria | 1371 |
| 770 | Ga0307510_10009294 | 3300033180 | Bacteria | 11718 |
| 771 | Ga0307510_10009432 | 3300033180 | Bacteria | 11626 |
| 772 | Ga0307510_10122397 | 3300033180 | Bacteria | 2301 |
| 773 | Ga0373929_0011337 | 3300035085 | Bacteria | 1679 |
| 774 | Ga0373940_0027381 | 3300035088 | Bacteria | 1498 |
| 775 | Ga0373932_0038750 | 3300035112 | Bacteria | 1364 |
| 776 | Ga0373936_0207513 | 3300035113 | Bacteria | 866 |
| 777 | Ga0373943_0206506 | 3300035170 | Bacteria | 1089 |
| 778 | Ga0373955_0135855 | 3300035172 | Bacteria | 1438 |
| 779 | Ga0373931_0004895 | 3300035691 | Bacteria | 6157 |
| 780 | Ga0373931_0014121 | 3300035691 | Bacteria | 3900 |
| 781 | Ga0373931_0018946 | 3300035691 | Bacteria | 3429 |
| 782 | Ga0373931_0104620 | 3300035691 | Bacteria | 1597 |
| 783 | Ga0373927_0282930 | 3300035695 | Bacteria | 1091 |
| 784 | Ga0373933_0046455 | 3300035724 | Bacteria | 2579 |
| 785 | Ga0373937_0058064 | 3300036401 | Bacteria | 3555 |
| 786 | Ga0373937_0177093 | 3300036401 | Bacteria | 2002 |
| 787 | Ga0373925_0111737 | 3300037068 | Bacteria | 2112 |
| 788 | Ga0373925_0431086 | 3300037068 | Bacteria | 1078 |
| 789 | Ga0395900_0243828 | 3300037418 | Bacteria | 1802 |
| 790 | Ga0395905_0000026 | 3300037471 | Bacteria | 315051 |
| 791 | Ga0395905_0055676 | 3300037471 | Bacteria | 3701 |
| 792 | Ga0395905_0248099 | 3300037471 | Bacteria | 1663 |
| 793 | Ga0395905_0307890 | 3300037471 | Bacteria | 1472 |
| 794 | Ga0395905_0568640 | 3300037471 | Bacteria | 1035 |
| 795 | Ga0395905_0748583 | 3300037471 | Bacteria | 879 |
| 796 | Ga0395901_0132121 | 3300038443 | Bacteria | 2623 |
| 797 | Ga0436365_0361177 | 3300039437 | Bacteria | 4074 |
| 798 | Ga0439436_0000086 | 3300041404 | Bacteria | 22153 |
| 799 | Ga0439439_0008548 | 3300041406 | Bacteria | 2421 |
| 800 | Ga0439466_0005453 | 3300041411 | Bacteria | 4858 |
| 801 | Ga0439465_0000464 | 3300041413 | Bacteria | 11950 |
| 802 | Ga0451800_0010811 | 3300041459 | Bacteria | 840 |
| 803 | Ga0451807_0017675 | 3300041486 | Bacteria | 990 |
| 804 | Ga0451853_1666867 | 3300041512 | Bacteria | 931 |
| 805 | Ga0439431_0007902 | 3300041997 | Bacteria | 2379 |
| 806 | Ga0439445_0000486 | 3300042004 | Bacteria | 8048 |
| 807 | Ga0439448_0012659 | 3300042005 | Bacteria | 2528 |
| 808 | Ga0439432_005058 | 3300042006 | Bacteria | 4768 |
| 809 | Ga0439432_018316 | 3300042006 | Bacteria | 2341 |
| 810 | Ga0439449_0000300 | 3300042007 | Bacteria | 17778 |
| 811 | Ga0439452_001494 | 3300042010 | Bacteria | 9486 |
| 812 | Ga0439457_020155 | 3300042014 | Bacteria | 1480 |
| 813 | Ga0439462_0001329 | 3300042015 | Bacteria | 5451 |
| 814 | Ga0439462_0002187 | 3300042015 | Bacteria | 4506 |
| 815 | Ga0450919_000456 | 3300042121 | Bacteria | 5084 |
| 816 | Ga0439446_0000332 | 3300042156 | Bacteria | 9108 |
| 817 | Ga0439458_0012656 | 3300042157 | Bacteria | 1896 |
| 818 | Ga0439459_0048958 | 3300042438 | Bacteria | 922 |
| 819 | Ga0439464_0147910 | 3300042439 | Bacteria | 734 |
| 820 | Ga0450918_002380 | 3300042531 | Bacteria | 3554 |
| 821 | Ga0453683_0004804 | 3300044673 | Bacteria | 9512 |
| 822 | Ga0466965_0027812 | 3300044683 | Bacteria | 2745 |
| 823 | Ga0453684_0007800 | 3300044712 | Bacteria | 19522 |
| 824 | Ga0453684_0151671 | 3300044712 | Bacteria | 2753 |
| 825 | Ga0466970_0081755 | 3300044765 | Bacteria | 1747 |
| 826 | Ga0466960_0015324 | 3300044901 | Bacteria | 3302 |
| 827 | Ga0466967_0022959 | 3300045976 | Bacteria | 5103 |
| 828 | Ga0466967_0068005 | 3300045976 | Bacteria | 3179 |
| 829 | Ga0466967_0463031 | 3300045976 | Bacteria | 1240 |
| 830 | Ga0495592_0000272 | 3300046454 | Bacteria | 44189 |
| 831 | Ga0495603_0370864 | 3300046455 | Unclassified | 821 |
| 832 | Ga0495629_0141305 | 3300046459 | Bacteria | 1675 |
| 833 | Ga0495629_0204716 | 3300046459 | Bacteria | 1364 |
| 834 | Ga0495580_0380850 | 3300046472 | Bacteria | 953 |
| 835 | Ga0495639_0072671 | 3300046475 | Bacteria | 1591 |
| 836 | Ga0495585_0240405 | 3300046492 | Bacteria | 907 |
| 837 | Ga0495594_0172390 | 3300046499 | Bacteria | 1231 |
| 838 | Ga0495610_0101621 | 3300046512 | Bacteria | 1287 |
| 839 | Ga0495620_0085972 | 3300046515 | Bacteria | 1267 |
| 840 | Ga0495628_0342193 | 3300046516 | Bacteria | 1101 |
| 841 | Ga0495630_0240583 | 3300046517 | Bacteria | 1383 |
| 842 | Ga0495643_0028708 | 3300046522 | Bacteria | 3116 |
| 843 | Ga0495648_0092742 | 3300046524 | Bacteria | 1686 |
| 844 | Ga0495586_0212541 | 3300046535 | Bacteria | 1098 |
| 845 | Ga0495598_0091642 | 3300046537 | Bacteria | 992 |
| 846 | Ga0495645_0352094 | 3300046543 | Bacteria | 948 |
| 847 | Ga0495667_0206930 | 3300046559 | Bacteria | 1255 |
| 848 | Ga0495656_0003749 | 3300046615 | Bacteria | 5160 |
| 849 | Ga0495599_0246634 | 3300046678 | Bacteria | 1088 |
| 850 | Ga0495646_0061312 | 3300046680 | Bacteria | 2240 |
| 851 | Ga0495647_0188710 | 3300046681 | Bacteria | 900 |
| 852 | Ga0495658_0060520 | 3300046683 | Bacteria | 2172 |
| 853 | Ga0495658_0094143 | 3300046683 | Bacteria | 1779 |
| 854 | Ga0495613_0153308 | 3300046689 | Bacteria | 1642 |
| 855 | Ga0495624_0409286 | 3300046690 | Bacteria | 814 |
| 856 | Ga0495604_0375788 | 3300047317 | Bacteria | 940 |
| 857 | Ga0495636_0132374 | 3300047318 | Bacteria | 1110 |
| 858 | Ga0495681_0166474 | 3300047470 | Bacteria | 915 |
| 859 | Ga0495684_0406835 | 3300047471 | Bacteria | 954 |
| 860 | Ga0495686_0003640 | 3300047472 | Bacteria | 13199 |
| 861 | Ga0495686_0083309 | 3300047472 | Bacteria | 1951 |
| 862 | Ga0495615_0030324 | 3300048090 | Bacteria | 1290 |
| 863 | Ga0496100_0002898 | 3300048903 | Bacteria | 8803 |
| 864 | Ga0496100_0128746 | 3300048903 | Bacteria | 1780 |
| 865 | Ga0496100_0378677 | 3300048903 | Bacteria | 1074 |
| 866 | Ga0496100_0542201 | 3300048903 | Bacteria | 899 |
| 867 | Ga0496100_0640813 | 3300048903 | Bacteria | 827 |
| 868 | Ga0496101_0002087 | 3300048904 | Bacteria | 12163 |
| 869 | Ga0496101_0011436 | 3300048904 | Bacteria | 5889 |
| 870 | Ga0496101_0022835 | 3300048904 | Bacteria | 4313 |
| 871 | Ga0496101_0344501 | 3300048904 | Bacteria | 1171 |
| 872 | Ga0496102_0001109 | 3300048905 | Bacteria | 24710 |
| 873 | Ga0496102_0010119 | 3300048905 | Bacteria | 8113 |
| 874 | Ga0496102_0048432 | 3300048905 | Bacteria | 3864 |
| 875 | Ga0496103_0011381 | 3300048906 | Bacteria | 5270 |
| 876 | Ga0496103_0140546 | 3300048906 | Bacteria | 1544 |
| 877 | Ga0496104_0005004 | 3300048907 | Bacteria | 11562 |
| 878 | Ga0496104_0022800 | 3300048907 | Bacteria | 5751 |
| 879 | Ga0496104_0182487 | 3300048907 | Bacteria | 2009 |
| 880 | Ga0496104_0297480 | 3300048907 | Bacteria | 1526 |
| 881 | Ga0496105_0020021 | 3300048908 | Bacteria | 5401 |
| 882 | Ga0496105_0035471 | 3300048908 | Bacteria | 4104 |
| 883 | Ga0496105_0079410 | 3300048908 | Bacteria | 2709 |
| 884 | Ga0496105_0519307 | 3300048908 | Bacteria | 933 |
| 885 | Ga0496106_0009849 | 3300048909 | Bacteria | 7057 |
| 886 | Ga0496106_0009864 | 3300048909 | Bacteria | 7050 |
| 887 | Ga0496106_0021246 | 3300048909 | Bacteria | 4819 |
| 888 | Ga0496107_0002258 | 3300048910 | Bacteria | 12431 |
| 889 | Ga0496107_0021980 | 3300048910 | Bacteria | 4506 |
| 890 | Ga0496107_0600618 | 3300048910 | Bacteria | 813 |
| 891 | Ga0496108_0009344 | 3300048911 | Bacteria | 7939 |
| 892 | Ga0496108_0026830 | 3300048911 | Bacteria | 4754 |
| 893 | Ga0496108_0058254 | 3300048911 | Bacteria | 3246 |
| 894 | Ga0496108_0180337 | 3300048911 | Bacteria | 1829 |
| 895 | Ga0496108_0298480 | 3300048911 | Bacteria | 1403 |
| 896 | Ga0496108_0459634 | 3300048911 | Bacteria | 1112 |
| 897 | Ga0496109_0111943 | 3300048912 | Bacteria | 2538 |
| 898 | Ga0496109_0113761 | 3300048912 | Bacteria | 2517 |
| 899 | Ga0496109_0182361 | 3300048912 | Bacteria | 1972 |
| 900 | Ga0496109_0226342 | 3300048912 | Bacteria | 1759 |
| 901 | Ga0496110_0001863 | 3300048913 | Bacteria | 15575 |
| 902 | Ga0496110_0063219 | 3300048913 | Bacteria | 3270 |
| 903 | Ga0496111_0010154 | 3300048914 | Bacteria | 6304 |
| 904 | Ga0496111_0083712 | 3300048914 | Bacteria | 2331 |
| 905 | Ga0496112_0043821 | 3300048915 | Bacteria | 4381 |
| 906 | Ga0496112_0663212 | 3300048915 | Bacteria | 972 |
| 907 | Ga0496113_0059891 | 3300048916 | Bacteria | 2869 |
| 908 | Ga0496114_0001480 | 3300048917 | Bacteria | 17833 |
| 909 | Ga0496114_0002558 | 3300048917 | Bacteria | 13895 |
| 910 | Ga0496114_0003140 | 3300048917 | Bacteria | 12679 |
| 911 | Ga0496114_0029841 | 3300048917 | Bacteria | 4483 |
| 912 | Ga0496114_0080624 | 3300048917 | Bacteria | 2749 |
| 913 | Ga0496114_0622929 | 3300048917 | Bacteria | 950 |
| 914 | Ga0496115_0028775 | 3300048918 | Bacteria | 4358 |
| 915 | Ga0496115_0339912 | 3300048918 | Bacteria | 1225 |
| 916 | Ga0501292_002626 | 3300049515 | Bacteria | 2333 |
| 917 | Ga0501297_015612 | 3300049520 | Bacteria | 910 |
| 918 | Ga0501298_009377 | 3300049521 | Bacteria | 1664 |
| 919 | Ga0501301_000987 | 3300049524 | Bacteria | 1779 |
| 920 | Ga0501034_0250905 | 3300049571 | Bacteria | 1714 |
| 921 | Ga0501034_0595995 | 3300049571 | Bacteria | 1011 |
| 922 | Ga0501039_0260484 | 3300049575 | Bacteria | 1363 |
| 923 | Ga0501067_0002689 | 3300049583 | Bacteria | 9815 |
| 924 | Ga0501067_0185792 | 3300049583 | Bacteria | 1157 |
| 925 | Ga0501069_0015079 | 3300049585 | Bacteria | 4140 |
| 926 | Ga0501198_000004 | 3300049649 | Bacteria | 175146 |
| 927 | Ga0501206_008319 | 3300049653 | Bacteria | 1370 |
| 928 | Ga0501207_018567 | 3300049654 | Bacteria | 1095 |
| 929 | Ga0501222_000038 | 3300049662 | Bacteria | 51424 |
| 930 | Ga0501252_000809 | 3300049682 | Bacteria | 2632 |
| 931 | Ga0501257_009870 | 3300049686 | Bacteria | 2160 |
| 932 | Ga0501221_109755 | 3300049704 | Bacteria | 694 |
| 933 | Ga0501265_001086 | 3300049762 | Bacteria | 3062 |
| 934 | nmdc:mga03683_193645_c1 | 3300050489 | Bacteria | 931 |
| 935 | nmdc:mga0yw44_156079_c1 | 3300050492 | Bacteria | 1491 |
| 936 | nmdc:mga0yw44_206316_c1 | 3300050492 | Bacteria | 1299 |
| 937 | nmdc:mga07m45_352965_c1 | 3300050496 | Bacteria | 854 |
| 938 | nmdc:mga05p37_1507_c1 | 3300050507 | Bacteria | 27071 |
| 939 | nmdc:mga05p37_343680_c1 | 3300050507 | Bacteria | 1759 |
| 940 | nmdc:mga08y16_593114_c1 | 3300050511 | Bacteria | 1117 |
| 941 | nmdc:mga0n895_3433_c1 | 3300050512 | Bacteria | 12787 |
| 942 | nmdc:mga0a205_65042_c1 | 3300050515 | Bacteria | 3523 |
| 943 | Ga0495612_0023758 | 3300053078 | Bacteria | 2461 |
| 944 | Ga0495619_0097206 | 3300053085 | Bacteria | 2000 |
| 945 | Ga0500644_0001734 | 3300053088 | Bacteria | 5662 |
| 946 | Ga0500644_0014473 | 3300053088 | Bacteria | 2228 |
| 947 | Ga0500583_0019283 | 3300053092 | Bacteria | 2793 |
| 948 | Ga0500651_0014926 | 3300053093 | Bacteria | 4760 |
| 949 | Ga0500566_0379699 | 3300053094 | Bacteria | 639 |
| 950 | Ga0500593_004651 | 3300053117 | Bacteria | 5342 |
| 951 | Ga0500652_102749 | 3300053131 | Bacteria | 1195 |
| 952 | Ga0500559_0000022 | 3300053136 | Bacteria | 128071 |
| 953 | Ga0500559_0125696 | 3300053136 | Bacteria | 1195 |
| 954 | Ga0500564_041112 | 3300053138 | Bacteria | 2128 |
| 955 | Ga0500568_0012032 | 3300053139 | Bacteria | 3989 |
| 956 | Ga0500590_000246 | 3300053148 | Bacteria | 16671 |
| 957 | Ga0500622_0000498 | 3300053156 | Bacteria | 36624 |
| 958 | Ga0500645_000114 | 3300053730 | Bacteria | 64351 |
| 959 | Ga0500645_002232 | 3300053730 | Bacteria | 8833 |
| 960 | Ga0501084_0096638 | 3300054114 | Bacteria | 2481 |
| 961 | 2511243286 | 2511231002 | Bacteria | 5042903 |
| 962 | 2643865843 | 2643221570 | Bacteria | 5103772 |
| 963 | 2644060466 | 2643221609 | Bacteria | 6756331 |
| 964 | 2644073788 | 2643221611 | Bacteria | 6820941 |
| 965 | 2644248278 | 2643221644 | Bacteria | 6865017 |
| 966 | 2885195931 | 2885192300 | Bacteria | 5882526 |
| 967 | 2894025595 | 2894023352 | Bacteria | 5167372 |
| 968 | Ga0068871_100281820 | |||
| 969 | JGI25155J39150_1000105 | |||
| 970 | JGI25156J39149_1000191 | |||
| 971 | JGI25154J39366_1000195 | |||
| 972 | JGI25157J39369_1000227 | |||
| 973 | JGI25159J45721_1001565 | |||
| 974 | JGI25151J46595_10015577 | |||
| 975 | JGI25151J46595_10017387 | |||
| 976 | rootH2_10069953 | |||
| 977 | Ga0055525_1000021 | |||
| 978 | Ga0055526_1006669 | |||
| 979 | Ga0055526_1018321 | |||
| 980 | Ga0055526_1028759 | |||
| 981 | Ga0055537_1000257 | |||
| 982 | Ga0055537_1024980 | |||
| 983 | Ga0055524_1000077 | |||
| 984 | Ga0055524_1000253 | |||
| 985 | Ga0055536_1000408 | |||
| 986 | Ga0055534_1000619 | |||
| 987 | Ga0055528_1001926 | |||
| 988 | Ga0055530_10000354 | |||
| 989 | Ga0055530_10004807 | |||
| 990 | Ga0055540_1000010 | |||
| 991 | Ga0055540_1000011 | |||
| 992 | Ga0055540_1023256 | |||
| 993 | Ga0055540_1040480 | |||
| 994 | Ga0055531_10000298 | |||
| 995 | Ga0055531_10000405 | |||
| 996 | Ga0055531_10000992 | |||
| 997 | Ga0055531_10038475 | |||
| 998 | Ga0065165_1009925 | |||
| 999 | Ga0065165_1012628 | |||
| 1000 | Ga0065165_1043885 | |||
| 1001 | Ga0070658_10024955 | |||
| 1002 | Ga0070658_10250138 | |||
| 1003 | Ga0070676_10003203 | |||
| 1004 | Ga0070676_10071698 | |||
| 1005 | Ga0070683_100115298 | |||
| 1006 | Ga0070690_100030145 | |||
| 1007 | Ga0070670_100003584 | |||
| 1008 | Ga0070670_100031412 | |||
| 1009 | Ga0070670_100051303 | |||
| 1010 | Ga0070670_100052640 | |||
| 1011 | Ga0070670_100063526 | |||
| 1012 | Ga0070670_100075224 | |||
| 1013 | Ga0070670_100130651 | |||
| 1014 | Ga0070670_100149786 | |||
| 1015 | Ga0070670_100328245 | |||
| 1016 | Ga0070670_100351182 | |||
| 1017 | Ga0070677_10004214 | |||
| 1018 | Ga0070677_10006294 | |||
| 1019 | Ga0070677_10006352 | |||
| 1020 | Ga0070677_10016635 | |||
| 1021 | Ga0070677_10022883 | |||
| 1022 | Ga0070677_10046686 | |||
| 1023 | Ga0070677_10053980 | |||
| 1024 | Ga0068869_100000464 | |||
| 1025 | Ga0068869_100017548 | |||
| 1026 | Ga0068869_100042984 | |||
| 1027 | Ga0068869_100070609 | |||
| 1028 | Ga0068869_100201233 | |||
| 1029 | Ga0070666_10008685 | |||
| 1030 | Ga0070666_10085206 | |||
| 1031 | Ga0070666_10104502 | |||
| 1032 | Ga0070680_100020509 | |||
| 1033 | Ga0070682_100005154 | |||
| 1034 | Ga0070682_100053329 | |||
| 1035 | Ga0068868_100001157 | |||
| 1036 | Ga0068868_100003589 | |||
| 1037 | Ga0068868_100018257 | |||
| 1038 | Ga0068868_100038490 | |||
| 1039 | Ga0068868_100040850 | |||
| 1040 | Ga0068868_100070593 | |||
| 1041 | Ga0068868_100105169 | |||
| 1042 | Ga0070660_100083499 | |||
| 1043 | Ga0070660_100465622 | |||
| 1044 | Ga0070660_100541561 | |||
| 1045 | Ga0070689_100019366 | |||
| 1046 | Ga0070689_100157142 | |||
| 1047 | Ga0070689_100218497 | |||
| 1048 | Ga0070691_10002512 | |||
| 1049 | Ga0070687_100001572 | |||
| 1050 | Ga0070687_100040473 | |||
| 1051 | Ga0070661_100204767 | |||
| 1052 | Ga0070692_10009917 | |||
| 1053 | Ga0070692_10206857 | |||
| 1054 | Ga0070668_100019369 | |||
| 1055 | Ga0070668_100035665 | |||
| 1056 | Ga0070668_100152762 | |||
| 1057 | Ga0070668_100159003 | |||
| 1058 | Ga0070669_100001896 | |||
| 1059 | Ga0070669_100002377 | |||
| 1060 | Ga0070669_100028374 | |||
| 1061 | Ga0070669_100099987 | |||
| 1062 | Ga0070669_100619360 | |||
| 1063 | Ga0070675_100001801 | |||
| 1064 | Ga0070675_100001993 | |||
| 1065 | Ga0070675_100022306 | |||
| 1066 | Ga0070675_100026137 | |||
| 1067 | Ga0070675_100029917 | |||
| 1068 | Ga0070675_100072042 | |||
| 1069 | Ga0070675_100084496 | |||
| 1070 | Ga0070675_100179384 | |||
| 1071 | Ga0070675_100347154 | |||
| 1072 | Ga0070671_100006533 | |||
| 1073 | Ga0070671_100020918 | |||
| 1074 | Ga0070671_100045128 | |||
| 1075 | Ga0070671_100055230 | |||
| 1076 | Ga0070671_100071832 | |||
| 1077 | Ga0070671_100155508 | |||
| 1078 | Ga0070671_100455788 | |||
| 1079 | Ga0070674_100001004 | |||
| 1080 | Ga0070674_100028169 | |||
| 1081 | Ga0070674_100035179 | |||
| 1082 | Ga0070674_100462154 | |||
| 1083 | Ga0070673_100002809 | |||
| 1084 | Ga0070673_100003898 | |||
| 1085 | Ga0070673_100037898 | |||
| 1086 | Ga0070673_100078466 | |||
| 1087 | Ga0070673_100126960 | |||
| 1088 | Ga0070673_100127201 | |||
| 1089 | Ga0070673_100142252 | |||
| 1090 | Ga0070673_100163489 | |||
| 1091 | Ga0070673_100332099 | |||
| 1092 | Ga0070673_100408969 | |||
| 1093 | Ga0070673_100823069 | |||
| 1094 | Ga0070659_100017714 | |||
| 1095 | Ga0070659_100087482 | |||
| 1096 | Ga0070667_100006750 | |||
| 1097 | Ga0070667_100022158 | |||
| 1098 | Ga0070667_100132813 | |||
| 1099 | Ga0070709_10044004 | |||
| 1100 | Ga0070714_100049718 | |||
| 1101 | Ga0070713_100121718 | |||
| 1102 | Ga0070710_10083778 | |||
| 1103 | Ga0070701_10037308 | |||
| 1104 | Ga0070701_10089688 | |||
| 1105 | Ga0070701_10139535 | |||
| 1106 | Ga0070711_100129900 | |||
| 1107 | Ga0070700_100498752 | |||
| 1108 | Ga0070708_100336081 | |||
| 1109 | Ga0070663_100011135 | |||
| 1110 | Ga0070663_100034752 | |||
| 1111 | Ga0070663_100097140 | |||
| 1112 | Ga0070663_100462505 | |||
| 1113 | Ga0070663_100550638 | |||
| 1114 | Ga0070678_100005974 | |||
| 1115 | Ga0070678_100007713 | |||
| 1116 | Ga0070678_100018295 | |||
| 1117 | Ga0070678_100023041 | |||
| 1118 | Ga0070678_100133529 | |||
| 1119 | Ga0070678_100227568 | |||
| 1120 | Ga0070678_100270260 | |||
| 1121 | Ga0070678_100347630 | |||
| 1122 | Ga0070678_100361807 | |||
| 1123 | Ga0070678_100498097 | |||
| 1124 | Ga0070662_100000867 | |||
| 1125 | Ga0070662_100027044 | |||
| 1126 | Ga0070662_100052602 | |||
| 1127 | Ga0070681_10004529 | |||
| 1128 | Ga0070681_10060748 | |||
| 1129 | Ga0068867_100000005 | |||
| 1130 | Ga0068867_100008508 | |||
| 1131 | Ga0068867_100011686 | |||
| 1132 | Ga0068867_100031401 | |||
| 1133 | Ga0068867_100035530 | |||
| 1134 | Ga0068867_100066669 | |||
| 1135 | Ga0068867_100106939 | |||
| 1136 | Ga0068867_100157010 | |||
| 1137 | Ga0068867_100311171 | |||
| 1138 | Ga0070706_100029862 | |||
| 1139 | Ga0070706_100671812 | |||
| 1140 | Ga0070698_100071963 | |||
| 1141 | Ga0070679_100014568 | |||
| 1142 | Ga0070679_100076037 | |||
| 1143 | Ga0070684_100058255 | |||
| 1144 | Ga0068853_100002880 | |||
| 1145 | Ga0068853_100150830 | |||
| 1146 | Ga0068853_100151378 | |||
| 1147 | Ga0068853_100281758 | |||
| 1148 | Ga0068853_100684319 | |||
| 1149 | Ga0070672_100000535 | |||
| 1150 | Ga0070672_100002739 | |||
| 1151 | Ga0070672_100015927 | |||
| 1152 | Ga0070672_100057199 | |||
| 1153 | Ga0070672_100059868 | |||
| 1154 | Ga0070672_100180219 | |||
| 1155 | Ga0070672_100294564 | |||
| 1156 | Ga0070672_100295381 | |||
| 1157 | Ga0070672_100306273 | |||
| 1158 | Ga0070686_100231040 | |||
| 1159 | Ga0070686_100371529 | |||
| 1160 | Ga0070696_100201015 | |||
| 1161 | Ga0070693_100008393 | |||
| 1162 | Ga0070693_100019340 | |||
| 1163 | Ga0070693_100022140 | |||
| 1164 | Ga0070665_100143768 | |||
| 1165 | Ga0070665_100231023 | |||
| 1166 | Ga0070665_100514414 | |||
| 1167 | Ga0068855_100058435 | |||
| 1168 | Ga0068855_100165685 | |||
| 1169 | Ga0070664_100081262 | |||
| 1170 | Ga0070664_100082504 | |||
| 1171 | Ga0070664_100444364 | |||
| 1172 | Ga0070664_100785973 | |||
| 1173 | Ga0068854_100017820 | |||
| 1174 | Ga0068854_100022161 | |||
| 1175 | Ga0068854_100028660 | |||
| 1176 | Ga0068854_100048963 | |||
| 1177 | Ga0068854_100092539 | |||
| 1178 | Ga0068854_100216016 | |||
| 1179 | Ga0068856_100004035 | |||
| 1180 | Ga0068856_100018011 | |||
| 1181 | Ga0070702_100001510 | |||
| 1182 | Ga0070702_100008822 | |||
| 1183 | Ga0070702_100019205 | |||
| 1184 | Ga0070702_100419295 | |||
| 1185 | Ga0068852_100004252 | |||
| 1186 | Ga0068852_100007302 | |||
| 1187 | Ga0068852_100055967 | |||
| 1188 | Ga0068852_100093632 | |||
| 1189 | Ga0068852_100158420 | |||
| 1190 | Ga0068852_100268585 | |||
| 1191 | Ga0068852_100269628 | |||
| 1192 | Ga0068852_100782185 | |||
| 1193 | Ga0068859_100022772 | |||
| 1194 | Ga0068859_100035116 | |||
| 1195 | Ga0068859_100058573 | |||
| 1196 | Ga0068859_100134057 | |||
| 1197 | Ga0068859_100183798 | |||
| 1198 | Ga0068864_100000875 | |||
| 1199 | Ga0068864_100008330 | |||
| 1200 | Ga0068864_100011769 | |||
| 1201 | Ga0068864_100043505 | |||
| 1202 | Ga0068864_100045627 | |||
| 1203 | Ga0068864_100104006 | |||
| 1204 | Ga0068864_100189128 | |||
| 1205 | Ga0068864_100239029 | |||
| 1206 | Ga0068864_100472275 | |||
| 1207 | Ga0068866_10003567 | |||
| 1208 | Ga0068866_10006470 | |||
| 1209 | Ga0068861_100003855 | |||
| 1210 | Ga0068861_100015935 | |||
| 1211 | Ga0068861_100026650 | |||
| 1212 | Ga0068861_100244541 | |||
| 1213 | Ga0068851_10025409 | |||
| 1214 | Ga0068851_10048558 | |||
| 1215 | Ga0068851_10434473 | |||
| 1216 | Ga0068870_10007303 | |||
| 1217 | Ga0068870_10196682 | |||
| 1218 | Ga0068870_10219049 | |||
| 1219 | Ga0068863_100002558 | |||
| 1220 | Ga0068863_100010010 | |||
| 1221 | Ga0068863_100010659 | |||
| 1222 | Ga0068863_100035145 | |||
| 1223 | Ga0068863_100051014 | |||
| 1224 | Ga0068863_100081499 | |||
| 1225 | Ga0068863_100085929 | |||
| 1226 | Ga0068863_100096825 | |||
| 1227 | Ga0068863_100152978 | |||
| 1228 | Ga0068863_100429801 | |||
| 1229 | Ga0068858_100000703 | |||
| 1230 | Ga0068858_100013992 | |||
| 1231 | Ga0068858_100032986 | |||
| 1232 | Ga0068858_100107651 | |||
| 1233 | Ga0068858_100279942 | |||
| 1234 | Ga0068858_100568689 | |||
| 1235 | Ga0068860_100003734 | |||
| 1236 | Ga0068860_100033660 | |||
| 1237 | Ga0068860_100043222 | |||
| 1238 | Ga0068860_100092901 | |||
| 1239 | Ga0068860_100187154 | |||
| 1240 | Ga0068860_100228313 | |||
| 1241 | Ga0068862_100084701 | |||
| 1242 | Ga0068862_100917475 | |||
| 1243 | Ga0075365_10016275 | |||
| 1244 | Ga0075365_10321986 | |||
| 1245 | Ga0075432_10005363 | |||
| 1246 | Ga0075432_10042669 | |||
| 1247 | Ga0070715_10034025 | |||
| 1248 | Ga0070715_10385188 | |||
| 1249 | Ga0070716_100224101 | |||
| 1250 | Ga0070712_100152684 | |||
| 1251 | Ga0075367_10086708 | |||
| 1252 | Ga0097621_100001230 | |||
| 1253 | Ga0097621_100006734 | |||
| 1254 | Ga0097621_100011335 | |||
| 1255 | Ga0097621_100063536 | |||
| 1256 | Ga0097621_100141688 | |||
| 1257 | Ga0097621_100191600 | |||
| 1258 | Ga0075370_10066213 | |||
| 1259 | Ga0075370_10252413 | |||
| 1260 | Ga0075370_10367260 | |||
| 1261 | Ga0068871_100012983 | |||
| 1262 | Ga0068871_100017138 | |||
| 1263 | Ga0068871_100069683 | |||
| 1264 | Ga0068871_100098522 | |||
| 1265 | Ga0068871_100427472 | |||
| 1266 | Ga0075431_100193574 | |||
| 1267 | Ga0075433_10016370 | |||
| 1268 | Ga0075434_100005990 | |||
| 1269 | Ga0075434_100485172 | |||
| 1270 | Ga0068865_100001470 | |||
| 1271 | Ga0068865_100007997 | |||
| 1272 | Ga0068865_100730434 | |||
| 1273 | Ga0075436_100033151 | |||
| 1274 | Ga0097620_100022772 | |||
| 1275 | Ga0097620_100035114 | |||
| 1276 | Ga0097620_100058574 | |||
| 1277 | Ga0097620_100134048 | |||
| 1278 | Ga0097620_100183805 | |||
| 1279 | Ga0079104_1000040 | |||
| 1280 | Ga0075435_100003754 | |||
| 1281 | Ga0105240_10145647 | |||
| 1282 | Ga0105240_10216771 | |||
| 1283 | Ga0105245_10059383 | |||
| 1284 | Ga0105245_10065787 | |||
| 1285 | Ga0105245_10135159 | |||
| 1286 | Ga0105245_10329311 | |||
| 1287 | Ga0105247_10006783 | |||
| 1288 | Ga0105247_10628123 | |||
| 1289 | Ga0114129_10000114 | |||
| 1290 | Ga0114129_10175873 | |||
| 1291 | Ga0114129_10210660 | |||
| 1292 | Ga0114129_10568288 | |||
| 1293 | Ga0114129_11046435 | |||
| 1294 | Ga0114129_11060650 | |||
| 1295 | Ga0105243_10014299 | |||
| 1296 | Ga0105243_10058093 | |||
| 1297 | Ga0105243_10078734 | |||
| 1298 | Ga0105243_10118359 | |||
| 1299 | Ga0105241_10007301 | |||
| 1300 | Ga0105241_10024754 | |||
| 1301 | Ga0105241_10175746 | |||
| 1302 | Ga0105241_10443225 | |||
| 1303 | Ga0105242_10014074 | |||
| 1304 | Ga0105242_10276195 | |||
| 1305 | Ga0105242_10740995 | |||
| 1306 | Ga0105248_10016659 | |||
| 1307 | Ga0105248_10026400 | |||
| 1308 | Ga0105248_10037374 | |||
| 1309 | Ga0105248_10050259 | |||
| 1310 | Ga0105248_10152200 | |||
| 1311 | Ga0105248_10465756 | |||
| 1312 | Ga0105237_10001971 | |||
| 1313 | Ga0105237_10184040 | |||
| 1314 | Ga0105238_10022974 | |||
| 1315 | Ga0105238_10026817 | |||
| 1316 | Ga0105238_10085150 | |||
| 1317 | Ga0105249_10101261 | |||
| 1318 | Ga0105249_10197204 | |||
| 1319 | Ga0105249_10254939 | |||
| 1320 | Ga0105239_10000531 | |||
| 1321 | Ga0105246_10007831 | |||
| 1322 | Ga0157316_1004889 | |||
| 1323 | Ga0157373_10041996 | |||
| 1324 | Ga0157373_10063675 | |||
| 1325 | Ga0157371_10049369 | |||
| 1326 | Ga0157370_10028511 | |||
| 1327 | Ga0157370_10503974 | |||
| 1328 | Ga0157369_10027535 | |||
| 1329 | Ga0157369_10418734 | |||
| 1330 | Ga0157374_10035458 | |||
| 1331 | Ga0157374_10071381 | |||
| 1332 | Ga0157374_10117491 | |||
| 1333 | Ga0157374_10376948 | |||
| 1334 | Ga0157374_10639801 | |||
| 1335 | Ga0157374_10810223 | |||
| 1336 | Ga0157378_10038089 | |||
| 1337 | Ga0157378_10825634 | |||
| 1338 | Ga0163162_10016188 | |||
| 1339 | Ga0163162_10069089 | |||
| 1340 | Ga0163162_10086356 | |||
| 1341 | Ga0163162_10204736 | |||
| 1342 | Ga0163162_10228300 | |||
| 1343 | Ga0163162_10820953 | |||
| 1344 | Ga0163162_11451725 | |||
| 1345 | Ga0157372_10028330 | |||
| 1346 | Ga0157372_10100758 | |||
| 1347 | Ga0157372_10187981 | |||
| 1348 | Ga0157372_10282825 | |||
| 1349 | Ga0157375_10005937 | |||
| 1350 | Ga0157375_10039133 | |||
| 1351 | Ga0157375_10094763 | |||
| 1352 | Ga0157375_10096018 | |||
| 1353 | Ga0157375_10220688 | |||
| 1354 | Ga0157375_10265562 | |||
| 1355 | Ga0157375_10427534 | |||
| 1356 | Ga0157375_10432144 | |||
| 1357 | Ga0157375_10675732 | |||
| 1358 | Ga0157375_10734819 | |||
| 1359 | Ga0163163_10005258 | |||
| 1360 | Ga0163163_10090065 | |||
| 1361 | Ga0163163_10503704 | |||
| 1362 | Ga0163163_10542633 | |||
| 1363 | Ga0157380_10004961 | |||
| 1364 | Ga0157380_10010895 | |||
| 1365 | Ga0157380_10079110 | |||
| 1366 | Ga0157380_10099648 | |||
| 1367 | Ga0157380_10117345 | |||
| 1368 | Ga0157380_10775725 | |||
| 1369 | Ga0157380_10905994 | |||
| 1370 | Ga0157377_10000022 | |||
| 1371 | Ga0157377_10001663 | |||
| 1372 | Ga0157377_10002890 | |||
| 1373 | Ga0157377_10210438 | |||
| 1374 | Ga0157379_10010626 | |||
| 1375 | Ga0157379_10010802 | |||
| 1376 | Ga0157379_10022405 | |||
| 1377 | Ga0157379_10027535 | |||
| 1378 | Ga0157379_10044121 | |||
| 1379 | Ga0157379_10051355 | |||
| 1380 | Ga0157379_10053977 | |||
| 1381 | Ga0157379_10057691 | |||
| 1382 | Ga0157379_10063401 | |||
| 1383 | Ga0157379_10137731 | |||
| 1384 | Ga0157376_10009598 | |||
| 1385 | Ga0157376_10012290 | |||
| 1386 | Ga0157376_10127296 | |||
| 1387 | Ga0157376_10232269 | |||
| 1388 | Ga0157376_10383852 | |||
| 1389 | Ga0157376_10510605 | |||
| 1390 | Ga0157376_10637851 | |||
| 1391 | Ga0157376_10693663 | |||
| 1392 | Ga0182007_10139375 | |||
| 1393 | Ga0163161_10010482 | |||
| 1394 | Ga0163161_10061902 | |||
| 1395 | Ga0163161_10085889 | |||
| 1396 | Ga0163161_10321773 | |||
| 1397 | Ga0206356_11249198 | |||
| 1398 | Ga0206354_11204485 | |||
| 1399 | Ga0206353_10288226 | |||
| 1400 | Ga0213876_10032532 | |||
| 1401 | Ga0209435_100010 | |||
| 1402 | Ga0209674_108306 | |||
| 1403 | Ga0209563_100005 | |||
| 1404 | Ga0207425_1000774 | |||
| 1405 | Ga0207425_1002031 | |||
| 1406 | Ga0209646_1000001 | |||
| 1407 | Ga0209759_1000001 | |||
| 1408 | Ga0209129_1011340 | |||
| 1409 | Ga0209565_1000036 | |||
| 1410 | Ga0209565_1001584 | |||
| 1411 | Ga0209565_1006670 | |||
| 1412 | Ga0209673_1000008 | |||
| 1413 | Ga0209130_1000622 | |||
| 1414 | Ga0209130_1047807 | |||
| 1415 | Ga0209675_1000106 | |||
| 1416 | Ga0209675_1003163 | |||
| 1417 | Ga0209676_1000007 | |||
| 1418 | Ga0209676_1003255 | |||
| 1419 | Ga0209025_1002522 | |||
| 1420 | Ga0209025_1008912 | |||
| 1421 | Ga0209025_1012221 | |||
| 1422 | Ga0209025_1063541 | |||
| 1423 | Ga0209564_1000487 | |||
| 1424 | Ga0209564_1001215 | |||
| 1425 | Ga0209564_1001602 | |||
| 1426 | Ga0209758_1016244 | |||
| 1427 | Ga0209050_1000003 | |||
| 1428 | Ga0209050_1004196 | |||
| 1429 | Ga0209256_1000001 | |||
| 1430 | Ga0209256_1000113 | |||
| 1431 | Ga0207426_1000988 | |||
| 1432 | Ga0209051_1000003 | |||
| 1433 | Ga0209051_1000020 | |||
| 1434 | Ga0209051_1000281 | |||
| 1435 | Ga0209051_1014881 | |||
| 1436 | Ga0209257_1000020 | |||
| 1437 | Ga0209257_1000039 | |||
| 1438 | Ga0209257_1000085 | |||
| 1439 | Ga0207697_10017271 | |||
| 1440 | Ga0207656_10016593 | |||
| 1441 | Ga0207656_10036064 | |||
| 1442 | Ga0207656_10132169 | |||
| 1443 | Ga0207682_10000158 | |||
| 1444 | Ga0207682_10002043 | |||
| 1445 | Ga0207682_10006828 | |||
| 1446 | Ga0207682_10024321 | |||
| 1447 | Ga0207682_10103131 | |||
| 1448 | Ga0207692_10044183 | |||
| 1449 | Ga0207642_10002232 | |||
| 1450 | Ga0207642_10011633 | |||
| 1451 | Ga0207710_10016966 | |||
| 1452 | Ga0207688_10010279 | |||
| 1453 | Ga0207688_10025807 | |||
| 1454 | Ga0207688_10135796 | |||
| 1455 | Ga0207680_10013624 | |||
| 1456 | Ga0207680_10028229 | |||
| 1457 | Ga0207680_10073448 | |||
| 1458 | Ga0207645_10005861 | |||
| 1459 | Ga0207645_10010859 | |||
| 1460 | Ga0207645_10012965 | |||
| 1461 | Ga0207643_10000126 | |||
| 1462 | Ga0207643_10032526 | |||
| 1463 | Ga0207643_10150704 | |||
| 1464 | Ga0207643_10170818 | |||
| 1465 | Ga0207705_10057712 | |||
| 1466 | Ga0207705_10209948 | |||
| 1467 | Ga0207705_10291073 | |||
| 1468 | Ga0207684_10034594 | |||
| 1469 | Ga0207654_10031438 | |||
| 1470 | Ga0207654_10242835 | |||
| 1471 | Ga0207707_10025955 | |||
| 1472 | Ga0207707_10070363 | |||
| 1473 | Ga0207695_10182479 | |||
| 1474 | Ga0207671_10010045 | |||
| 1475 | Ga0207663_10115051 | |||
| 1476 | Ga0207660_10111562 | |||
| 1477 | Ga0207662_10002506 | |||
| 1478 | Ga0207662_10022676 | |||
| 1479 | Ga0207657_10020055 | |||
| 1480 | Ga0207657_10029332 | |||
| 1481 | Ga0207657_10093594 | |||
| 1482 | Ga0207657_10522372 | |||
| 1483 | Ga0207649_10014470 | |||
| 1484 | Ga0207649_10213427 | |||
| 1485 | Ga0207649_10534607 | |||
| 1486 | Ga0207652_10020046 | |||
| 1487 | Ga0207652_10075067 | |||
| 1488 | Ga0207652_10921281 | |||
| 1489 | Ga0207681_10000205 | |||
| 1490 | Ga0207681_10018140 | |||
| 1491 | Ga0207681_10022630 | |||
| 1492 | Ga0207681_10063447 | |||
| 1493 | Ga0207681_10468195 | |||
| 1494 | Ga0207694_10072035 | |||
| 1495 | Ga0207694_10085702 | |||
| 1496 | Ga0207650_10000480 | |||
| 1497 | Ga0207650_10003292 | |||
| 1498 | Ga0207650_10021208 | |||
| 1499 | Ga0207650_10091213 | |||
| 1500 | Ga0207650_10167785 | |||
| 1501 | Ga0207650_10228028 | |||
| 1502 | Ga0207659_10000118 | |||
| 1503 | Ga0207659_10001268 | |||
| 1504 | Ga0207659_10003663 | |||
| 1505 | Ga0207659_10015369 | |||
| 1506 | Ga0207659_10027958 | |||
| 1507 | Ga0207659_10047812 | |||
| 1508 | Ga0207659_10059678 | |||
| 1509 | Ga0207659_10136785 | |||
| 1510 | Ga0207659_10298987 | |||
| 1511 | Ga0207687_10121766 | |||
| 1512 | Ga0207687_10250901 | |||
| 1513 | Ga0207687_10335716 | |||
| 1514 | Ga0207687_10413634 | |||
| 1515 | Ga0207687_10850893 | |||
| 1516 | Ga0207700_10066304 | |||
| 1517 | Ga0207700_10070045 | |||
| 1518 | Ga0207644_10003975 | |||
| 1519 | Ga0207644_10019508 | |||
| 1520 | Ga0207644_10104590 | |||
| 1521 | Ga0207644_10133954 | |||
| 1522 | Ga0207644_10168230 | |||
| 1523 | Ga0207644_10297784 | |||
| 1524 | Ga0207644_10457128 | |||
| 1525 | Ga0207690_10028353 | |||
| 1526 | Ga0207690_10241539 | |||
| 1527 | Ga0207706_10000933 | |||
| 1528 | Ga0207706_10019724 | |||
| 1529 | Ga0207706_10025747 | |||
| 1530 | Ga0207706_10036217 | |||
| 1531 | Ga0207706_10169666 | |||
| 1532 | Ga0207706_10321995 | |||
| 1533 | Ga0207686_10217585 | |||
| 1534 | Ga0207709_10013768 | |||
| 1535 | Ga0207709_10198844 | |||
| 1536 | Ga0207670_10167890 | |||
| 1537 | Ga0207669_10000706 | |||
| 1538 | Ga0207669_10007121 | |||
| 1539 | Ga0207669_10050204 | |||
| 1540 | Ga0207669_10084058 | |||
| 1541 | Ga0207669_10103604 | |||
| 1542 | Ga0207669_10203135 | |||
| 1543 | Ga0207704_10001897 | |||
| 1544 | Ga0207704_10003903 | |||
| 1545 | Ga0207704_10192055 | |||
| 1546 | Ga0207704_10240048 | |||
| 1547 | Ga0207691_10000238 | |||
| 1548 | Ga0207691_10008515 | |||
| 1549 | Ga0207691_10027884 | |||
| 1550 | Ga0207691_10038127 | |||
| 1551 | Ga0207691_10047509 | |||
| 1552 | Ga0207691_10062672 | |||
| 1553 | Ga0207691_10083361 | |||
| 1554 | Ga0207691_10097071 | |||
| 1555 | Ga0207691_10132362 | |||
| 1556 | Ga0207691_10158640 | |||
| 1557 | Ga0207691_10291174 | |||
| 1558 | Ga0207691_10345436 | |||
| 1559 | Ga0207711_10031004 | |||
| 1560 | Ga0207711_10031635 | |||
| 1561 | Ga0207711_10035637 | |||
| 1562 | Ga0207711_10054798 | |||
| 1563 | Ga0207711_10083057 | |||
| 1564 | Ga0207711_10105794 | |||
| 1565 | Ga0207711_10228744 | |||
| 1566 | Ga0207689_10000150 | |||
| 1567 | Ga0207689_10006391 | |||
| 1568 | Ga0207689_10012442 | |||
| 1569 | Ga0207689_10019637 | |||
| 1570 | Ga0207661_10018031 | |||
| 1571 | Ga0207679_10022926 | |||
| 1572 | Ga0207679_10099825 | |||
| 1573 | Ga0207679_10283325 | |||
| 1574 | Ga0207667_10148644 | |||
| 1575 | Ga0207651_10001131 | |||
| 1576 | Ga0207651_10018265 | |||
| 1577 | Ga0207651_10043471 | |||
| 1578 | Ga0207651_10078593 | |||
| 1579 | Ga0207651_10134222 | |||
| 1580 | Ga0207651_10180917 | |||
| 1581 | Ga0207651_10333218 | |||
| 1582 | Ga0207651_10669978 | |||
| 1583 | Ga0207651_10715977 | |||
| 1584 | Ga0207712_10052734 | |||
| 1585 | Ga0207712_10070221 | |||
| 1586 | Ga0207668_10028131 | |||
| 1587 | Ga0207668_10033237 | |||
| 1588 | Ga0207640_10031917 | |||
| 1589 | Ga0207640_10042745 | |||
| 1590 | Ga0207640_10061281 | |||
| 1591 | Ga0207658_10014469 | |||
| 1592 | Ga0207658_10065840 | |||
| 1593 | Ga0207658_10073115 | |||
| 1594 | Ga0207658_10239220 | |||
| 1595 | Ga0207658_10651525 | |||
| 1596 | Ga0207677_10005476 | |||
| 1597 | Ga0207677_10009321 | |||
| 1598 | Ga0207677_10132024 | |||
| 1599 | Ga0207677_10137224 | |||
| 1600 | Ga0207677_10141682 | |||
| 1601 | Ga0207677_10305244 | |||
| 1602 | Ga0207677_10464460 | |||
| 1603 | Ga0207703_10002955 | |||
| 1604 | Ga0207703_10008624 | |||
| 1605 | Ga0207703_10016069 | |||
| 1606 | Ga0207703_10030511 | |||
| 1607 | Ga0207703_10297844 | |||
| 1608 | Ga0207639_10245631 | |||
| 1609 | Ga0207639_10584088 | |||
| 1610 | Ga0207678_10000821 | |||
| 1611 | Ga0207678_10002944 | |||
| 1612 | Ga0207678_10028904 | |||
| 1613 | Ga0207678_10071519 | |||
| 1614 | Ga0207708_10022773 | |||
| 1615 | Ga0207708_10429113 | |||
| 1616 | Ga0207702_10002877 | |||
| 1617 | Ga0207702_10021046 | |||
| 1618 | Ga0207702_10024026 | |||
| 1619 | Ga0207702_10228894 | |||
| 1620 | Ga0207702_10564109 | |||
| 1621 | Ga0207641_10003621 | |||
| 1622 | Ga0207641_10016238 | |||
| 1623 | Ga0207641_10025306 | |||
| 1624 | Ga0207641_10042640 | |||
| 1625 | Ga0207641_10047000 | |||
| 1626 | Ga0207641_10055755 | |||
| 1627 | Ga0207641_10097217 | |||
| 1628 | Ga0207641_10813152 | |||
| 1629 | Ga0207648_10000032 | |||
| 1630 | Ga0207648_10003526 | |||
| 1631 | Ga0207648_10005311 | |||
| 1632 | Ga0207648_10029392 | |||
| 1633 | Ga0207648_10042712 | |||
| 1634 | Ga0207648_10044866 | |||
| 1635 | Ga0207648_10185127 | |||
| 1636 | Ga0207648_10364231 | |||
| 1637 | Ga0207648_10974953 | |||
| 1638 | Ga0207676_10012629 | |||
| 1639 | Ga0207676_10019318 | |||
| 1640 | Ga0207676_10020581 | |||
| 1641 | Ga0207676_10020892 | |||
| 1642 | Ga0207676_10020980 | |||
| 1643 | Ga0207676_10034951 | |||
| 1644 | Ga0207676_10058347 | |||
| 1645 | Ga0207676_10096496 | |||
| 1646 | Ga0207675_100001131 | |||
| 1647 | Ga0207675_100040389 | |||
| 1648 | Ga0207675_100099102 | |||
| 1649 | Ga0207675_100840349 | |||
| 1650 | Ga0207683_10000079 | |||
| 1651 | Ga0207683_10000844 | |||
| 1652 | Ga0207683_10013866 | |||
| 1653 | Ga0207683_10044919 | |||
| 1654 | Ga0207683_10045569 | |||
| 1655 | Ga0207683_10112850 | |||
| 1656 | Ga0207683_10160593 | |||
| 1657 | Ga0207683_10168636 | |||
| 1658 | Ga0207683_10336385 | |||
| 1659 | Ga0207683_10403392 | |||
| 1660 | Ga0207683_10433701 | |||
| 1661 | Ga0207698_10005102 | |||
| 1662 | Ga0207698_10011027 | |||
| 1663 | Ga0207698_10016930 | |||
| 1664 | Ga0207698_10017008 | |||
| 1665 | Ga0207698_10017398 | |||
| 1666 | Ga0207698_10041127 | |||
| 1667 | Ga0207698_10063780 | |||
| 1668 | Ga0207698_10428754 | |||
| 1669 | Ga0207698_10825519 | |||
| 1670 | Ga0209281_1000074 | |||
| 1671 | Ga0209281_1015948 | |||
| 1672 | Ga0207428_10493521 | |||
| 1673 | Ga0268266_10018888 | |||
| 1674 | Ga0268264_10004410 | |||
| 1675 | Ga0268264_10056204 | |||
| 1676 | Ga0268264_10143525 | |||
| 1677 | Ga0265318_10063423 | |||
| 1678 | Ga0265323_10003257 | |||
| 1679 | Ga0265323_10010912 | |||
| 1680 | Ga0265322_10000199 | |||
| 1681 | Ga0265336_10000003 | |||
| 1682 | Ga0307517_10000810 | |||
| 1683 | Ga0307515_10000110 | |||
| 1684 | Ga0307515_10015338 | |||
| 1685 | Ga0307515_10117740 | |||
| 1686 | Ga0307515_10278698 | |||
| 1687 | Ga0265324_10000908 | |||
| 1688 | Ga0307512_10004629 | |||
| 1689 | Ga0265329_10017929 | |||
| 1690 | Ga0265316_10000456 | |||
| 1691 | Ga0265316_10026553 | |||
| 1692 | Ga0307513_10000011 | |||
| 1693 | Ga0307513_10001586 | |||
| 1694 | Ga0307513_10126205 | |||
| 1695 | Ga0307513_10158342 | |||
| 1696 | Ga0307509_10000802 | |||
| 1697 | Ga0307509_10003238 | |||
| 1698 | Ga0307509_10012626 | |||
| 1699 | Ga0307509_10022383 | |||
| 1700 | Ga0307509_10023332 | |||
| 1701 | Ga0307509_10030645 | |||
| 1702 | Ga0307509_10178615 | |||
| 1703 | Ga0307408_100022685 | |||
| 1704 | Ga0307508_10002132 | |||
| 1705 | Ga0307508_10033344 | |||
| 1706 | Ga0307508_10409992 | |||
| 1707 | Ga0307514_10018100 | |||
| 1708 | Ga0265314_10047501 | |||
| 1709 | Ga0265342_10007343 | |||
| 1710 | Ga0307516_10001054 | |||
| 1711 | Ga0307405_10005514 | |||
| 1712 | Ga0307405_10007548 | |||
| 1713 | Ga0307413_10004470 | |||
| 1714 | Ga0307410_10041255 | |||
| 1715 | Ga0307410_10268228 | |||
| 1716 | Ga0307406_10007622 | |||
| 1717 | Ga0307406_10048836 | |||
| 1718 | Ga0307407_10020188 | |||
| 1719 | Ga0307407_10129209 | |||
| 1720 | Ga0307412_10015518 | |||
| 1721 | Ga0307412_10490239 | |||
| 1722 | Ga0307409_100118378 | |||
| 1723 | Ga0307409_100234675 | |||
| 1724 | Ga0307409_100392134 | |||
| 1725 | Ga0307409_100832013 | |||
| 1726 | Ga0307416_100054349 | |||
| 1727 | Ga0307416_100069120 | |||
| 1728 | Ga0307416_100585444 | |||
| 1729 | Ga0307416_100723826 | |||
| 1730 | Ga0307414_10019903 | |||
| 1731 | Ga0307411_10001107 | |||
| 1732 | Ga0307411_10155863 | |||
| 1733 | Ga0307411_10878998 | |||
| 1734 | Ga0307415_100010508 | |||
| 1735 | Ga0307415_100112857 | |||
| 1736 | Ga0307415_100279896 | |||
| 1737 | Ga0307510_10009294 | |||
| 1738 | Ga0307510_10009432 | |||
| 1739 | Ga0307510_10122397 | |||
| 1740 | Ga0373929_0011337 | |||
| 1741 | Ga0373940_0027381 | |||
| 1742 | Ga0373932_0038750 | |||
| 1743 | Ga0373936_0207513 | |||
| 1744 | Ga0373943_0206506 | |||
| 1745 | Ga0373955_0135855 | |||
| 1746 | Ga0373931_0004895 | |||
| 1747 | Ga0373931_0014121 | |||
| 1748 | Ga0373931_0018946 | |||
| 1749 | Ga0373931_0104620 | |||
| 1750 | Ga0373927_0282930 | |||
| 1751 | Ga0373933_0046455 | |||
| 1752 | Ga0373937_0058064 | |||
| 1753 | Ga0373937_0177093 | |||
| 1754 | Ga0373925_0111737 | |||
| 1755 | Ga0373925_0431086 | |||
| 1756 | Ga0395900_0243828 | |||
| 1757 | Ga0395905_0000026 | |||
| 1758 | Ga0395905_0055676 | |||
| 1759 | Ga0395905_0248099 | |||
| 1760 | Ga0395905_0307890 | |||
| 1761 | Ga0395905_0568640 | |||
| 1762 | Ga0395905_0748583 | |||
| 1763 | Ga0395901_0132121 | |||
| 1764 | Ga0436365_0361177 | |||
| 1765 | Ga0439436_0000086 | |||
| 1766 | Ga0439439_0008548 | |||
| 1767 | Ga0439466_0005453 | |||
| 1768 | Ga0439465_0000464 | |||
| 1769 | Ga0451800_0010811 | |||
| 1770 | Ga0451807_0017675 | |||
| 1771 | Ga0451853_1666867 | |||
| 1772 | Ga0439431_0007902 | |||
| 1773 | Ga0439445_0000486 | |||
| 1774 | Ga0439448_0012659 | |||
| 1775 | Ga0439432_005058 | |||
| 1776 | Ga0439432_018316 | |||
| 1777 | Ga0439449_0000300 | |||
| 1778 | Ga0439452_001494 | |||
| 1779 | Ga0439457_020155 | |||
| 1780 | Ga0439462_0001329 | |||
| 1781 | Ga0439462_0002187 | |||
| 1782 | Ga0450919_000456 | |||
| 1783 | Ga0439446_0000332 | |||
| 1784 | Ga0439458_0012656 | |||
| 1785 | Ga0439459_0048958 | |||
| 1786 | Ga0439464_0147910 | |||
| 1787 | Ga0450918_002380 | |||
| 1788 | Ga0453683_0004804 | |||
| 1789 | Ga0466965_0027812 | |||
| 1790 | Ga0453684_0007800 | |||
| 1791 | Ga0453684_0151671 | |||
| 1792 | Ga0466970_0081755 | |||
| 1793 | Ga0466960_0015324 | |||
| 1794 | Ga0466967_0022959 | |||
| 1795 | Ga0466967_0068005 | |||
| 1796 | Ga0466967_0463031 | |||
| 1797 | Ga0495592_0000272 | |||
| 1798 | Ga0495603_0370864 | |||
| 1799 | Ga0495629_0141305 | |||
| 1800 | Ga0495629_0204716 | |||
| 1801 | Ga0495580_0380850 | |||
| 1802 | Ga0495639_0072671 | |||
| 1803 | Ga0495585_0240405 | |||
| 1804 | Ga0495594_0172390 | |||
| 1805 | Ga0495610_0101621 | |||
| 1806 | Ga0495620_0085972 | |||
| 1807 | Ga0495628_0342193 | |||
| 1808 | Ga0495630_0240583 | |||
| 1809 | Ga0495643_0028708 | |||
| 1810 | Ga0495648_0092742 | |||
| 1811 | Ga0495586_0212541 | |||
| 1812 | Ga0495598_0091642 | |||
| 1813 | Ga0495645_0352094 | |||
| 1814 | Ga0495667_0206930 | |||
| 1815 | Ga0495656_0003749 | |||
| 1816 | Ga0495599_0246634 | |||
| 1817 | Ga0495646_0061312 | |||
| 1818 | Ga0495647_0188710 | |||
| 1819 | Ga0495658_0060520 | |||
| 1820 | Ga0495658_0094143 | |||
| 1821 | Ga0495613_0153308 | |||
| 1822 | Ga0495624_0409286 | |||
| 1823 | Ga0495604_0375788 | |||
| 1824 | Ga0495636_0132374 | |||
| 1825 | Ga0495681_0166474 | |||
| 1826 | Ga0495684_0406835 | |||
| 1827 | Ga0495686_0003640 | |||
| 1828 | Ga0495686_0083309 | |||
| 1829 | Ga0495615_0030324 | |||
| 1830 | Ga0496100_0002898 | |||
| 1831 | Ga0496100_0128746 | |||
| 1832 | Ga0496100_0378677 | |||
| 1833 | Ga0496100_0542201 | |||
| 1834 | Ga0496100_0640813 | |||
| 1835 | Ga0496101_0002087 | |||
| 1836 | Ga0496101_0011436 | |||
| 1837 | Ga0496101_0022835 | |||
| 1838 | Ga0496101_0344501 | |||
| 1839 | Ga0496102_0001109 | |||
| 1840 | Ga0496102_0010119 | |||
| 1841 | Ga0496102_0048432 | |||
| 1842 | Ga0496103_0011381 | |||
| 1843 | Ga0496103_0140546 | |||
| 1844 | Ga0496104_0005004 | |||
| 1845 | Ga0496104_0022800 | |||
| 1846 | Ga0496104_0182487 | |||
| 1847 | Ga0496104_0297480 | |||
| 1848 | Ga0496105_0020021 | |||
| 1849 | Ga0496105_0035471 | |||
| 1850 | Ga0496105_0079410 | |||
| 1851 | Ga0496105_0519307 | |||
| 1852 | Ga0496106_0009849 | |||
| 1853 | Ga0496106_0009864 | |||
| 1854 | Ga0496106_0021246 | |||
| 1855 | Ga0496107_0002258 | |||
| 1856 | Ga0496107_0021980 | |||
| 1857 | Ga0496107_0600618 | |||
| 1858 | Ga0496108_0009344 | |||
| 1859 | Ga0496108_0026830 | |||
| 1860 | Ga0496108_0058254 | |||
| 1861 | Ga0496108_0180337 | |||
| 1862 | Ga0496108_0298480 | |||
| 1863 | Ga0496108_0459634 | |||
| 1864 | Ga0496109_0111943 | |||
| 1865 | Ga0496109_0113761 | |||
| 1866 | Ga0496109_0182361 | |||
| 1867 | Ga0496109_0226342 | |||
| 1868 | Ga0496110_0001863 | |||
| 1869 | Ga0496110_0063219 | |||
| 1870 | Ga0496111_0010154 | |||
| 1871 | Ga0496111_0083712 | |||
| 1872 | Ga0496112_0043821 | |||
| 1873 | Ga0496112_0663212 | |||
| 1874 | Ga0496113_0059891 | |||
| 1875 | Ga0496114_0001480 | |||
| 1876 | Ga0496114_0002558 | |||
| 1877 | Ga0496114_0003140 | |||
| 1878 | Ga0496114_0029841 | |||
| 1879 | Ga0496114_0080624 | |||
| 1880 | Ga0496114_0622929 | |||
| 1881 | Ga0496115_0028775 | |||
| 1882 | Ga0496115_0339912 | |||
| 1883 | Ga0501292_002626 | |||
| 1884 | Ga0501297_015612 | |||
| 1885 | Ga0501298_009377 | |||
| 1886 | Ga0501301_000987 | |||
| 1887 | Ga0501034_0250905 | |||
| 1888 | Ga0501034_0595995 | |||
| 1889 | Ga0501039_0260484 | |||
| 1890 | Ga0501067_0002689 | |||
| 1891 | Ga0501067_0185792 | |||
| 1892 | Ga0501069_0015079 | |||
| 1893 | Ga0501198_000004 | |||
| 1894 | Ga0501206_008319 | |||
| 1895 | Ga0501207_018567 | |||
| 1896 | Ga0501222_000038 | |||
| 1897 | Ga0501252_000809 | |||
| 1898 | Ga0501257_009870 | |||
| 1899 | Ga0501221_109755 | |||
| 1900 | Ga0501265_001086 | |||
| 1901 | nmdc:mga03683_193645_c1 | |||
| 1902 | nmdc:mga0yw44_156079_c1 | |||
| 1903 | nmdc:mga0yw44_206316_c1 | |||
| 1904 | nmdc:mga07m45_352965_c1 | |||
| 1905 | nmdc:mga05p37_1507_c1 | |||
| 1906 | nmdc:mga05p37_343680_c1 | |||
| 1907 | nmdc:mga08y16_593114_c1 | |||
| 1908 | nmdc:mga0n895_3433_c1 | |||
| 1909 | nmdc:mga0a205_65042_c1 | |||
| 1910 | Ga0495612_0023758 | |||
| 1911 | Ga0495619_0097206 | |||
| 1912 | Ga0500644_0001734 | |||
| 1913 | Ga0500644_0014473 | |||
| 1914 | Ga0500583_0019283 | |||
| 1915 | Ga0500651_0014926 | |||
| 1916 | Ga0500566_0379699 | |||
| 1917 | Ga0500593_004651 | |||
| 1918 | Ga0500652_102749 | |||
| 1919 | Ga0500559_0000022 | |||
| 1920 | Ga0500559_0125696 | |||
| 1921 | Ga0500564_041112 | |||
| 1922 | Ga0500568_0012032 | |||
| 1923 | Ga0500590_000246 | |||
| 1924 | Ga0500622_0000498 | |||
| 1925 | Ga0500645_000114 | |||
| 1926 | Ga0500645_002232 | |||
| 1927 | Ga0501084_0096638 | |||
| 1928 | 2511243286 | |||
| 1929 | 2643865843 | |||
| 1930 | 2644060466 | |||
| 1931 | 2644073788 | |||
| 1932 | 2644248278 | |||
| 1933 | 2885195931 | |||
| 1934 | 2894025595 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jnw-assembly1.cif.gz_A-2 | active site structure of e. coli pyridoxine 5'-phosphate oxidase | 0.9758 | 7 | 216 |
| 1dnl-assembly1.cif.gz_A | x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution | 0.9588 | 18 | 216 |
| 6ylz-assembly1.cif.gz_AAA-2 | x-ray structure of the k72i,y129f,r133l, h199a quadruple mutant of pnp-oxidase from e. coli | 0.9586 | 18 | 216 |
| 1dnl-assembly1.cif.gz_A | x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution | 0.9541 | 18 | 216 |
| 1jnw-assembly1.cif.gz_A-2 | active site structure of e. coli pyridoxine 5'-phosphate oxidase | 0.9535 | 7 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LTX3_323_519_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9842 | 15 | 204 | 2.30.110.10 |
| af_A0A1R3LXN8_584_738_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9759 | 15 | 166 | 2.30.110.10 |
| 1g78A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.97 | 18 | 216 | 2.30.110.10 |
| 1g78A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9651 | 18 | 216 | 2.30.110.10 |
| af_Q54YS6_26_227_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9602 | 18 | 216 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V2T6Z1-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) | 0.9907 | 8 | 179 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A538P7C7-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) | 0.9893 | 7 | 216 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A4Y9SP62-F1-model_v4 | Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) | 0.9892 | 8 | 216 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A836UTG3-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) | 0.9889 | 18 | 165 |
GO:0004733
GO:0008615 GO:0010181 |
| AF-A0A519I4P0-F1-model_v4 | deleted | 0.988 | 45 | 216 |
|