F487041
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 968 | 383 | 967 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300005340|Ga0070689_100249975|Ga0070689_1002499752 |
| Length | 270 |
| Sequence | MGIVLRSQAEIDKLRRANQLVGRVLAELRAMVTPGVTTQDIDEVAEARVREAGAKPAFKGYHGYPATVCASINEQVVHGIPSARPLVKGDIVSIDMGAVLDGYFGDCAVTVPVSDIASEASELLRVTEESLFRGIDAVKPGARVSDIGAAVQQHVEAAGFSVVREFVGHGIGTSLHEEPQIANYGPAGHGPRLSEGMVFAIEPMVNAGTPDVKVLADGWTAVTRDGRLSAHFEHTVVVTREGCEILTLLAADAGRAKQLLGAAVRSAYGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 129 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 137 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 138 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 232 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 234 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 304 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 305 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 306 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 307 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 308 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 309 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 310 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 311 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 315 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 316 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 317 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 318 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 319 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 321 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 323 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 324 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 325 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 327 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 328 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 329 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 330 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 331 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 332 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 334 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 336 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 337 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 338 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 339 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 340 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 341 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 342 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 344 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 345 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 346 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 347 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 348 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 349 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.6 |
| Metatranscriptomes | 9.3 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0.1 |
| Rhizoplane | 4.65 |
| Rhizosphere | 94.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000185 | 3300000546 | Bacteria | 10421 |
| 2 | rootH2_10094920 | 3300003320 | Bacteria | 1342 |
| 3 | rootH1_10245303 | 3300003323 | Unclassified | 1160 |
| 4 | Ga0058863_10007402 | 3300004799 | Bacteria | 1389 |
| 5 | Ga0058863_10026251 | 3300004799 | Bacteria | 4666 |
| 6 | Ga0058863_10107058 | 3300004799 | Bacteria | 2349 |
| 7 | Ga0058861_10061883 | 3300004800 | Bacteria | 2429 |
| 8 | Ga0058861_10190128 | 3300004800 | Bacteria | 1733 |
| 9 | Ga0058861_11824691 | 3300004800 | Bacteria | 1432 |
| 10 | Ga0058860_12198664 | 3300004801 | Bacteria | 5509 |
| 11 | Ga0058862_10141803 | 3300004803 | Bacteria | 2984 |
| 12 | Ga0058862_10144175 | 3300004803 | Bacteria | 3897 |
| 13 | Ga0058862_10197740 | 3300004803 | Bacteria | 5441 |
| 14 | Ga0058862_10250586 | 3300004803 | Bacteria | 2354 |
| 15 | Ga0065712_10027462 | 3300005290 | Bacteria | 1546 |
| 16 | Ga0065715_10023180 | 3300005293 | Bacteria | 2058 |
| 17 | Ga0070676_10004776 | 3300005328 | Bacteria | 7163 |
| 18 | Ga0070676_10036288 | 3300005328 | Bacteria | 2840 |
| 19 | Ga0070683_100099993 | 3300005329 | Bacteria | 2730 |
| 20 | Ga0070683_100114311 | 3300005329 | Bacteria | 2547 |
| 21 | Ga0070683_100122721 | 3300005329 | Bacteria | 2454 |
| 22 | Ga0070683_100186830 | 3300005329 | Bacteria | 1967 |
| 23 | Ga0070683_100347730 | 3300005329 | Bacteria | 1412 |
| 24 | Ga0070683_100366021 | 3300005329 | Bacteria | 1373 |
| 25 | Ga0070683_100453679 | 3300005329 | Bacteria | 1223 |
| 26 | Ga0070690_100032721 | 3300005330 | Bacteria | 3249 |
| 27 | Ga0070690_100046535 | 3300005330 | Bacteria | 2758 |
| 28 | Ga0070690_100327958 | 3300005330 | Bacteria | 1105 |
| 29 | Ga0070670_100076304 | 3300005331 | Bacteria | 2880 |
| 30 | Ga0070677_10008739 | 3300005333 | Bacteria | 3418 |
| 31 | Ga0070677_10071319 | 3300005333 | Bacteria | 1462 |
| 32 | Ga0068869_100001846 | 3300005334 | Bacteria | 12731 |
| 33 | Ga0068869_100010773 | 3300005334 | Bacteria | 5973 |
| 34 | Ga0068869_100027435 | 3300005334 | Bacteria | 3970 |
| 35 | Ga0068869_100298461 | 3300005334 | Bacteria | 1300 |
| 36 | Ga0070666_10014850 | 3300005335 | Bacteria | 4962 |
| 37 | Ga0070680_100016919 | 3300005336 | Bacteria | 5741 |
| 38 | Ga0070680_100039076 | 3300005336 | Bacteria | 3840 |
| 39 | Ga0070680_100107636 | 3300005336 | Bacteria | 2319 |
| 40 | Ga0070680_100250794 | 3300005336 | Bacteria | 1496 |
| 41 | Ga0070680_100638141 | 3300005336 | Bacteria | 915 |
| 42 | Ga0068868_100006530 | 3300005338 | Bacteria | 8259 |
| 43 | Ga0068868_100071322 | 3300005338 | Bacteria | 2770 |
| 44 | Ga0070660_100062076 | 3300005339 | Bacteria | 2902 |
| 45 | Ga0070689_100047225 | 3300005340 | Bacteria | 3319 |
| 46 | Ga0070689_100249975 | 3300005340 | Bacteria | 1463 |
| 47 | Ga0070661_100047556 | 3300005344 | Bacteria | 3140 |
| 48 | Ga0070661_100107749 | 3300005344 | Bacteria | 2078 |
| 49 | Ga0070661_100357641 | 3300005344 | Bacteria | 1147 |
| 50 | Ga0070668_100032434 | 3300005347 | Bacteria | 3975 |
| 51 | Ga0070669_100098899 | 3300005353 | Bacteria | 2198 |
| 52 | Ga0070675_100002788 | 3300005354 | Bacteria | 13157 |
| 53 | Ga0070675_100042746 | 3300005354 | Bacteria | 3703 |
| 54 | Ga0070675_100090126 | 3300005354 | Bacteria | 2568 |
| 55 | Ga0070675_100280787 | 3300005354 | Bacteria | 1463 |
| 56 | Ga0070675_100294260 | 3300005354 | Bacteria | 1429 |
| 57 | Ga0070671_100043889 | 3300005355 | Bacteria | 3715 |
| 58 | Ga0070671_100080002 | 3300005355 | Bacteria | 2732 |
| 59 | Ga0070673_100067958 | 3300005364 | Bacteria | 2852 |
| 60 | Ga0070673_100084232 | 3300005364 | Bacteria | 2585 |
| 61 | Ga0070688_100304949 | 3300005365 | Bacteria | 1152 |
| 62 | Ga0070667_100219341 | 3300005367 | Bacteria | 1693 |
| 63 | Ga0070703_10098924 | 3300005406 | Bacteria | 1025 |
| 64 | Ga0070709_10000423 | 3300005434 | Bacteria | 25611 |
| 65 | Ga0070709_10036190 | 3300005434 | Bacteria | 3005 |
| 66 | Ga0070709_10040857 | 3300005434 | Bacteria | 2854 |
| 67 | Ga0070709_10466381 | 3300005434 | Bacteria | 954 |
| 68 | Ga0070714_100014828 | 3300005435 | Bacteria | 6265 |
| 69 | Ga0070714_100021848 | 3300005435 | Bacteria | 5239 |
| 70 | Ga0070714_100029336 | 3300005435 | Bacteria | 4573 |
| 71 | Ga0070714_100195392 | 3300005435 | Bacteria | 1848 |
| 72 | Ga0070714_100338627 | 3300005435 | Bacteria | 1410 |
| 73 | Ga0070713_100000364 | 3300005436 | Bacteria | 29177 |
| 74 | Ga0070713_100002249 | 3300005436 | Bacteria | 12530 |
| 75 | Ga0070713_100005638 | 3300005436 | Bacteria | 8584 |
| 76 | Ga0070713_100091363 | 3300005436 | Bacteria | 2619 |
| 77 | Ga0070713_100098986 | 3300005436 | Bacteria | 2522 |
| 78 | Ga0070713_100133438 | 3300005436 | Bacteria | 2192 |
| 79 | Ga0070713_100134671 | 3300005436 | Bacteria | 2182 |
| 80 | Ga0070713_100252898 | 3300005436 | Unclassified | 1608 |
| 81 | Ga0070713_100309223 | 3300005436 | Bacteria | 1457 |
| 82 | Ga0070713_100368642 | 3300005436 | Bacteria | 1336 |
| 83 | Ga0070713_100464439 | 3300005436 | Unclassified | 1190 |
| 84 | Ga0070710_10023917 | 3300005437 | Bacteria | 3217 |
| 85 | Ga0070710_10031205 | 3300005437 | Bacteria | 2874 |
| 86 | Ga0070710_10031408 | 3300005437 | Bacteria | 2867 |
| 87 | Ga0070701_10030951 | 3300005438 | Bacteria | 2652 |
| 88 | Ga0070711_100000191 | 3300005439 | Bacteria | 32562 |
| 89 | Ga0070711_100063203 | 3300005439 | Bacteria | 2583 |
| 90 | Ga0070711_100092324 | 3300005439 | Bacteria | 2184 |
| 91 | Ga0070711_100113461 | 3300005439 | Bacteria | 1993 |
| 92 | Ga0070711_100252627 | 3300005439 | Bacteria | 1384 |
| 93 | Ga0070705_100068395 | 3300005440 | Bacteria | 2137 |
| 94 | Ga0070700_100072430 | 3300005441 | Bacteria | 2203 |
| 95 | Ga0070708_100000356 | 3300005445 | Bacteria | 34664 |
| 96 | Ga0070708_100000459 | 3300005445 | Bacteria | 30632 |
| 97 | Ga0070708_100005339 | 3300005445 | Bacteria | 10189 |
| 98 | Ga0070708_100006987 | 3300005445 | Bacteria | 9006 |
| 99 | Ga0070708_100026039 | 3300005445 | Bacteria | 5003 |
| 100 | Ga0070708_100054805 | 3300005445 | Bacteria | 3543 |
| 101 | Ga0070708_100480428 | 3300005445 | Bacteria | 1172 |
| 102 | Ga0070678_100036448 | 3300005456 | Bacteria | 3443 |
| 103 | Ga0070678_100116726 | 3300005456 | Bacteria | 2098 |
| 104 | Ga0070678_100201334 | 3300005456 | Bacteria | 1643 |
| 105 | Ga0070678_100351103 | 3300005456 | Bacteria | 1268 |
| 106 | Ga0070662_100054645 | 3300005457 | Bacteria | 2894 |
| 107 | Ga0070681_10005952 | 3300005458 | Bacteria | 11811 |
| 108 | Ga0070681_10008803 | 3300005458 | Bacteria | 9908 |
| 109 | Ga0070681_10054241 | 3300005458 | Bacteria | 3994 |
| 110 | Ga0070681_10055173 | 3300005458 | Bacteria | 3958 |
| 111 | Ga0070681_10068582 | 3300005458 | Bacteria | 3513 |
| 112 | Ga0070681_10077768 | 3300005458 | Bacteria | 3275 |
| 113 | Ga0070681_10078202 | 3300005458 | Bacteria | 3265 |
| 114 | Ga0070681_10162187 | 3300005458 | Bacteria | 2159 |
| 115 | Ga0070681_10312591 | 3300005458 | Bacteria | 1480 |
| 116 | Ga0070681_10612305 | 3300005458 | Bacteria | 1003 |
| 117 | Ga0068867_100006640 | 3300005459 | Bacteria | 8180 |
| 118 | Ga0068867_100033809 | 3300005459 | Bacteria | 3705 |
| 119 | Ga0068867_100473323 | 3300005459 | Bacteria | 1072 |
| 120 | Ga0070706_100000278 | 3300005467 | Bacteria | 62365 |
| 121 | Ga0070706_100000514 | 3300005467 | Bacteria | 45375 |
| 122 | Ga0070706_100001389 | 3300005467 | Bacteria | 25655 |
| 123 | Ga0070706_100033341 | 3300005467 | Bacteria | 4753 |
| 124 | Ga0070706_100109917 | 3300005467 | Bacteria | 2565 |
| 125 | Ga0070706_100169474 | 3300005467 | Bacteria | 2038 |
| 126 | Ga0070706_100660911 | 3300005467 | Bacteria | 970 |
| 127 | Ga0070707_100000141 | 3300005468 | Bacteria | 67927 |
| 128 | Ga0070707_100000662 | 3300005468 | Bacteria | 34318 |
| 129 | Ga0070707_100013079 | 3300005468 | Bacteria | 7755 |
| 130 | Ga0070707_100025509 | 3300005468 | Bacteria | 5607 |
| 131 | Ga0070707_100036339 | 3300005468 | Bacteria | 4700 |
| 132 | Ga0070707_100044794 | 3300005468 | Bacteria | 4236 |
| 133 | Ga0070707_100061516 | 3300005468 | Bacteria | 3601 |
| 134 | Ga0070707_100066623 | 3300005468 | Bacteria | 3461 |
| 135 | Ga0070707_100301057 | 3300005468 | Bacteria | 1558 |
| 136 | Ga0070698_100000139 | 3300005471 | Bacteria | 65079 |
| 137 | Ga0070698_100002247 | 3300005471 | Bacteria | 21366 |
| 138 | Ga0070698_100002449 | 3300005471 | Bacteria | 20472 |
| 139 | Ga0070698_100004533 | 3300005471 | Bacteria | 15264 |
| 140 | Ga0070698_100046998 | 3300005471 | Bacteria | 4413 |
| 141 | Ga0070698_100131141 | 3300005471 | Bacteria | 2462 |
| 142 | Ga0070698_100215092 | 3300005471 | Bacteria | 1856 |
| 143 | Ga0070698_100303576 | 3300005471 | Bacteria | 1527 |
| 144 | Ga0070698_100329736 | 3300005471 | Bacteria | 1457 |
| 145 | Ga0070699_100000441 | 3300005518 | Bacteria | 39851 |
| 146 | Ga0070699_100001695 | 3300005518 | Bacteria | 20060 |
| 147 | Ga0070699_100001725 | 3300005518 | Bacteria | 19935 |
| 148 | Ga0070699_100003886 | 3300005518 | Bacteria | 13210 |
| 149 | Ga0070699_100057839 | 3300005518 | Bacteria | 3358 |
| 150 | Ga0070699_100093484 | 3300005518 | Bacteria | 2631 |
| 151 | Ga0070699_100131330 | 3300005518 | Bacteria | 2208 |
| 152 | Ga0070699_100214448 | 3300005518 | Bacteria | 1714 |
| 153 | Ga0070699_100240066 | 3300005518 | Bacteria | 1617 |
| 154 | Ga0070699_100272844 | 3300005518 | Bacteria | 1514 |
| 155 | Ga0070679_100022709 | 3300005530 | Bacteria | 6134 |
| 156 | Ga0070679_100030101 | 3300005530 | Bacteria | 5358 |
| 157 | Ga0070679_100046215 | 3300005530 | Bacteria | 4339 |
| 158 | Ga0070679_100081564 | 3300005530 | Bacteria | 3224 |
| 159 | Ga0070679_100185732 | 3300005530 | Bacteria | 2049 |
| 160 | Ga0070679_100355777 | 3300005530 | Bacteria | 1412 |
| 161 | Ga0070679_100790781 | 3300005530 | Unclassified | 892 |
| 162 | Ga0070684_100030620 | 3300005535 | Bacteria | 4573 |
| 163 | Ga0070684_100052579 | 3300005535 | Bacteria | 3543 |
| 164 | Ga0070684_100061067 | 3300005535 | Bacteria | 3298 |
| 165 | Ga0070684_100100706 | 3300005535 | Bacteria | 2580 |
| 166 | Ga0070684_100343658 | 3300005535 | Bacteria | 1372 |
| 167 | Ga0070684_100358534 | 3300005535 | Bacteria | 1342 |
| 168 | Ga0070697_100000181 | 3300005536 | Bacteria | 51962 |
| 169 | Ga0070697_100000975 | 3300005536 | Bacteria | 21592 |
| 170 | Ga0070697_100000993 | 3300005536 | Bacteria | 21455 |
| 171 | Ga0070697_100001451 | 3300005536 | Bacteria | 18044 |
| 172 | Ga0070697_100003489 | 3300005536 | Bacteria | 12085 |
| 173 | Ga0070697_100005121 | 3300005536 | Bacteria | 10067 |
| 174 | Ga0070697_100028160 | 3300005536 | Bacteria | 4498 |
| 175 | Ga0070697_100063174 | 3300005536 | Bacteria | 3023 |
| 176 | Ga0070697_100097515 | 3300005536 | Bacteria | 2439 |
| 177 | Ga0070697_100523131 | 3300005536 | Bacteria | 1038 |
| 178 | Ga0070697_100530093 | 3300005536 | Bacteria | 1032 |
| 179 | Ga0070697_100547244 | 3300005536 | Bacteria | 1015 |
| 180 | Ga0070697_100591626 | 3300005536 | Unclassified | 975 |
| 181 | Ga0068853_100335268 | 3300005539 | Bacteria | 1404 |
| 182 | Ga0070672_100082364 | 3300005543 | Bacteria | 2581 |
| 183 | Ga0070686_100010421 | 3300005544 | Bacteria | 5241 |
| 184 | Ga0070686_100037655 | 3300005544 | Bacteria | 3001 |
| 185 | Ga0070686_100332789 | 3300005544 | Bacteria | 1136 |
| 186 | Ga0070695_100207484 | 3300005545 | Bacteria | 1404 |
| 187 | Ga0070696_100180882 | 3300005546 | Bacteria | 1564 |
| 188 | Ga0070696_100192360 | 3300005546 | Bacteria | 1519 |
| 189 | Ga0070693_100024724 | 3300005547 | Bacteria | 3225 |
| 190 | Ga0070693_100060464 | 3300005547 | Bacteria | 2199 |
| 191 | Ga0070693_100061331 | 3300005547 | Bacteria | 2185 |
| 192 | Ga0070693_100276161 | 3300005547 | Unclassified | 1123 |
| 193 | Ga0070665_100013944 | 3300005548 | Bacteria | 8083 |
| 194 | Ga0070704_100031956 | 3300005549 | Bacteria | 3545 |
| 195 | Ga0068855_100086489 | 3300005563 | Bacteria | 3625 |
| 196 | Ga0068855_100122881 | 3300005563 | Bacteria | 2970 |
| 197 | Ga0068855_100131537 | 3300005563 | Bacteria | 2857 |
| 198 | Ga0068855_100131632 | 3300005563 | Bacteria | 2856 |
| 199 | Ga0068855_100153885 | 3300005563 | Bacteria | 2613 |
| 200 | Ga0070664_100000277 | 3300005564 | Bacteria | 36913 |
| 201 | Ga0070664_100001536 | 3300005564 | Bacteria | 18433 |
| 202 | Ga0070664_100056946 | 3300005564 | Bacteria | 3322 |
| 203 | Ga0068857_100011854 | 3300005577 | Bacteria | 7583 |
| 204 | Ga0068857_100015288 | 3300005577 | Bacteria | 6699 |
| 205 | Ga0068857_100087100 | 3300005577 | Bacteria | 2793 |
| 206 | Ga0068857_100464867 | 3300005577 | Bacteria | 1184 |
| 207 | Ga0068854_100015875 | 3300005578 | Bacteria | 5004 |
| 208 | Ga0068854_100028405 | 3300005578 | Bacteria | 3865 |
| 209 | Ga0068854_100151280 | 3300005578 | Bacteria | 1790 |
| 210 | Ga0068854_100155176 | 3300005578 | Bacteria | 1768 |
| 211 | Ga0068856_100018752 | 3300005614 | Bacteria | 6708 |
| 212 | Ga0068856_100036536 | 3300005614 | Bacteria | 4816 |
| 213 | Ga0068856_100101196 | 3300005614 | Bacteria | 2874 |
| 214 | Ga0068856_100102927 | 3300005614 | Bacteria | 2849 |
| 215 | Ga0068856_100241533 | 3300005614 | Bacteria | 1821 |
| 216 | Ga0068856_100390222 | 3300005614 | Bacteria | 1412 |
| 217 | Ga0068856_100597869 | 3300005614 | Bacteria | 1124 |
| 218 | Ga0068856_100621120 | 3300005614 | Bacteria | 1101 |
| 219 | Ga0068852_100018750 | 3300005616 | Bacteria | 5457 |
| 220 | Ga0068852_100037792 | 3300005616 | Bacteria | 4051 |
| 221 | Ga0068852_100077400 | 3300005616 | Bacteria | 2940 |
| 222 | Ga0068859_100013371 | 3300005617 | Bacteria | 8230 |
| 223 | Ga0068859_100017062 | 3300005617 | Bacteria | 7289 |
| 224 | Ga0068859_100822611 | 3300005617 | Bacteria | 1016 |
| 225 | Ga0068864_100012547 | 3300005618 | Bacteria | 7006 |
| 226 | Ga0068864_100186541 | 3300005618 | Bacteria | 1899 |
| 227 | Ga0068864_100347854 | 3300005618 | Bacteria | 1398 |
| 228 | Ga0068864_100357383 | 3300005618 | Bacteria | 1380 |
| 229 | Ga0068861_100084611 | 3300005719 | Bacteria | 2490 |
| 230 | Ga0068851_10021382 | 3300005834 | Bacteria | 3141 |
| 231 | Ga0068851_10105071 | 3300005834 | Bacteria | 1502 |
| 232 | Ga0068870_10044634 | 3300005840 | Bacteria | 2317 |
| 233 | Ga0068870_10064860 | 3300005840 | Bacteria | 1973 |
| 234 | Ga0068870_10163463 | 3300005840 | Bacteria | 1322 |
| 235 | Ga0068863_100044079 | 3300005841 | Bacteria | 4235 |
| 236 | Ga0068863_100068631 | 3300005841 | Bacteria | 3353 |
| 237 | Ga0068863_100451082 | 3300005841 | Bacteria | 1262 |
| 238 | Ga0068858_100020862 | 3300005842 | Bacteria | 6124 |
| 239 | Ga0068858_100047535 | 3300005842 | Bacteria | 3977 |
| 240 | Ga0068860_100018016 | 3300005843 | Bacteria | 6877 |
| 241 | Ga0068860_100025252 | 3300005843 | Bacteria | 5734 |
| 242 | Ga0068860_100173182 | 3300005843 | Bacteria | 2085 |
| 243 | Ga0068860_100252271 | 3300005843 | Bacteria | 1719 |
| 244 | Ga0068860_100390052 | 3300005843 | Bacteria | 1376 |
| 245 | Ga0068862_100116286 | 3300005844 | Bacteria | 2352 |
| 246 | Ga0068862_100259774 | 3300005844 | Bacteria | 1585 |
| 247 | Ga0081538_10034921 | 3300005981 | Bacteria | 3314 |
| 248 | Ga0081540_1096199 | 3300005983 | Bacteria | 1288 |
| 249 | Ga0070717_10002614 | 3300006028 | Bacteria | 12700 |
| 250 | Ga0070717_10006374 | 3300006028 | Bacteria | 8673 |
| 251 | Ga0070717_10006770 | 3300006028 | Bacteria | 8457 |
| 252 | Ga0070717_10022846 | 3300006028 | Bacteria | 4948 |
| 253 | Ga0070717_10024604 | 3300006028 | Bacteria | 4784 |
| 254 | Ga0070717_10155162 | 3300006028 | Bacteria | 1983 |
| 255 | Ga0070717_10200924 | 3300006028 | Bacteria | 1746 |
| 256 | Ga0070717_10202099 | 3300006028 | Bacteria | 1741 |
| 257 | Ga0070717_10483169 | 3300006028 | Bacteria | 1118 |
| 258 | Ga0070716_100005841 | 3300006173 | Bacteria | 5980 |
| 259 | Ga0070716_100012088 | 3300006173 | Bacteria | 4365 |
| 260 | Ga0070716_100016153 | 3300006173 | Bacteria | 3848 |
| 261 | Ga0070716_100023979 | 3300006173 | Bacteria | 3243 |
| 262 | Ga0070716_100037411 | 3300006173 | Bacteria | 2682 |
| 263 | Ga0070716_100056250 | 3300006173 | Bacteria | 2255 |
| 264 | Ga0070716_100471755 | 3300006173 | Bacteria | 920 |
| 265 | Ga0070712_100000593 | 3300006175 | Bacteria | 21160 |
| 266 | Ga0070712_100001135 | 3300006175 | Bacteria | 16046 |
| 267 | Ga0070712_100003022 | 3300006175 | Bacteria | 10410 |
| 268 | Ga0070712_100004622 | 3300006175 | Bacteria | 8508 |
| 269 | Ga0070712_100056210 | 3300006175 | Bacteria | 2759 |
| 270 | Ga0070712_100118675 | 3300006175 | Bacteria | 1987 |
| 271 | Ga0070712_100202118 | 3300006175 | Bacteria | 1562 |
| 272 | Ga0075367_10076806 | 3300006178 | Bacteria | 2016 |
| 273 | Ga0097621_100007525 | 3300006237 | Bacteria | 7797 |
| 274 | Ga0097621_100013773 | 3300006237 | Bacteria | 6038 |
| 275 | Ga0097621_100070515 | 3300006237 | Bacteria | 2886 |
| 276 | Ga0097621_100073449 | 3300006237 | Bacteria | 2831 |
| 277 | Ga0097621_100157200 | 3300006237 | Bacteria | 1952 |
| 278 | Ga0068871_100014064 | 3300006358 | Bacteria | 5952 |
| 279 | Ga0068871_100020698 | 3300006358 | Bacteria | 5044 |
| 280 | Ga0068871_100026575 | 3300006358 | Bacteria | 4518 |
| 281 | Ga0068871_100068684 | 3300006358 | Bacteria | 2910 |
| 282 | Ga0068871_100071804 | 3300006358 | Bacteria | 2848 |
| 283 | Ga0068871_100072335 | 3300006358 | Bacteria | 2839 |
| 284 | Ga0068871_100084357 | 3300006358 | Bacteria | 2636 |
| 285 | Ga0068871_100159495 | 3300006358 | Bacteria | 1928 |
| 286 | Ga0075428_100034853 | 3300006844 | Bacteria | 5550 |
| 287 | Ga0075430_100001931 | 3300006846 | Bacteria | 17021 |
| 288 | Ga0075431_100112052 | 3300006847 | Bacteria | 2816 |
| 289 | Ga0075434_100000230 | 3300006871 | Bacteria | 38508 |
| 290 | Ga0075434_100005131 | 3300006871 | Bacteria | 11896 |
| 291 | Ga0075429_100001796 | 3300006880 | Bacteria | 17765 |
| 292 | Ga0068865_100006206 | 3300006881 | Bacteria | 7284 |
| 293 | Ga0068865_100165105 | 3300006881 | Bacteria | 1692 |
| 294 | Ga0068865_100219752 | 3300006881 | Bacteria | 1485 |
| 295 | Ga0075436_100000510 | 3300006914 | Bacteria | 25141 |
| 296 | Ga0075436_100012852 | 3300006914 | Bacteria | 5738 |
| 297 | Ga0075436_100013001 | 3300006914 | Bacteria | 5707 |
| 298 | Ga0075436_100032647 | 3300006914 | Bacteria | 3588 |
| 299 | Ga0075436_100040669 | 3300006914 | Bacteria | 3207 |
| 300 | Ga0075436_100258144 | 3300006914 | Unclassified | 1242 |
| 301 | Ga0097620_100013371 | 3300006931 | Bacteria | 8230 |
| 302 | Ga0097620_100017062 | 3300006931 | Bacteria | 7289 |
| 303 | Ga0097620_100822568 | 3300006931 | Bacteria | 1016 |
| 304 | Ga0075435_100000389 | 3300007076 | Bacteria | 26853 |
| 305 | Ga0075435_100045994 | 3300007076 | Bacteria | 3500 |
| 306 | Ga0075435_100333245 | 3300007076 | Bacteria | 1300 |
| 307 | Ga0075435_100547357 | 3300007076 | Bacteria | 1002 |
| 308 | Ga0099795_10007913 | 3300007788 | Bacteria | 2999 |
| 309 | Ga0105240_10029138 | 3300009093 | Bacteria | 7199 |
| 310 | Ga0105240_10037261 | 3300009093 | Bacteria | 6251 |
| 311 | Ga0105240_10066274 | 3300009093 | Bacteria | 4480 |
| 312 | Ga0105240_10098360 | 3300009093 | Bacteria | 3563 |
| 313 | Ga0105240_10301875 | 3300009093 | Bacteria | 1832 |
| 314 | Ga0105240_10351030 | 3300009093 | Bacteria | 1673 |
| 315 | Ga0105240_10546511 | 3300009093 | Bacteria | 1282 |
| 316 | Ga0105240_10566055 | 3300009093 | Bacteria | 1255 |
| 317 | Ga0111539_10302448 | 3300009094 | Bacteria | 1862 |
| 318 | Ga0105245_10005238 | 3300009098 | Bacteria | 11396 |
| 319 | Ga0105245_10121450 | 3300009098 | Bacteria | 2441 |
| 320 | Ga0105247_10019238 | 3300009101 | Bacteria | 4098 |
| 321 | Ga0105247_10132378 | 3300009101 | Bacteria | 1626 |
| 322 | Ga0114129_10030197 | 3300009147 | Bacteria | 7676 |
| 323 | Ga0105243_10017394 | 3300009148 | Bacteria | 5435 |
| 324 | Ga0105241_10036407 | 3300009174 | Bacteria | 3703 |
| 325 | Ga0105241_10060464 | 3300009174 | Bacteria | 2915 |
| 326 | Ga0105241_10243630 | 3300009174 | Bacteria | 1521 |
| 327 | Ga0105241_10308570 | 3300009174 | Bacteria | 1360 |
| 328 | Ga0105242_10021951 | 3300009176 | Bacteria | 5017 |
| 329 | Ga0105242_10025185 | 3300009176 | Bacteria | 4705 |
| 330 | Ga0105242_10286600 | 3300009176 | Bacteria | 1498 |
| 331 | Ga0105242_10347723 | 3300009176 | Bacteria | 1368 |
| 332 | Ga0105242_10443105 | 3300009176 | Bacteria | 1222 |
| 333 | Ga0105242_10732535 | 3300009176 | Unclassified | 971 |
| 334 | Ga0105248_10087800 | 3300009177 | Bacteria | 3500 |
| 335 | Ga0105248_10168623 | 3300009177 | Bacteria | 2468 |
| 336 | Ga0105248_10211826 | 3300009177 | Bacteria | 2183 |
| 337 | Ga0105248_10256836 | 3300009177 | Bacteria | 1967 |
| 338 | Ga0105248_10449093 | 3300009177 | Bacteria | 1453 |
| 339 | Ga0105237_10016610 | 3300009545 | Bacteria | 7645 |
| 340 | Ga0105237_10059544 | 3300009545 | Bacteria | 3821 |
| 341 | Ga0105237_10096007 | 3300009545 | Bacteria | 2954 |
| 342 | Ga0105237_10178865 | 3300009545 | Bacteria | 2121 |
| 343 | Ga0105237_10193165 | 3300009545 | Bacteria | 2035 |
| 344 | Ga0105237_10618325 | 3300009545 | Unclassified | 1090 |
| 345 | Ga0105238_10004639 | 3300009551 | Bacteria | 13603 |
| 346 | Ga0105238_10121061 | 3300009551 | Bacteria | 2596 |
| 347 | Ga0105238_10122762 | 3300009551 | Bacteria | 2577 |
| 348 | Ga0105249_10017780 | 3300009553 | Bacteria | 6316 |
| 349 | Ga0099796_10025283 | 3300010159 | Bacteria | 1873 |
| 350 | Ga0099796_10059515 | 3300010159 | Bacteria | 1349 |
| 351 | Ga0105239_10116116 | 3300010375 | Bacteria | 2970 |
| 352 | Ga0105239_10295798 | 3300010375 | Bacteria | 1823 |
| 353 | Ga0105239_11123062 | 3300010375 | Bacteria | 905 |
| 354 | Ga0105246_10018819 | 3300011119 | Bacteria | 4404 |
| 355 | Ga0105246_10104324 | 3300011119 | Bacteria | 2070 |
| 356 | Ga0105246_10307490 | 3300011119 | Unclassified | 1283 |
| 357 | Ga0157373_10016891 | 3300013100 | Bacteria | 5322 |
| 358 | Ga0157373_10082678 | 3300013100 | Bacteria | 2263 |
| 359 | Ga0157373_10092181 | 3300013100 | Bacteria | 2134 |
| 360 | Ga0157371_10016410 | 3300013102 | Bacteria | 5528 |
| 361 | Ga0157370_10124040 | 3300013104 | Bacteria | 2412 |
| 362 | Ga0157369_10075050 | 3300013105 | Bacteria | 3626 |
| 363 | Ga0157369_10077234 | 3300013105 | Bacteria | 3569 |
| 364 | Ga0157369_10109693 | 3300013105 | Bacteria | 2934 |
| 365 | Ga0157369_10196641 | 3300013105 | Bacteria | 2117 |
| 366 | Ga0157374_10053416 | 3300013296 | Bacteria | 3767 |
| 367 | Ga0157374_10056630 | 3300013296 | Bacteria | 3660 |
| 368 | Ga0157374_10094140 | 3300013296 | Bacteria | 2862 |
| 369 | Ga0157374_10094974 | 3300013296 | Bacteria | 2850 |
| 370 | Ga0157374_10314730 | 3300013296 | Unclassified | 1550 |
| 371 | Ga0157374_10327687 | 3300013296 | Unclassified | 1518 |
| 372 | Ga0157374_10367777 | 3300013296 | Bacteria | 1431 |
| 373 | Ga0157374_10598803 | 3300013296 | Bacteria | 1112 |
| 374 | Ga0157378_10000411 | 3300013297 | Bacteria | 42281 |
| 375 | Ga0157378_10000516 | 3300013297 | Bacteria | 36737 |
| 376 | Ga0157378_10000641 | 3300013297 | Bacteria | 32867 |
| 377 | Ga0157378_10023476 | 3300013297 | Bacteria | 5427 |
| 378 | Ga0157378_10027505 | 3300013297 | Bacteria | 5018 |
| 379 | Ga0157378_10044668 | 3300013297 | Bacteria | 3935 |
| 380 | Ga0157378_10260721 | 3300013297 | Bacteria | 1663 |
| 381 | Ga0157378_10400508 | 3300013297 | Bacteria | 1352 |
| 382 | Ga0157378_10815642 | 3300013297 | Bacteria | 960 |
| 383 | Ga0163162_10020357 | 3300013306 | Bacteria | 6517 |
| 384 | Ga0163162_10322933 | 3300013306 | Bacteria | 1676 |
| 385 | Ga0163162_10701539 | 3300013306 | Bacteria | 1134 |
| 386 | Ga0163162_11210431 | 3300013306 | Bacteria | 857 |
| 387 | Ga0157372_10029430 | 3300013307 | Bacteria | 5997 |
| 388 | Ga0157372_10087746 | 3300013307 | Bacteria | 3530 |
| 389 | Ga0157372_10117278 | 3300013307 | Bacteria | 3053 |
| 390 | Ga0157372_10133152 | 3300013307 | Bacteria | 2862 |
| 391 | Ga0157372_10163271 | 3300013307 | Bacteria | 2575 |
| 392 | Ga0157372_10238753 | 3300013307 | Bacteria | 2108 |
| 393 | Ga0157372_10464426 | 3300013307 | Bacteria | 1475 |
| 394 | Ga0157375_10273036 | 3300013308 | Bacteria | 1853 |
| 395 | Ga0163163_10038186 | 3300014325 | Bacteria | 4677 |
| 396 | Ga0163163_10060784 | 3300014325 | Bacteria | 3742 |
| 397 | Ga0163163_10085804 | 3300014325 | Bacteria | 3156 |
| 398 | Ga0163163_10150827 | 3300014325 | Bacteria | 2368 |
| 399 | Ga0157380_10226030 | 3300014326 | Bacteria | 1678 |
| 400 | Ga0157379_10004402 | 3300014968 | Bacteria | 12067 |
| 401 | Ga0157376_10008421 | 3300014969 | Bacteria | 7439 |
| 402 | Ga0157376_10155309 | 3300014969 | Bacteria | 2068 |
| 403 | Ga0157376_10198242 | 3300014969 | Bacteria | 1845 |
| 404 | Ga0157376_10216896 | 3300014969 | Bacteria | 1770 |
| 405 | Ga0182007_10006522 | 3300015262 | Bacteria | 5005 |
| 406 | Ga0182007_10096360 | 3300015262 | Unclassified | 977 |
| 407 | Ga0163161_10327237 | 3300017792 | Bacteria | 1213 |
| 408 | Ga0184602_100587 | 3300019161 | Bacteria | 1580 |
| 409 | Ga0184601_138509 | 3300019183 | Bacteria | 2771 |
| 410 | Ga0184599_124137 | 3300019188 | Bacteria | 4861 |
| 411 | Ga0184600_107512 | 3300019190 | Unclassified | 2151 |
| 412 | Ga0197907_10394153 | 3300020069 | Bacteria | 989 |
| 413 | Ga0197907_10527156 | 3300020069 | Bacteria | 1435 |
| 414 | Ga0197907_10662566 | 3300020069 | Bacteria | 2353 |
| 415 | Ga0206356_10049636 | 3300020070 | Bacteria | 1906 |
| 416 | Ga0206356_10051902 | 3300020070 | Bacteria | 1697 |
| 417 | Ga0206356_10833199 | 3300020070 | Bacteria | 1016 |
| 418 | Ga0206356_11173081 | 3300020070 | Bacteria | 2030 |
| 419 | Ga0206356_11476520 | 3300020070 | Bacteria | 1230 |
| 420 | Ga0206356_11803998 | 3300020070 | Bacteria | 1891 |
| 421 | Ga0206355_1040840 | 3300020076 | Bacteria | 974 |
| 422 | Ga0206355_1106755 | 3300020076 | Bacteria | 995 |
| 423 | Ga0206355_1328072 | 3300020076 | Bacteria | 1178 |
| 424 | Ga0206351_10678473 | 3300020077 | Bacteria | 2545 |
| 425 | Ga0206351_10806319 | 3300020077 | Bacteria | 1227 |
| 426 | Ga0206352_10443739 | 3300020078 | Bacteria | 1698 |
| 427 | Ga0206352_10818178 | 3300020078 | Bacteria | 1211 |
| 428 | Ga0206350_10297924 | 3300020080 | Bacteria | 1432 |
| 429 | Ga0206350_10978419 | 3300020080 | Bacteria | 1872 |
| 430 | Ga0206354_10240356 | 3300020081 | Bacteria | 1220 |
| 431 | Ga0206354_10881815 | 3300020081 | Bacteria | 1408 |
| 432 | Ga0206353_11188867 | 3300020082 | Bacteria | 1134 |
| 433 | Ga0206353_11403828 | 3300020082 | Bacteria | 1437 |
| 434 | Ga0154015_1684329 | 3300020610 | Bacteria | 1179 |
| 435 | Ga0154015_1706975 | 3300020610 | Bacteria | 2206 |
| 436 | Ga0224712_10020119 | 3300022467 | Bacteria | 2260 |
| 437 | Ga0224712_10053142 | 3300022467 | Bacteria | 1585 |
| 438 | Ga0224712_10068472 | 3300022467 | Bacteria | 1435 |
| 439 | Ga0224712_10119152 | 3300022467 | Bacteria | 1141 |
| 440 | Ga0224712_10128781 | 3300022467 | Bacteria | 1103 |
| 441 | Ga0224570_100717 | 3300022730 | Bacteria | 2645 |
| 442 | Ga0224569_100499 | 3300022732 | Bacteria | 3400 |
| 443 | Ga0247554_100062 | 3300023547 | Bacteria | 2139 |
| 444 | Ga0228598_1000213 | 3300024227 | Bacteria | 10848 |
| 445 | Ga0228598_1000513 | 3300024227 | Bacteria | 8046 |
| 446 | Ga0207656_10005274 | 3300025321 | Bacteria | 4559 |
| 447 | Ga0207656_10013964 | 3300025321 | Bacteria | 3082 |
| 448 | Ga0207656_10026011 | 3300025321 | Unclassified | 2381 |
| 449 | Ga0207653_10129640 | 3300025885 | Unclassified | 914 |
| 450 | Ga0207682_10076728 | 3300025893 | Bacteria | 1425 |
| 451 | Ga0207692_10006388 | 3300025898 | Bacteria | 4778 |
| 452 | Ga0207692_10013131 | 3300025898 | Bacteria | 3585 |
| 453 | Ga0207692_10020497 | 3300025898 | Bacteria | 3008 |
| 454 | Ga0207642_10062870 | 3300025899 | Bacteria | 1734 |
| 455 | Ga0207680_10338107 | 3300025903 | Bacteria | 1056 |
| 456 | Ga0207647_10006875 | 3300025904 | Bacteria | 8248 |
| 457 | Ga0207647_10019145 | 3300025904 | Bacteria | 4608 |
| 458 | Ga0207685_10038470 | 3300025905 | Bacteria | 1769 |
| 459 | Ga0207699_10002321 | 3300025906 | Bacteria | 8995 |
| 460 | Ga0207699_10014274 | 3300025906 | Bacteria | 4090 |
| 461 | Ga0207699_10020090 | 3300025906 | Bacteria | 3574 |
| 462 | Ga0207699_10021232 | 3300025906 | Bacteria | 3496 |
| 463 | Ga0207699_10055306 | 3300025906 | Bacteria | 2361 |
| 464 | Ga0207699_10297324 | 3300025906 | Bacteria | 1126 |
| 465 | Ga0207645_10004038 | 3300025907 | Bacteria | 10936 |
| 466 | Ga0207645_10035810 | 3300025907 | Bacteria | 3187 |
| 467 | Ga0207643_10148556 | 3300025908 | Bacteria | 1404 |
| 468 | Ga0207684_10000188 | 3300025910 | Bacteria | 97995 |
| 469 | Ga0207684_10000614 | 3300025910 | Bacteria | 42486 |
| 470 | Ga0207684_10001048 | 3300025910 | Bacteria | 30878 |
| 471 | Ga0207684_10001851 | 3300025910 | Bacteria | 22017 |
| 472 | Ga0207684_10003017 | 3300025910 | Bacteria | 16680 |
| 473 | Ga0207684_10194029 | 3300025910 | Bacteria | 1752 |
| 474 | Ga0207684_10278928 | 3300025910 | Bacteria | 1441 |
| 475 | Ga0207684_10541969 | 3300025910 | Bacteria | 996 |
| 476 | Ga0207654_10052456 | 3300025911 | Bacteria | 2351 |
| 477 | Ga0207654_10097758 | 3300025911 | Bacteria | 1803 |
| 478 | Ga0207654_10148662 | 3300025911 | Bacteria | 1501 |
| 479 | Ga0207707_10003361 | 3300025912 | Bacteria | 14208 |
| 480 | Ga0207707_10007456 | 3300025912 | Bacteria | 9532 |
| 481 | Ga0207707_10018585 | 3300025912 | Bacteria | 6059 |
| 482 | Ga0207707_10021611 | 3300025912 | Bacteria | 5623 |
| 483 | Ga0207707_10109026 | 3300025912 | Bacteria | 2420 |
| 484 | Ga0207707_10127170 | 3300025912 | Bacteria | 2228 |
| 485 | Ga0207707_10168596 | 3300025912 | Bacteria | 1913 |
| 486 | Ga0207707_10287986 | 3300025912 | Bacteria | 1421 |
| 487 | Ga0207707_10299411 | 3300025912 | Bacteria | 1391 |
| 488 | Ga0207695_10007039 | 3300025913 | Bacteria | 14431 |
| 489 | Ga0207695_10008453 | 3300025913 | Bacteria | 12891 |
| 490 | Ga0207695_10081934 | 3300025913 | Bacteria | 3264 |
| 491 | Ga0207695_10150454 | 3300025913 | Bacteria | 2267 |
| 492 | Ga0207695_10172513 | 3300025913 | Bacteria | 2087 |
| 493 | Ga0207671_10042349 | 3300025914 | Bacteria | 3370 |
| 494 | Ga0207671_10068785 | 3300025914 | Bacteria | 2639 |
| 495 | Ga0207671_10074923 | 3300025914 | Bacteria | 2530 |
| 496 | Ga0207671_10122703 | 3300025914 | Bacteria | 1987 |
| 497 | Ga0207693_10000026 | 3300025915 | Bacteria | 122717 |
| 498 | Ga0207693_10000922 | 3300025915 | Bacteria | 26418 |
| 499 | Ga0207693_10001260 | 3300025915 | Bacteria | 22561 |
| 500 | Ga0207693_10004232 | 3300025915 | Bacteria | 12174 |
| 501 | Ga0207693_10041078 | 3300025915 | Bacteria | 3642 |
| 502 | Ga0207693_10306845 | 3300025915 | Bacteria | 1243 |
| 503 | Ga0207663_10006104 | 3300025916 | Bacteria | 6133 |
| 504 | Ga0207663_10027488 | 3300025916 | Bacteria | 3317 |
| 505 | Ga0207663_10031788 | 3300025916 | Bacteria | 3127 |
| 506 | Ga0207663_10062577 | 3300025916 | Bacteria | 2366 |
| 507 | Ga0207663_10140657 | 3300025916 | Bacteria | 1681 |
| 508 | Ga0207660_10023735 | 3300025917 | Bacteria | 4144 |
| 509 | Ga0207660_10085371 | 3300025917 | Bacteria | 2328 |
| 510 | Ga0207660_10096860 | 3300025917 | Bacteria | 2197 |
| 511 | Ga0207660_10119042 | 3300025917 | Bacteria | 1998 |
| 512 | Ga0207657_10006426 | 3300025919 | Bacteria | 12189 |
| 513 | Ga0207649_10036883 | 3300025920 | Bacteria | 2948 |
| 514 | Ga0207649_10058342 | 3300025920 | Bacteria | 2417 |
| 515 | Ga0207652_10018223 | 3300025921 | Bacteria | 5757 |
| 516 | Ga0207652_10061092 | 3300025921 | Bacteria | 3253 |
| 517 | Ga0207652_10096820 | 3300025921 | Bacteria | 2600 |
| 518 | Ga0207652_10104357 | 3300025921 | Bacteria | 2507 |
| 519 | Ga0207646_10000238 | 3300025922 | Bacteria | 75978 |
| 520 | Ga0207646_10000258 | 3300025922 | Bacteria | 72085 |
| 521 | Ga0207646_10001230 | 3300025922 | Bacteria | 32163 |
| 522 | Ga0207646_10004899 | 3300025922 | Bacteria | 14334 |
| 523 | Ga0207646_10017066 | 3300025922 | Bacteria | 6802 |
| 524 | Ga0207646_10206047 | 3300025922 | Bacteria | 1776 |
| 525 | Ga0207646_10241285 | 3300025922 | Bacteria | 1632 |
| 526 | Ga0207646_10333690 | 3300025922 | Bacteria | 1370 |
| 527 | Ga0207681_10048860 | 3300025923 | Bacteria | 2857 |
| 528 | Ga0207681_10114519 | 3300025923 | Bacteria | 1967 |
| 529 | Ga0207681_10181869 | 3300025923 | Bacteria | 1602 |
| 530 | Ga0207681_10285150 | 3300025923 | Bacteria | 1302 |
| 531 | Ga0207681_10366824 | 3300025923 | Bacteria | 1156 |
| 532 | Ga0207694_10000718 | 3300025924 | Bacteria | 29747 |
| 533 | Ga0207694_10019318 | 3300025924 | Bacteria | 5152 |
| 534 | Ga0207694_10044180 | 3300025924 | Bacteria | 3441 |
| 535 | Ga0207650_10014338 | 3300025925 | Bacteria | 5510 |
| 536 | Ga0207650_10071395 | 3300025925 | Bacteria | 2611 |
| 537 | Ga0207650_10725017 | 3300025925 | Bacteria | 841 |
| 538 | Ga0207659_10003579 | 3300025926 | Bacteria | 9354 |
| 539 | Ga0207659_10007868 | 3300025926 | Bacteria | 6590 |
| 540 | Ga0207659_10114968 | 3300025926 | Bacteria | 2052 |
| 541 | Ga0207659_10243802 | 3300025926 | Bacteria | 1455 |
| 542 | Ga0207687_10056079 | 3300025927 | Bacteria | 2763 |
| 543 | Ga0207687_10127310 | 3300025927 | Bacteria | 1914 |
| 544 | Ga0207700_10004902 | 3300025928 | Bacteria | 7952 |
| 545 | Ga0207700_10039497 | 3300025928 | Bacteria | 3436 |
| 546 | Ga0207700_10087615 | 3300025928 | Bacteria | 2449 |
| 547 | Ga0207700_10110922 | 3300025928 | Bacteria | 2207 |
| 548 | Ga0207700_10142418 | 3300025928 | Bacteria | 1971 |
| 549 | Ga0207700_10151903 | 3300025928 | Bacteria | 1914 |
| 550 | Ga0207700_10212126 | 3300025928 | Bacteria | 1637 |
| 551 | Ga0207700_10378013 | 3300025928 | Bacteria | 1238 |
| 552 | Ga0207664_10000087 | 3300025929 | Bacteria | 88607 |
| 553 | Ga0207664_10032913 | 3300025929 | Bacteria | 3978 |
| 554 | Ga0207664_10076602 | 3300025929 | Bacteria | 2708 |
| 555 | Ga0207664_10102458 | 3300025929 | Bacteria | 2367 |
| 556 | Ga0207664_10637139 | 3300025929 | Bacteria | 958 |
| 557 | Ga0207644_10010037 | 3300025931 | Bacteria | 6233 |
| 558 | Ga0207644_10030088 | 3300025931 | Bacteria | 3772 |
| 559 | Ga0207644_10063127 | 3300025931 | Bacteria | 2689 |
| 560 | Ga0207644_10081911 | 3300025931 | Bacteria | 2386 |
| 561 | Ga0207690_10207300 | 3300025932 | Bacteria | 1492 |
| 562 | Ga0207706_10002545 | 3300025933 | Bacteria | 17768 |
| 563 | Ga0207686_10020935 | 3300025934 | Bacteria | 3744 |
| 564 | Ga0207686_10030480 | 3300025934 | Bacteria | 3193 |
| 565 | Ga0207686_10138054 | 3300025934 | Bacteria | 1681 |
| 566 | Ga0207709_10011617 | 3300025935 | Bacteria | 4855 |
| 567 | Ga0207709_10014728 | 3300025935 | Bacteria | 4322 |
| 568 | Ga0207670_10042709 | 3300025936 | Bacteria | 2989 |
| 569 | Ga0207670_10449137 | 3300025936 | Bacteria | 1039 |
| 570 | Ga0207669_10386970 | 3300025937 | Bacteria | 1091 |
| 571 | Ga0207704_10012199 | 3300025938 | Bacteria | 4258 |
| 572 | Ga0207704_10013374 | 3300025938 | Bacteria | 4104 |
| 573 | Ga0207704_10065992 | 3300025938 | Bacteria | 2269 |
| 574 | Ga0207704_10339944 | 3300025938 | Bacteria | 1165 |
| 575 | Ga0207704_10387223 | 3300025938 | Bacteria | 1099 |
| 576 | Ga0207665_10001798 | 3300025939 | Bacteria | 14443 |
| 577 | Ga0207665_10012476 | 3300025939 | Bacteria | 5580 |
| 578 | Ga0207665_10019095 | 3300025939 | Bacteria | 4504 |
| 579 | Ga0207665_10020276 | 3300025939 | Bacteria | 4367 |
| 580 | Ga0207665_10042405 | 3300025939 | Bacteria | 3041 |
| 581 | Ga0207665_10071183 | 3300025939 | Bacteria | 2374 |
| 582 | Ga0207665_10080999 | 3300025939 | Unclassified | 2234 |
| 583 | Ga0207665_10086009 | 3300025939 | Bacteria | 2171 |
| 584 | Ga0207665_10147286 | 3300025939 | Bacteria | 1683 |
| 585 | Ga0207665_10270932 | 3300025939 | Bacteria | 1261 |
| 586 | Ga0207691_10067123 | 3300025940 | Bacteria | 3243 |
| 587 | Ga0207691_10416654 | 3300025940 | Bacteria | 1145 |
| 588 | Ga0207711_10024877 | 3300025941 | Bacteria | 5023 |
| 589 | Ga0207711_10102246 | 3300025941 | Bacteria | 2537 |
| 590 | Ga0207711_10382048 | 3300025941 | Bacteria | 1307 |
| 591 | Ga0207711_10385399 | 3300025941 | Bacteria | 1301 |
| 592 | Ga0207689_10000542 | 3300025942 | Bacteria | 35861 |
| 593 | Ga0207689_10007360 | 3300025942 | Bacteria | 9653 |
| 594 | Ga0207689_10027283 | 3300025942 | Bacteria | 4782 |
| 595 | Ga0207689_10032344 | 3300025942 | Bacteria | 4353 |
| 596 | Ga0207661_10110732 | 3300025944 | Bacteria | 2322 |
| 597 | Ga0207661_10125253 | 3300025944 | Bacteria | 2193 |
| 598 | Ga0207661_10127104 | 3300025944 | Bacteria | 2178 |
| 599 | Ga0207661_10139424 | 3300025944 | Bacteria | 2086 |
| 600 | Ga0207661_10436222 | 3300025944 | Bacteria | 1191 |
| 601 | Ga0207679_10232910 | 3300025945 | Unclassified | 1556 |
| 602 | Ga0207667_10000245 | 3300025949 | Bacteria | 76423 |
| 603 | Ga0207667_10002261 | 3300025949 | Bacteria | 24195 |
| 604 | Ga0207667_10008140 | 3300025949 | Bacteria | 12487 |
| 605 | Ga0207667_10046387 | 3300025949 | Bacteria | 4600 |
| 606 | Ga0207667_10132398 | 3300025949 | Bacteria | 2568 |
| 607 | Ga0207667_10360439 | 3300025949 | Bacteria | 1482 |
| 608 | Ga0207651_10073059 | 3300025960 | Bacteria | 2437 |
| 609 | Ga0207651_10091307 | 3300025960 | Bacteria | 2229 |
| 610 | Ga0207651_10192162 | 3300025960 | Bacteria | 1629 |
| 611 | Ga0207712_10066602 | 3300025961 | Bacteria | 2575 |
| 612 | Ga0207668_10501201 | 3300025972 | Bacteria | 1044 |
| 613 | Ga0207640_10008195 | 3300025981 | Bacteria | 5791 |
| 614 | Ga0207640_10010596 | 3300025981 | Bacteria | 5199 |
| 615 | Ga0207640_10058331 | 3300025981 | Bacteria | 2543 |
| 616 | Ga0207640_10198997 | 3300025981 | Bacteria | 1517 |
| 617 | Ga0207640_10343797 | 3300025981 | Bacteria | 1196 |
| 618 | Ga0207640_10624275 | 3300025981 | Bacteria | 915 |
| 619 | Ga0207677_10004281 | 3300026023 | Bacteria | 7637 |
| 620 | Ga0207677_10004546 | 3300026023 | Bacteria | 7461 |
| 621 | Ga0207677_10008537 | 3300026023 | Bacteria | 5730 |
| 622 | Ga0207677_10024595 | 3300026023 | Bacteria | 3744 |
| 623 | Ga0207703_10003490 | 3300026035 | Bacteria | 13160 |
| 624 | Ga0207703_10013683 | 3300026035 | Bacteria | 6323 |
| 625 | Ga0207703_10041811 | 3300026035 | Bacteria | 3674 |
| 626 | Ga0207703_10050418 | 3300026035 | Bacteria | 3369 |
| 627 | Ga0207703_10051358 | 3300026035 | Bacteria | 3341 |
| 628 | Ga0207639_10060468 | 3300026041 | Bacteria | 2923 |
| 629 | Ga0207639_10064124 | 3300026041 | Bacteria | 2847 |
| 630 | Ga0207639_10117426 | 3300026041 | Bacteria | 2180 |
| 631 | Ga0207678_10001612 | 3300026067 | Bacteria | 20753 |
| 632 | Ga0207708_10039059 | 3300026075 | Bacteria | 3616 |
| 633 | Ga0207702_10001276 | 3300026078 | Bacteria | 25273 |
| 634 | Ga0207702_10001425 | 3300026078 | Bacteria | 23875 |
| 635 | Ga0207702_10003851 | 3300026078 | Bacteria | 13535 |
| 636 | Ga0207702_10041975 | 3300026078 | Bacteria | 3836 |
| 637 | Ga0207702_10127482 | 3300026078 | Bacteria | 2287 |
| 638 | Ga0207702_10282887 | 3300026078 | Bacteria | 1569 |
| 639 | Ga0207702_10564251 | 3300026078 | Bacteria | 1114 |
| 640 | Ga0207641_10045230 | 3300026088 | Bacteria | 3706 |
| 641 | Ga0207641_10245130 | 3300026088 | Bacteria | 1671 |
| 642 | Ga0207641_10386607 | 3300026088 | Bacteria | 1341 |
| 643 | Ga0207648_10001325 | 3300026089 | Bacteria | 27526 |
| 644 | Ga0207648_10023379 | 3300026089 | Bacteria | 5537 |
| 645 | Ga0207648_10103312 | 3300026089 | Bacteria | 2499 |
| 646 | Ga0207676_10046329 | 3300026095 | Bacteria | 3364 |
| 647 | Ga0207676_10051605 | 3300026095 | Bacteria | 3211 |
| 648 | Ga0207676_10087662 | 3300026095 | Bacteria | 2546 |
| 649 | Ga0207676_10236285 | 3300026095 | Bacteria | 1637 |
| 650 | Ga0207676_10497192 | 3300026095 | Bacteria | 1157 |
| 651 | Ga0207674_10000864 | 3300026116 | Bacteria | 39645 |
| 652 | Ga0207674_10018522 | 3300026116 | Bacteria | 7566 |
| 653 | Ga0207674_10041099 | 3300026116 | Bacteria | 4784 |
| 654 | Ga0207674_10100633 | 3300026116 | Bacteria | 2872 |
| 655 | Ga0207683_10051020 | 3300026121 | Bacteria | 3624 |
| 656 | Ga0207683_10062607 | 3300026121 | Bacteria | 3277 |
| 657 | Ga0207683_10080116 | 3300026121 | Bacteria | 2896 |
| 658 | Ga0207683_10174724 | 3300026121 | Bacteria | 1946 |
| 659 | Ga0207683_10249749 | 3300026121 | Bacteria | 1619 |
| 660 | Ga0207698_10089386 | 3300026142 | Bacteria | 2515 |
| 661 | Ga0207698_10205590 | 3300026142 | Bacteria | 1767 |
| 662 | Ga0207698_10720062 | 3300026142 | Unclassified | 994 |
| 663 | Ga0209999_1030202 | 3300027543 | Bacteria | 1006 |
| 664 | Ga0209983_1000426 | 3300027665 | Bacteria | 9102 |
| 665 | Ga0209971_1020867 | 3300027682 | Unclassified | 1558 |
| 666 | Ga0209974_10000500 | 3300027876 | Bacteria | 13071 |
| 667 | Ga0265356_1000279 | 3300028017 | Bacteria | 9531 |
| 668 | Ga0268266_10023242 | 3300028379 | Bacteria | 5278 |
| 669 | Ga0268265_10209553 | 3300028380 | Bacteria | 1697 |
| 670 | Ga0268264_10017321 | 3300028381 | Bacteria | 5903 |
| 671 | Ga0268264_10028638 | 3300028381 | Bacteria | 4558 |
| 672 | Ga0268264_10209769 | 3300028381 | Bacteria | 1787 |
| 673 | Ga0268264_10224831 | 3300028381 | Bacteria | 1730 |
| 674 | Ga0268264_10270162 | 3300028381 | Bacteria | 1588 |
| 675 | Ga0265338_10002857 | 3300028800 | Bacteria | 25250 |
| 676 | Ga0265338_10056425 | 3300028800 | Bacteria | 3483 |
| 677 | Ga0265338_10152496 | 3300028800 | Bacteria | 1794 |
| 678 | Ga0265338_10157549 | 3300028800 | Bacteria | 1757 |
| 679 | Ga0265338_10158627 | 3300028800 | Bacteria | 1750 |
| 680 | Ga0265338_10307499 | 3300028800 | Bacteria | 1151 |
| 681 | Ga0265762_1000268 | 3300030760 | Bacteria | 8677 |
| 682 | Ga0265762_1001772 | 3300030760 | Bacteria | 3918 |
| 683 | Ga0265762_1015375 | 3300030760 | Bacteria | 1385 |
| 684 | Ga0265762_1015712 | 3300030760 | Bacteria | 1370 |
| 685 | Ga0265763_1010057 | 3300030763 | Bacteria | 868 |
| 686 | Ga0265766_1000373 | 3300030863 | Bacteria | 1881 |
| 687 | Ga0265777_101167 | 3300030877 | Bacteria | 1368 |
| 688 | Ga0265777_101745 | 3300030877 | Unclassified | 1199 |
| 689 | Ga0265765_1012638 | 3300030879 | Bacteria | 959 |
| 690 | Ga0265760_10000694 | 3300031090 | Bacteria | 9605 |
| 691 | Ga0265760_10011555 | 3300031090 | Bacteria | 2522 |
| 692 | Ga0265760_10016330 | 3300031090 | Bacteria | 2130 |
| 693 | Ga0265760_10017826 | 3300031090 | Bacteria | 2040 |
| 694 | Ga0265760_10035955 | 3300031090 | Bacteria | 1468 |
| 695 | Ga0265328_10008639 | 3300031239 | Bacteria | 4190 |
| 696 | Ga0265320_10169513 | 3300031240 | Unclassified | 981 |
| 697 | Ga0265325_10003007 | 3300031241 | Bacteria | 11190 |
| 698 | Ga0265325_10047694 | 3300031241 | Bacteria | 2216 |
| 699 | Ga0265325_10088259 | 3300031241 | Bacteria | 1532 |
| 700 | Ga0265340_10005004 | 3300031247 | Bacteria | 7367 |
| 701 | Ga0265331_10012160 | 3300031250 | Bacteria | 4675 |
| 702 | Ga0265327_10051700 | 3300031251 | Bacteria | 2143 |
| 703 | Ga0265316_10024062 | 3300031344 | Bacteria | 5113 |
| 704 | Ga0265316_10070945 | 3300031344 | Bacteria | 2686 |
| 705 | Ga0265313_10002540 | 3300031595 | Bacteria | 15638 |
| 706 | Ga0265313_10037261 | 3300031595 | Bacteria | 2434 |
| 707 | Ga0265314_10015736 | 3300031711 | Bacteria | 5993 |
| 708 | Ga0265342_10031116 | 3300031712 | Bacteria | 3302 |
| 709 | Ga0307405_10000473 | 3300031731 | Bacteria | 15091 |
| 710 | Ga0307410_10314420 | 3300031852 | Bacteria | 1240 |
| 711 | Ga0307407_10009603 | 3300031903 | Bacteria | 4515 |
| 712 | Ga0307414_10266029 | 3300032004 | Bacteria | 1433 |
| 713 | Ga0307411_10072579 | 3300032005 | Bacteria | 2337 |
| 714 | Ga0316053_100082 | 3300032120 | Bacteria | 3043 |
| 715 | Ga0316588_1016936 | 3300033528 | Bacteria | 1620 |
| 716 | Ga0316214_1000473 | 3300033545 | Bacteria | 4092 |
| 717 | Ga0373926_0003574 | 3300035083 | Bacteria | 5040 |
| 718 | Ga0373926_0088992 | 3300035083 | Bacteria | 1147 |
| 719 | Ga0373926_0089301 | 3300035083 | Bacteria | 1145 |
| 720 | Ga0373934_0087673 | 3300035086 | Bacteria | 1253 |
| 721 | Ga0373934_0126980 | 3300035086 | Bacteria | 1039 |
| 722 | Ga0373923_0021599 | 3300035111 | Bacteria | 2514 |
| 723 | Ga0373936_0012061 | 3300035113 | Bacteria | 3282 |
| 724 | Ga0373936_0023335 | 3300035113 | Bacteria | 2411 |
| 725 | Ga0373953_0121023 | 3300035117 | Bacteria | 1112 |
| 726 | Ga0373954_0150956 | 3300035118 | Bacteria | 1135 |
| 727 | Ga0373943_0000594 | 3300035170 | Bacteria | 15714 |
| 728 | Ga0373943_0196682 | 3300035170 | Bacteria | 1114 |
| 729 | Ga0373946_0011730 | 3300035171 | Bacteria | 3276 |
| 730 | Ga0373946_0032109 | 3300035171 | Bacteria | 2107 |
| 731 | Ga0373946_0055918 | 3300035171 | Bacteria | 1665 |
| 732 | Ga0373955_0097240 | 3300035172 | Bacteria | 1686 |
| 733 | Ga0373955_0111755 | 3300035172 | Bacteria | 1580 |
| 734 | Ga0373955_0128990 | 3300035172 | Bacteria | 1475 |
| 735 | Ga0373942_0099938 | 3300035207 | Unclassified | 885 |
| 736 | Ga0373962_0018042 | 3300035242 | Bacteria | 1833 |
| 737 | Ga0373924_0037264 | 3300035410 | Bacteria | 1979 |
| 738 | Ga0373931_0127825 | 3300035691 | Bacteria | 1459 |
| 739 | Ga0373931_0177118 | 3300035691 | Bacteria | 1260 |
| 740 | Ga0373931_0277239 | 3300035691 | Bacteria | 1028 |
| 741 | Ga0373935_0001675 | 3300035692 | Bacteria | 12390 |
| 742 | Ga0373935_0008518 | 3300035692 | Bacteria | 6138 |
| 743 | Ga0373935_0044338 | 3300035692 | Bacteria | 2802 |
| 744 | Ga0373927_0000747 | 3300035695 | Bacteria | 24845 |
| 745 | Ga0373927_0272728 | 3300035695 | Bacteria | 1112 |
| 746 | Ga0373933_0090555 | 3300035724 | Bacteria | 1887 |
| 747 | Ga0373947_0000971 | 3300035725 | Bacteria | 17501 |
| 748 | Ga0373947_0001211 | 3300035725 | Bacteria | 15877 |
| 749 | Ga0373937_0021575 | 3300036401 | Bacteria | 5779 |
| 750 | Ga0373937_0040661 | 3300036401 | Bacteria | 4239 |
| 751 | Ga0373937_0054915 | 3300036401 | Bacteria | 3656 |
| 752 | Ga0373937_0179904 | 3300036401 | Bacteria | 1985 |
| 753 | Ga0373937_0240705 | 3300036401 | Bacteria | 1705 |
| 754 | Ga0373937_0979633 | 3300036401 | Bacteria | 794 |
| 755 | Ga0373925_0039256 | 3300037068 | Bacteria | 3502 |
| 756 | Ga0373925_0174457 | 3300037068 | Unclassified | 1698 |
| 757 | Ga0373925_0175752 | 3300037068 | Bacteria | 1692 |
| 758 | Ga0395900_0698613 | 3300037418 | Bacteria | 948 |
| 759 | Ga0395898_0020412 | 3300037466 | Bacteria | 6728 |
| 760 | Ga0395905_0659058 | 3300037471 | Bacteria | 949 |
| 761 | Ga0436365_1839081 | 3300039437 | Bacteria | 1058 |
| 762 | Ga0436363_1122218 | 3300039450 | Bacteria | 4045 |
| 763 | Ga0451853_3230832 | 3300041512 | Bacteria | 1220 |
| 764 | Ga0451577_0082373 | 3300042876 | Bacteria | 2870 |
| 765 | Ga0466966_0115682 | 3300044684 | Bacteria | 1651 |
| 766 | Ga0466966_0143822 | 3300044684 | Bacteria | 1456 |
| 767 | Ga0466963_0000986 | 3300044694 | Bacteria | 14660 |
| 768 | Ga0466963_0002381 | 3300044694 | Bacteria | 10510 |
| 769 | Ga0466964_0028661 | 3300044706 | Bacteria | 2195 |
| 770 | Ga0466964_0048034 | 3300044706 | Bacteria | 1744 |
| 771 | Ga0466970_0122543 | 3300044765 | Bacteria | 1425 |
| 772 | Ga0466957_0000324 | 3300044842 | Bacteria | 23180 |
| 773 | Ga0466959_0011621 | 3300045049 | Bacteria | 6329 |
| 774 | Ga0451576_0004157 | 3300045051 | Bacteria | 19055 |
| 775 | Ga0451576_0092322 | 3300045051 | Bacteria | 3149 |
| 776 | Ga0451576_0346190 | 3300045051 | Bacteria | 1556 |
| 777 | Ga0451576_0405387 | 3300045051 | Bacteria | 1430 |
| 778 | Ga0451576_0437311 | 3300045051 | Bacteria | 1373 |
| 779 | Ga0466958_0016862 | 3300045836 | Bacteria | 4215 |
| 780 | Ga0466958_0034939 | 3300045836 | Bacteria | 3001 |
| 781 | Ga0466967_0017072 | 3300045976 | Bacteria | 5747 |
| 782 | Ga0466967_0041428 | 3300045976 | Bacteria | 3970 |
| 783 | Ga0466967_0110685 | 3300045976 | Bacteria | 2523 |
| 784 | Ga0466967_0170640 | 3300045976 | Bacteria | 2046 |
| 785 | Ga0495629_0053519 | 3300046459 | Bacteria | 2824 |
| 786 | Ga0495629_0288172 | 3300046459 | Bacteria | 1126 |
| 787 | Ga0495651_0022857 | 3300046462 | Bacteria | 4862 |
| 788 | Ga0495651_0165050 | 3300046462 | Bacteria | 1583 |
| 789 | Ga0495580_0001673 | 3300046472 | Bacteria | 19470 |
| 790 | Ga0495580_0001845 | 3300046472 | Bacteria | 18638 |
| 791 | Ga0495580_0005545 | 3300046472 | Bacteria | 10406 |
| 792 | Ga0495580_0016664 | 3300046472 | Bacteria | 5514 |
| 793 | Ga0495580_0018154 | 3300046472 | Bacteria | 5242 |
| 794 | Ga0495580_0118241 | 3300046472 | Bacteria | 1840 |
| 795 | Ga0495580_0133362 | 3300046472 | Bacteria | 1722 |
| 796 | Ga0495580_0181217 | 3300046472 | Bacteria | 1455 |
| 797 | Ga0495580_0361148 | 3300046472 | Bacteria | 983 |
| 798 | Ga0495582_0000596 | 3300046473 | Bacteria | 19949 |
| 799 | Ga0495582_0082239 | 3300046473 | Bacteria | 1789 |
| 800 | Ga0495582_0107609 | 3300046473 | Bacteria | 1565 |
| 801 | Ga0495662_0272273 | 3300046476 | Bacteria | 833 |
| 802 | Ga0495628_0102363 | 3300046516 | Bacteria | 2210 |
| 803 | Ga0495666_0021051 | 3300046526 | Bacteria | 3229 |
| 804 | Ga0495666_0092719 | 3300046526 | Bacteria | 1425 |
| 805 | Ga0495665_0000974 | 3300046531 | Bacteria | 15176 |
| 806 | Ga0495665_0131102 | 3300046531 | Bacteria | 1312 |
| 807 | Ga0495621_0021241 | 3300046539 | Bacteria | 2139 |
| 808 | Ga0495621_0043593 | 3300046539 | Bacteria | 1583 |
| 809 | Ga0495657_0223755 | 3300046675 | Bacteria | 1140 |
| 810 | Ga0495658_0049778 | 3300046683 | Bacteria | 2368 |
| 811 | Ga0495658_0057450 | 3300046683 | Bacteria | 2223 |
| 812 | Ga0495658_0096862 | 3300046683 | Bacteria | 1755 |
| 813 | Ga0495669_0000669 | 3300046684 | Bacteria | 14899 |
| 814 | Ga0495624_0182823 | 3300046690 | Bacteria | 1277 |
| 815 | Ga0495581_0167444 | 3300047315 | Bacteria | 1285 |
| 816 | Ga0495674_0013768 | 3300047319 | Bacteria | 7593 |
| 817 | Ga0495674_0046446 | 3300047319 | Bacteria | 3854 |
| 818 | Ga0495675_0085365 | 3300047444 | Bacteria | 1985 |
| 819 | Ga0495684_0133954 | 3300047471 | Bacteria | 1860 |
| 820 | Ga0495602_0078631 | 3300048088 | Bacteria | 2786 |
| 821 | Ga0495602_0285483 | 3300048088 | Bacteria | 1214 |
| 822 | Ga0496100_0104235 | 3300048903 | Bacteria | 1959 |
| 823 | Ga0496100_0250095 | 3300048903 | Bacteria | 1311 |
| 824 | Ga0496101_0086194 | 3300048904 | Bacteria | 2329 |
| 825 | Ga0496101_0242897 | 3300048904 | Bacteria | 1402 |
| 826 | Ga0496101_0773977 | 3300048904 | Bacteria | 757 |
| 827 | Ga0496102_0003212 | 3300048905 | Bacteria | 13867 |
| 828 | Ga0496102_0016554 | 3300048905 | Bacteria | 6444 |
| 829 | Ga0496102_0034032 | 3300048905 | Bacteria | 4582 |
| 830 | Ga0496102_0238756 | 3300048905 | Bacteria | 1714 |
| 831 | Ga0496102_0283500 | 3300048905 | Unclassified | 1561 |
| 832 | Ga0496103_0002380 | 3300048906 | Bacteria | 11861 |
| 833 | Ga0496103_0039142 | 3300048906 | Bacteria | 2913 |
| 834 | Ga0496104_0025955 | 3300048907 | Bacteria | 5403 |
| 835 | Ga0496104_0220731 | 3300048907 | Bacteria | 1808 |
| 836 | Ga0496104_0288112 | 3300048907 | Bacteria | 1555 |
| 837 | Ga0496104_0923870 | 3300048907 | Bacteria | 777 |
| 838 | Ga0496105_0307859 | 3300048908 | Bacteria | 1272 |
| 839 | Ga0496106_0063431 | 3300048909 | Bacteria | 2808 |
| 840 | Ga0496106_0307045 | 3300048909 | Bacteria | 1273 |
| 841 | Ga0496106_0322373 | 3300048909 | Bacteria | 1240 |
| 842 | Ga0496107_0078051 | 3300048910 | Bacteria | 2412 |
| 843 | Ga0496107_0284470 | 3300048910 | Unclassified | 1231 |
| 844 | Ga0496108_0022698 | 3300048911 | Bacteria | 5162 |
| 845 | Ga0496109_0038156 | 3300048912 | Bacteria | 4342 |
| 846 | Ga0496109_0189690 | 3300048912 | Bacteria | 1931 |
| 847 | Ga0496110_0702414 | 3300048913 | Bacteria | 913 |
| 848 | Ga0496111_0057018 | 3300048914 | Bacteria | 2828 |
| 849 | Ga0496112_0027473 | 3300048915 | Bacteria | 5486 |
| 850 | Ga0496112_0038846 | 3300048915 | Bacteria | 4650 |
| 851 | Ga0496112_0047142 | 3300048915 | Bacteria | 4227 |
| 852 | Ga0496112_0057520 | 3300048915 | Bacteria | 3828 |
| 853 | Ga0496112_0079924 | 3300048915 | Bacteria | 3234 |
| 854 | Ga0496112_0162779 | 3300048915 | Bacteria | 2197 |
| 855 | Ga0496112_0172754 | 3300048915 | Bacteria | 2126 |
| 856 | Ga0496112_0191638 | 3300048915 | Bacteria | 2006 |
| 857 | Ga0496112_0445977 | 3300048915 | Bacteria | 1232 |
| 858 | Ga0496113_0009232 | 3300048916 | Bacteria | 6470 |
| 859 | Ga0496113_0027888 | 3300048916 | Bacteria | 4054 |
| 860 | Ga0496114_0060383 | 3300048917 | Bacteria | 3169 |
| 861 | Ga0496115_0004694 | 3300048918 | Bacteria | 9905 |
| 862 | Ga0496115_0084254 | 3300048918 | Bacteria | 2592 |
| 863 | Ga0496115_0087626 | 3300048918 | Bacteria | 2540 |
| 864 | Ga0496115_0106988 | 3300048918 | Bacteria | 2296 |
| 865 | Ga0496115_0145780 | 3300048918 | Bacteria | 1954 |
| 866 | Ga0496115_0374922 | 3300048918 | Bacteria | 1158 |
| 867 | Ga0501290_000006 | 3300049513 | Bacteria | 41465 |
| 868 | Ga0501292_000272 | 3300049515 | Bacteria | 7407 |
| 869 | Ga0501294_000481 | 3300049517 | Bacteria | 4674 |
| 870 | Ga0501295_000073 | 3300049518 | Bacteria | 10094 |
| 871 | Ga0501296_000045 | 3300049519 | Bacteria | 13836 |
| 872 | Ga0501297_000036 | 3300049520 | Bacteria | 13632 |
| 873 | Ga0501300_000028 | 3300049523 | Bacteria | 22326 |
| 874 | Ga0501301_000136 | 3300049524 | Bacteria | 3898 |
| 875 | Ga0501302_000637 | 3300049525 | Bacteria | 1866 |
| 876 | Ga0501032_0247775 | 3300049569 | Bacteria | 1157 |
| 877 | Ga0501038_0399170 | 3300049574 | Bacteria | 1064 |
| 878 | Ga0501198_001028 | 3300049649 | Bacteria | 3555 |
| 879 | Ga0501199_000973 | 3300049650 | Bacteria | 2566 |
| 880 | Ga0501201_000064 | 3300049651 | Bacteria | 7641 |
| 881 | Ga0501206_001081 | 3300049653 | Bacteria | 3390 |
| 882 | Ga0501217_000887 | 3300049661 | Bacteria | 5327 |
| 883 | Ga0501223_004773 | 3300049663 | Bacteria | 2885 |
| 884 | Ga0501230_000571 | 3300049667 | Bacteria | 3836 |
| 885 | Ga0501235_000120 | 3300049669 | Bacteria | 12942 |
| 886 | Ga0501243_001725 | 3300049675 | Bacteria | 3157 |
| 887 | Ga0501246_000833 | 3300049676 | Bacteria | 2293 |
| 888 | Ga0501247_008278 | 3300049677 | Bacteria | 1211 |
| 889 | Ga0501249_000254 | 3300049679 | Bacteria | 15773 |
| 890 | Ga0501250_002902 | 3300049680 | Bacteria | 1597 |
| 891 | Ga0501256_004473 | 3300049685 | Bacteria | 1202 |
| 892 | Ga0501257_002107 | 3300049686 | Bacteria | 4154 |
| 893 | Ga0501261_000374 | 3300049690 | Bacteria | 5979 |
| 894 | Ga0501219_000556 | 3300049703 | Bacteria | 5469 |
| 895 | Ga0501221_000274 | 3300049704 | Bacteria | 7642 |
| 896 | Ga0501225_0000149 | 3300049705 | Bacteria | 21494 |
| 897 | Ga0501229_007354 | 3300049706 | Bacteria | 1371 |
| 898 | Ga0501234_000101 | 3300049707 | Bacteria | 10829 |
| 899 | Ga0501245_000270 | 3300049708 | Bacteria | 6007 |
| 900 | Ga0501232_007194 | 3300049757 | Bacteria | 1167 |
| 901 | Ga0501241_020006 | 3300049758 | Bacteria | 1230 |
| 902 | Ga0501265_003862 | 3300049762 | Bacteria | 1701 |
| 903 | Ga0501266_008158 | 3300049763 | Bacteria | 1318 |
| 904 | Ga0501270_000039 | 3300049767 | Bacteria | 9661 |
| 905 | Ga0501271_000251 | 3300049768 | Bacteria | 4528 |
| 906 | Ga0501272_000266 | 3300049769 | Bacteria | 4402 |
| 907 | Ga0501274_001107 | 3300049771 | Bacteria | 2026 |
| 908 | Ga0501276_000854 | 3300049773 | Bacteria | 1954 |
| 909 | Ga0501278_000069 | 3300049774 | Bacteria | 7005 |
| 910 | Ga0501279_000228 | 3300049775 | Bacteria | 7775 |
| 911 | Ga0501280_005247 | 3300049776 | Bacteria | 1860 |
| 912 | Ga0501281_01370 | 3300049777 | Bacteria | 1928 |
| 913 | Ga0501045_0260460 | 3300049824 | Bacteria | 1291 |
| 914 | Ga0501226_000270 | 3300049853 | Bacteria | 7831 |
| 915 | nmdc:mga0yw44_25889_c1 | 3300050492 | Bacteria | 3344 |
| 916 | nmdc:mga05p37_300092_c1 | 3300050507 | Bacteria | 1909 |
| 917 | nmdc:mga05p37_4432_c1 | 3300050507 | Bacteria | 16406 |
| 918 | nmdc:mga09592_283859_c1 | 3300050508 | Bacteria | 1436 |
| 919 | nmdc:mga09592_4132_c1 | 3300050508 | Bacteria | 11727 |
| 920 | nmdc:mga0qj67_19376_c1 | 3300050509 | Bacteria | 5198 |
| 921 | nmdc:mga0qj67_53356_c1 | 3300050509 | Bacteria | 3201 |
| 922 | nmdc:mga0n895_21442_c1 | 3300050512 | Bacteria | 6042 |
| 923 | nmdc:mga0n895_26592_c1 | 3300050512 | Bacteria | 5483 |
| 924 | nmdc:mga0n895_344_c1 | 3300050512 | Bacteria | 31117 |
| 925 | nmdc:mga0n895_451715_c1 | 3300050512 | Bacteria | 1297 |
| 926 | nmdc:mga0rr50_350648_c1 | 3300050513 | Bacteria | 1241 |
| 927 | nmdc:mga0rr50_37321_c1 | 3300050513 | Bacteria | 3507 |
| 928 | nmdc:mga0rr50_872_c1 | 3300050513 | Bacteria | 16295 |
| 929 | nmdc:mga08x19_3391_c1 | 3300050514 | Bacteria | 9503 |
| 930 | nmdc:mga08x19_3614_c1 | 3300050514 | Bacteria | 9212 |
| 931 | nmdc:mga08x19_444446_c1 | 3300050514 | Bacteria | 912 |
| 932 | nmdc:mga08x19_9637_c1 | 3300050514 | Bacteria | 5785 |
| 933 | nmdc:mga0a205_247203_c1 | 3300050515 | Bacteria | 1664 |
| 934 | nmdc:mga0a205_7367_c1 | 3300050515 | Bacteria | 9965 |
| 935 | Ga0495601_0023927 | 3300053077 | Bacteria | 3757 |
| 936 | Ga0495601_0427759 | 3300053077 | Bacteria | 857 |
| 937 | Ga0495612_0085918 | 3300053078 | Bacteria | 1326 |
| 938 | Ga0587093_001841 | 3300059478 | Bacteria | 1873 |
| 939 | Ga0587066_000041 | 3300059490 | Bacteria | 5943 |
| 940 | Ga0587066_002101 | 3300059490 | Bacteria | 2142 |
| 941 | Ga0587070_000114 | 3300059491 | Bacteria | 4759 |
| 942 | Ga0587073_0004031 | 3300059492 | Bacteria | 2070 |
| 943 | Ga0587073_0007886 | 3300059492 | Bacteria | 1703 |
| 944 | Ga0587073_0034242 | 3300059492 | Bacteria | 1069 |
| 945 | Ga0587077_000059 | 3300059493 | Bacteria | 5517 |
| 946 | Ga0587080_000447 | 3300059503 | Bacteria | 3474 |
| 947 | Ga0587082_000041 | 3300059504 | Bacteria | 6191 |
| 948 | Ga0587083_0000140 | 3300059505 | Bacteria | 4785 |
| 949 | Ga0587085_000049 | 3300059506 | Bacteria | 5074 |
| 950 | Ga0587089_001185 | 3300059509 | Bacteria | 2342 |
| 951 | Ga0587091_000037 | 3300059511 | Bacteria | 6401 |
| 952 | Ga0587092_000359 | 3300059512 | Bacteria | 3473 |
| 953 | Ga0587092_008497 | 3300059512 | Bacteria | 1357 |
| 954 | Ga0587113_000220 | 3300059625 | Bacteria | 2674 |
| 955 | Ga0587128_005905 | 3300059630 | Bacteria | 1486 |
| 956 | Ga0587062_000813 | 3300059639 | Bacteria | 2412 |
| 957 | Ga0587067_000531 | 3300059640 | Bacteria | 3405 |
| 958 | Ga0587075_000131 | 3300059644 | Bacteria | 4321 |
| 959 | Ga0587076_000182 | 3300059645 | Bacteria | 4244 |
| 960 | Ga0587076_007119 | 3300059645 | Bacteria | 1516 |
| 961 | Ga0587078_000985 | 3300059646 | Bacteria | 2387 |
| 962 | Ga0587078_002585 | 3300059646 | Bacteria | 1765 |
| 963 | Ga0587079_000058 | 3300059647 | Bacteria | 6141 |
| 964 | Ga0587060_000766 | 3300060243 | Bacteria | 1918 |
| 965 | Ga0587071_000028 | 3300060344 | Bacteria | 7821 |
| 966 | Ga0587071_015934 | 3300060344 | Bacteria | 1324 |
| 967 | Ga0501082_0875179 | 3300060353 | Bacteria | 786 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005981 | Ga0081538_10034921 | Ga0081538_100349212 | 213 |
| 2 | 3300048909 | Ga0496106_0307045 | Ga0496106_0307045_12_707 | 213 |
| 3 | 3300009176 | Ga0105242_10021951 | Ga0105242_100219518 | 218 |
| 4 | 3300025923 | Ga0207681_10366824 | Ga0207681_103668242 | 218 |
| 5 | 3300050512 | nmdc:mga0n895_451715_c1 | nmdc:mga0n895_451715_c1_41_703 | 220 |
| 6 | 3300004799 | Ga0058863_10026251 | Ga0058863_100262513 | 226 |
| 7 | 3300004803 | Ga0058862_10141803 | Ga0058862_101418035 | 226 |
| 8 | 3300005329 | Ga0070683_100347730 | Ga0070683_1003477303 | 226 |
| 9 | 3300005336 | Ga0070680_100039076 | Ga0070680_1000390764 | 226 |
| 10 | 3300005458 | Ga0070681_10055173 | Ga0070681_100551736 | 226 |
| 11 | 3300005530 | Ga0070679_100022709 | Ga0070679_1000227094 | 226 |
| 12 | 3300005535 | Ga0070684_100343658 | Ga0070684_1003436582 | 226 |
| 13 | 3300005577 | Ga0068857_100464867 | Ga0068857_1004648672 | 226 |
| 14 | 3300025912 | Ga0207707_10109026 | Ga0207707_101090262 | 226 |
| 15 | 3300025917 | Ga0207660_10096860 | Ga0207660_100968602 | 226 |
| 16 | 3300025921 | Ga0207652_10104357 | Ga0207652_101043572 | 226 |
| 17 | 3300025944 | Ga0207661_10139424 | Ga0207661_101394244 | 226 |
| 18 | 3300059490 | Ga0587066_002101 | Ga0587066_002101_838_1590 | 226 |
| 19 | 3300060353 | Ga0501082_0875179 | Ga0501082_0875179_11_703 | 228 |
| 20 | 3300041512 | Ga0451853_3230832 | Ga0451853_3230832_455_1201 | 229 |
| 21 | iso_pu_bacteria | 2551306092 | 2551736114 | 230 |
| 22 | 3300005290 | Ga0065712_10027462 | Ga0065712_100274622 | 235 |
| 23 | 3300005293 | Ga0065715_10023180 | Ga0065715_100231803 | 235 |
| 24 | 3300005328 | Ga0070676_10036288 | Ga0070676_100362884 | 235 |
| 25 | 3300005329 | Ga0070683_100366021 | Ga0070683_1003660212 | 235 |
| 26 | 3300005329 | Ga0070683_100453679 | Ga0070683_1004536791 | 235 |
| 27 | 3300005330 | Ga0070690_100046535 | Ga0070690_1000465353 | 235 |
| 28 | 3300005330 | Ga0070690_100327958 | Ga0070690_1003279581 | 235 |
| 29 | 3300005331 | Ga0070670_100076304 | Ga0070670_1000763045 | 235 |
| 30 | 3300005333 | Ga0070677_10008739 | Ga0070677_100087395 | 235 |
| 31 | 3300005334 | Ga0068869_100010773 | Ga0068869_1000107733 | 235 |
| 32 | 3300005334 | Ga0068869_100298461 | Ga0068869_1002984611 | 235 |
| 33 | 3300005340 | Ga0070689_100047225 | Ga0070689_1000472253 | 235 |
| 34 | 3300005340 | Ga0070689_100249975 | Ga0070689_1002499752 | 235 |
| 35 | 3300005344 | Ga0070661_100357641 | Ga0070661_1003576412 | 235 |
| 36 | 3300005354 | Ga0070675_100002788 | Ga0070675_10000278811 | 235 |
| 37 | 3300005354 | Ga0070675_100042746 | Ga0070675_1000427464 | 235 |
| 38 | 3300005354 | Ga0070675_100090126 | Ga0070675_1000901263 | 235 |
| 39 | 3300005354 | Ga0070675_100294260 | Ga0070675_1002942603 | 235 |
| 40 | 3300005355 | Ga0070671_100080002 | Ga0070671_1000800024 | 235 |
| 41 | 3300005364 | Ga0070673_100067958 | Ga0070673_1000679583 | 235 |
| 42 | 3300005364 | Ga0070673_100084232 | Ga0070673_1000842323 | 235 |
| 43 | 3300005367 | Ga0070667_100219341 | Ga0070667_1002193412 | 235 |
| 44 | 3300005438 | Ga0070701_10030951 | Ga0070701_100309512 | 235 |
| 45 | 3300005441 | Ga0070700_100072430 | Ga0070700_1000724303 | 235 |
| 46 | 3300005445 | Ga0070708_100006987 | Ga0070708_10000698715 | 235 |
| 47 | 3300005445 | Ga0070708_100026039 | Ga0070708_1000260394 | 235 |
| 48 | 3300005456 | Ga0070678_100116726 | Ga0070678_1001167261 | 235 |
| 49 | 3300005456 | Ga0070678_100351103 | Ga0070678_1003511032 | 235 |
| 50 | 3300005458 | Ga0070681_10005952 | Ga0070681_100059528 | 235 |
| 51 | 3300005459 | Ga0068867_100006640 | Ga0068867_10000664013 | 235 |
| 52 | 3300005467 | Ga0070706_100001389 | Ga0070706_10000138925 | 235 |
| 53 | 3300005468 | Ga0070707_100000141 | Ga0070707_10000014152 | 235 |
| 54 | 3300005468 | Ga0070707_100013079 | Ga0070707_1000130797 | 235 |
| 55 | 3300005471 | Ga0070698_100000139 | Ga0070698_10000013948 | 235 |
| 56 | 3300005471 | Ga0070698_100002247 | Ga0070698_10000224714 | 235 |
| 57 | 3300005471 | Ga0070698_100046998 | Ga0070698_1000469983 | 235 |
| 58 | 3300005471 | Ga0070698_100329736 | Ga0070698_1003297361 | 235 |
| 59 | 3300005518 | Ga0070699_100001695 | Ga0070699_10000169518 | 235 |
| 60 | 3300005518 | Ga0070699_100093484 | Ga0070699_1000934842 | 235 |
| 61 | 3300005518 | Ga0070699_100131330 | Ga0070699_1001313303 | 235 |
| 62 | 3300005518 | Ga0070699_100214448 | Ga0070699_1002144482 | 235 |
| 63 | 3300005518 | Ga0070699_100272844 | Ga0070699_1002728442 | 235 |
| 64 | 3300005535 | Ga0070684_100100706 | Ga0070684_1001007062 | 235 |
| 65 | 3300005536 | Ga0070697_100000181 | Ga0070697_10000018133 | 235 |
| 66 | 3300005536 | Ga0070697_100097515 | Ga0070697_1000975153 | 235 |
| 67 | 3300005536 | Ga0070697_100591626 | Ga0070697_1005916262 | 235 |
| 68 | 3300005543 | Ga0070672_100082364 | Ga0070672_1000823644 | 235 |
| 69 | 3300005544 | Ga0070686_100010421 | Ga0070686_1000104215 | 235 |
| 70 | 3300005549 | Ga0070704_100031956 | Ga0070704_1000319564 | 235 |
| 71 | 3300005564 | Ga0070664_100001536 | Ga0070664_10000153614 | 235 |
| 72 | 3300005617 | Ga0068859_100822611 | Ga0068859_1008226111 | 235 |
| 73 | 3300005618 | Ga0068864_100186541 | Ga0068864_1001865412 | 235 |
| 74 | 3300005618 | Ga0068864_100357383 | Ga0068864_1003573832 | 235 |
| 75 | 3300005719 | Ga0068861_100084611 | Ga0068861_1000846113 | 235 |
| 76 | 3300005834 | Ga0068851_10021382 | Ga0068851_100213823 | 235 |
| 77 | 3300005840 | Ga0068870_10064860 | Ga0068870_100648602 | 235 |
| 78 | 3300005840 | Ga0068870_10163463 | Ga0068870_101634632 | 235 |
| 79 | 3300005843 | Ga0068860_100390052 | Ga0068860_1003900522 | 235 |
| 80 | 3300005844 | Ga0068862_100259774 | Ga0068862_1002597742 | 235 |
| 81 | 3300006028 | Ga0070717_10155162 | Ga0070717_101551623 | 235 |
| 82 | 3300006178 | Ga0075367_10076806 | Ga0075367_100768062 | 235 |
| 83 | 3300006358 | Ga0068871_100020698 | Ga0068871_1000206985 | 235 |
| 84 | 3300006358 | Ga0068871_100068684 | Ga0068871_1000686843 | 235 |
| 85 | 3300006844 | Ga0075428_100034853 | Ga0075428_1000348532 | 235 |
| 86 | 3300006846 | Ga0075430_100001931 | Ga0075430_10000193110 | 235 |
| 87 | 3300006847 | Ga0075431_100112052 | Ga0075431_1001120523 | 235 |
| 88 | 3300006880 | Ga0075429_100001796 | Ga0075429_1000017967 | 235 |
| 89 | 3300006881 | Ga0068865_100219752 | Ga0068865_1002197522 | 235 |
| 90 | 3300006914 | Ga0075436_100258144 | Ga0075436_1002581442 | 235 |
| 91 | 3300006931 | Ga0097620_100822568 | Ga0097620_1008225681 | 235 |
| 92 | 3300007076 | Ga0075435_100547357 | Ga0075435_1005473572 | 235 |
| 93 | 3300009094 | Ga0111539_10302448 | Ga0111539_103024482 | 235 |
| 94 | 3300009176 | Ga0105242_10025185 | Ga0105242_100251853 | 235 |
| 95 | 3300009176 | Ga0105242_10732535 | Ga0105242_107325352 | 235 |
| 96 | 3300013296 | Ga0157374_10367777 | Ga0157374_103677772 | 235 |
| 97 | 3300014325 | Ga0163163_10150827 | Ga0163163_101508272 | 235 |
| 98 | 3300014326 | Ga0157380_10226030 | Ga0157380_102260302 | 235 |
| 99 | 3300014969 | Ga0157376_10008421 | Ga0157376_100084217 | 235 |
| 100 | 3300017792 | Ga0163161_10327237 | Ga0163161_103272373 | 235 |
| 101 | 3300025321 | Ga0207656_10005274 | Ga0207656_100052744 | 235 |
| 102 | 3300025893 | Ga0207682_10076728 | Ga0207682_100767282 | 235 |
| 103 | 3300025907 | Ga0207645_10035810 | Ga0207645_100358103 | 235 |
| 104 | 3300025908 | Ga0207643_10148556 | Ga0207643_101485563 | 235 |
| 105 | 3300025910 | Ga0207684_10000188 | Ga0207684_1000018853 | 235 |
| 106 | 3300025910 | Ga0207684_10001851 | Ga0207684_1000185125 | 235 |
| 107 | 3300025910 | Ga0207684_10194029 | Ga0207684_101940292 | 235 |
| 108 | 3300025910 | Ga0207684_10278928 | Ga0207684_102789281 | 235 |
| 109 | 3300025922 | Ga0207646_10000238 | Ga0207646_1000023826 | 235 |
| 110 | 3300025922 | Ga0207646_10000258 | Ga0207646_1000025856 | 235 |
| 111 | 3300025922 | Ga0207646_10206047 | Ga0207646_102060473 | 235 |
| 112 | 3300025922 | Ga0207646_10333690 | Ga0207646_103336902 | 235 |
| 113 | 3300025923 | Ga0207681_10048860 | Ga0207681_100488603 | 235 |
| 114 | 3300025923 | Ga0207681_10114519 | Ga0207681_101145192 | 235 |
| 115 | 3300025923 | Ga0207681_10181869 | Ga0207681_101818691 | 235 |
| 116 | 3300025924 | Ga0207694_10019318 | Ga0207694_100193188 | 235 |
| 117 | 3300025925 | Ga0207650_10014338 | Ga0207650_100143383 | 235 |
| 118 | 3300025925 | Ga0207650_10725017 | Ga0207650_107250172 | 235 |
| 119 | 3300025926 | Ga0207659_10003579 | Ga0207659_1000357918 | 235 |
| 120 | 3300025926 | Ga0207659_10007868 | Ga0207659_1000786811 | 235 |
| 121 | 3300025926 | Ga0207659_10114968 | Ga0207659_101149683 | 235 |
| 122 | 3300025926 | Ga0207659_10243802 | Ga0207659_102438022 | 235 |
| 123 | 3300025931 | Ga0207644_10010037 | Ga0207644_100100373 | 235 |
| 124 | 3300025931 | Ga0207644_10063127 | Ga0207644_100631274 | 235 |
| 125 | 3300025934 | Ga0207686_10020935 | Ga0207686_100209354 | 235 |
| 126 | 3300025934 | Ga0207686_10030480 | Ga0207686_100304803 | 235 |
| 127 | 3300025935 | Ga0207709_10011617 | Ga0207709_100116173 | 235 |
| 128 | 3300025936 | Ga0207670_10042709 | Ga0207670_100427094 | 235 |
| 129 | 3300025939 | Ga0207665_10020276 | Ga0207665_100202765 | 235 |
| 130 | 3300025940 | Ga0207691_10067123 | Ga0207691_100671233 | 235 |
| 131 | 3300025942 | Ga0207689_10007360 | Ga0207689_1000736016 | 235 |
| 132 | 3300025944 | Ga0207661_10110732 | Ga0207661_101107322 | 235 |
| 133 | 3300025960 | Ga0207651_10073059 | Ga0207651_100730595 | 235 |
| 134 | 3300025960 | Ga0207651_10091307 | Ga0207651_100913073 | 235 |
| 135 | 3300026035 | Ga0207703_10051358 | Ga0207703_100513584 | 235 |
| 136 | 3300026075 | Ga0207708_10039059 | Ga0207708_100390596 | 235 |
| 137 | 3300026089 | Ga0207648_10001325 | Ga0207648_1000132521 | 235 |
| 138 | 3300026095 | Ga0207676_10087662 | Ga0207676_100876624 | 235 |
| 139 | 3300026095 | Ga0207676_10236285 | Ga0207676_102362852 | 235 |
| 140 | 3300026121 | Ga0207683_10062607 | Ga0207683_100626075 | 235 |
| 141 | 3300026121 | Ga0207683_10249749 | Ga0207683_102497492 | 235 |
| 142 | 3300027543 | Ga0209999_1030202 | Ga0209999_10302021 | 235 |
| 143 | 3300027665 | Ga0209983_1000426 | Ga0209983_100042618 | 235 |
| 144 | 3300027682 | Ga0209971_1020867 | Ga0209971_10208672 | 235 |
| 145 | 3300027876 | Ga0209974_10000500 | Ga0209974_100005003 | 235 |
| 146 | 3300028381 | Ga0268264_10028638 | Ga0268264_100286383 | 235 |
| 147 | 3300031731 | Ga0307405_10000473 | Ga0307405_1000047324 | 235 |
| 148 | 3300031852 | Ga0307410_10314420 | Ga0307410_103144202 | 235 |
| 149 | 3300031903 | Ga0307407_10009603 | Ga0307407_100096034 | 235 |
| 150 | 3300032004 | Ga0307414_10266029 | Ga0307414_102660292 | 235 |
| 151 | 3300032005 | Ga0307411_10072579 | Ga0307411_100725794 | 235 |
| 152 | 3300033528 | Ga0316588_1016936 | Ga0316588_10169363 | 235 |
| 153 | 3300035691 | Ga0373931_0177118 | Ga0373931_0177118_194_943 | 235 |
| 154 | 3300044694 | Ga0466963_0002381 | Ga0466963_0002381_8661_9407 | 235 |
| 155 | 3300045051 | Ga0451576_0004157 | Ga0451576_0004157_13376_14125 | 235 |
| 156 | 3300045976 | Ga0466967_0017072 | Ga0466967_0017072_1948_2694 | 235 |
| 157 | 3300046539 | Ga0495621_0021241 | Ga0495621_0021241_719_1498 | 235 |
| 158 | 3300046539 | Ga0495621_0043593 | Ga0495621_0043593_418_1215 | 235 |
| 159 | 3300048905 | Ga0496102_0034032 | Ga0496102_0034032_3531_4286 | 235 |
| 160 | 3300048915 | Ga0496112_0162779 | Ga0496112_0162779_161_937 | 235 |
| 161 | 3300048918 | Ga0496115_0106988 | Ga0496115_0106988_1088_1843 | 235 |
| 162 | 3300049513 | Ga0501290_000006 | Ga0501290_000006_3319_4068 | 235 |
| 163 | 3300049515 | Ga0501292_000272 | Ga0501292_000272_5915_6664 | 235 |
| 164 | 3300049517 | Ga0501294_000481 | Ga0501294_000481_157_906 | 235 |
| 165 | 3300049518 | Ga0501295_000073 | Ga0501295_000073_2400_3149 | 235 |
| 166 | 3300049519 | Ga0501296_000045 | Ga0501296_000045_9633_10382 | 235 |
| 167 | 3300049520 | Ga0501297_000036 | Ga0501297_000036_10656_11405 | 235 |
| 168 | 3300049523 | Ga0501300_000028 | Ga0501300_000028_11680_12429 | 235 |
| 169 | 3300049524 | Ga0501301_000136 | Ga0501301_000136_965_1714 | 235 |
| 170 | 3300049525 | Ga0501302_000637 | Ga0501302_000637_340_1089 | 235 |
| 171 | 3300049569 | Ga0501032_0247775 | Ga0501032_0247775_242_1012 | 235 |
| 172 | 3300049574 | Ga0501038_0399170 | Ga0501038_0399170_43_801 | 235 |
| 173 | 3300049649 | Ga0501198_001028 | Ga0501198_001028_1756_2505 | 235 |
| 174 | 3300049650 | Ga0501199_000973 | Ga0501199_000973_1663_2412 | 235 |
| 175 | 3300049651 | Ga0501201_000064 | Ga0501201_000064_4526_5275 | 235 |
| 176 | 3300049653 | Ga0501206_001081 | Ga0501206_001081_887_1636 | 235 |
| 177 | 3300049661 | Ga0501217_000887 | Ga0501217_000887_1221_1970 | 235 |
| 178 | 3300049663 | Ga0501223_004773 | Ga0501223_004773_366_1115 | 235 |
| 179 | 3300049667 | Ga0501230_000571 | Ga0501230_000571_1173_1922 | 235 |
| 180 | 3300049669 | Ga0501235_000120 | Ga0501235_000120_12216_12929 | 235 |
| 181 | 3300049675 | Ga0501243_001725 | Ga0501243_001725_374_1123 | 235 |
| 182 | 3300049676 | Ga0501246_000833 | Ga0501246_000833_1282_2031 | 235 |
| 183 | 3300049677 | Ga0501247_008278 | Ga0501247_008278_86_835 | 235 |
| 184 | 3300049679 | Ga0501249_000254 | Ga0501249_000254_8869_9618 | 235 |
| 185 | 3300049680 | Ga0501250_002902 | Ga0501250_002902_804_1553 | 235 |
| 186 | 3300049685 | Ga0501256_004473 | Ga0501256_004473_245_994 | 235 |
| 187 | 3300049686 | Ga0501257_002107 | Ga0501257_002107_2424_3173 | 235 |
| 188 | 3300049690 | Ga0501261_000374 | Ga0501261_000374_5256_5969 | 235 |
| 189 | 3300049703 | Ga0501219_000556 | Ga0501219_000556_3481_4230 | 235 |
| 190 | 3300049704 | Ga0501221_000274 | Ga0501221_000274_6453_7202 | 235 |
| 191 | 3300049705 | Ga0501225_0000149 | Ga0501225_0000149_112_861 | 235 |
| 192 | 3300049706 | Ga0501229_007354 | Ga0501229_007354_362_1111 | 235 |
| 193 | 3300049707 | Ga0501234_000101 | Ga0501234_000101_6067_6816 | 235 |
| 194 | 3300049708 | Ga0501245_000270 | Ga0501245_000270_2943_3692 | 235 |
| 195 | 3300049757 | Ga0501232_007194 | Ga0501232_007194_395_1144 | 235 |
| 196 | 3300049758 | Ga0501241_020006 | Ga0501241_020006_415_1164 | 235 |
| 197 | 3300049762 | Ga0501265_003862 | Ga0501265_003862_737_1486 | 235 |
| 198 | 3300049763 | Ga0501266_008158 | Ga0501266_008158_361_1110 | 235 |
| 199 | 3300049767 | Ga0501270_000039 | Ga0501270_000039_6038_6787 | 235 |
| 200 | 3300049768 | Ga0501271_000251 | Ga0501271_000251_2386_3135 | 235 |
| 201 | 3300049769 | Ga0501272_000266 | Ga0501272_000266_2745_3494 | 235 |
| 202 | 3300049771 | Ga0501274_001107 | Ga0501274_001107_328_1077 | 235 |
| 203 | 3300049773 | Ga0501276_000854 | Ga0501276_000854_853_1602 | 235 |
| 204 | 3300049774 | Ga0501278_000069 | Ga0501278_000069_3021_3770 | 235 |
| 205 | 3300049775 | Ga0501279_000228 | Ga0501279_000228_5803_6552 | 235 |
| 206 | 3300049776 | Ga0501280_005247 | Ga0501280_005247_1099_1848 | 235 |
| 207 | 3300049777 | Ga0501281_01370 | Ga0501281_01370_685_1434 | 235 |
| 208 | 3300049824 | Ga0501045_0260460 | Ga0501045_0260460_278_1027 | 235 |
| 209 | 3300049853 | Ga0501226_000270 | Ga0501226_000270_1134_1883 | 235 |
| 210 | 3300050492 | nmdc:mga0yw44_25889_c1 | nmdc:mga0yw44_25889_c1_1098_1853 | 235 |
| 211 | 3300050507 | nmdc:mga05p37_4432_c1 | nmdc:mga05p37_4432_c1_4475_5248 | 235 |
| 212 | 3300050508 | nmdc:mga09592_283859_c1 | nmdc:mga09592_283859_c1_316_1089 | 235 |
| 213 | 3300050508 | nmdc:mga09592_4132_c1 | nmdc:mga09592_4132_c1_2670_3419 | 235 |
| 214 | 3300050509 | nmdc:mga0qj67_19376_c1 | nmdc:mga0qj67_19376_c1_4103_4852 | 235 |
| 215 | 3300050509 | nmdc:mga0qj67_53356_c1 | nmdc:mga0qj67_53356_c1_1033_1806 | 235 |
| 216 | 3300050514 | nmdc:mga08x19_444446_c1 | nmdc:mga08x19_444446_c1_12_758 | 235 |
| 217 | 3300050515 | nmdc:mga0a205_247203_c1 | nmdc:mga0a205_247203_c1_52_816 | 235 |
| 218 | 3300005467 | Ga0070706_100033341 | Ga0070706_1000333413 | 236 |
| 219 | 3300005468 | Ga0070707_100044794 | Ga0070707_1000447943 | 236 |
| 220 | 3300005518 | Ga0070699_100240066 | Ga0070699_1002400662 | 236 |
| 221 | 3300006028 | Ga0070717_10483169 | Ga0070717_104831692 | 236 |
| 222 | 3300010159 | Ga0099796_10025283 | Ga0099796_100252832 | 236 |
| 223 | 3300025922 | Ga0207646_10017066 | Ga0207646_100170666 | 236 |
| 224 | 3300000546 | LJNas_1000185 | LJNas_10001855 | 237 |
| 225 | 3300003320 | rootH2_10094920 | rootH2_100949202 | 237 |
| 226 | 3300003323 | rootH1_10245303 | rootH1_102453032 | 237 |
| 227 | 3300004799 | Ga0058863_10007402 | Ga0058863_100074022 | 237 |
| 228 | 3300004799 | Ga0058863_10107058 | Ga0058863_101070583 | 237 |
| 229 | 3300004800 | Ga0058861_10061883 | Ga0058861_100618833 | 237 |
| 230 | 3300004800 | Ga0058861_10190128 | Ga0058861_101901283 | 237 |
| 231 | 3300004800 | Ga0058861_11824691 | Ga0058861_118246912 | 237 |
| 232 | 3300004801 | Ga0058860_12198664 | Ga0058860_121986643 | 237 |
| 233 | 3300004803 | Ga0058862_10144175 | Ga0058862_101441753 | 237 |
| 234 | 3300004803 | Ga0058862_10197740 | Ga0058862_101977401 | 237 |
| 235 | 3300004803 | Ga0058862_10250586 | Ga0058862_102505862 | 237 |
| 236 | 3300005328 | Ga0070676_10004776 | Ga0070676_100047769 | 237 |
| 237 | 3300005329 | Ga0070683_100099993 | Ga0070683_1000999933 | 237 |
| 238 | 3300005329 | Ga0070683_100114311 | Ga0070683_1001143116 | 237 |
| 239 | 3300005329 | Ga0070683_100122721 | Ga0070683_1001227212 | 237 |
| 240 | 3300005329 | Ga0070683_100186830 | Ga0070683_1001868303 | 237 |
| 241 | 3300005330 | Ga0070690_100032721 | Ga0070690_1000327214 | 237 |
| 242 | 3300005333 | Ga0070677_10071319 | Ga0070677_100713192 | 237 |
| 243 | 3300005334 | Ga0068869_100001846 | Ga0068869_1000018468 | 237 |
| 244 | 3300005334 | Ga0068869_100027435 | Ga0068869_1000274355 | 237 |
| 245 | 3300005335 | Ga0070666_10014850 | Ga0070666_100148506 | 237 |
| 246 | 3300005336 | Ga0070680_100016919 | Ga0070680_1000169199 | 237 |
| 247 | 3300005336 | Ga0070680_100107636 | Ga0070680_1001076363 | 237 |
| 248 | 3300005336 | Ga0070680_100250794 | Ga0070680_1002507942 | 237 |
| 249 | 3300005336 | Ga0070680_100638141 | Ga0070680_1006381411 | 237 |
| 250 | 3300005338 | Ga0068868_100006530 | Ga0068868_1000065308 | 237 |
| 251 | 3300005338 | Ga0068868_100071322 | Ga0068868_1000713225 | 237 |
| 252 | 3300005339 | Ga0070660_100062076 | Ga0070660_1000620763 | 237 |
| 253 | 3300005344 | Ga0070661_100047556 | Ga0070661_1000475563 | 237 |
| 254 | 3300005344 | Ga0070661_100107749 | Ga0070661_1001077492 | 237 |
| 255 | 3300005347 | Ga0070668_100032434 | Ga0070668_1000324344 | 237 |
| 256 | 3300005353 | Ga0070669_100098899 | Ga0070669_1000988992 | 237 |
| 257 | 3300005354 | Ga0070675_100280787 | Ga0070675_1002807872 | 237 |
| 258 | 3300005355 | Ga0070671_100043889 | Ga0070671_1000438893 | 237 |
| 259 | 3300005365 | Ga0070688_100304949 | Ga0070688_1003049492 | 237 |
| 260 | 3300005406 | Ga0070703_10098924 | Ga0070703_100989241 | 237 |
| 261 | 3300005434 | Ga0070709_10000423 | Ga0070709_100004232 | 237 |
| 262 | 3300005434 | Ga0070709_10036190 | Ga0070709_100361903 | 237 |
| 263 | 3300005434 | Ga0070709_10040857 | Ga0070709_100408572 | 237 |
| 264 | 3300005434 | Ga0070709_10466381 | Ga0070709_104663811 | 237 |
| 265 | 3300005435 | Ga0070714_100014828 | Ga0070714_10001482810 | 237 |
| 266 | 3300005435 | Ga0070714_100021848 | Ga0070714_1000218488 | 237 |
| 267 | 3300005435 | Ga0070714_100029336 | Ga0070714_1000293361 | 237 |
| 268 | 3300005435 | Ga0070714_100195392 | Ga0070714_1001953922 | 237 |
| 269 | 3300005435 | Ga0070714_100338627 | Ga0070714_1003386272 | 237 |
| 270 | 3300005436 | Ga0070713_100000364 | Ga0070713_10000036422 | 237 |
| 271 | 3300005436 | Ga0070713_100002249 | Ga0070713_1000022494 | 237 |
| 272 | 3300005436 | Ga0070713_100005638 | Ga0070713_1000056389 | 237 |
| 273 | 3300005436 | Ga0070713_100091363 | Ga0070713_1000913634 | 237 |
| 274 | 3300005436 | Ga0070713_100098986 | Ga0070713_1000989863 | 237 |
| 275 | 3300005436 | Ga0070713_100133438 | Ga0070713_1001334382 | 237 |
| 276 | 3300005436 | Ga0070713_100134671 | Ga0070713_1001346713 | 237 |
| 277 | 3300005436 | Ga0070713_100252898 | Ga0070713_1002528982 | 237 |
| 278 | 3300005436 | Ga0070713_100309223 | Ga0070713_1003092233 | 237 |
| 279 | 3300005436 | Ga0070713_100368642 | Ga0070713_1003686422 | 237 |
| 280 | 3300005436 | Ga0070713_100464439 | Ga0070713_1004644391 | 237 |
| 281 | 3300005437 | Ga0070710_10023917 | Ga0070710_100239173 | 237 |
| 282 | 3300005437 | Ga0070710_10031205 | Ga0070710_100312052 | 237 |
| 283 | 3300005437 | Ga0070710_10031408 | Ga0070710_100314084 | 237 |
| 284 | 3300005439 | Ga0070711_100000191 | Ga0070711_10000019119 | 237 |
| 285 | 3300005439 | Ga0070711_100063203 | Ga0070711_1000632033 | 237 |
| 286 | 3300005439 | Ga0070711_100092324 | Ga0070711_1000923242 | 237 |
| 287 | 3300005439 | Ga0070711_100113461 | Ga0070711_1001134611 | 237 |
| 288 | 3300005439 | Ga0070711_100252627 | Ga0070711_1002526272 | 237 |
| 289 | 3300005440 | Ga0070705_100068395 | Ga0070705_1000683951 | 237 |
| 290 | 3300005445 | Ga0070708_100000356 | Ga0070708_10000035624 | 237 |
| 291 | 3300005445 | Ga0070708_100000459 | Ga0070708_10000045933 | 237 |
| 292 | 3300005445 | Ga0070708_100005339 | Ga0070708_1000053398 | 237 |
| 293 | 3300005445 | Ga0070708_100054805 | Ga0070708_1000548057 | 237 |
| 294 | 3300005445 | Ga0070708_100480428 | Ga0070708_1004804282 | 237 |
| 295 | 3300005456 | Ga0070678_100036448 | Ga0070678_1000364484 | 237 |
| 296 | 3300005456 | Ga0070678_100201334 | Ga0070678_1002013341 | 237 |
| 297 | 3300005457 | Ga0070662_100054645 | Ga0070662_1000546452 | 237 |
| 298 | 3300005458 | Ga0070681_10008803 | Ga0070681_100088037 | 237 |
| 299 | 3300005458 | Ga0070681_10054241 | Ga0070681_100542413 | 237 |
| 300 | 3300005458 | Ga0070681_10068582 | Ga0070681_100685823 | 237 |
| 301 | 3300005458 | Ga0070681_10077768 | Ga0070681_100777685 | 237 |
| 302 | 3300005458 | Ga0070681_10078202 | Ga0070681_100782025 | 237 |
| 303 | 3300005458 | Ga0070681_10162187 | Ga0070681_101621872 | 237 |
| 304 | 3300005458 | Ga0070681_10312591 | Ga0070681_103125912 | 237 |
| 305 | 3300005458 | Ga0070681_10612305 | Ga0070681_106123051 | 237 |
| 306 | 3300005459 | Ga0068867_100033809 | Ga0068867_1000338092 | 237 |
| 307 | 3300005459 | Ga0068867_100473323 | Ga0068867_1004733232 | 237 |
| 308 | 3300005467 | Ga0070706_100000278 | Ga0070706_10000027824 | 237 |
| 309 | 3300005467 | Ga0070706_100000514 | Ga0070706_10000051424 | 237 |
| 310 | 3300005467 | Ga0070706_100109917 | Ga0070706_1001099172 | 237 |
| 311 | 3300005467 | Ga0070706_100169474 | Ga0070706_1001694743 | 237 |
| 312 | 3300005467 | Ga0070706_100660911 | Ga0070706_1006609111 | 237 |
| 313 | 3300005468 | Ga0070707_100000662 | Ga0070707_10000066216 | 237 |
| 314 | 3300005468 | Ga0070707_100025509 | Ga0070707_1000255099 | 237 |
| 315 | 3300005468 | Ga0070707_100036339 | Ga0070707_1000363395 | 237 |
| 316 | 3300005468 | Ga0070707_100061516 | Ga0070707_1000615162 | 237 |
| 317 | 3300005468 | Ga0070707_100066623 | Ga0070707_1000666232 | 237 |
| 318 | 3300005468 | Ga0070707_100301057 | Ga0070707_1003010572 | 237 |
| 319 | 3300005471 | Ga0070698_100002449 | Ga0070698_10000244925 | 237 |
| 320 | 3300005471 | Ga0070698_100004533 | Ga0070698_10000453311 | 237 |
| 321 | 3300005471 | Ga0070698_100131141 | Ga0070698_1001311413 | 237 |
| 322 | 3300005471 | Ga0070698_100215092 | Ga0070698_1002150922 | 237 |
| 323 | 3300005471 | Ga0070698_100303576 | Ga0070698_1003035762 | 237 |
| 324 | 3300005518 | Ga0070699_100000441 | Ga0070699_10000044120 | 237 |
| 325 | 3300005518 | Ga0070699_100001725 | Ga0070699_1000017253 | 237 |
| 326 | 3300005518 | Ga0070699_100003886 | Ga0070699_10000388612 | 237 |
| 327 | 3300005518 | Ga0070699_100057839 | Ga0070699_1000578393 | 237 |
| 328 | 3300005530 | Ga0070679_100030101 | Ga0070679_1000301013 | 237 |
| 329 | 3300005530 | Ga0070679_100046215 | Ga0070679_1000462154 | 237 |
| 330 | 3300005530 | Ga0070679_100081564 | Ga0070679_1000815644 | 237 |
| 331 | 3300005530 | Ga0070679_100185732 | Ga0070679_1001857323 | 237 |
| 332 | 3300005530 | Ga0070679_100355777 | Ga0070679_1003557772 | 237 |
| 333 | 3300005530 | Ga0070679_100790781 | Ga0070679_1007907811 | 237 |
| 334 | 3300005535 | Ga0070684_100030620 | Ga0070684_1000306205 | 237 |
| 335 | 3300005535 | Ga0070684_100052579 | Ga0070684_1000525793 | 237 |
| 336 | 3300005535 | Ga0070684_100061067 | Ga0070684_1000610672 | 237 |
| 337 | 3300005535 | Ga0070684_100358534 | Ga0070684_1003585341 | 237 |
| 338 | 3300005536 | Ga0070697_100000975 | Ga0070697_10000097524 | 237 |
| 339 | 3300005536 | Ga0070697_100000993 | Ga0070697_10000099311 | 237 |
| 340 | 3300005536 | Ga0070697_100001451 | Ga0070697_1000014519 | 237 |
| 341 | 3300005536 | Ga0070697_100003489 | Ga0070697_1000034892 | 237 |
| 342 | 3300005536 | Ga0070697_100005121 | Ga0070697_1000051214 | 237 |
| 343 | 3300005536 | Ga0070697_100028160 | Ga0070697_1000281604 | 237 |
| 344 | 3300005536 | Ga0070697_100063174 | Ga0070697_1000631743 | 237 |
| 345 | 3300005536 | Ga0070697_100523131 | Ga0070697_1005231311 | 237 |
| 346 | 3300005536 | Ga0070697_100530093 | Ga0070697_1005300932 | 237 |
| 347 | 3300005536 | Ga0070697_100547244 | Ga0070697_1005472441 | 237 |
| 348 | 3300005539 | Ga0068853_100335268 | Ga0068853_1003352682 | 237 |
| 349 | 3300005544 | Ga0070686_100037655 | Ga0070686_1000376553 | 237 |
| 350 | 3300005544 | Ga0070686_100332789 | Ga0070686_1003327891 | 237 |
| 351 | 3300005545 | Ga0070695_100207484 | Ga0070695_1002074842 | 237 |
| 352 | 3300005546 | Ga0070696_100180882 | Ga0070696_1001808822 | 237 |
| 353 | 3300005546 | Ga0070696_100192360 | Ga0070696_1001923602 | 237 |
| 354 | 3300005547 | Ga0070693_100024724 | Ga0070693_1000247243 | 237 |
| 355 | 3300005547 | Ga0070693_100060464 | Ga0070693_1000604641 | 237 |
| 356 | 3300005547 | Ga0070693_100061331 | Ga0070693_1000613313 | 237 |
| 357 | 3300005547 | Ga0070693_100276161 | Ga0070693_1002761612 | 237 |
| 358 | 3300005548 | Ga0070665_100013944 | Ga0070665_1000139442 | 237 |
| 359 | 3300005563 | Ga0068855_100086489 | Ga0068855_1000864895 | 237 |
| 360 | 3300005563 | Ga0068855_100122881 | Ga0068855_1001228816 | 237 |
| 361 | 3300005563 | Ga0068855_100131537 | Ga0068855_1001315373 | 237 |
| 362 | 3300005563 | Ga0068855_100131632 | Ga0068855_1001316325 | 237 |
| 363 | 3300005563 | Ga0068855_100153885 | Ga0068855_1001538853 | 237 |
| 364 | 3300005564 | Ga0070664_100000277 | Ga0070664_10000027737 | 237 |
| 365 | 3300005564 | Ga0070664_100056946 | Ga0070664_1000569466 | 237 |
| 366 | 3300005577 | Ga0068857_100011854 | Ga0068857_1000118549 | 237 |
| 367 | 3300005577 | Ga0068857_100015288 | Ga0068857_1000152889 | 237 |
| 368 | 3300005577 | Ga0068857_100087100 | Ga0068857_1000871002 | 237 |
| 369 | 3300005578 | Ga0068854_100015875 | Ga0068854_1000158755 | 237 |
| 370 | 3300005578 | Ga0068854_100028405 | Ga0068854_1000284056 | 237 |
| 371 | 3300005578 | Ga0068854_100151280 | Ga0068854_1001512802 | 237 |
| 372 | 3300005578 | Ga0068854_100155176 | Ga0068854_1001551762 | 237 |
| 373 | 3300005614 | Ga0068856_100018752 | Ga0068856_1000187528 | 237 |
| 374 | 3300005614 | Ga0068856_100036536 | Ga0068856_1000365364 | 237 |
| 375 | 3300005614 | Ga0068856_100101196 | Ga0068856_1001011966 | 237 |
| 376 | 3300005614 | Ga0068856_100102927 | Ga0068856_1001029275 | 237 |
| 377 | 3300005614 | Ga0068856_100241533 | Ga0068856_1002415333 | 237 |
| 378 | 3300005614 | Ga0068856_100390222 | Ga0068856_1003902222 | 237 |
| 379 | 3300005614 | Ga0068856_100597869 | Ga0068856_1005978692 | 237 |
| 380 | 3300005614 | Ga0068856_100621120 | Ga0068856_1006211202 | 237 |
| 381 | 3300005616 | Ga0068852_100018750 | Ga0068852_1000187503 | 237 |
| 382 | 3300005616 | Ga0068852_100037792 | Ga0068852_1000377923 | 237 |
| 383 | 3300005616 | Ga0068852_100077400 | Ga0068852_1000774004 | 237 |
| 384 | 3300005617 | Ga0068859_100013371 | Ga0068859_10001337111 | 237 |
| 385 | 3300005617 | Ga0068859_100017062 | Ga0068859_1000170622 | 237 |
| 386 | 3300005618 | Ga0068864_100012547 | Ga0068864_1000125477 | 237 |
| 387 | 3300005618 | Ga0068864_100347854 | Ga0068864_1003478542 | 237 |
| 388 | 3300005834 | Ga0068851_10105071 | Ga0068851_101050712 | 237 |
| 389 | 3300005840 | Ga0068870_10044634 | Ga0068870_100446344 | 237 |
| 390 | 3300005841 | Ga0068863_100044079 | Ga0068863_1000440792 | 237 |
| 391 | 3300005841 | Ga0068863_100068631 | Ga0068863_1000686313 | 237 |
| 392 | 3300005841 | Ga0068863_100451082 | Ga0068863_1004510822 | 237 |
| 393 | 3300005842 | Ga0068858_100020862 | Ga0068858_1000208624 | 237 |
| 394 | 3300005842 | Ga0068858_100047535 | Ga0068858_1000475352 | 237 |
| 395 | 3300005843 | Ga0068860_100018016 | Ga0068860_1000180162 | 237 |
| 396 | 3300005843 | Ga0068860_100025252 | Ga0068860_1000252523 | 237 |
| 397 | 3300005843 | Ga0068860_100173182 | Ga0068860_1001731822 | 237 |
| 398 | 3300005843 | Ga0068860_100252271 | Ga0068860_1002522712 | 237 |
| 399 | 3300005844 | Ga0068862_100116286 | Ga0068862_1001162862 | 237 |
| 400 | 3300005983 | Ga0081540_1096199 | Ga0081540_10961992 | 237 |
| 401 | 3300006028 | Ga0070717_10002614 | Ga0070717_1000261415 | 237 |
| 402 | 3300006028 | Ga0070717_10006374 | Ga0070717_100063748 | 237 |
| 403 | 3300006028 | Ga0070717_10006770 | Ga0070717_1000677013 | 237 |
| 404 | 3300006028 | Ga0070717_10022846 | Ga0070717_100228463 | 237 |
| 405 | 3300006028 | Ga0070717_10024604 | Ga0070717_100246044 | 237 |
| 406 | 3300006028 | Ga0070717_10200924 | Ga0070717_102009243 | 237 |
| 407 | 3300006028 | Ga0070717_10202099 | Ga0070717_102020992 | 237 |
| 408 | 3300006173 | Ga0070716_100005841 | Ga0070716_1000058413 | 237 |
| 409 | 3300006173 | Ga0070716_100012088 | Ga0070716_1000120886 | 237 |
| 410 | 3300006173 | Ga0070716_100016153 | Ga0070716_1000161536 | 237 |
| 411 | 3300006173 | Ga0070716_100023979 | Ga0070716_1000239792 | 237 |
| 412 | 3300006173 | Ga0070716_100037411 | Ga0070716_1000374112 | 237 |
| 413 | 3300006173 | Ga0070716_100056250 | Ga0070716_1000562502 | 237 |
| 414 | 3300006173 | Ga0070716_100471755 | Ga0070716_1004717551 | 237 |
| 415 | 3300006175 | Ga0070712_100000593 | Ga0070712_10000059325 | 237 |
| 416 | 3300006175 | Ga0070712_100001135 | Ga0070712_10000113510 | 237 |
| 417 | 3300006175 | Ga0070712_100003022 | Ga0070712_10000302210 | 237 |
| 418 | 3300006175 | Ga0070712_100004622 | Ga0070712_1000046228 | 237 |
| 419 | 3300006175 | Ga0070712_100056210 | Ga0070712_1000562102 | 237 |
| 420 | 3300006175 | Ga0070712_100118675 | Ga0070712_1001186753 | 237 |
| 421 | 3300006175 | Ga0070712_100202118 | Ga0070712_1002021182 | 237 |
| 422 | 3300006237 | Ga0097621_100007525 | Ga0097621_1000075255 | 237 |
| 423 | 3300006237 | Ga0097621_100013773 | Ga0097621_1000137737 | 237 |
| 424 | 3300006237 | Ga0097621_100070515 | Ga0097621_1000705152 | 237 |
| 425 | 3300006237 | Ga0097621_100073449 | Ga0097621_1000734496 | 237 |
| 426 | 3300006237 | Ga0097621_100157200 | Ga0097621_1001572003 | 237 |
| 427 | 3300006358 | Ga0068871_100014064 | Ga0068871_1000140644 | 237 |
| 428 | 3300006358 | Ga0068871_100026575 | Ga0068871_1000265757 | 237 |
| 429 | 3300006358 | Ga0068871_100071804 | Ga0068871_1000718042 | 237 |
| 430 | 3300006358 | Ga0068871_100072335 | Ga0068871_1000723356 | 237 |
| 431 | 3300006358 | Ga0068871_100084357 | Ga0068871_1000843572 | 237 |
| 432 | 3300006358 | Ga0068871_100159495 | Ga0068871_1001594954 | 237 |
| 433 | 3300006871 | Ga0075434_100000230 | Ga0075434_10000023024 | 237 |
| 434 | 3300006871 | Ga0075434_100005131 | Ga0075434_10000513110 | 237 |
| 435 | 3300006881 | Ga0068865_100006206 | Ga0068865_1000062062 | 237 |
| 436 | 3300006881 | Ga0068865_100165105 | Ga0068865_1001651052 | 237 |
| 437 | 3300006914 | Ga0075436_100000510 | Ga0075436_10000051014 | 237 |
| 438 | 3300006914 | Ga0075436_100012852 | Ga0075436_1000128523 | 237 |
| 439 | 3300006914 | Ga0075436_100013001 | Ga0075436_1000130014 | 237 |
| 440 | 3300006914 | Ga0075436_100032647 | Ga0075436_1000326473 | 237 |
| 441 | 3300006914 | Ga0075436_100040669 | Ga0075436_1000406693 | 237 |
| 442 | 3300006931 | Ga0097620_100013371 | Ga0097620_10001337111 | 237 |
| 443 | 3300006931 | Ga0097620_100017062 | Ga0097620_1000170622 | 237 |
| 444 | 3300007076 | Ga0075435_100000389 | Ga0075435_10000038924 | 237 |
| 445 | 3300007076 | Ga0075435_100045994 | Ga0075435_1000459943 | 237 |
| 446 | 3300007076 | Ga0075435_100333245 | Ga0075435_1003332452 | 237 |
| 447 | 3300007788 | Ga0099795_10007913 | Ga0099795_100079134 | 237 |
| 448 | 3300009093 | Ga0105240_10029138 | Ga0105240_100291389 | 237 |
| 449 | 3300009093 | Ga0105240_10037261 | Ga0105240_100372614 | 237 |
| 450 | 3300009093 | Ga0105240_10066274 | Ga0105240_100662744 | 237 |
| 451 | 3300009093 | Ga0105240_10098360 | Ga0105240_100983603 | 237 |
| 452 | 3300009093 | Ga0105240_10301875 | Ga0105240_103018752 | 237 |
| 453 | 3300009093 | Ga0105240_10351030 | Ga0105240_103510301 | 237 |
| 454 | 3300009093 | Ga0105240_10546511 | Ga0105240_105465112 | 237 |
| 455 | 3300009093 | Ga0105240_10566055 | Ga0105240_105660552 | 237 |
| 456 | 3300009098 | Ga0105245_10005238 | Ga0105245_1000523811 | 237 |
| 457 | 3300009098 | Ga0105245_10121450 | Ga0105245_101214502 | 237 |
| 458 | 3300009101 | Ga0105247_10019238 | Ga0105247_100192384 | 237 |
| 459 | 3300009101 | Ga0105247_10132378 | Ga0105247_101323782 | 237 |
| 460 | 3300009147 | Ga0114129_10030197 | Ga0114129_100301973 | 237 |
| 461 | 3300009148 | Ga0105243_10017394 | Ga0105243_100173943 | 237 |
| 462 | 3300009174 | Ga0105241_10036407 | Ga0105241_100364073 | 237 |
| 463 | 3300009174 | Ga0105241_10060464 | Ga0105241_100604643 | 237 |
| 464 | 3300009174 | Ga0105241_10243630 | Ga0105241_102436302 | 237 |
| 465 | 3300009174 | Ga0105241_10308570 | Ga0105241_103085703 | 237 |
| 466 | 3300009176 | Ga0105242_10286600 | Ga0105242_102866002 | 237 |
| 467 | 3300009176 | Ga0105242_10347723 | Ga0105242_103477232 | 237 |
| 468 | 3300009176 | Ga0105242_10443105 | Ga0105242_104431052 | 237 |
| 469 | 3300009177 | Ga0105248_10087800 | Ga0105248_100878001 | 237 |
| 470 | 3300009177 | Ga0105248_10168623 | Ga0105248_101686232 | 237 |
| 471 | 3300009177 | Ga0105248_10211826 | Ga0105248_102118263 | 237 |
| 472 | 3300009177 | Ga0105248_10256836 | Ga0105248_102568363 | 237 |
| 473 | 3300009177 | Ga0105248_10449093 | Ga0105248_104490932 | 237 |
| 474 | 3300009545 | Ga0105237_10016610 | Ga0105237_100166104 | 237 |
| 475 | 3300009545 | Ga0105237_10059544 | Ga0105237_100595443 | 237 |
| 476 | 3300009545 | Ga0105237_10096007 | Ga0105237_100960073 | 237 |
| 477 | 3300009545 | Ga0105237_10178865 | Ga0105237_101788652 | 237 |
| 478 | 3300009545 | Ga0105237_10193165 | Ga0105237_101931652 | 237 |
| 479 | 3300009545 | Ga0105237_10618325 | Ga0105237_106183252 | 237 |
| 480 | 3300009551 | Ga0105238_10004639 | Ga0105238_1000463917 | 237 |
| 481 | 3300009551 | Ga0105238_10121061 | Ga0105238_101210612 | 237 |
| 482 | 3300009551 | Ga0105238_10122762 | Ga0105238_101227625 | 237 |
| 483 | 3300009553 | Ga0105249_10017780 | Ga0105249_100177809 | 237 |
| 484 | 3300010159 | Ga0099796_10059515 | Ga0099796_100595152 | 237 |
| 485 | 3300010375 | Ga0105239_10116116 | Ga0105239_101161162 | 237 |
| 486 | 3300010375 | Ga0105239_10295798 | Ga0105239_102957982 | 237 |
| 487 | 3300010375 | Ga0105239_11123062 | Ga0105239_111230621 | 237 |
| 488 | 3300011119 | Ga0105246_10018819 | Ga0105246_100188195 | 237 |
| 489 | 3300011119 | Ga0105246_10104324 | Ga0105246_101043243 | 237 |
| 490 | 3300011119 | Ga0105246_10307490 | Ga0105246_103074902 | 237 |
| 491 | 3300013100 | Ga0157373_10016891 | Ga0157373_100168914 | 237 |
| 492 | 3300013100 | Ga0157373_10082678 | Ga0157373_100826784 | 237 |
| 493 | 3300013100 | Ga0157373_10092181 | Ga0157373_100921811 | 237 |
| 494 | 3300013102 | Ga0157371_10016410 | Ga0157371_100164107 | 237 |
| 495 | 3300013104 | Ga0157370_10124040 | Ga0157370_101240404 | 237 |
| 496 | 3300013105 | Ga0157369_10075050 | Ga0157369_100750502 | 237 |
| 497 | 3300013105 | Ga0157369_10077234 | Ga0157369_100772344 | 237 |
| 498 | 3300013105 | Ga0157369_10109693 | Ga0157369_101096932 | 237 |
| 499 | 3300013105 | Ga0157369_10196641 | Ga0157369_101966412 | 237 |
| 500 | 3300013296 | Ga0157374_10053416 | Ga0157374_100534162 | 237 |
| 501 | 3300013296 | Ga0157374_10056630 | Ga0157374_100566303 | 237 |
| 502 | 3300013296 | Ga0157374_10094140 | Ga0157374_100941402 | 237 |
| 503 | 3300013296 | Ga0157374_10094974 | Ga0157374_100949742 | 237 |
| 504 | 3300013296 | Ga0157374_10314730 | Ga0157374_103147302 | 237 |
| 505 | 3300013296 | Ga0157374_10327687 | Ga0157374_103276871 | 237 |
| 506 | 3300013296 | Ga0157374_10598803 | Ga0157374_105988031 | 237 |
| 507 | 3300013297 | Ga0157378_10000411 | Ga0157378_1000041131 | 237 |
| 508 | 3300013297 | Ga0157378_10000516 | Ga0157378_100005162 | 237 |
| 509 | 3300013297 | Ga0157378_10000641 | Ga0157378_1000064133 | 237 |
| 510 | 3300013297 | Ga0157378_10023476 | Ga0157378_100234762 | 237 |
| 511 | 3300013297 | Ga0157378_10027505 | Ga0157378_100275057 | 237 |
| 512 | 3300013297 | Ga0157378_10044668 | Ga0157378_100446683 | 237 |
| 513 | 3300013297 | Ga0157378_10260721 | Ga0157378_102607213 | 237 |
| 514 | 3300013297 | Ga0157378_10400508 | Ga0157378_104005082 | 237 |
| 515 | 3300013297 | Ga0157378_10815642 | Ga0157378_108156422 | 237 |
| 516 | 3300013306 | Ga0163162_10020357 | Ga0163162_100203576 | 237 |
| 517 | 3300013306 | Ga0163162_10322933 | Ga0163162_103229334 | 237 |
| 518 | 3300013306 | Ga0163162_10701539 | Ga0163162_107015392 | 237 |
| 519 | 3300013306 | Ga0163162_11210431 | Ga0163162_112104311 | 237 |
| 520 | 3300013307 | Ga0157372_10029430 | Ga0157372_100294308 | 237 |
| 521 | 3300013307 | Ga0157372_10087746 | Ga0157372_100877462 | 237 |
| 522 | 3300013307 | Ga0157372_10117278 | Ga0157372_101172783 | 237 |
| 523 | 3300013307 | Ga0157372_10133152 | Ga0157372_101331522 | 237 |
| 524 | 3300013307 | Ga0157372_10163271 | Ga0157372_101632711 | 237 |
| 525 | 3300013307 | Ga0157372_10238753 | Ga0157372_102387532 | 237 |
| 526 | 3300013307 | Ga0157372_10464426 | Ga0157372_104644263 | 237 |
| 527 | 3300013308 | Ga0157375_10273036 | Ga0157375_102730362 | 237 |
| 528 | 3300014325 | Ga0163163_10038186 | Ga0163163_100381861 | 237 |
| 529 | 3300014325 | Ga0163163_10060784 | Ga0163163_100607845 | 237 |
| 530 | 3300014325 | Ga0163163_10085804 | Ga0163163_100858043 | 237 |
| 531 | 3300014968 | Ga0157379_10004402 | Ga0157379_100044024 | 237 |
| 532 | 3300014969 | Ga0157376_10155309 | Ga0157376_101553092 | 237 |
| 533 | 3300014969 | Ga0157376_10198242 | Ga0157376_101982422 | 237 |
| 534 | 3300014969 | Ga0157376_10216896 | Ga0157376_102168962 | 237 |
| 535 | 3300015262 | Ga0182007_10006522 | Ga0182007_100065226 | 237 |
| 536 | 3300015262 | Ga0182007_10096360 | Ga0182007_100963601 | 237 |
| 537 | 3300019161 | Ga0184602_100587 | Ga0184602_1005871 | 237 |
| 538 | 3300019183 | Ga0184601_138509 | Ga0184601_1385092 | 237 |
| 539 | 3300019188 | Ga0184599_124137 | Ga0184599_1241373 | 237 |
| 540 | 3300019190 | Ga0184600_107512 | Ga0184600_1075125 | 237 |
| 541 | 3300020069 | Ga0197907_10394153 | Ga0197907_103941531 | 237 |
| 542 | 3300020069 | Ga0197907_10527156 | Ga0197907_105271562 | 237 |
| 543 | 3300020069 | Ga0197907_10662566 | Ga0197907_106625662 | 237 |
| 544 | 3300020070 | Ga0206356_10049636 | Ga0206356_100496363 | 237 |
| 545 | 3300020070 | Ga0206356_10051902 | Ga0206356_100519022 | 237 |
| 546 | 3300020070 | Ga0206356_10833199 | Ga0206356_108331991 | 237 |
| 547 | 3300020070 | Ga0206356_11173081 | Ga0206356_111730813 | 237 |
| 548 | 3300020070 | Ga0206356_11476520 | Ga0206356_114765201 | 237 |
| 549 | 3300020070 | Ga0206356_11803998 | Ga0206356_118039982 | 237 |
| 550 | 3300020076 | Ga0206355_1040840 | Ga0206355_10408402 | 237 |
| 551 | 3300020076 | Ga0206355_1106755 | Ga0206355_11067551 | 237 |
| 552 | 3300020076 | Ga0206355_1328072 | Ga0206355_13280722 | 237 |
| 553 | 3300020077 | Ga0206351_10678473 | Ga0206351_106784732 | 237 |
| 554 | 3300020077 | Ga0206351_10806319 | Ga0206351_108063192 | 237 |
| 555 | 3300020078 | Ga0206352_10443739 | Ga0206352_104437392 | 237 |
| 556 | 3300020078 | Ga0206352_10818178 | Ga0206352_108181782 | 237 |
| 557 | 3300020080 | Ga0206350_10297924 | Ga0206350_102979242 | 237 |
| 558 | 3300020080 | Ga0206350_10978419 | Ga0206350_109784192 | 237 |
| 559 | 3300020081 | Ga0206354_10240356 | Ga0206354_102403562 | 237 |
| 560 | 3300020081 | Ga0206354_10881815 | Ga0206354_108818152 | 237 |
| 561 | 3300020082 | Ga0206353_11188867 | Ga0206353_111888671 | 237 |
| 562 | 3300020082 | Ga0206353_11403828 | Ga0206353_114038282 | 237 |
| 563 | 3300020610 | Ga0154015_1684329 | Ga0154015_16843292 | 237 |
| 564 | 3300020610 | Ga0154015_1706975 | Ga0154015_17069752 | 237 |
| 565 | 3300022467 | Ga0224712_10020119 | Ga0224712_100201192 | 237 |
| 566 | 3300022467 | Ga0224712_10053142 | Ga0224712_100531422 | 237 |
| 567 | 3300022467 | Ga0224712_10068472 | Ga0224712_100684722 | 237 |
| 568 | 3300022467 | Ga0224712_10119152 | Ga0224712_101191522 | 237 |
| 569 | 3300022467 | Ga0224712_10128781 | Ga0224712_101287811 | 237 |
| 570 | 3300022730 | Ga0224570_100717 | Ga0224570_1007173 | 237 |
| 571 | 3300022732 | Ga0224569_100499 | Ga0224569_1004993 | 237 |
| 572 | 3300023547 | Ga0247554_100062 | Ga0247554_1000623 | 237 |
| 573 | 3300024227 | Ga0228598_1000213 | Ga0228598_100021313 | 237 |
| 574 | 3300024227 | Ga0228598_1000513 | Ga0228598_10005134 | 237 |
| 575 | 3300025321 | Ga0207656_10013964 | Ga0207656_100139642 | 237 |
| 576 | 3300025321 | Ga0207656_10026011 | Ga0207656_100260112 | 237 |
| 577 | 3300025885 | Ga0207653_10129640 | Ga0207653_101296401 | 237 |
| 578 | 3300025898 | Ga0207692_10006388 | Ga0207692_100063888 | 237 |
| 579 | 3300025898 | Ga0207692_10013131 | Ga0207692_100131314 | 237 |
| 580 | 3300025898 | Ga0207692_10020497 | Ga0207692_100204972 | 237 |
| 581 | 3300025899 | Ga0207642_10062870 | Ga0207642_100628702 | 237 |
| 582 | 3300025903 | Ga0207680_10338107 | Ga0207680_103381071 | 237 |
| 583 | 3300025904 | Ga0207647_10006875 | Ga0207647_1000687510 | 237 |
| 584 | 3300025904 | Ga0207647_10019145 | Ga0207647_100191456 | 237 |
| 585 | 3300025905 | Ga0207685_10038470 | Ga0207685_100384703 | 237 |
| 586 | 3300025906 | Ga0207699_10002321 | Ga0207699_100023212 | 237 |
| 587 | 3300025906 | Ga0207699_10014274 | Ga0207699_100142744 | 237 |
| 588 | 3300025906 | Ga0207699_10020090 | Ga0207699_100200903 | 237 |
| 589 | 3300025906 | Ga0207699_10021232 | Ga0207699_100212323 | 237 |
| 590 | 3300025906 | Ga0207699_10055306 | Ga0207699_100553064 | 237 |
| 591 | 3300025906 | Ga0207699_10297324 | Ga0207699_102973241 | 237 |
| 592 | 3300025907 | Ga0207645_10004038 | Ga0207645_100040383 | 237 |
| 593 | 3300025910 | Ga0207684_10000614 | Ga0207684_1000061434 | 237 |
| 594 | 3300025910 | Ga0207684_10001048 | Ga0207684_1000104823 | 237 |
| 595 | 3300025910 | Ga0207684_10003017 | Ga0207684_1000301726 | 237 |
| 596 | 3300025910 | Ga0207684_10541969 | Ga0207684_105419691 | 237 |
| 597 | 3300025911 | Ga0207654_10052456 | Ga0207654_100524563 | 237 |
| 598 | 3300025911 | Ga0207654_10097758 | Ga0207654_100977583 | 237 |
| 599 | 3300025911 | Ga0207654_10148662 | Ga0207654_101486622 | 237 |
| 600 | 3300025912 | Ga0207707_10003361 | Ga0207707_100033612 | 237 |
| 601 | 3300025912 | Ga0207707_10007456 | Ga0207707_100074567 | 237 |
| 602 | 3300025912 | Ga0207707_10018585 | Ga0207707_100185855 | 237 |
| 603 | 3300025912 | Ga0207707_10021611 | Ga0207707_100216118 | 237 |
| 604 | 3300025912 | Ga0207707_10127170 | Ga0207707_101271702 | 237 |
| 605 | 3300025912 | Ga0207707_10168596 | Ga0207707_101685962 | 237 |
| 606 | 3300025912 | Ga0207707_10287986 | Ga0207707_102879862 | 237 |
| 607 | 3300025912 | Ga0207707_10299411 | Ga0207707_102994112 | 237 |
| 608 | 3300025913 | Ga0207695_10007039 | Ga0207695_1000703911 | 237 |
| 609 | 3300025913 | Ga0207695_10008453 | Ga0207695_1000845317 | 237 |
| 610 | 3300025913 | Ga0207695_10081934 | Ga0207695_100819346 | 237 |
| 611 | 3300025913 | Ga0207695_10150454 | Ga0207695_101504542 | 237 |
| 612 | 3300025913 | Ga0207695_10172513 | Ga0207695_101725132 | 237 |
| 613 | 3300025914 | Ga0207671_10042349 | Ga0207671_100423493 | 237 |
| 614 | 3300025914 | Ga0207671_10068785 | Ga0207671_100687852 | 237 |
| 615 | 3300025914 | Ga0207671_10074923 | Ga0207671_100749233 | 237 |
| 616 | 3300025914 | Ga0207671_10122703 | Ga0207671_101227033 | 237 |
| 617 | 3300025915 | Ga0207693_10000026 | Ga0207693_1000002670 | 237 |
| 618 | 3300025915 | Ga0207693_10000922 | Ga0207693_1000092221 | 237 |
| 619 | 3300025915 | Ga0207693_10001260 | Ga0207693_1000126011 | 237 |
| 620 | 3300025915 | Ga0207693_10004232 | Ga0207693_100042325 | 237 |
| 621 | 3300025915 | Ga0207693_10041078 | Ga0207693_100410783 | 237 |
| 622 | 3300025915 | Ga0207693_10306845 | Ga0207693_103068451 | 237 |
| 623 | 3300025916 | Ga0207663_10006104 | Ga0207663_100061049 | 237 |
| 624 | 3300025916 | Ga0207663_10027488 | Ga0207663_100274882 | 237 |
| 625 | 3300025916 | Ga0207663_10031788 | Ga0207663_100317881 | 237 |
| 626 | 3300025916 | Ga0207663_10062577 | Ga0207663_100625773 | 237 |
| 627 | 3300025916 | Ga0207663_10140657 | Ga0207663_101406572 | 237 |
| 628 | 3300025917 | Ga0207660_10023735 | Ga0207660_100237353 | 237 |
| 629 | 3300025917 | Ga0207660_10085371 | Ga0207660_100853713 | 237 |
| 630 | 3300025917 | Ga0207660_10119042 | Ga0207660_101190423 | 237 |
| 631 | 3300025919 | Ga0207657_10006426 | Ga0207657_100064262 | 237 |
| 632 | 3300025920 | Ga0207649_10036883 | Ga0207649_100368833 | 237 |
| 633 | 3300025920 | Ga0207649_10058342 | Ga0207649_100583423 | 237 |
| 634 | 3300025921 | Ga0207652_10018223 | Ga0207652_100182236 | 237 |
| 635 | 3300025921 | Ga0207652_10061092 | Ga0207652_100610921 | 237 |
| 636 | 3300025921 | Ga0207652_10096820 | Ga0207652_100968206 | 237 |
| 637 | 3300025922 | Ga0207646_10001230 | Ga0207646_1000123025 | 237 |
| 638 | 3300025922 | Ga0207646_10004899 | Ga0207646_1000489916 | 237 |
| 639 | 3300025922 | Ga0207646_10241285 | Ga0207646_102412852 | 237 |
| 640 | 3300025923 | Ga0207681_10285150 | Ga0207681_102851502 | 237 |
| 641 | 3300025924 | Ga0207694_10000718 | Ga0207694_1000071821 | 237 |
| 642 | 3300025924 | Ga0207694_10044180 | Ga0207694_100441804 | 237 |
| 643 | 3300025925 | Ga0207650_10071395 | Ga0207650_100713954 | 237 |
| 644 | 3300025927 | Ga0207687_10056079 | Ga0207687_100560793 | 237 |
| 645 | 3300025927 | Ga0207687_10127310 | Ga0207687_101273103 | 237 |
| 646 | 3300025928 | Ga0207700_10004902 | Ga0207700_100049026 | 237 |
| 647 | 3300025928 | Ga0207700_10039497 | Ga0207700_100394975 | 237 |
| 648 | 3300025928 | Ga0207700_10087615 | Ga0207700_100876153 | 237 |
| 649 | 3300025928 | Ga0207700_10110922 | Ga0207700_101109222 | 237 |
| 650 | 3300025928 | Ga0207700_10142418 | Ga0207700_101424183 | 237 |
| 651 | 3300025928 | Ga0207700_10151903 | Ga0207700_101519032 | 237 |
| 652 | 3300025928 | Ga0207700_10212126 | Ga0207700_102121261 | 237 |
| 653 | 3300025928 | Ga0207700_10378013 | Ga0207700_103780132 | 237 |
| 654 | 3300025929 | Ga0207664_10000087 | Ga0207664_1000008769 | 237 |
| 655 | 3300025929 | Ga0207664_10032913 | Ga0207664_100329132 | 237 |
| 656 | 3300025929 | Ga0207664_10076602 | Ga0207664_100766023 | 237 |
| 657 | 3300025929 | Ga0207664_10102458 | Ga0207664_101024582 | 237 |
| 658 | 3300025929 | Ga0207664_10637139 | Ga0207664_106371392 | 237 |
| 659 | 3300025931 | Ga0207644_10030088 | Ga0207644_100300883 | 237 |
| 660 | 3300025931 | Ga0207644_10081911 | Ga0207644_100819112 | 237 |
| 661 | 3300025932 | Ga0207690_10207300 | Ga0207690_102073002 | 237 |
| 662 | 3300025933 | Ga0207706_10002545 | Ga0207706_100025453 | 237 |
| 663 | 3300025934 | Ga0207686_10138054 | Ga0207686_101380543 | 237 |
| 664 | 3300025935 | Ga0207709_10014728 | Ga0207709_100147287 | 237 |
| 665 | 3300025936 | Ga0207670_10449137 | Ga0207670_104491372 | 237 |
| 666 | 3300025937 | Ga0207669_10386970 | Ga0207669_103869701 | 237 |
| 667 | 3300025938 | Ga0207704_10012199 | Ga0207704_100121992 | 237 |
| 668 | 3300025938 | Ga0207704_10013374 | Ga0207704_100133744 | 237 |
| 669 | 3300025938 | Ga0207704_10065992 | Ga0207704_100659924 | 237 |
| 670 | 3300025938 | Ga0207704_10339944 | Ga0207704_103399442 | 237 |
| 671 | 3300025938 | Ga0207704_10387223 | Ga0207704_103872232 | 237 |
| 672 | 3300025939 | Ga0207665_10001798 | Ga0207665_1000179821 | 237 |
| 673 | 3300025939 | Ga0207665_10012476 | Ga0207665_100124766 | 237 |
| 674 | 3300025939 | Ga0207665_10019095 | Ga0207665_100190953 | 237 |
| 675 | 3300025939 | Ga0207665_10042405 | Ga0207665_100424053 | 237 |
| 676 | 3300025939 | Ga0207665_10071183 | Ga0207665_100711832 | 237 |
| 677 | 3300025939 | Ga0207665_10080999 | Ga0207665_100809992 | 237 |
| 678 | 3300025939 | Ga0207665_10086009 | Ga0207665_100860092 | 237 |
| 679 | 3300025939 | Ga0207665_10147286 | Ga0207665_101472862 | 237 |
| 680 | 3300025939 | Ga0207665_10270932 | Ga0207665_102709322 | 237 |
| 681 | 3300025940 | Ga0207691_10416654 | Ga0207691_104166542 | 237 |
| 682 | 3300025941 | Ga0207711_10024877 | Ga0207711_100248775 | 237 |
| 683 | 3300025941 | Ga0207711_10102246 | Ga0207711_101022463 | 237 |
| 684 | 3300025941 | Ga0207711_10382048 | Ga0207711_103820482 | 237 |
| 685 | 3300025941 | Ga0207711_10385399 | Ga0207711_103853992 | 237 |
| 686 | 3300025942 | Ga0207689_10000542 | Ga0207689_100005422 | 237 |
| 687 | 3300025942 | Ga0207689_10027283 | Ga0207689_100272837 | 237 |
| 688 | 3300025942 | Ga0207689_10032344 | Ga0207689_100323444 | 237 |
| 689 | 3300025944 | Ga0207661_10125253 | Ga0207661_101252532 | 237 |
| 690 | 3300025944 | Ga0207661_10127104 | Ga0207661_101271042 | 237 |
| 691 | 3300025944 | Ga0207661_10436222 | Ga0207661_104362222 | 237 |
| 692 | 3300025945 | Ga0207679_10232910 | Ga0207679_102329101 | 237 |
| 693 | 3300025949 | Ga0207667_10000245 | Ga0207667_100002452 | 237 |
| 694 | 3300025949 | Ga0207667_10002261 | Ga0207667_100022612 | 237 |
| 695 | 3300025949 | Ga0207667_10008140 | Ga0207667_100081402 | 237 |
| 696 | 3300025949 | Ga0207667_10046387 | Ga0207667_100463872 | 237 |
| 697 | 3300025949 | Ga0207667_10132398 | Ga0207667_101323983 | 237 |
| 698 | 3300025949 | Ga0207667_10360439 | Ga0207667_103604392 | 237 |
| 699 | 3300025960 | Ga0207651_10192162 | Ga0207651_101921622 | 237 |
| 700 | 3300025961 | Ga0207712_10066602 | Ga0207712_100666022 | 237 |
| 701 | 3300025972 | Ga0207668_10501201 | Ga0207668_105012012 | 237 |
| 702 | 3300025981 | Ga0207640_10008195 | Ga0207640_100081954 | 237 |
| 703 | 3300025981 | Ga0207640_10010596 | Ga0207640_100105966 | 237 |
| 704 | 3300025981 | Ga0207640_10058331 | Ga0207640_100583312 | 237 |
| 705 | 3300025981 | Ga0207640_10198997 | Ga0207640_101989971 | 237 |
| 706 | 3300025981 | Ga0207640_10343797 | Ga0207640_103437972 | 237 |
| 707 | 3300025981 | Ga0207640_10624275 | Ga0207640_106242751 | 237 |
| 708 | 3300026023 | Ga0207677_10004281 | Ga0207677_100042815 | 237 |
| 709 | 3300026023 | Ga0207677_10004546 | Ga0207677_100045469 | 237 |
| 710 | 3300026023 | Ga0207677_10008537 | Ga0207677_100085379 | 237 |
| 711 | 3300026023 | Ga0207677_10024595 | Ga0207677_100245954 | 237 |
| 712 | 3300026035 | Ga0207703_10003490 | Ga0207703_100034902 | 237 |
| 713 | 3300026035 | Ga0207703_10013683 | Ga0207703_100136833 | 237 |
| 714 | 3300026035 | Ga0207703_10041811 | Ga0207703_100418112 | 237 |
| 715 | 3300026035 | Ga0207703_10050418 | Ga0207703_100504186 | 237 |
| 716 | 3300026041 | Ga0207639_10060468 | Ga0207639_100604685 | 237 |
| 717 | 3300026041 | Ga0207639_10064124 | Ga0207639_100641242 | 237 |
| 718 | 3300026041 | Ga0207639_10117426 | Ga0207639_101174262 | 237 |
| 719 | 3300026067 | Ga0207678_10001612 | Ga0207678_1000161211 | 237 |
| 720 | 3300026078 | Ga0207702_10001276 | Ga0207702_1000127625 | 237 |
| 721 | 3300026078 | Ga0207702_10001425 | Ga0207702_100014252 | 237 |
| 722 | 3300026078 | Ga0207702_10003851 | Ga0207702_1000385119 | 237 |
| 723 | 3300026078 | Ga0207702_10041975 | Ga0207702_100419756 | 237 |
| 724 | 3300026078 | Ga0207702_10127482 | Ga0207702_101274824 | 237 |
| 725 | 3300026078 | Ga0207702_10282887 | Ga0207702_102828873 | 237 |
| 726 | 3300026078 | Ga0207702_10564251 | Ga0207702_105642511 | 237 |
| 727 | 3300026088 | Ga0207641_10045230 | Ga0207641_100452303 | 237 |
| 728 | 3300026088 | Ga0207641_10245130 | Ga0207641_102451302 | 237 |
| 729 | 3300026088 | Ga0207641_10386607 | Ga0207641_103866072 | 237 |
| 730 | 3300026089 | Ga0207648_10023379 | Ga0207648_100233794 | 237 |
| 731 | 3300026089 | Ga0207648_10103312 | Ga0207648_101033122 | 237 |
| 732 | 3300026095 | Ga0207676_10046329 | Ga0207676_100463295 | 237 |
| 733 | 3300026095 | Ga0207676_10051605 | Ga0207676_100516053 | 237 |
| 734 | 3300026095 | Ga0207676_10497192 | Ga0207676_104971921 | 237 |
| 735 | 3300026116 | Ga0207674_10000864 | Ga0207674_100008642 | 237 |
| 736 | 3300026116 | Ga0207674_10018522 | Ga0207674_1001852210 | 237 |
| 737 | 3300026116 | Ga0207674_10041099 | Ga0207674_100410996 | 237 |
| 738 | 3300026116 | Ga0207674_10100633 | Ga0207674_101006332 | 237 |
| 739 | 3300026121 | Ga0207683_10051020 | Ga0207683_100510205 | 237 |
| 740 | 3300026121 | Ga0207683_10080116 | Ga0207683_100801164 | 237 |
| 741 | 3300026121 | Ga0207683_10174724 | Ga0207683_101747243 | 237 |
| 742 | 3300026142 | Ga0207698_10089386 | Ga0207698_100893862 | 237 |
| 743 | 3300026142 | Ga0207698_10205590 | Ga0207698_102055904 | 237 |
| 744 | 3300026142 | Ga0207698_10720062 | Ga0207698_107200622 | 237 |
| 745 | 3300028017 | Ga0265356_1000279 | Ga0265356_10002794 | 237 |
| 746 | 3300028379 | Ga0268266_10023242 | Ga0268266_100232423 | 237 |
| 747 | 3300028380 | Ga0268265_10209553 | Ga0268265_102095533 | 237 |
| 748 | 3300028381 | Ga0268264_10017321 | Ga0268264_100173212 | 237 |
| 749 | 3300028381 | Ga0268264_10209769 | Ga0268264_102097694 | 237 |
| 750 | 3300028381 | Ga0268264_10224831 | Ga0268264_102248313 | 237 |
| 751 | 3300028381 | Ga0268264_10270162 | Ga0268264_102701623 | 237 |
| 752 | 3300028800 | Ga0265338_10002857 | Ga0265338_1000285724 | 237 |
| 753 | 3300028800 | Ga0265338_10056425 | Ga0265338_100564253 | 237 |
| 754 | 3300028800 | Ga0265338_10152496 | Ga0265338_101524962 | 237 |
| 755 | 3300028800 | Ga0265338_10157549 | Ga0265338_101575492 | 237 |
| 756 | 3300028800 | Ga0265338_10158627 | Ga0265338_101586272 | 237 |
| 757 | 3300028800 | Ga0265338_10307499 | Ga0265338_103074992 | 237 |
| 758 | 3300030760 | Ga0265762_1000268 | Ga0265762_10002683 | 237 |
| 759 | 3300030760 | Ga0265762_1001772 | Ga0265762_10017724 | 237 |
| 760 | 3300030760 | Ga0265762_1015375 | Ga0265762_10153752 | 237 |
| 761 | 3300030760 | Ga0265762_1015712 | Ga0265762_10157121 | 237 |
| 762 | 3300030763 | Ga0265763_1010057 | Ga0265763_10100571 | 237 |
| 763 | 3300030863 | Ga0265766_1000373 | Ga0265766_10003733 | 237 |
| 764 | 3300030877 | Ga0265777_101167 | Ga0265777_1011672 | 237 |
| 765 | 3300030877 | Ga0265777_101745 | Ga0265777_1017452 | 237 |
| 766 | 3300030879 | Ga0265765_1012638 | Ga0265765_10126381 | 237 |
| 767 | 3300031090 | Ga0265760_10000694 | Ga0265760_1000069417 | 237 |
| 768 | 3300031090 | Ga0265760_10011555 | Ga0265760_100115552 | 237 |
| 769 | 3300031090 | Ga0265760_10016330 | Ga0265760_100163303 | 237 |
| 770 | 3300031090 | Ga0265760_10017826 | Ga0265760_100178265 | 237 |
| 771 | 3300031090 | Ga0265760_10035955 | Ga0265760_100359552 | 237 |
| 772 | 3300031239 | Ga0265328_10008639 | Ga0265328_100086395 | 237 |
| 773 | 3300031240 | Ga0265320_10169513 | Ga0265320_101695131 | 237 |
| 774 | 3300031241 | Ga0265325_10003007 | Ga0265325_100030077 | 237 |
| 775 | 3300031241 | Ga0265325_10047694 | Ga0265325_100476942 | 237 |
| 776 | 3300031241 | Ga0265325_10088259 | Ga0265325_100882592 | 237 |
| 777 | 3300031247 | Ga0265340_10005004 | Ga0265340_1000500411 | 237 |
| 778 | 3300031250 | Ga0265331_10012160 | Ga0265331_100121607 | 237 |
| 779 | 3300031251 | Ga0265327_10051700 | Ga0265327_100517002 | 237 |
| 780 | 3300031344 | Ga0265316_10024062 | Ga0265316_100240627 | 237 |
| 781 | 3300031344 | Ga0265316_10070945 | Ga0265316_100709453 | 237 |
| 782 | 3300031595 | Ga0265313_10002540 | Ga0265313_100025409 | 237 |
| 783 | 3300031595 | Ga0265313_10037261 | Ga0265313_100372613 | 237 |
| 784 | 3300031711 | Ga0265314_10015736 | Ga0265314_100157363 | 237 |
| 785 | 3300031712 | Ga0265342_10031116 | Ga0265342_100311166 | 237 |
| 786 | 3300032120 | Ga0316053_100082 | Ga0316053_1000824 | 237 |
| 787 | 3300033545 | Ga0316214_1000473 | Ga0316214_10004734 | 237 |
| 788 | 3300035083 | Ga0373926_0003574 | Ga0373926_0003574_56_808 | 237 |
| 789 | 3300035083 | Ga0373926_0088992 | Ga0373926_0088992_110_862 | 237 |
| 790 | 3300035083 | Ga0373926_0089301 | Ga0373926_0089301_61_774 | 237 |
| 791 | 3300035086 | Ga0373934_0087673 | Ga0373934_0087673_172_924 | 237 |
| 792 | 3300035086 | Ga0373934_0126980 | Ga0373934_0126980_136_888 | 237 |
| 793 | 3300035111 | Ga0373923_0021599 | Ga0373923_0021599_1249_2001 | 237 |
| 794 | 3300035113 | Ga0373936_0012061 | Ga0373936_0012061_465_1217 | 237 |
| 795 | 3300035113 | Ga0373936_0023335 | Ga0373936_0023335_1547_2299 | 237 |
| 796 | 3300035117 | Ga0373953_0121023 | Ga0373953_0121023_327_1079 | 237 |
| 797 | 3300035118 | Ga0373954_0150956 | Ga0373954_0150956_62_811 | 237 |
| 798 | 3300035170 | Ga0373943_0000594 | Ga0373943_0000594_361_1113 | 237 |
| 799 | 3300035170 | Ga0373943_0196682 | Ga0373943_0196682_301_1014 | 237 |
| 800 | 3300035171 | Ga0373946_0011730 | Ga0373946_0011730_2499_3251 | 237 |
| 801 | 3300035171 | Ga0373946_0032109 | Ga0373946_0032109_1011_1763 | 237 |
| 802 | 3300035171 | Ga0373946_0055918 | Ga0373946_0055918_300_1049 | 237 |
| 803 | 3300035172 | Ga0373955_0097240 | Ga0373955_0097240_400_1152 | 237 |
| 804 | 3300035172 | Ga0373955_0111755 | Ga0373955_0111755_629_1381 | 237 |
| 805 | 3300035172 | Ga0373955_0128990 | Ga0373955_0128990_549_1301 | 237 |
| 806 | 3300035207 | Ga0373942_0099938 | Ga0373942_0099938_81_833 | 237 |
| 807 | 3300035242 | Ga0373962_0018042 | Ga0373962_0018042_361_1113 | 237 |
| 808 | 3300035410 | Ga0373924_0037264 | Ga0373924_0037264_1238_1951 | 237 |
| 809 | 3300035691 | Ga0373931_0127825 | Ga0373931_0127825_252_1004 | 237 |
| 810 | 3300035691 | Ga0373931_0277239 | Ga0373931_0277239_17_730 | 237 |
| 811 | 3300035692 | Ga0373935_0001675 | Ga0373935_0001675_2057_2809 | 237 |
| 812 | 3300035692 | Ga0373935_0008518 | Ga0373935_0008518_453_1205 | 237 |
| 813 | 3300035692 | Ga0373935_0044338 | Ga0373935_0044338_38_790 | 237 |
| 814 | 3300035695 | Ga0373927_0000747 | Ga0373927_0000747_18124_18876 | 237 |
| 815 | 3300035695 | Ga0373927_0272728 | Ga0373927_0272728_68_820 | 237 |
| 816 | 3300035724 | Ga0373933_0090555 | Ga0373933_0090555_1013_1765 | 237 |
| 817 | 3300035725 | Ga0373947_0000971 | Ga0373947_0000971_1084_1836 | 237 |
| 818 | 3300035725 | Ga0373947_0001211 | Ga0373947_0001211_12476_13228 | 237 |
| 819 | 3300036401 | Ga0373937_0021575 | Ga0373937_0021575_1574_2323 | 237 |
| 820 | 3300036401 | Ga0373937_0040661 | Ga0373937_0040661_3330_4082 | 237 |
| 821 | 3300036401 | Ga0373937_0054915 | Ga0373937_0054915_220_972 | 237 |
| 822 | 3300036401 | Ga0373937_0179904 | Ga0373937_0179904_1018_1770 | 237 |
| 823 | 3300036401 | Ga0373937_0240705 | Ga0373937_0240705_282_1034 | 237 |
| 824 | 3300036401 | Ga0373937_0979633 | Ga0373937_0979633_57_770 | 237 |
| 825 | 3300037068 | Ga0373925_0039256 | Ga0373925_0039256_742_1494 | 237 |
| 826 | 3300037068 | Ga0373925_0174457 | Ga0373925_0174457_197_949 | 237 |
| 827 | 3300037068 | Ga0373925_0175752 | Ga0373925_0175752_919_1671 | 237 |
| 828 | 3300037418 | Ga0395900_0698613 | Ga0395900_0698613_179_928 | 237 |
| 829 | 3300037466 | Ga0395898_0020412 | Ga0395898_0020412_338_1087 | 237 |
| 830 | 3300037471 | Ga0395905_0659058 | Ga0395905_0659058_86_835 | 237 |
| 831 | 3300039437 | Ga0436365_1839081 | Ga0436365_1839081_35_787 | 237 |
| 832 | 3300039450 | Ga0436363_1122218 | Ga0436363_1122218_466_1218 | 237 |
| 833 | 3300042876 | Ga0451577_0082373 | Ga0451577_0082373_925_1677 | 237 |
| 834 | 3300044684 | Ga0466966_0115682 | Ga0466966_0115682_113_862 | 237 |
| 835 | 3300044684 | Ga0466966_0143822 | Ga0466966_0143822_632_1381 | 237 |
| 836 | 3300044694 | Ga0466963_0000986 | Ga0466963_0000986_12039_12788 | 237 |
| 837 | 3300044706 | Ga0466964_0028661 | Ga0466964_0028661_871_1620 | 237 |
| 838 | 3300044706 | Ga0466964_0048034 | Ga0466964_0048034_96_848 | 237 |
| 839 | 3300044765 | Ga0466970_0122543 | Ga0466970_0122543_507_1256 | 237 |
| 840 | 3300044842 | Ga0466957_0000324 | Ga0466957_0000324_13888_14637 | 237 |
| 841 | 3300045049 | Ga0466959_0011621 | Ga0466959_0011621_3733_4482 | 237 |
| 842 | 3300045051 | Ga0451576_0092322 | Ga0451576_0092322_2303_3055 | 237 |
| 843 | 3300045051 | Ga0451576_0346190 | Ga0451576_0346190_134_886 | 237 |
| 844 | 3300045051 | Ga0451576_0405387 | Ga0451576_0405387_498_1211 | 237 |
| 845 | 3300045051 | Ga0451576_0437311 | Ga0451576_0437311_157_870 | 237 |
| 846 | 3300045836 | Ga0466958_0016862 | Ga0466958_0016862_3235_3984 | 237 |
| 847 | 3300045836 | Ga0466958_0034939 | Ga0466958_0034939_448_1197 | 237 |
| 848 | 3300045976 | Ga0466967_0041428 | Ga0466967_0041428_2201_2950 | 237 |
| 849 | 3300045976 | Ga0466967_0110685 | Ga0466967_0110685_1591_2340 | 237 |
| 850 | 3300045976 | Ga0466967_0170640 | Ga0466967_0170640_20_733 | 237 |
| 851 | 3300046459 | Ga0495629_0053519 | Ga0495629_0053519_829_1581 | 237 |
| 852 | 3300046459 | Ga0495629_0288172 | Ga0495629_0288172_337_1089 | 237 |
| 853 | 3300046462 | Ga0495651_0022857 | Ga0495651_0022857_2395_3144 | 237 |
| 854 | 3300046462 | Ga0495651_0165050 | Ga0495651_0165050_398_1150 | 237 |
| 855 | 3300046472 | Ga0495580_0001673 | Ga0495580_0001673_15421_16173 | 237 |
| 856 | 3300046472 | Ga0495580_0001845 | Ga0495580_0001845_4218_4970 | 237 |
| 857 | 3300046472 | Ga0495580_0005545 | Ga0495580_0005545_2168_2920 | 237 |
| 858 | 3300046472 | Ga0495580_0016664 | Ga0495580_0016664_3863_4615 | 237 |
| 859 | 3300046472 | Ga0495580_0018154 | Ga0495580_0018154_1680_2432 | 237 |
| 860 | 3300046472 | Ga0495580_0118241 | Ga0495580_0118241_746_1498 | 237 |
| 861 | 3300046472 | Ga0495580_0133362 | Ga0495580_0133362_168_920 | 237 |
| 862 | 3300046472 | Ga0495580_0181217 | Ga0495580_0181217_372_1124 | 237 |
| 863 | 3300046472 | Ga0495580_0361148 | Ga0495580_0361148_33_785 | 237 |
| 864 | 3300046473 | Ga0495582_0000596 | Ga0495582_0000596_14574_15326 | 237 |
| 865 | 3300046473 | Ga0495582_0082239 | Ga0495582_0082239_28_741 | 237 |
| 866 | 3300046473 | Ga0495582_0107609 | Ga0495582_0107609_589_1338 | 237 |
| 867 | 3300046476 | Ga0495662_0272273 | Ga0495662_0272273_13_765 | 237 |
| 868 | 3300046516 | Ga0495628_0102363 | Ga0495628_0102363_266_1018 | 237 |
| 869 | 3300046526 | Ga0495666_0021051 | Ga0495666_0021051_242_994 | 237 |
| 870 | 3300046526 | Ga0495666_0092719 | Ga0495666_0092719_367_1080 | 237 |
| 871 | 3300046531 | Ga0495665_0000974 | Ga0495665_0000974_1044_1796 | 237 |
| 872 | 3300046531 | Ga0495665_0131102 | Ga0495665_0131102_169_921 | 237 |
| 873 | 3300046675 | Ga0495657_0223755 | Ga0495657_0223755_371_1123 | 237 |
| 874 | 3300046683 | Ga0495658_0049778 | Ga0495658_0049778_1363_2115 | 237 |
| 875 | 3300046683 | Ga0495658_0057450 | Ga0495658_0057450_754_1506 | 237 |
| 876 | 3300046683 | Ga0495658_0096862 | Ga0495658_0096862_465_1214 | 237 |
| 877 | 3300046684 | Ga0495669_0000669 | Ga0495669_0000669_12901_13614 | 237 |
| 878 | 3300046690 | Ga0495624_0182823 | Ga0495624_0182823_473_1186 | 237 |
| 879 | 3300047315 | Ga0495581_0167444 | Ga0495581_0167444_457_1209 | 237 |
| 880 | 3300047319 | Ga0495674_0013768 | Ga0495674_0013768_4626_5378 | 237 |
| 881 | 3300047319 | Ga0495674_0046446 | Ga0495674_0046446_1634_2386 | 237 |
| 882 | 3300047444 | Ga0495675_0085365 | Ga0495675_0085365_824_1576 | 237 |
| 883 | 3300047471 | Ga0495684_0133954 | Ga0495684_0133954_319_1071 | 237 |
| 884 | 3300048088 | Ga0495602_0078631 | Ga0495602_0078631_270_1019 | 237 |
| 885 | 3300048088 | Ga0495602_0285483 | Ga0495602_0285483_261_974 | 237 |
| 886 | 3300048903 | Ga0496100_0104235 | Ga0496100_0104235_892_1644 | 237 |
| 887 | 3300048903 | Ga0496100_0250095 | Ga0496100_0250095_20_733 | 237 |
| 888 | 3300048904 | Ga0496101_0086194 | Ga0496101_0086194_1264_2016 | 237 |
| 889 | 3300048904 | Ga0496101_0242897 | Ga0496101_0242897_540_1253 | 237 |
| 890 | 3300048904 | Ga0496101_0773977 | Ga0496101_0773977_33_746 | 237 |
| 891 | 3300048905 | Ga0496102_0003212 | Ga0496102_0003212_6246_6998 | 237 |
| 892 | 3300048905 | Ga0496102_0016554 | Ga0496102_0016554_888_1637 | 237 |
| 893 | 3300048905 | Ga0496102_0238756 | Ga0496102_0238756_32_784 | 237 |
| 894 | 3300048905 | Ga0496102_0283500 | Ga0496102_0283500_611_1363 | 237 |
| 895 | 3300048906 | Ga0496103_0002380 | Ga0496103_0002380_1531_2283 | 237 |
| 896 | 3300048906 | Ga0496103_0039142 | Ga0496103_0039142_498_1247 | 237 |
| 897 | 3300048907 | Ga0496104_0025955 | Ga0496104_0025955_3581_4333 | 237 |
| 898 | 3300048907 | Ga0496104_0220731 | Ga0496104_0220731_471_1223 | 237 |
| 899 | 3300048907 | Ga0496104_0288112 | Ga0496104_0288112_27_779 | 237 |
| 900 | 3300048907 | Ga0496104_0923870 | Ga0496104_0923870_53_766 | 237 |
| 901 | 3300048908 | Ga0496105_0307859 | Ga0496105_0307859_162_914 | 237 |
| 902 | 3300048909 | Ga0496106_0063431 | Ga0496106_0063431_651_1403 | 237 |
| 903 | 3300048909 | Ga0496106_0322373 | Ga0496106_0322373_37_789 | 237 |
| 904 | 3300048910 | Ga0496107_0078051 | Ga0496107_0078051_1056_1808 | 237 |
| 905 | 3300048910 | Ga0496107_0284470 | Ga0496107_0284470_447_1199 | 237 |
| 906 | 3300048911 | Ga0496108_0022698 | Ga0496108_0022698_2336_3049 | 237 |
| 907 | 3300048912 | Ga0496109_0038156 | Ga0496109_0038156_1704_2417 | 237 |
| 908 | 3300048912 | Ga0496109_0189690 | Ga0496109_0189690_330_1082 | 237 |
| 909 | 3300048913 | Ga0496110_0702414 | Ga0496110_0702414_78_830 | 237 |
| 910 | 3300048914 | Ga0496111_0057018 | Ga0496111_0057018_1314_2027 | 237 |
| 911 | 3300048915 | Ga0496112_0027473 | Ga0496112_0027473_2989_3741 | 237 |
| 912 | 3300048915 | Ga0496112_0038846 | Ga0496112_0038846_3680_4429 | 237 |
| 913 | 3300048915 | Ga0496112_0047142 | Ga0496112_0047142_1429_2142 | 237 |
| 914 | 3300048915 | Ga0496112_0057520 | Ga0496112_0057520_2719_3471 | 237 |
| 915 | 3300048915 | Ga0496112_0079924 | Ga0496112_0079924_1132_1884 | 237 |
| 916 | 3300048915 | Ga0496112_0172754 | Ga0496112_0172754_1092_1844 | 237 |
| 917 | 3300048915 | Ga0496112_0191638 | Ga0496112_0191638_546_1298 | 237 |
| 918 | 3300048915 | Ga0496112_0445977 | Ga0496112_0445977_341_1093 | 237 |
| 919 | 3300048916 | Ga0496113_0009232 | Ga0496113_0009232_737_1489 | 237 |
| 920 | 3300048916 | Ga0496113_0027888 | Ga0496113_0027888_13_726 | 237 |
| 921 | 3300048917 | Ga0496114_0060383 | Ga0496114_0060383_1783_2535 | 237 |
| 922 | 3300048918 | Ga0496115_0004694 | Ga0496115_0004694_4471_5223 | 237 |
| 923 | 3300048918 | Ga0496115_0084254 | Ga0496115_0084254_488_1240 | 237 |
| 924 | 3300048918 | Ga0496115_0087626 | Ga0496115_0087626_788_1537 | 237 |
| 925 | 3300048918 | Ga0496115_0145780 | Ga0496115_0145780_1134_1886 | 237 |
| 926 | 3300048918 | Ga0496115_0374922 | Ga0496115_0374922_353_1105 | 237 |
| 927 | 3300050507 | nmdc:mga05p37_300092_c1 | nmdc:mga05p37_300092_c1_144_893 | 237 |
| 928 | 3300050512 | nmdc:mga0n895_21442_c1 | nmdc:mga0n895_21442_c1_3700_4452 | 237 |
| 929 | 3300050512 | nmdc:mga0n895_26592_c1 | nmdc:mga0n895_26592_c1_716_1465 | 237 |
| 930 | 3300050512 | nmdc:mga0n895_344_c1 | nmdc:mga0n895_344_c1_9887_10657 | 237 |
| 931 | 3300050513 | nmdc:mga0rr50_350648_c1 | nmdc:mga0rr50_350648_c1_359_1111 | 237 |
| 932 | 3300050513 | nmdc:mga0rr50_37321_c1 | nmdc:mga0rr50_37321_c1_1057_1809 | 237 |
| 933 | 3300050513 | nmdc:mga0rr50_872_c1 | nmdc:mga0rr50_872_c1_3035_3805 | 237 |
| 934 | 3300050514 | nmdc:mga08x19_3391_c1 | nmdc:mga08x19_3391_c1_6168_6938 | 237 |
| 935 | 3300050514 | nmdc:mga08x19_3614_c1 | nmdc:mga08x19_3614_c1_6782_7534 | 237 |
| 936 | 3300050514 | nmdc:mga08x19_9637_c1 | nmdc:mga08x19_9637_c1_79_831 | 237 |
| 937 | 3300050515 | nmdc:mga0a205_7367_c1 | nmdc:mga0a205_7367_c1_816_1586 | 237 |
| 938 | 3300053077 | Ga0495601_0023927 | Ga0495601_0023927_1684_2433 | 237 |
| 939 | 3300053077 | Ga0495601_0427759 | Ga0495601_0427759_52_804 | 237 |
| 940 | 3300053078 | Ga0495612_0085918 | Ga0495612_0085918_54_806 | 237 |
| 941 | 3300059478 | Ga0587093_001841 | Ga0587093_001841_1061_1810 | 237 |
| 942 | 3300059490 | Ga0587066_000041 | Ga0587066_000041_96_845 | 237 |
| 943 | 3300059491 | Ga0587070_000114 | Ga0587070_000114_63_812 | 237 |
| 944 | 3300059492 | Ga0587073_0004031 | Ga0587073_0004031_1276_2025 | 237 |
| 945 | 3300059492 | Ga0587073_0007886 | Ga0587073_0007886_584_1333 | 237 |
| 946 | 3300059492 | Ga0587073_0034242 | Ga0587073_0034242_52_804 | 237 |
| 947 | 3300059493 | Ga0587077_000059 | Ga0587077_000059_63_812 | 237 |
| 948 | 3300059503 | Ga0587080_000447 | Ga0587080_000447_2207_2956 | 237 |
| 949 | 3300059504 | Ga0587082_000041 | Ga0587082_000041_602_1351 | 237 |
| 950 | 3300059505 | Ga0587083_0000140 | Ga0587083_0000140_49_798 | 237 |
| 951 | 3300059506 | Ga0587085_000049 | Ga0587085_000049_3795_4544 | 237 |
| 952 | 3300059509 | Ga0587089_001185 | Ga0587089_001185_1051_1800 | 237 |
| 953 | 3300059511 | Ga0587091_000037 | Ga0587091_000037_5041_5790 | 237 |
| 954 | 3300059512 | Ga0587092_000359 | Ga0587092_000359_372_1121 | 237 |
| 955 | 3300059512 | Ga0587092_008497 | Ga0587092_008497_323_1072 | 237 |
| 956 | 3300059625 | Ga0587113_000220 | Ga0587113_000220_650_1399 | 237 |
| 957 | 3300059630 | Ga0587128_005905 | Ga0587128_005905_172_921 | 237 |
| 958 | 3300059639 | Ga0587062_000813 | Ga0587062_000813_1394_2143 | 237 |
| 959 | 3300059640 | Ga0587067_000531 | Ga0587067_000531_430_1179 | 237 |
| 960 | 3300059644 | Ga0587075_000131 | Ga0587075_000131_3054_3803 | 237 |
| 961 | 3300059645 | Ga0587076_000182 | Ga0587076_000182_441_1190 | 237 |
| 962 | 3300059645 | Ga0587076_007119 | Ga0587076_007119_245_994 | 237 |
| 963 | 3300059646 | Ga0587078_000985 | Ga0587078_000985_363_1112 | 237 |
| 964 | 3300059646 | Ga0587078_002585 | Ga0587078_002585_472_1221 | 237 |
| 965 | 3300059647 | Ga0587079_000058 | Ga0587079_000058_4775_5524 | 237 |
| 966 | 3300060243 | Ga0587060_000766 | Ga0587060_000766_976_1725 | 237 |
| 967 | 3300060344 | Ga0587071_000028 | Ga0587071_000028_2299_3048 | 237 |
| 968 | 3300060344 | Ga0587071_015934 | Ga0587071_015934_315_1064 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.988 | 2 | 237 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9876 | 1 | 237 |
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9863 | 2 | 237 |
| 4fuk-assembly1.cif.gz_A | aminopeptidase from trypanosoma brucei | 0.9859 | 2 | 237 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9837 | 2 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9876 | 1 | 237 | 3.90.230.10 |
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9843 | 1 | 114 | 3.90.230.10 |
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9819 | 1 | 237 | 3.90.230.10 |
| af_P9WK21_10_265_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9816 | 1 | 237 | 3.90.230.10 |
| af_Q4D257_64_370_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9814 | 2 | 237 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I0E2C8-F1-model_v4 | M24 family metallopeptidase | 0.9997 | 4 | 96 |
GO:0005829
GO:0070006 |
| AF-A0A1Q7AGF7-F1-model_v4 | Multifunctional fusion protein [Includes: Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase); Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M)] | 0.9982 | 10 | 237 |
GO:0004017
GO:0004239 GO:0005524 GO:0005829 GO:0006508 GO:0044209 GO:0046872 GO:0070006 |
| AF-A0A250IPK0-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9973 | 1 | 237 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A7C7DIY6-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9959 | 2 | 237 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A7C6TDM5-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9957 | 1 | 237 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar