F487041

General Info

Members Datasets Scaffolds Average Seq Length
968 383 967 250

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100249975|Ga0070689_1002499752
Length 270
Sequence MGIVLRSQAEIDKLRRANQLVGRVLAELRAMVTPGVTTQDIDEVAEARVREAGAKPAFKGYHGYPATVCASINEQVVHGIPSARPLVKGDIVSIDMGAVLDGYFGDCAVTVPVSDIASEASELLRVTEESLFRGIDAVKPGARVSDIGAAVQQHVEAAGFSVVREFVGHGIGTSLHEEPQIANYGPAGHGPRLSEGMVFAIEPMVNAGTPDVKVLADGWTAVTRDGRLSAHFEHTVVVTREGCEILTLLAADAGRAKQLLGAAVRSAYGG

Samples

Sample ID Description Type Environment
1 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
129 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
137 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
138 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
232 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
304 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
305 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
306 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
307 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
308 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
309 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
310 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
311 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
315 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
316 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
317 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
318 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
319 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
320 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
321 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
322 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
323 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
324 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
325 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
326 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
327 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
328 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
329 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
330 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
331 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
332 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
333 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
334 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
335 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
336 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
337 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
338 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
339 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
340 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
341 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
342 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
343 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
344 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
345 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
346 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
347 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
348 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.6
Metatranscriptomes 9.3
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0.1
Rhizoplane 4.65
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000185 3300000546 Bacteria 10421
2 rootH2_10094920 3300003320 Bacteria 1342
3 rootH1_10245303 3300003323 Unclassified 1160
4 Ga0058863_10007402 3300004799 Bacteria 1389
5 Ga0058863_10026251 3300004799 Bacteria 4666
6 Ga0058863_10107058 3300004799 Bacteria 2349
7 Ga0058861_10061883 3300004800 Bacteria 2429
8 Ga0058861_10190128 3300004800 Bacteria 1733
9 Ga0058861_11824691 3300004800 Bacteria 1432
10 Ga0058860_12198664 3300004801 Bacteria 5509
11 Ga0058862_10141803 3300004803 Bacteria 2984
12 Ga0058862_10144175 3300004803 Bacteria 3897
13 Ga0058862_10197740 3300004803 Bacteria 5441
14 Ga0058862_10250586 3300004803 Bacteria 2354
15 Ga0065712_10027462 3300005290 Bacteria 1546
16 Ga0065715_10023180 3300005293 Bacteria 2058
17 Ga0070676_10004776 3300005328 Bacteria 7163
18 Ga0070676_10036288 3300005328 Bacteria 2840
19 Ga0070683_100099993 3300005329 Bacteria 2730
20 Ga0070683_100114311 3300005329 Bacteria 2547
21 Ga0070683_100122721 3300005329 Bacteria 2454
22 Ga0070683_100186830 3300005329 Bacteria 1967
23 Ga0070683_100347730 3300005329 Bacteria 1412
24 Ga0070683_100366021 3300005329 Bacteria 1373
25 Ga0070683_100453679 3300005329 Bacteria 1223
26 Ga0070690_100032721 3300005330 Bacteria 3249
27 Ga0070690_100046535 3300005330 Bacteria 2758
28 Ga0070690_100327958 3300005330 Bacteria 1105
29 Ga0070670_100076304 3300005331 Bacteria 2880
30 Ga0070677_10008739 3300005333 Bacteria 3418
31 Ga0070677_10071319 3300005333 Bacteria 1462
32 Ga0068869_100001846 3300005334 Bacteria 12731
33 Ga0068869_100010773 3300005334 Bacteria 5973
34 Ga0068869_100027435 3300005334 Bacteria 3970
35 Ga0068869_100298461 3300005334 Bacteria 1300
36 Ga0070666_10014850 3300005335 Bacteria 4962
37 Ga0070680_100016919 3300005336 Bacteria 5741
38 Ga0070680_100039076 3300005336 Bacteria 3840
39 Ga0070680_100107636 3300005336 Bacteria 2319
40 Ga0070680_100250794 3300005336 Bacteria 1496
41 Ga0070680_100638141 3300005336 Bacteria 915
42 Ga0068868_100006530 3300005338 Bacteria 8259
43 Ga0068868_100071322 3300005338 Bacteria 2770
44 Ga0070660_100062076 3300005339 Bacteria 2902
45 Ga0070689_100047225 3300005340 Bacteria 3319
46 Ga0070689_100249975 3300005340 Bacteria 1463
47 Ga0070661_100047556 3300005344 Bacteria 3140
48 Ga0070661_100107749 3300005344 Bacteria 2078
49 Ga0070661_100357641 3300005344 Bacteria 1147
50 Ga0070668_100032434 3300005347 Bacteria 3975
51 Ga0070669_100098899 3300005353 Bacteria 2198
52 Ga0070675_100002788 3300005354 Bacteria 13157
53 Ga0070675_100042746 3300005354 Bacteria 3703
54 Ga0070675_100090126 3300005354 Bacteria 2568
55 Ga0070675_100280787 3300005354 Bacteria 1463
56 Ga0070675_100294260 3300005354 Bacteria 1429
57 Ga0070671_100043889 3300005355 Bacteria 3715
58 Ga0070671_100080002 3300005355 Bacteria 2732
59 Ga0070673_100067958 3300005364 Bacteria 2852
60 Ga0070673_100084232 3300005364 Bacteria 2585
61 Ga0070688_100304949 3300005365 Bacteria 1152
62 Ga0070667_100219341 3300005367 Bacteria 1693
63 Ga0070703_10098924 3300005406 Bacteria 1025
64 Ga0070709_10000423 3300005434 Bacteria 25611
65 Ga0070709_10036190 3300005434 Bacteria 3005
66 Ga0070709_10040857 3300005434 Bacteria 2854
67 Ga0070709_10466381 3300005434 Bacteria 954
68 Ga0070714_100014828 3300005435 Bacteria 6265
69 Ga0070714_100021848 3300005435 Bacteria 5239
70 Ga0070714_100029336 3300005435 Bacteria 4573
71 Ga0070714_100195392 3300005435 Bacteria 1848
72 Ga0070714_100338627 3300005435 Bacteria 1410
73 Ga0070713_100000364 3300005436 Bacteria 29177
74 Ga0070713_100002249 3300005436 Bacteria 12530
75 Ga0070713_100005638 3300005436 Bacteria 8584
76 Ga0070713_100091363 3300005436 Bacteria 2619
77 Ga0070713_100098986 3300005436 Bacteria 2522
78 Ga0070713_100133438 3300005436 Bacteria 2192
79 Ga0070713_100134671 3300005436 Bacteria 2182
80 Ga0070713_100252898 3300005436 Unclassified 1608
81 Ga0070713_100309223 3300005436 Bacteria 1457
82 Ga0070713_100368642 3300005436 Bacteria 1336
83 Ga0070713_100464439 3300005436 Unclassified 1190
84 Ga0070710_10023917 3300005437 Bacteria 3217
85 Ga0070710_10031205 3300005437 Bacteria 2874
86 Ga0070710_10031408 3300005437 Bacteria 2867
87 Ga0070701_10030951 3300005438 Bacteria 2652
88 Ga0070711_100000191 3300005439 Bacteria 32562
89 Ga0070711_100063203 3300005439 Bacteria 2583
90 Ga0070711_100092324 3300005439 Bacteria 2184
91 Ga0070711_100113461 3300005439 Bacteria 1993
92 Ga0070711_100252627 3300005439 Bacteria 1384
93 Ga0070705_100068395 3300005440 Bacteria 2137
94 Ga0070700_100072430 3300005441 Bacteria 2203
95 Ga0070708_100000356 3300005445 Bacteria 34664
96 Ga0070708_100000459 3300005445 Bacteria 30632
97 Ga0070708_100005339 3300005445 Bacteria 10189
98 Ga0070708_100006987 3300005445 Bacteria 9006
99 Ga0070708_100026039 3300005445 Bacteria 5003
100 Ga0070708_100054805 3300005445 Bacteria 3543
101 Ga0070708_100480428 3300005445 Bacteria 1172
102 Ga0070678_100036448 3300005456 Bacteria 3443
103 Ga0070678_100116726 3300005456 Bacteria 2098
104 Ga0070678_100201334 3300005456 Bacteria 1643
105 Ga0070678_100351103 3300005456 Bacteria 1268
106 Ga0070662_100054645 3300005457 Bacteria 2894
107 Ga0070681_10005952 3300005458 Bacteria 11811
108 Ga0070681_10008803 3300005458 Bacteria 9908
109 Ga0070681_10054241 3300005458 Bacteria 3994
110 Ga0070681_10055173 3300005458 Bacteria 3958
111 Ga0070681_10068582 3300005458 Bacteria 3513
112 Ga0070681_10077768 3300005458 Bacteria 3275
113 Ga0070681_10078202 3300005458 Bacteria 3265
114 Ga0070681_10162187 3300005458 Bacteria 2159
115 Ga0070681_10312591 3300005458 Bacteria 1480
116 Ga0070681_10612305 3300005458 Bacteria 1003
117 Ga0068867_100006640 3300005459 Bacteria 8180
118 Ga0068867_100033809 3300005459 Bacteria 3705
119 Ga0068867_100473323 3300005459 Bacteria 1072
120 Ga0070706_100000278 3300005467 Bacteria 62365
121 Ga0070706_100000514 3300005467 Bacteria 45375
122 Ga0070706_100001389 3300005467 Bacteria 25655
123 Ga0070706_100033341 3300005467 Bacteria 4753
124 Ga0070706_100109917 3300005467 Bacteria 2565
125 Ga0070706_100169474 3300005467 Bacteria 2038
126 Ga0070706_100660911 3300005467 Bacteria 970
127 Ga0070707_100000141 3300005468 Bacteria 67927
128 Ga0070707_100000662 3300005468 Bacteria 34318
129 Ga0070707_100013079 3300005468 Bacteria 7755
130 Ga0070707_100025509 3300005468 Bacteria 5607
131 Ga0070707_100036339 3300005468 Bacteria 4700
132 Ga0070707_100044794 3300005468 Bacteria 4236
133 Ga0070707_100061516 3300005468 Bacteria 3601
134 Ga0070707_100066623 3300005468 Bacteria 3461
135 Ga0070707_100301057 3300005468 Bacteria 1558
136 Ga0070698_100000139 3300005471 Bacteria 65079
137 Ga0070698_100002247 3300005471 Bacteria 21366
138 Ga0070698_100002449 3300005471 Bacteria 20472
139 Ga0070698_100004533 3300005471 Bacteria 15264
140 Ga0070698_100046998 3300005471 Bacteria 4413
141 Ga0070698_100131141 3300005471 Bacteria 2462
142 Ga0070698_100215092 3300005471 Bacteria 1856
143 Ga0070698_100303576 3300005471 Bacteria 1527
144 Ga0070698_100329736 3300005471 Bacteria 1457
145 Ga0070699_100000441 3300005518 Bacteria 39851
146 Ga0070699_100001695 3300005518 Bacteria 20060
147 Ga0070699_100001725 3300005518 Bacteria 19935
148 Ga0070699_100003886 3300005518 Bacteria 13210
149 Ga0070699_100057839 3300005518 Bacteria 3358
150 Ga0070699_100093484 3300005518 Bacteria 2631
151 Ga0070699_100131330 3300005518 Bacteria 2208
152 Ga0070699_100214448 3300005518 Bacteria 1714
153 Ga0070699_100240066 3300005518 Bacteria 1617
154 Ga0070699_100272844 3300005518 Bacteria 1514
155 Ga0070679_100022709 3300005530 Bacteria 6134
156 Ga0070679_100030101 3300005530 Bacteria 5358
157 Ga0070679_100046215 3300005530 Bacteria 4339
158 Ga0070679_100081564 3300005530 Bacteria 3224
159 Ga0070679_100185732 3300005530 Bacteria 2049
160 Ga0070679_100355777 3300005530 Bacteria 1412
161 Ga0070679_100790781 3300005530 Unclassified 892
162 Ga0070684_100030620 3300005535 Bacteria 4573
163 Ga0070684_100052579 3300005535 Bacteria 3543
164 Ga0070684_100061067 3300005535 Bacteria 3298
165 Ga0070684_100100706 3300005535 Bacteria 2580
166 Ga0070684_100343658 3300005535 Bacteria 1372
167 Ga0070684_100358534 3300005535 Bacteria 1342
168 Ga0070697_100000181 3300005536 Bacteria 51962
169 Ga0070697_100000975 3300005536 Bacteria 21592
170 Ga0070697_100000993 3300005536 Bacteria 21455
171 Ga0070697_100001451 3300005536 Bacteria 18044
172 Ga0070697_100003489 3300005536 Bacteria 12085
173 Ga0070697_100005121 3300005536 Bacteria 10067
174 Ga0070697_100028160 3300005536 Bacteria 4498
175 Ga0070697_100063174 3300005536 Bacteria 3023
176 Ga0070697_100097515 3300005536 Bacteria 2439
177 Ga0070697_100523131 3300005536 Bacteria 1038
178 Ga0070697_100530093 3300005536 Bacteria 1032
179 Ga0070697_100547244 3300005536 Bacteria 1015
180 Ga0070697_100591626 3300005536 Unclassified 975
181 Ga0068853_100335268 3300005539 Bacteria 1404
182 Ga0070672_100082364 3300005543 Bacteria 2581
183 Ga0070686_100010421 3300005544 Bacteria 5241
184 Ga0070686_100037655 3300005544 Bacteria 3001
185 Ga0070686_100332789 3300005544 Bacteria 1136
186 Ga0070695_100207484 3300005545 Bacteria 1404
187 Ga0070696_100180882 3300005546 Bacteria 1564
188 Ga0070696_100192360 3300005546 Bacteria 1519
189 Ga0070693_100024724 3300005547 Bacteria 3225
190 Ga0070693_100060464 3300005547 Bacteria 2199
191 Ga0070693_100061331 3300005547 Bacteria 2185
192 Ga0070693_100276161 3300005547 Unclassified 1123
193 Ga0070665_100013944 3300005548 Bacteria 8083
194 Ga0070704_100031956 3300005549 Bacteria 3545
195 Ga0068855_100086489 3300005563 Bacteria 3625
196 Ga0068855_100122881 3300005563 Bacteria 2970
197 Ga0068855_100131537 3300005563 Bacteria 2857
198 Ga0068855_100131632 3300005563 Bacteria 2856
199 Ga0068855_100153885 3300005563 Bacteria 2613
200 Ga0070664_100000277 3300005564 Bacteria 36913
201 Ga0070664_100001536 3300005564 Bacteria 18433
202 Ga0070664_100056946 3300005564 Bacteria 3322
203 Ga0068857_100011854 3300005577 Bacteria 7583
204 Ga0068857_100015288 3300005577 Bacteria 6699
205 Ga0068857_100087100 3300005577 Bacteria 2793
206 Ga0068857_100464867 3300005577 Bacteria 1184
207 Ga0068854_100015875 3300005578 Bacteria 5004
208 Ga0068854_100028405 3300005578 Bacteria 3865
209 Ga0068854_100151280 3300005578 Bacteria 1790
210 Ga0068854_100155176 3300005578 Bacteria 1768
211 Ga0068856_100018752 3300005614 Bacteria 6708
212 Ga0068856_100036536 3300005614 Bacteria 4816
213 Ga0068856_100101196 3300005614 Bacteria 2874
214 Ga0068856_100102927 3300005614 Bacteria 2849
215 Ga0068856_100241533 3300005614 Bacteria 1821
216 Ga0068856_100390222 3300005614 Bacteria 1412
217 Ga0068856_100597869 3300005614 Bacteria 1124
218 Ga0068856_100621120 3300005614 Bacteria 1101
219 Ga0068852_100018750 3300005616 Bacteria 5457
220 Ga0068852_100037792 3300005616 Bacteria 4051
221 Ga0068852_100077400 3300005616 Bacteria 2940
222 Ga0068859_100013371 3300005617 Bacteria 8230
223 Ga0068859_100017062 3300005617 Bacteria 7289
224 Ga0068859_100822611 3300005617 Bacteria 1016
225 Ga0068864_100012547 3300005618 Bacteria 7006
226 Ga0068864_100186541 3300005618 Bacteria 1899
227 Ga0068864_100347854 3300005618 Bacteria 1398
228 Ga0068864_100357383 3300005618 Bacteria 1380
229 Ga0068861_100084611 3300005719 Bacteria 2490
230 Ga0068851_10021382 3300005834 Bacteria 3141
231 Ga0068851_10105071 3300005834 Bacteria 1502
232 Ga0068870_10044634 3300005840 Bacteria 2317
233 Ga0068870_10064860 3300005840 Bacteria 1973
234 Ga0068870_10163463 3300005840 Bacteria 1322
235 Ga0068863_100044079 3300005841 Bacteria 4235
236 Ga0068863_100068631 3300005841 Bacteria 3353
237 Ga0068863_100451082 3300005841 Bacteria 1262
238 Ga0068858_100020862 3300005842 Bacteria 6124
239 Ga0068858_100047535 3300005842 Bacteria 3977
240 Ga0068860_100018016 3300005843 Bacteria 6877
241 Ga0068860_100025252 3300005843 Bacteria 5734
242 Ga0068860_100173182 3300005843 Bacteria 2085
243 Ga0068860_100252271 3300005843 Bacteria 1719
244 Ga0068860_100390052 3300005843 Bacteria 1376
245 Ga0068862_100116286 3300005844 Bacteria 2352
246 Ga0068862_100259774 3300005844 Bacteria 1585
247 Ga0081538_10034921 3300005981 Bacteria 3314
248 Ga0081540_1096199 3300005983 Bacteria 1288
249 Ga0070717_10002614 3300006028 Bacteria 12700
250 Ga0070717_10006374 3300006028 Bacteria 8673
251 Ga0070717_10006770 3300006028 Bacteria 8457
252 Ga0070717_10022846 3300006028 Bacteria 4948
253 Ga0070717_10024604 3300006028 Bacteria 4784
254 Ga0070717_10155162 3300006028 Bacteria 1983
255 Ga0070717_10200924 3300006028 Bacteria 1746
256 Ga0070717_10202099 3300006028 Bacteria 1741
257 Ga0070717_10483169 3300006028 Bacteria 1118
258 Ga0070716_100005841 3300006173 Bacteria 5980
259 Ga0070716_100012088 3300006173 Bacteria 4365
260 Ga0070716_100016153 3300006173 Bacteria 3848
261 Ga0070716_100023979 3300006173 Bacteria 3243
262 Ga0070716_100037411 3300006173 Bacteria 2682
263 Ga0070716_100056250 3300006173 Bacteria 2255
264 Ga0070716_100471755 3300006173 Bacteria 920
265 Ga0070712_100000593 3300006175 Bacteria 21160
266 Ga0070712_100001135 3300006175 Bacteria 16046
267 Ga0070712_100003022 3300006175 Bacteria 10410
268 Ga0070712_100004622 3300006175 Bacteria 8508
269 Ga0070712_100056210 3300006175 Bacteria 2759
270 Ga0070712_100118675 3300006175 Bacteria 1987
271 Ga0070712_100202118 3300006175 Bacteria 1562
272 Ga0075367_10076806 3300006178 Bacteria 2016
273 Ga0097621_100007525 3300006237 Bacteria 7797
274 Ga0097621_100013773 3300006237 Bacteria 6038
275 Ga0097621_100070515 3300006237 Bacteria 2886
276 Ga0097621_100073449 3300006237 Bacteria 2831
277 Ga0097621_100157200 3300006237 Bacteria 1952
278 Ga0068871_100014064 3300006358 Bacteria 5952
279 Ga0068871_100020698 3300006358 Bacteria 5044
280 Ga0068871_100026575 3300006358 Bacteria 4518
281 Ga0068871_100068684 3300006358 Bacteria 2910
282 Ga0068871_100071804 3300006358 Bacteria 2848
283 Ga0068871_100072335 3300006358 Bacteria 2839
284 Ga0068871_100084357 3300006358 Bacteria 2636
285 Ga0068871_100159495 3300006358 Bacteria 1928
286 Ga0075428_100034853 3300006844 Bacteria 5550
287 Ga0075430_100001931 3300006846 Bacteria 17021
288 Ga0075431_100112052 3300006847 Bacteria 2816
289 Ga0075434_100000230 3300006871 Bacteria 38508
290 Ga0075434_100005131 3300006871 Bacteria 11896
291 Ga0075429_100001796 3300006880 Bacteria 17765
292 Ga0068865_100006206 3300006881 Bacteria 7284
293 Ga0068865_100165105 3300006881 Bacteria 1692
294 Ga0068865_100219752 3300006881 Bacteria 1485
295 Ga0075436_100000510 3300006914 Bacteria 25141
296 Ga0075436_100012852 3300006914 Bacteria 5738
297 Ga0075436_100013001 3300006914 Bacteria 5707
298 Ga0075436_100032647 3300006914 Bacteria 3588
299 Ga0075436_100040669 3300006914 Bacteria 3207
300 Ga0075436_100258144 3300006914 Unclassified 1242
301 Ga0097620_100013371 3300006931 Bacteria 8230
302 Ga0097620_100017062 3300006931 Bacteria 7289
303 Ga0097620_100822568 3300006931 Bacteria 1016
304 Ga0075435_100000389 3300007076 Bacteria 26853
305 Ga0075435_100045994 3300007076 Bacteria 3500
306 Ga0075435_100333245 3300007076 Bacteria 1300
307 Ga0075435_100547357 3300007076 Bacteria 1002
308 Ga0099795_10007913 3300007788 Bacteria 2999
309 Ga0105240_10029138 3300009093 Bacteria 7199
310 Ga0105240_10037261 3300009093 Bacteria 6251
311 Ga0105240_10066274 3300009093 Bacteria 4480
312 Ga0105240_10098360 3300009093 Bacteria 3563
313 Ga0105240_10301875 3300009093 Bacteria 1832
314 Ga0105240_10351030 3300009093 Bacteria 1673
315 Ga0105240_10546511 3300009093 Bacteria 1282
316 Ga0105240_10566055 3300009093 Bacteria 1255
317 Ga0111539_10302448 3300009094 Bacteria 1862
318 Ga0105245_10005238 3300009098 Bacteria 11396
319 Ga0105245_10121450 3300009098 Bacteria 2441
320 Ga0105247_10019238 3300009101 Bacteria 4098
321 Ga0105247_10132378 3300009101 Bacteria 1626
322 Ga0114129_10030197 3300009147 Bacteria 7676
323 Ga0105243_10017394 3300009148 Bacteria 5435
324 Ga0105241_10036407 3300009174 Bacteria 3703
325 Ga0105241_10060464 3300009174 Bacteria 2915
326 Ga0105241_10243630 3300009174 Bacteria 1521
327 Ga0105241_10308570 3300009174 Bacteria 1360
328 Ga0105242_10021951 3300009176 Bacteria 5017
329 Ga0105242_10025185 3300009176 Bacteria 4705
330 Ga0105242_10286600 3300009176 Bacteria 1498
331 Ga0105242_10347723 3300009176 Bacteria 1368
332 Ga0105242_10443105 3300009176 Bacteria 1222
333 Ga0105242_10732535 3300009176 Unclassified 971
334 Ga0105248_10087800 3300009177 Bacteria 3500
335 Ga0105248_10168623 3300009177 Bacteria 2468
336 Ga0105248_10211826 3300009177 Bacteria 2183
337 Ga0105248_10256836 3300009177 Bacteria 1967
338 Ga0105248_10449093 3300009177 Bacteria 1453
339 Ga0105237_10016610 3300009545 Bacteria 7645
340 Ga0105237_10059544 3300009545 Bacteria 3821
341 Ga0105237_10096007 3300009545 Bacteria 2954
342 Ga0105237_10178865 3300009545 Bacteria 2121
343 Ga0105237_10193165 3300009545 Bacteria 2035
344 Ga0105237_10618325 3300009545 Unclassified 1090
345 Ga0105238_10004639 3300009551 Bacteria 13603
346 Ga0105238_10121061 3300009551 Bacteria 2596
347 Ga0105238_10122762 3300009551 Bacteria 2577
348 Ga0105249_10017780 3300009553 Bacteria 6316
349 Ga0099796_10025283 3300010159 Bacteria 1873
350 Ga0099796_10059515 3300010159 Bacteria 1349
351 Ga0105239_10116116 3300010375 Bacteria 2970
352 Ga0105239_10295798 3300010375 Bacteria 1823
353 Ga0105239_11123062 3300010375 Bacteria 905
354 Ga0105246_10018819 3300011119 Bacteria 4404
355 Ga0105246_10104324 3300011119 Bacteria 2070
356 Ga0105246_10307490 3300011119 Unclassified 1283
357 Ga0157373_10016891 3300013100 Bacteria 5322
358 Ga0157373_10082678 3300013100 Bacteria 2263
359 Ga0157373_10092181 3300013100 Bacteria 2134
360 Ga0157371_10016410 3300013102 Bacteria 5528
361 Ga0157370_10124040 3300013104 Bacteria 2412
362 Ga0157369_10075050 3300013105 Bacteria 3626
363 Ga0157369_10077234 3300013105 Bacteria 3569
364 Ga0157369_10109693 3300013105 Bacteria 2934
365 Ga0157369_10196641 3300013105 Bacteria 2117
366 Ga0157374_10053416 3300013296 Bacteria 3767
367 Ga0157374_10056630 3300013296 Bacteria 3660
368 Ga0157374_10094140 3300013296 Bacteria 2862
369 Ga0157374_10094974 3300013296 Bacteria 2850
370 Ga0157374_10314730 3300013296 Unclassified 1550
371 Ga0157374_10327687 3300013296 Unclassified 1518
372 Ga0157374_10367777 3300013296 Bacteria 1431
373 Ga0157374_10598803 3300013296 Bacteria 1112
374 Ga0157378_10000411 3300013297 Bacteria 42281
375 Ga0157378_10000516 3300013297 Bacteria 36737
376 Ga0157378_10000641 3300013297 Bacteria 32867
377 Ga0157378_10023476 3300013297 Bacteria 5427
378 Ga0157378_10027505 3300013297 Bacteria 5018
379 Ga0157378_10044668 3300013297 Bacteria 3935
380 Ga0157378_10260721 3300013297 Bacteria 1663
381 Ga0157378_10400508 3300013297 Bacteria 1352
382 Ga0157378_10815642 3300013297 Bacteria 960
383 Ga0163162_10020357 3300013306 Bacteria 6517
384 Ga0163162_10322933 3300013306 Bacteria 1676
385 Ga0163162_10701539 3300013306 Bacteria 1134
386 Ga0163162_11210431 3300013306 Bacteria 857
387 Ga0157372_10029430 3300013307 Bacteria 5997
388 Ga0157372_10087746 3300013307 Bacteria 3530
389 Ga0157372_10117278 3300013307 Bacteria 3053
390 Ga0157372_10133152 3300013307 Bacteria 2862
391 Ga0157372_10163271 3300013307 Bacteria 2575
392 Ga0157372_10238753 3300013307 Bacteria 2108
393 Ga0157372_10464426 3300013307 Bacteria 1475
394 Ga0157375_10273036 3300013308 Bacteria 1853
395 Ga0163163_10038186 3300014325 Bacteria 4677
396 Ga0163163_10060784 3300014325 Bacteria 3742
397 Ga0163163_10085804 3300014325 Bacteria 3156
398 Ga0163163_10150827 3300014325 Bacteria 2368
399 Ga0157380_10226030 3300014326 Bacteria 1678
400 Ga0157379_10004402 3300014968 Bacteria 12067
401 Ga0157376_10008421 3300014969 Bacteria 7439
402 Ga0157376_10155309 3300014969 Bacteria 2068
403 Ga0157376_10198242 3300014969 Bacteria 1845
404 Ga0157376_10216896 3300014969 Bacteria 1770
405 Ga0182007_10006522 3300015262 Bacteria 5005
406 Ga0182007_10096360 3300015262 Unclassified 977
407 Ga0163161_10327237 3300017792 Bacteria 1213
408 Ga0184602_100587 3300019161 Bacteria 1580
409 Ga0184601_138509 3300019183 Bacteria 2771
410 Ga0184599_124137 3300019188 Bacteria 4861
411 Ga0184600_107512 3300019190 Unclassified 2151
412 Ga0197907_10394153 3300020069 Bacteria 989
413 Ga0197907_10527156 3300020069 Bacteria 1435
414 Ga0197907_10662566 3300020069 Bacteria 2353
415 Ga0206356_10049636 3300020070 Bacteria 1906
416 Ga0206356_10051902 3300020070 Bacteria 1697
417 Ga0206356_10833199 3300020070 Bacteria 1016
418 Ga0206356_11173081 3300020070 Bacteria 2030
419 Ga0206356_11476520 3300020070 Bacteria 1230
420 Ga0206356_11803998 3300020070 Bacteria 1891
421 Ga0206355_1040840 3300020076 Bacteria 974
422 Ga0206355_1106755 3300020076 Bacteria 995
423 Ga0206355_1328072 3300020076 Bacteria 1178
424 Ga0206351_10678473 3300020077 Bacteria 2545
425 Ga0206351_10806319 3300020077 Bacteria 1227
426 Ga0206352_10443739 3300020078 Bacteria 1698
427 Ga0206352_10818178 3300020078 Bacteria 1211
428 Ga0206350_10297924 3300020080 Bacteria 1432
429 Ga0206350_10978419 3300020080 Bacteria 1872
430 Ga0206354_10240356 3300020081 Bacteria 1220
431 Ga0206354_10881815 3300020081 Bacteria 1408
432 Ga0206353_11188867 3300020082 Bacteria 1134
433 Ga0206353_11403828 3300020082 Bacteria 1437
434 Ga0154015_1684329 3300020610 Bacteria 1179
435 Ga0154015_1706975 3300020610 Bacteria 2206
436 Ga0224712_10020119 3300022467 Bacteria 2260
437 Ga0224712_10053142 3300022467 Bacteria 1585
438 Ga0224712_10068472 3300022467 Bacteria 1435
439 Ga0224712_10119152 3300022467 Bacteria 1141
440 Ga0224712_10128781 3300022467 Bacteria 1103
441 Ga0224570_100717 3300022730 Bacteria 2645
442 Ga0224569_100499 3300022732 Bacteria 3400
443 Ga0247554_100062 3300023547 Bacteria 2139
444 Ga0228598_1000213 3300024227 Bacteria 10848
445 Ga0228598_1000513 3300024227 Bacteria 8046
446 Ga0207656_10005274 3300025321 Bacteria 4559
447 Ga0207656_10013964 3300025321 Bacteria 3082
448 Ga0207656_10026011 3300025321 Unclassified 2381
449 Ga0207653_10129640 3300025885 Unclassified 914
450 Ga0207682_10076728 3300025893 Bacteria 1425
451 Ga0207692_10006388 3300025898 Bacteria 4778
452 Ga0207692_10013131 3300025898 Bacteria 3585
453 Ga0207692_10020497 3300025898 Bacteria 3008
454 Ga0207642_10062870 3300025899 Bacteria 1734
455 Ga0207680_10338107 3300025903 Bacteria 1056
456 Ga0207647_10006875 3300025904 Bacteria 8248
457 Ga0207647_10019145 3300025904 Bacteria 4608
458 Ga0207685_10038470 3300025905 Bacteria 1769
459 Ga0207699_10002321 3300025906 Bacteria 8995
460 Ga0207699_10014274 3300025906 Bacteria 4090
461 Ga0207699_10020090 3300025906 Bacteria 3574
462 Ga0207699_10021232 3300025906 Bacteria 3496
463 Ga0207699_10055306 3300025906 Bacteria 2361
464 Ga0207699_10297324 3300025906 Bacteria 1126
465 Ga0207645_10004038 3300025907 Bacteria 10936
466 Ga0207645_10035810 3300025907 Bacteria 3187
467 Ga0207643_10148556 3300025908 Bacteria 1404
468 Ga0207684_10000188 3300025910 Bacteria 97995
469 Ga0207684_10000614 3300025910 Bacteria 42486
470 Ga0207684_10001048 3300025910 Bacteria 30878
471 Ga0207684_10001851 3300025910 Bacteria 22017
472 Ga0207684_10003017 3300025910 Bacteria 16680
473 Ga0207684_10194029 3300025910 Bacteria 1752
474 Ga0207684_10278928 3300025910 Bacteria 1441
475 Ga0207684_10541969 3300025910 Bacteria 996
476 Ga0207654_10052456 3300025911 Bacteria 2351
477 Ga0207654_10097758 3300025911 Bacteria 1803
478 Ga0207654_10148662 3300025911 Bacteria 1501
479 Ga0207707_10003361 3300025912 Bacteria 14208
480 Ga0207707_10007456 3300025912 Bacteria 9532
481 Ga0207707_10018585 3300025912 Bacteria 6059
482 Ga0207707_10021611 3300025912 Bacteria 5623
483 Ga0207707_10109026 3300025912 Bacteria 2420
484 Ga0207707_10127170 3300025912 Bacteria 2228
485 Ga0207707_10168596 3300025912 Bacteria 1913
486 Ga0207707_10287986 3300025912 Bacteria 1421
487 Ga0207707_10299411 3300025912 Bacteria 1391
488 Ga0207695_10007039 3300025913 Bacteria 14431
489 Ga0207695_10008453 3300025913 Bacteria 12891
490 Ga0207695_10081934 3300025913 Bacteria 3264
491 Ga0207695_10150454 3300025913 Bacteria 2267
492 Ga0207695_10172513 3300025913 Bacteria 2087
493 Ga0207671_10042349 3300025914 Bacteria 3370
494 Ga0207671_10068785 3300025914 Bacteria 2639
495 Ga0207671_10074923 3300025914 Bacteria 2530
496 Ga0207671_10122703 3300025914 Bacteria 1987
497 Ga0207693_10000026 3300025915 Bacteria 122717
498 Ga0207693_10000922 3300025915 Bacteria 26418
499 Ga0207693_10001260 3300025915 Bacteria 22561
500 Ga0207693_10004232 3300025915 Bacteria 12174
501 Ga0207693_10041078 3300025915 Bacteria 3642
502 Ga0207693_10306845 3300025915 Bacteria 1243
503 Ga0207663_10006104 3300025916 Bacteria 6133
504 Ga0207663_10027488 3300025916 Bacteria 3317
505 Ga0207663_10031788 3300025916 Bacteria 3127
506 Ga0207663_10062577 3300025916 Bacteria 2366
507 Ga0207663_10140657 3300025916 Bacteria 1681
508 Ga0207660_10023735 3300025917 Bacteria 4144
509 Ga0207660_10085371 3300025917 Bacteria 2328
510 Ga0207660_10096860 3300025917 Bacteria 2197
511 Ga0207660_10119042 3300025917 Bacteria 1998
512 Ga0207657_10006426 3300025919 Bacteria 12189
513 Ga0207649_10036883 3300025920 Bacteria 2948
514 Ga0207649_10058342 3300025920 Bacteria 2417
515 Ga0207652_10018223 3300025921 Bacteria 5757
516 Ga0207652_10061092 3300025921 Bacteria 3253
517 Ga0207652_10096820 3300025921 Bacteria 2600
518 Ga0207652_10104357 3300025921 Bacteria 2507
519 Ga0207646_10000238 3300025922 Bacteria 75978
520 Ga0207646_10000258 3300025922 Bacteria 72085
521 Ga0207646_10001230 3300025922 Bacteria 32163
522 Ga0207646_10004899 3300025922 Bacteria 14334
523 Ga0207646_10017066 3300025922 Bacteria 6802
524 Ga0207646_10206047 3300025922 Bacteria 1776
525 Ga0207646_10241285 3300025922 Bacteria 1632
526 Ga0207646_10333690 3300025922 Bacteria 1370
527 Ga0207681_10048860 3300025923 Bacteria 2857
528 Ga0207681_10114519 3300025923 Bacteria 1967
529 Ga0207681_10181869 3300025923 Bacteria 1602
530 Ga0207681_10285150 3300025923 Bacteria 1302
531 Ga0207681_10366824 3300025923 Bacteria 1156
532 Ga0207694_10000718 3300025924 Bacteria 29747
533 Ga0207694_10019318 3300025924 Bacteria 5152
534 Ga0207694_10044180 3300025924 Bacteria 3441
535 Ga0207650_10014338 3300025925 Bacteria 5510
536 Ga0207650_10071395 3300025925 Bacteria 2611
537 Ga0207650_10725017 3300025925 Bacteria 841
538 Ga0207659_10003579 3300025926 Bacteria 9354
539 Ga0207659_10007868 3300025926 Bacteria 6590
540 Ga0207659_10114968 3300025926 Bacteria 2052
541 Ga0207659_10243802 3300025926 Bacteria 1455
542 Ga0207687_10056079 3300025927 Bacteria 2763
543 Ga0207687_10127310 3300025927 Bacteria 1914
544 Ga0207700_10004902 3300025928 Bacteria 7952
545 Ga0207700_10039497 3300025928 Bacteria 3436
546 Ga0207700_10087615 3300025928 Bacteria 2449
547 Ga0207700_10110922 3300025928 Bacteria 2207
548 Ga0207700_10142418 3300025928 Bacteria 1971
549 Ga0207700_10151903 3300025928 Bacteria 1914
550 Ga0207700_10212126 3300025928 Bacteria 1637
551 Ga0207700_10378013 3300025928 Bacteria 1238
552 Ga0207664_10000087 3300025929 Bacteria 88607
553 Ga0207664_10032913 3300025929 Bacteria 3978
554 Ga0207664_10076602 3300025929 Bacteria 2708
555 Ga0207664_10102458 3300025929 Bacteria 2367
556 Ga0207664_10637139 3300025929 Bacteria 958
557 Ga0207644_10010037 3300025931 Bacteria 6233
558 Ga0207644_10030088 3300025931 Bacteria 3772
559 Ga0207644_10063127 3300025931 Bacteria 2689
560 Ga0207644_10081911 3300025931 Bacteria 2386
561 Ga0207690_10207300 3300025932 Bacteria 1492
562 Ga0207706_10002545 3300025933 Bacteria 17768
563 Ga0207686_10020935 3300025934 Bacteria 3744
564 Ga0207686_10030480 3300025934 Bacteria 3193
565 Ga0207686_10138054 3300025934 Bacteria 1681
566 Ga0207709_10011617 3300025935 Bacteria 4855
567 Ga0207709_10014728 3300025935 Bacteria 4322
568 Ga0207670_10042709 3300025936 Bacteria 2989
569 Ga0207670_10449137 3300025936 Bacteria 1039
570 Ga0207669_10386970 3300025937 Bacteria 1091
571 Ga0207704_10012199 3300025938 Bacteria 4258
572 Ga0207704_10013374 3300025938 Bacteria 4104
573 Ga0207704_10065992 3300025938 Bacteria 2269
574 Ga0207704_10339944 3300025938 Bacteria 1165
575 Ga0207704_10387223 3300025938 Bacteria 1099
576 Ga0207665_10001798 3300025939 Bacteria 14443
577 Ga0207665_10012476 3300025939 Bacteria 5580
578 Ga0207665_10019095 3300025939 Bacteria 4504
579 Ga0207665_10020276 3300025939 Bacteria 4367
580 Ga0207665_10042405 3300025939 Bacteria 3041
581 Ga0207665_10071183 3300025939 Bacteria 2374
582 Ga0207665_10080999 3300025939 Unclassified 2234
583 Ga0207665_10086009 3300025939 Bacteria 2171
584 Ga0207665_10147286 3300025939 Bacteria 1683
585 Ga0207665_10270932 3300025939 Bacteria 1261
586 Ga0207691_10067123 3300025940 Bacteria 3243
587 Ga0207691_10416654 3300025940 Bacteria 1145
588 Ga0207711_10024877 3300025941 Bacteria 5023
589 Ga0207711_10102246 3300025941 Bacteria 2537
590 Ga0207711_10382048 3300025941 Bacteria 1307
591 Ga0207711_10385399 3300025941 Bacteria 1301
592 Ga0207689_10000542 3300025942 Bacteria 35861
593 Ga0207689_10007360 3300025942 Bacteria 9653
594 Ga0207689_10027283 3300025942 Bacteria 4782
595 Ga0207689_10032344 3300025942 Bacteria 4353
596 Ga0207661_10110732 3300025944 Bacteria 2322
597 Ga0207661_10125253 3300025944 Bacteria 2193
598 Ga0207661_10127104 3300025944 Bacteria 2178
599 Ga0207661_10139424 3300025944 Bacteria 2086
600 Ga0207661_10436222 3300025944 Bacteria 1191
601 Ga0207679_10232910 3300025945 Unclassified 1556
602 Ga0207667_10000245 3300025949 Bacteria 76423
603 Ga0207667_10002261 3300025949 Bacteria 24195
604 Ga0207667_10008140 3300025949 Bacteria 12487
605 Ga0207667_10046387 3300025949 Bacteria 4600
606 Ga0207667_10132398 3300025949 Bacteria 2568
607 Ga0207667_10360439 3300025949 Bacteria 1482
608 Ga0207651_10073059 3300025960 Bacteria 2437
609 Ga0207651_10091307 3300025960 Bacteria 2229
610 Ga0207651_10192162 3300025960 Bacteria 1629
611 Ga0207712_10066602 3300025961 Bacteria 2575
612 Ga0207668_10501201 3300025972 Bacteria 1044
613 Ga0207640_10008195 3300025981 Bacteria 5791
614 Ga0207640_10010596 3300025981 Bacteria 5199
615 Ga0207640_10058331 3300025981 Bacteria 2543
616 Ga0207640_10198997 3300025981 Bacteria 1517
617 Ga0207640_10343797 3300025981 Bacteria 1196
618 Ga0207640_10624275 3300025981 Bacteria 915
619 Ga0207677_10004281 3300026023 Bacteria 7637
620 Ga0207677_10004546 3300026023 Bacteria 7461
621 Ga0207677_10008537 3300026023 Bacteria 5730
622 Ga0207677_10024595 3300026023 Bacteria 3744
623 Ga0207703_10003490 3300026035 Bacteria 13160
624 Ga0207703_10013683 3300026035 Bacteria 6323
625 Ga0207703_10041811 3300026035 Bacteria 3674
626 Ga0207703_10050418 3300026035 Bacteria 3369
627 Ga0207703_10051358 3300026035 Bacteria 3341
628 Ga0207639_10060468 3300026041 Bacteria 2923
629 Ga0207639_10064124 3300026041 Bacteria 2847
630 Ga0207639_10117426 3300026041 Bacteria 2180
631 Ga0207678_10001612 3300026067 Bacteria 20753
632 Ga0207708_10039059 3300026075 Bacteria 3616
633 Ga0207702_10001276 3300026078 Bacteria 25273
634 Ga0207702_10001425 3300026078 Bacteria 23875
635 Ga0207702_10003851 3300026078 Bacteria 13535
636 Ga0207702_10041975 3300026078 Bacteria 3836
637 Ga0207702_10127482 3300026078 Bacteria 2287
638 Ga0207702_10282887 3300026078 Bacteria 1569
639 Ga0207702_10564251 3300026078 Bacteria 1114
640 Ga0207641_10045230 3300026088 Bacteria 3706
641 Ga0207641_10245130 3300026088 Bacteria 1671
642 Ga0207641_10386607 3300026088 Bacteria 1341
643 Ga0207648_10001325 3300026089 Bacteria 27526
644 Ga0207648_10023379 3300026089 Bacteria 5537
645 Ga0207648_10103312 3300026089 Bacteria 2499
646 Ga0207676_10046329 3300026095 Bacteria 3364
647 Ga0207676_10051605 3300026095 Bacteria 3211
648 Ga0207676_10087662 3300026095 Bacteria 2546
649 Ga0207676_10236285 3300026095 Bacteria 1637
650 Ga0207676_10497192 3300026095 Bacteria 1157
651 Ga0207674_10000864 3300026116 Bacteria 39645
652 Ga0207674_10018522 3300026116 Bacteria 7566
653 Ga0207674_10041099 3300026116 Bacteria 4784
654 Ga0207674_10100633 3300026116 Bacteria 2872
655 Ga0207683_10051020 3300026121 Bacteria 3624
656 Ga0207683_10062607 3300026121 Bacteria 3277
657 Ga0207683_10080116 3300026121 Bacteria 2896
658 Ga0207683_10174724 3300026121 Bacteria 1946
659 Ga0207683_10249749 3300026121 Bacteria 1619
660 Ga0207698_10089386 3300026142 Bacteria 2515
661 Ga0207698_10205590 3300026142 Bacteria 1767
662 Ga0207698_10720062 3300026142 Unclassified 994
663 Ga0209999_1030202 3300027543 Bacteria 1006
664 Ga0209983_1000426 3300027665 Bacteria 9102
665 Ga0209971_1020867 3300027682 Unclassified 1558
666 Ga0209974_10000500 3300027876 Bacteria 13071
667 Ga0265356_1000279 3300028017 Bacteria 9531
668 Ga0268266_10023242 3300028379 Bacteria 5278
669 Ga0268265_10209553 3300028380 Bacteria 1697
670 Ga0268264_10017321 3300028381 Bacteria 5903
671 Ga0268264_10028638 3300028381 Bacteria 4558
672 Ga0268264_10209769 3300028381 Bacteria 1787
673 Ga0268264_10224831 3300028381 Bacteria 1730
674 Ga0268264_10270162 3300028381 Bacteria 1588
675 Ga0265338_10002857 3300028800 Bacteria 25250
676 Ga0265338_10056425 3300028800 Bacteria 3483
677 Ga0265338_10152496 3300028800 Bacteria 1794
678 Ga0265338_10157549 3300028800 Bacteria 1757
679 Ga0265338_10158627 3300028800 Bacteria 1750
680 Ga0265338_10307499 3300028800 Bacteria 1151
681 Ga0265762_1000268 3300030760 Bacteria 8677
682 Ga0265762_1001772 3300030760 Bacteria 3918
683 Ga0265762_1015375 3300030760 Bacteria 1385
684 Ga0265762_1015712 3300030760 Bacteria 1370
685 Ga0265763_1010057 3300030763 Bacteria 868
686 Ga0265766_1000373 3300030863 Bacteria 1881
687 Ga0265777_101167 3300030877 Bacteria 1368
688 Ga0265777_101745 3300030877 Unclassified 1199
689 Ga0265765_1012638 3300030879 Bacteria 959
690 Ga0265760_10000694 3300031090 Bacteria 9605
691 Ga0265760_10011555 3300031090 Bacteria 2522
692 Ga0265760_10016330 3300031090 Bacteria 2130
693 Ga0265760_10017826 3300031090 Bacteria 2040
694 Ga0265760_10035955 3300031090 Bacteria 1468
695 Ga0265328_10008639 3300031239 Bacteria 4190
696 Ga0265320_10169513 3300031240 Unclassified 981
697 Ga0265325_10003007 3300031241 Bacteria 11190
698 Ga0265325_10047694 3300031241 Bacteria 2216
699 Ga0265325_10088259 3300031241 Bacteria 1532
700 Ga0265340_10005004 3300031247 Bacteria 7367
701 Ga0265331_10012160 3300031250 Bacteria 4675
702 Ga0265327_10051700 3300031251 Bacteria 2143
703 Ga0265316_10024062 3300031344 Bacteria 5113
704 Ga0265316_10070945 3300031344 Bacteria 2686
705 Ga0265313_10002540 3300031595 Bacteria 15638
706 Ga0265313_10037261 3300031595 Bacteria 2434
707 Ga0265314_10015736 3300031711 Bacteria 5993
708 Ga0265342_10031116 3300031712 Bacteria 3302
709 Ga0307405_10000473 3300031731 Bacteria 15091
710 Ga0307410_10314420 3300031852 Bacteria 1240
711 Ga0307407_10009603 3300031903 Bacteria 4515
712 Ga0307414_10266029 3300032004 Bacteria 1433
713 Ga0307411_10072579 3300032005 Bacteria 2337
714 Ga0316053_100082 3300032120 Bacteria 3043
715 Ga0316588_1016936 3300033528 Bacteria 1620
716 Ga0316214_1000473 3300033545 Bacteria 4092
717 Ga0373926_0003574 3300035083 Bacteria 5040
718 Ga0373926_0088992 3300035083 Bacteria 1147
719 Ga0373926_0089301 3300035083 Bacteria 1145
720 Ga0373934_0087673 3300035086 Bacteria 1253
721 Ga0373934_0126980 3300035086 Bacteria 1039
722 Ga0373923_0021599 3300035111 Bacteria 2514
723 Ga0373936_0012061 3300035113 Bacteria 3282
724 Ga0373936_0023335 3300035113 Bacteria 2411
725 Ga0373953_0121023 3300035117 Bacteria 1112
726 Ga0373954_0150956 3300035118 Bacteria 1135
727 Ga0373943_0000594 3300035170 Bacteria 15714
728 Ga0373943_0196682 3300035170 Bacteria 1114
729 Ga0373946_0011730 3300035171 Bacteria 3276
730 Ga0373946_0032109 3300035171 Bacteria 2107
731 Ga0373946_0055918 3300035171 Bacteria 1665
732 Ga0373955_0097240 3300035172 Bacteria 1686
733 Ga0373955_0111755 3300035172 Bacteria 1580
734 Ga0373955_0128990 3300035172 Bacteria 1475
735 Ga0373942_0099938 3300035207 Unclassified 885
736 Ga0373962_0018042 3300035242 Bacteria 1833
737 Ga0373924_0037264 3300035410 Bacteria 1979
738 Ga0373931_0127825 3300035691 Bacteria 1459
739 Ga0373931_0177118 3300035691 Bacteria 1260
740 Ga0373931_0277239 3300035691 Bacteria 1028
741 Ga0373935_0001675 3300035692 Bacteria 12390
742 Ga0373935_0008518 3300035692 Bacteria 6138
743 Ga0373935_0044338 3300035692 Bacteria 2802
744 Ga0373927_0000747 3300035695 Bacteria 24845
745 Ga0373927_0272728 3300035695 Bacteria 1112
746 Ga0373933_0090555 3300035724 Bacteria 1887
747 Ga0373947_0000971 3300035725 Bacteria 17501
748 Ga0373947_0001211 3300035725 Bacteria 15877
749 Ga0373937_0021575 3300036401 Bacteria 5779
750 Ga0373937_0040661 3300036401 Bacteria 4239
751 Ga0373937_0054915 3300036401 Bacteria 3656
752 Ga0373937_0179904 3300036401 Bacteria 1985
753 Ga0373937_0240705 3300036401 Bacteria 1705
754 Ga0373937_0979633 3300036401 Bacteria 794
755 Ga0373925_0039256 3300037068 Bacteria 3502
756 Ga0373925_0174457 3300037068 Unclassified 1698
757 Ga0373925_0175752 3300037068 Bacteria 1692
758 Ga0395900_0698613 3300037418 Bacteria 948
759 Ga0395898_0020412 3300037466 Bacteria 6728
760 Ga0395905_0659058 3300037471 Bacteria 949
761 Ga0436365_1839081 3300039437 Bacteria 1058
762 Ga0436363_1122218 3300039450 Bacteria 4045
763 Ga0451853_3230832 3300041512 Bacteria 1220
764 Ga0451577_0082373 3300042876 Bacteria 2870
765 Ga0466966_0115682 3300044684 Bacteria 1651
766 Ga0466966_0143822 3300044684 Bacteria 1456
767 Ga0466963_0000986 3300044694 Bacteria 14660
768 Ga0466963_0002381 3300044694 Bacteria 10510
769 Ga0466964_0028661 3300044706 Bacteria 2195
770 Ga0466964_0048034 3300044706 Bacteria 1744
771 Ga0466970_0122543 3300044765 Bacteria 1425
772 Ga0466957_0000324 3300044842 Bacteria 23180
773 Ga0466959_0011621 3300045049 Bacteria 6329
774 Ga0451576_0004157 3300045051 Bacteria 19055
775 Ga0451576_0092322 3300045051 Bacteria 3149
776 Ga0451576_0346190 3300045051 Bacteria 1556
777 Ga0451576_0405387 3300045051 Bacteria 1430
778 Ga0451576_0437311 3300045051 Bacteria 1373
779 Ga0466958_0016862 3300045836 Bacteria 4215
780 Ga0466958_0034939 3300045836 Bacteria 3001
781 Ga0466967_0017072 3300045976 Bacteria 5747
782 Ga0466967_0041428 3300045976 Bacteria 3970
783 Ga0466967_0110685 3300045976 Bacteria 2523
784 Ga0466967_0170640 3300045976 Bacteria 2046
785 Ga0495629_0053519 3300046459 Bacteria 2824
786 Ga0495629_0288172 3300046459 Bacteria 1126
787 Ga0495651_0022857 3300046462 Bacteria 4862
788 Ga0495651_0165050 3300046462 Bacteria 1583
789 Ga0495580_0001673 3300046472 Bacteria 19470
790 Ga0495580_0001845 3300046472 Bacteria 18638
791 Ga0495580_0005545 3300046472 Bacteria 10406
792 Ga0495580_0016664 3300046472 Bacteria 5514
793 Ga0495580_0018154 3300046472 Bacteria 5242
794 Ga0495580_0118241 3300046472 Bacteria 1840
795 Ga0495580_0133362 3300046472 Bacteria 1722
796 Ga0495580_0181217 3300046472 Bacteria 1455
797 Ga0495580_0361148 3300046472 Bacteria 983
798 Ga0495582_0000596 3300046473 Bacteria 19949
799 Ga0495582_0082239 3300046473 Bacteria 1789
800 Ga0495582_0107609 3300046473 Bacteria 1565
801 Ga0495662_0272273 3300046476 Bacteria 833
802 Ga0495628_0102363 3300046516 Bacteria 2210
803 Ga0495666_0021051 3300046526 Bacteria 3229
804 Ga0495666_0092719 3300046526 Bacteria 1425
805 Ga0495665_0000974 3300046531 Bacteria 15176
806 Ga0495665_0131102 3300046531 Bacteria 1312
807 Ga0495621_0021241 3300046539 Bacteria 2139
808 Ga0495621_0043593 3300046539 Bacteria 1583
809 Ga0495657_0223755 3300046675 Bacteria 1140
810 Ga0495658_0049778 3300046683 Bacteria 2368
811 Ga0495658_0057450 3300046683 Bacteria 2223
812 Ga0495658_0096862 3300046683 Bacteria 1755
813 Ga0495669_0000669 3300046684 Bacteria 14899
814 Ga0495624_0182823 3300046690 Bacteria 1277
815 Ga0495581_0167444 3300047315 Bacteria 1285
816 Ga0495674_0013768 3300047319 Bacteria 7593
817 Ga0495674_0046446 3300047319 Bacteria 3854
818 Ga0495675_0085365 3300047444 Bacteria 1985
819 Ga0495684_0133954 3300047471 Bacteria 1860
820 Ga0495602_0078631 3300048088 Bacteria 2786
821 Ga0495602_0285483 3300048088 Bacteria 1214
822 Ga0496100_0104235 3300048903 Bacteria 1959
823 Ga0496100_0250095 3300048903 Bacteria 1311
824 Ga0496101_0086194 3300048904 Bacteria 2329
825 Ga0496101_0242897 3300048904 Bacteria 1402
826 Ga0496101_0773977 3300048904 Bacteria 757
827 Ga0496102_0003212 3300048905 Bacteria 13867
828 Ga0496102_0016554 3300048905 Bacteria 6444
829 Ga0496102_0034032 3300048905 Bacteria 4582
830 Ga0496102_0238756 3300048905 Bacteria 1714
831 Ga0496102_0283500 3300048905 Unclassified 1561
832 Ga0496103_0002380 3300048906 Bacteria 11861
833 Ga0496103_0039142 3300048906 Bacteria 2913
834 Ga0496104_0025955 3300048907 Bacteria 5403
835 Ga0496104_0220731 3300048907 Bacteria 1808
836 Ga0496104_0288112 3300048907 Bacteria 1555
837 Ga0496104_0923870 3300048907 Bacteria 777
838 Ga0496105_0307859 3300048908 Bacteria 1272
839 Ga0496106_0063431 3300048909 Bacteria 2808
840 Ga0496106_0307045 3300048909 Bacteria 1273
841 Ga0496106_0322373 3300048909 Bacteria 1240
842 Ga0496107_0078051 3300048910 Bacteria 2412
843 Ga0496107_0284470 3300048910 Unclassified 1231
844 Ga0496108_0022698 3300048911 Bacteria 5162
845 Ga0496109_0038156 3300048912 Bacteria 4342
846 Ga0496109_0189690 3300048912 Bacteria 1931
847 Ga0496110_0702414 3300048913 Bacteria 913
848 Ga0496111_0057018 3300048914 Bacteria 2828
849 Ga0496112_0027473 3300048915 Bacteria 5486
850 Ga0496112_0038846 3300048915 Bacteria 4650
851 Ga0496112_0047142 3300048915 Bacteria 4227
852 Ga0496112_0057520 3300048915 Bacteria 3828
853 Ga0496112_0079924 3300048915 Bacteria 3234
854 Ga0496112_0162779 3300048915 Bacteria 2197
855 Ga0496112_0172754 3300048915 Bacteria 2126
856 Ga0496112_0191638 3300048915 Bacteria 2006
857 Ga0496112_0445977 3300048915 Bacteria 1232
858 Ga0496113_0009232 3300048916 Bacteria 6470
859 Ga0496113_0027888 3300048916 Bacteria 4054
860 Ga0496114_0060383 3300048917 Bacteria 3169
861 Ga0496115_0004694 3300048918 Bacteria 9905
862 Ga0496115_0084254 3300048918 Bacteria 2592
863 Ga0496115_0087626 3300048918 Bacteria 2540
864 Ga0496115_0106988 3300048918 Bacteria 2296
865 Ga0496115_0145780 3300048918 Bacteria 1954
866 Ga0496115_0374922 3300048918 Bacteria 1158
867 Ga0501290_000006 3300049513 Bacteria 41465
868 Ga0501292_000272 3300049515 Bacteria 7407
869 Ga0501294_000481 3300049517 Bacteria 4674
870 Ga0501295_000073 3300049518 Bacteria 10094
871 Ga0501296_000045 3300049519 Bacteria 13836
872 Ga0501297_000036 3300049520 Bacteria 13632
873 Ga0501300_000028 3300049523 Bacteria 22326
874 Ga0501301_000136 3300049524 Bacteria 3898
875 Ga0501302_000637 3300049525 Bacteria 1866
876 Ga0501032_0247775 3300049569 Bacteria 1157
877 Ga0501038_0399170 3300049574 Bacteria 1064
878 Ga0501198_001028 3300049649 Bacteria 3555
879 Ga0501199_000973 3300049650 Bacteria 2566
880 Ga0501201_000064 3300049651 Bacteria 7641
881 Ga0501206_001081 3300049653 Bacteria 3390
882 Ga0501217_000887 3300049661 Bacteria 5327
883 Ga0501223_004773 3300049663 Bacteria 2885
884 Ga0501230_000571 3300049667 Bacteria 3836
885 Ga0501235_000120 3300049669 Bacteria 12942
886 Ga0501243_001725 3300049675 Bacteria 3157
887 Ga0501246_000833 3300049676 Bacteria 2293
888 Ga0501247_008278 3300049677 Bacteria 1211
889 Ga0501249_000254 3300049679 Bacteria 15773
890 Ga0501250_002902 3300049680 Bacteria 1597
891 Ga0501256_004473 3300049685 Bacteria 1202
892 Ga0501257_002107 3300049686 Bacteria 4154
893 Ga0501261_000374 3300049690 Bacteria 5979
894 Ga0501219_000556 3300049703 Bacteria 5469
895 Ga0501221_000274 3300049704 Bacteria 7642
896 Ga0501225_0000149 3300049705 Bacteria 21494
897 Ga0501229_007354 3300049706 Bacteria 1371
898 Ga0501234_000101 3300049707 Bacteria 10829
899 Ga0501245_000270 3300049708 Bacteria 6007
900 Ga0501232_007194 3300049757 Bacteria 1167
901 Ga0501241_020006 3300049758 Bacteria 1230
902 Ga0501265_003862 3300049762 Bacteria 1701
903 Ga0501266_008158 3300049763 Bacteria 1318
904 Ga0501270_000039 3300049767 Bacteria 9661
905 Ga0501271_000251 3300049768 Bacteria 4528
906 Ga0501272_000266 3300049769 Bacteria 4402
907 Ga0501274_001107 3300049771 Bacteria 2026
908 Ga0501276_000854 3300049773 Bacteria 1954
909 Ga0501278_000069 3300049774 Bacteria 7005
910 Ga0501279_000228 3300049775 Bacteria 7775
911 Ga0501280_005247 3300049776 Bacteria 1860
912 Ga0501281_01370 3300049777 Bacteria 1928
913 Ga0501045_0260460 3300049824 Bacteria 1291
914 Ga0501226_000270 3300049853 Bacteria 7831
915 nmdc:mga0yw44_25889_c1 3300050492 Bacteria 3344
916 nmdc:mga05p37_300092_c1 3300050507 Bacteria 1909
917 nmdc:mga05p37_4432_c1 3300050507 Bacteria 16406
918 nmdc:mga09592_283859_c1 3300050508 Bacteria 1436
919 nmdc:mga09592_4132_c1 3300050508 Bacteria 11727
920 nmdc:mga0qj67_19376_c1 3300050509 Bacteria 5198
921 nmdc:mga0qj67_53356_c1 3300050509 Bacteria 3201
922 nmdc:mga0n895_21442_c1 3300050512 Bacteria 6042
923 nmdc:mga0n895_26592_c1 3300050512 Bacteria 5483
924 nmdc:mga0n895_344_c1 3300050512 Bacteria 31117
925 nmdc:mga0n895_451715_c1 3300050512 Bacteria 1297
926 nmdc:mga0rr50_350648_c1 3300050513 Bacteria 1241
927 nmdc:mga0rr50_37321_c1 3300050513 Bacteria 3507
928 nmdc:mga0rr50_872_c1 3300050513 Bacteria 16295
929 nmdc:mga08x19_3391_c1 3300050514 Bacteria 9503
930 nmdc:mga08x19_3614_c1 3300050514 Bacteria 9212
931 nmdc:mga08x19_444446_c1 3300050514 Bacteria 912
932 nmdc:mga08x19_9637_c1 3300050514 Bacteria 5785
933 nmdc:mga0a205_247203_c1 3300050515 Bacteria 1664
934 nmdc:mga0a205_7367_c1 3300050515 Bacteria 9965
935 Ga0495601_0023927 3300053077 Bacteria 3757
936 Ga0495601_0427759 3300053077 Bacteria 857
937 Ga0495612_0085918 3300053078 Bacteria 1326
938 Ga0587093_001841 3300059478 Bacteria 1873
939 Ga0587066_000041 3300059490 Bacteria 5943
940 Ga0587066_002101 3300059490 Bacteria 2142
941 Ga0587070_000114 3300059491 Bacteria 4759
942 Ga0587073_0004031 3300059492 Bacteria 2070
943 Ga0587073_0007886 3300059492 Bacteria 1703
944 Ga0587073_0034242 3300059492 Bacteria 1069
945 Ga0587077_000059 3300059493 Bacteria 5517
946 Ga0587080_000447 3300059503 Bacteria 3474
947 Ga0587082_000041 3300059504 Bacteria 6191
948 Ga0587083_0000140 3300059505 Bacteria 4785
949 Ga0587085_000049 3300059506 Bacteria 5074
950 Ga0587089_001185 3300059509 Bacteria 2342
951 Ga0587091_000037 3300059511 Bacteria 6401
952 Ga0587092_000359 3300059512 Bacteria 3473
953 Ga0587092_008497 3300059512 Bacteria 1357
954 Ga0587113_000220 3300059625 Bacteria 2674
955 Ga0587128_005905 3300059630 Bacteria 1486
956 Ga0587062_000813 3300059639 Bacteria 2412
957 Ga0587067_000531 3300059640 Bacteria 3405
958 Ga0587075_000131 3300059644 Bacteria 4321
959 Ga0587076_000182 3300059645 Bacteria 4244
960 Ga0587076_007119 3300059645 Bacteria 1516
961 Ga0587078_000985 3300059646 Bacteria 2387
962 Ga0587078_002585 3300059646 Bacteria 1765
963 Ga0587079_000058 3300059647 Bacteria 6141
964 Ga0587060_000766 3300060243 Bacteria 1918
965 Ga0587071_000028 3300060344 Bacteria 7821
966 Ga0587071_015934 3300060344 Bacteria 1324
967 Ga0501082_0875179 3300060353 Bacteria 786

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10034921 Ga0081538_100349212 213
2 3300048909 Ga0496106_0307045 Ga0496106_0307045_12_707 213
3 3300009176 Ga0105242_10021951 Ga0105242_100219518 218
4 3300025923 Ga0207681_10366824 Ga0207681_103668242 218
5 3300050512 nmdc:mga0n895_451715_c1 nmdc:mga0n895_451715_c1_41_703 220
6 3300004799 Ga0058863_10026251 Ga0058863_100262513 226
7 3300004803 Ga0058862_10141803 Ga0058862_101418035 226
8 3300005329 Ga0070683_100347730 Ga0070683_1003477303 226
9 3300005336 Ga0070680_100039076 Ga0070680_1000390764 226
10 3300005458 Ga0070681_10055173 Ga0070681_100551736 226
11 3300005530 Ga0070679_100022709 Ga0070679_1000227094 226
12 3300005535 Ga0070684_100343658 Ga0070684_1003436582 226
13 3300005577 Ga0068857_100464867 Ga0068857_1004648672 226
14 3300025912 Ga0207707_10109026 Ga0207707_101090262 226
15 3300025917 Ga0207660_10096860 Ga0207660_100968602 226
16 3300025921 Ga0207652_10104357 Ga0207652_101043572 226
17 3300025944 Ga0207661_10139424 Ga0207661_101394244 226
18 3300059490 Ga0587066_002101 Ga0587066_002101_838_1590 226
19 3300060353 Ga0501082_0875179 Ga0501082_0875179_11_703 228
20 3300041512 Ga0451853_3230832 Ga0451853_3230832_455_1201 229
21 iso_pu_bacteria 2551306092 2551736114 230
22 3300005290 Ga0065712_10027462 Ga0065712_100274622 235
23 3300005293 Ga0065715_10023180 Ga0065715_100231803 235
24 3300005328 Ga0070676_10036288 Ga0070676_100362884 235
25 3300005329 Ga0070683_100366021 Ga0070683_1003660212 235
26 3300005329 Ga0070683_100453679 Ga0070683_1004536791 235
27 3300005330 Ga0070690_100046535 Ga0070690_1000465353 235
28 3300005330 Ga0070690_100327958 Ga0070690_1003279581 235
29 3300005331 Ga0070670_100076304 Ga0070670_1000763045 235
30 3300005333 Ga0070677_10008739 Ga0070677_100087395 235
31 3300005334 Ga0068869_100010773 Ga0068869_1000107733 235
32 3300005334 Ga0068869_100298461 Ga0068869_1002984611 235
33 3300005340 Ga0070689_100047225 Ga0070689_1000472253 235
34 3300005340 Ga0070689_100249975 Ga0070689_1002499752 235
35 3300005344 Ga0070661_100357641 Ga0070661_1003576412 235
36 3300005354 Ga0070675_100002788 Ga0070675_10000278811 235
37 3300005354 Ga0070675_100042746 Ga0070675_1000427464 235
38 3300005354 Ga0070675_100090126 Ga0070675_1000901263 235
39 3300005354 Ga0070675_100294260 Ga0070675_1002942603 235
40 3300005355 Ga0070671_100080002 Ga0070671_1000800024 235
41 3300005364 Ga0070673_100067958 Ga0070673_1000679583 235
42 3300005364 Ga0070673_100084232 Ga0070673_1000842323 235
43 3300005367 Ga0070667_100219341 Ga0070667_1002193412 235
44 3300005438 Ga0070701_10030951 Ga0070701_100309512 235
45 3300005441 Ga0070700_100072430 Ga0070700_1000724303 235
46 3300005445 Ga0070708_100006987 Ga0070708_10000698715 235
47 3300005445 Ga0070708_100026039 Ga0070708_1000260394 235
48 3300005456 Ga0070678_100116726 Ga0070678_1001167261 235
49 3300005456 Ga0070678_100351103 Ga0070678_1003511032 235
50 3300005458 Ga0070681_10005952 Ga0070681_100059528 235
51 3300005459 Ga0068867_100006640 Ga0068867_10000664013 235
52 3300005467 Ga0070706_100001389 Ga0070706_10000138925 235
53 3300005468 Ga0070707_100000141 Ga0070707_10000014152 235
54 3300005468 Ga0070707_100013079 Ga0070707_1000130797 235
55 3300005471 Ga0070698_100000139 Ga0070698_10000013948 235
56 3300005471 Ga0070698_100002247 Ga0070698_10000224714 235
57 3300005471 Ga0070698_100046998 Ga0070698_1000469983 235
58 3300005471 Ga0070698_100329736 Ga0070698_1003297361 235
59 3300005518 Ga0070699_100001695 Ga0070699_10000169518 235
60 3300005518 Ga0070699_100093484 Ga0070699_1000934842 235
61 3300005518 Ga0070699_100131330 Ga0070699_1001313303 235
62 3300005518 Ga0070699_100214448 Ga0070699_1002144482 235
63 3300005518 Ga0070699_100272844 Ga0070699_1002728442 235
64 3300005535 Ga0070684_100100706 Ga0070684_1001007062 235
65 3300005536 Ga0070697_100000181 Ga0070697_10000018133 235
66 3300005536 Ga0070697_100097515 Ga0070697_1000975153 235
67 3300005536 Ga0070697_100591626 Ga0070697_1005916262 235
68 3300005543 Ga0070672_100082364 Ga0070672_1000823644 235
69 3300005544 Ga0070686_100010421 Ga0070686_1000104215 235
70 3300005549 Ga0070704_100031956 Ga0070704_1000319564 235
71 3300005564 Ga0070664_100001536 Ga0070664_10000153614 235
72 3300005617 Ga0068859_100822611 Ga0068859_1008226111 235
73 3300005618 Ga0068864_100186541 Ga0068864_1001865412 235
74 3300005618 Ga0068864_100357383 Ga0068864_1003573832 235
75 3300005719 Ga0068861_100084611 Ga0068861_1000846113 235
76 3300005834 Ga0068851_10021382 Ga0068851_100213823 235
77 3300005840 Ga0068870_10064860 Ga0068870_100648602 235
78 3300005840 Ga0068870_10163463 Ga0068870_101634632 235
79 3300005843 Ga0068860_100390052 Ga0068860_1003900522 235
80 3300005844 Ga0068862_100259774 Ga0068862_1002597742 235
81 3300006028 Ga0070717_10155162 Ga0070717_101551623 235
82 3300006178 Ga0075367_10076806 Ga0075367_100768062 235
83 3300006358 Ga0068871_100020698 Ga0068871_1000206985 235
84 3300006358 Ga0068871_100068684 Ga0068871_1000686843 235
85 3300006844 Ga0075428_100034853 Ga0075428_1000348532 235
86 3300006846 Ga0075430_100001931 Ga0075430_10000193110 235
87 3300006847 Ga0075431_100112052 Ga0075431_1001120523 235
88 3300006880 Ga0075429_100001796 Ga0075429_1000017967 235
89 3300006881 Ga0068865_100219752 Ga0068865_1002197522 235
90 3300006914 Ga0075436_100258144 Ga0075436_1002581442 235
91 3300006931 Ga0097620_100822568 Ga0097620_1008225681 235
92 3300007076 Ga0075435_100547357 Ga0075435_1005473572 235
93 3300009094 Ga0111539_10302448 Ga0111539_103024482 235
94 3300009176 Ga0105242_10025185 Ga0105242_100251853 235
95 3300009176 Ga0105242_10732535 Ga0105242_107325352 235
96 3300013296 Ga0157374_10367777 Ga0157374_103677772 235
97 3300014325 Ga0163163_10150827 Ga0163163_101508272 235
98 3300014326 Ga0157380_10226030 Ga0157380_102260302 235
99 3300014969 Ga0157376_10008421 Ga0157376_100084217 235
100 3300017792 Ga0163161_10327237 Ga0163161_103272373 235
101 3300025321 Ga0207656_10005274 Ga0207656_100052744 235
102 3300025893 Ga0207682_10076728 Ga0207682_100767282 235
103 3300025907 Ga0207645_10035810 Ga0207645_100358103 235
104 3300025908 Ga0207643_10148556 Ga0207643_101485563 235
105 3300025910 Ga0207684_10000188 Ga0207684_1000018853 235
106 3300025910 Ga0207684_10001851 Ga0207684_1000185125 235
107 3300025910 Ga0207684_10194029 Ga0207684_101940292 235
108 3300025910 Ga0207684_10278928 Ga0207684_102789281 235
109 3300025922 Ga0207646_10000238 Ga0207646_1000023826 235
110 3300025922 Ga0207646_10000258 Ga0207646_1000025856 235
111 3300025922 Ga0207646_10206047 Ga0207646_102060473 235
112 3300025922 Ga0207646_10333690 Ga0207646_103336902 235
113 3300025923 Ga0207681_10048860 Ga0207681_100488603 235
114 3300025923 Ga0207681_10114519 Ga0207681_101145192 235
115 3300025923 Ga0207681_10181869 Ga0207681_101818691 235
116 3300025924 Ga0207694_10019318 Ga0207694_100193188 235
117 3300025925 Ga0207650_10014338 Ga0207650_100143383 235
118 3300025925 Ga0207650_10725017 Ga0207650_107250172 235
119 3300025926 Ga0207659_10003579 Ga0207659_1000357918 235
120 3300025926 Ga0207659_10007868 Ga0207659_1000786811 235
121 3300025926 Ga0207659_10114968 Ga0207659_101149683 235
122 3300025926 Ga0207659_10243802 Ga0207659_102438022 235
123 3300025931 Ga0207644_10010037 Ga0207644_100100373 235
124 3300025931 Ga0207644_10063127 Ga0207644_100631274 235
125 3300025934 Ga0207686_10020935 Ga0207686_100209354 235
126 3300025934 Ga0207686_10030480 Ga0207686_100304803 235
127 3300025935 Ga0207709_10011617 Ga0207709_100116173 235
128 3300025936 Ga0207670_10042709 Ga0207670_100427094 235
129 3300025939 Ga0207665_10020276 Ga0207665_100202765 235
130 3300025940 Ga0207691_10067123 Ga0207691_100671233 235
131 3300025942 Ga0207689_10007360 Ga0207689_1000736016 235
132 3300025944 Ga0207661_10110732 Ga0207661_101107322 235
133 3300025960 Ga0207651_10073059 Ga0207651_100730595 235
134 3300025960 Ga0207651_10091307 Ga0207651_100913073 235
135 3300026035 Ga0207703_10051358 Ga0207703_100513584 235
136 3300026075 Ga0207708_10039059 Ga0207708_100390596 235
137 3300026089 Ga0207648_10001325 Ga0207648_1000132521 235
138 3300026095 Ga0207676_10087662 Ga0207676_100876624 235
139 3300026095 Ga0207676_10236285 Ga0207676_102362852 235
140 3300026121 Ga0207683_10062607 Ga0207683_100626075 235
141 3300026121 Ga0207683_10249749 Ga0207683_102497492 235
142 3300027543 Ga0209999_1030202 Ga0209999_10302021 235
143 3300027665 Ga0209983_1000426 Ga0209983_100042618 235
144 3300027682 Ga0209971_1020867 Ga0209971_10208672 235
145 3300027876 Ga0209974_10000500 Ga0209974_100005003 235
146 3300028381 Ga0268264_10028638 Ga0268264_100286383 235
147 3300031731 Ga0307405_10000473 Ga0307405_1000047324 235
148 3300031852 Ga0307410_10314420 Ga0307410_103144202 235
149 3300031903 Ga0307407_10009603 Ga0307407_100096034 235
150 3300032004 Ga0307414_10266029 Ga0307414_102660292 235
151 3300032005 Ga0307411_10072579 Ga0307411_100725794 235
152 3300033528 Ga0316588_1016936 Ga0316588_10169363 235
153 3300035691 Ga0373931_0177118 Ga0373931_0177118_194_943 235
154 3300044694 Ga0466963_0002381 Ga0466963_0002381_8661_9407 235
155 3300045051 Ga0451576_0004157 Ga0451576_0004157_13376_14125 235
156 3300045976 Ga0466967_0017072 Ga0466967_0017072_1948_2694 235
157 3300046539 Ga0495621_0021241 Ga0495621_0021241_719_1498 235
158 3300046539 Ga0495621_0043593 Ga0495621_0043593_418_1215 235
159 3300048905 Ga0496102_0034032 Ga0496102_0034032_3531_4286 235
160 3300048915 Ga0496112_0162779 Ga0496112_0162779_161_937 235
161 3300048918 Ga0496115_0106988 Ga0496115_0106988_1088_1843 235
162 3300049513 Ga0501290_000006 Ga0501290_000006_3319_4068 235
163 3300049515 Ga0501292_000272 Ga0501292_000272_5915_6664 235
164 3300049517 Ga0501294_000481 Ga0501294_000481_157_906 235
165 3300049518 Ga0501295_000073 Ga0501295_000073_2400_3149 235
166 3300049519 Ga0501296_000045 Ga0501296_000045_9633_10382 235
167 3300049520 Ga0501297_000036 Ga0501297_000036_10656_11405 235
168 3300049523 Ga0501300_000028 Ga0501300_000028_11680_12429 235
169 3300049524 Ga0501301_000136 Ga0501301_000136_965_1714 235
170 3300049525 Ga0501302_000637 Ga0501302_000637_340_1089 235
171 3300049569 Ga0501032_0247775 Ga0501032_0247775_242_1012 235
172 3300049574 Ga0501038_0399170 Ga0501038_0399170_43_801 235
173 3300049649 Ga0501198_001028 Ga0501198_001028_1756_2505 235
174 3300049650 Ga0501199_000973 Ga0501199_000973_1663_2412 235
175 3300049651 Ga0501201_000064 Ga0501201_000064_4526_5275 235
176 3300049653 Ga0501206_001081 Ga0501206_001081_887_1636 235
177 3300049661 Ga0501217_000887 Ga0501217_000887_1221_1970 235
178 3300049663 Ga0501223_004773 Ga0501223_004773_366_1115 235
179 3300049667 Ga0501230_000571 Ga0501230_000571_1173_1922 235
180 3300049669 Ga0501235_000120 Ga0501235_000120_12216_12929 235
181 3300049675 Ga0501243_001725 Ga0501243_001725_374_1123 235
182 3300049676 Ga0501246_000833 Ga0501246_000833_1282_2031 235
183 3300049677 Ga0501247_008278 Ga0501247_008278_86_835 235
184 3300049679 Ga0501249_000254 Ga0501249_000254_8869_9618 235
185 3300049680 Ga0501250_002902 Ga0501250_002902_804_1553 235
186 3300049685 Ga0501256_004473 Ga0501256_004473_245_994 235
187 3300049686 Ga0501257_002107 Ga0501257_002107_2424_3173 235
188 3300049690 Ga0501261_000374 Ga0501261_000374_5256_5969 235
189 3300049703 Ga0501219_000556 Ga0501219_000556_3481_4230 235
190 3300049704 Ga0501221_000274 Ga0501221_000274_6453_7202 235
191 3300049705 Ga0501225_0000149 Ga0501225_0000149_112_861 235
192 3300049706 Ga0501229_007354 Ga0501229_007354_362_1111 235
193 3300049707 Ga0501234_000101 Ga0501234_000101_6067_6816 235
194 3300049708 Ga0501245_000270 Ga0501245_000270_2943_3692 235
195 3300049757 Ga0501232_007194 Ga0501232_007194_395_1144 235
196 3300049758 Ga0501241_020006 Ga0501241_020006_415_1164 235
197 3300049762 Ga0501265_003862 Ga0501265_003862_737_1486 235
198 3300049763 Ga0501266_008158 Ga0501266_008158_361_1110 235
199 3300049767 Ga0501270_000039 Ga0501270_000039_6038_6787 235
200 3300049768 Ga0501271_000251 Ga0501271_000251_2386_3135 235
201 3300049769 Ga0501272_000266 Ga0501272_000266_2745_3494 235
202 3300049771 Ga0501274_001107 Ga0501274_001107_328_1077 235
203 3300049773 Ga0501276_000854 Ga0501276_000854_853_1602 235
204 3300049774 Ga0501278_000069 Ga0501278_000069_3021_3770 235
205 3300049775 Ga0501279_000228 Ga0501279_000228_5803_6552 235
206 3300049776 Ga0501280_005247 Ga0501280_005247_1099_1848 235
207 3300049777 Ga0501281_01370 Ga0501281_01370_685_1434 235
208 3300049824 Ga0501045_0260460 Ga0501045_0260460_278_1027 235
209 3300049853 Ga0501226_000270 Ga0501226_000270_1134_1883 235
210 3300050492 nmdc:mga0yw44_25889_c1 nmdc:mga0yw44_25889_c1_1098_1853 235
211 3300050507 nmdc:mga05p37_4432_c1 nmdc:mga05p37_4432_c1_4475_5248 235
212 3300050508 nmdc:mga09592_283859_c1 nmdc:mga09592_283859_c1_316_1089 235
213 3300050508 nmdc:mga09592_4132_c1 nmdc:mga09592_4132_c1_2670_3419 235
214 3300050509 nmdc:mga0qj67_19376_c1 nmdc:mga0qj67_19376_c1_4103_4852 235
215 3300050509 nmdc:mga0qj67_53356_c1 nmdc:mga0qj67_53356_c1_1033_1806 235
216 3300050514 nmdc:mga08x19_444446_c1 nmdc:mga08x19_444446_c1_12_758 235
217 3300050515 nmdc:mga0a205_247203_c1 nmdc:mga0a205_247203_c1_52_816 235
218 3300005467 Ga0070706_100033341 Ga0070706_1000333413 236
219 3300005468 Ga0070707_100044794 Ga0070707_1000447943 236
220 3300005518 Ga0070699_100240066 Ga0070699_1002400662 236
221 3300006028 Ga0070717_10483169 Ga0070717_104831692 236
222 3300010159 Ga0099796_10025283 Ga0099796_100252832 236
223 3300025922 Ga0207646_10017066 Ga0207646_100170666 236
224 3300000546 LJNas_1000185 LJNas_10001855 237
225 3300003320 rootH2_10094920 rootH2_100949202 237
226 3300003323 rootH1_10245303 rootH1_102453032 237
227 3300004799 Ga0058863_10007402 Ga0058863_100074022 237
228 3300004799 Ga0058863_10107058 Ga0058863_101070583 237
229 3300004800 Ga0058861_10061883 Ga0058861_100618833 237
230 3300004800 Ga0058861_10190128 Ga0058861_101901283 237
231 3300004800 Ga0058861_11824691 Ga0058861_118246912 237
232 3300004801 Ga0058860_12198664 Ga0058860_121986643 237
233 3300004803 Ga0058862_10144175 Ga0058862_101441753 237
234 3300004803 Ga0058862_10197740 Ga0058862_101977401 237
235 3300004803 Ga0058862_10250586 Ga0058862_102505862 237
236 3300005328 Ga0070676_10004776 Ga0070676_100047769 237
237 3300005329 Ga0070683_100099993 Ga0070683_1000999933 237
238 3300005329 Ga0070683_100114311 Ga0070683_1001143116 237
239 3300005329 Ga0070683_100122721 Ga0070683_1001227212 237
240 3300005329 Ga0070683_100186830 Ga0070683_1001868303 237
241 3300005330 Ga0070690_100032721 Ga0070690_1000327214 237
242 3300005333 Ga0070677_10071319 Ga0070677_100713192 237
243 3300005334 Ga0068869_100001846 Ga0068869_1000018468 237
244 3300005334 Ga0068869_100027435 Ga0068869_1000274355 237
245 3300005335 Ga0070666_10014850 Ga0070666_100148506 237
246 3300005336 Ga0070680_100016919 Ga0070680_1000169199 237
247 3300005336 Ga0070680_100107636 Ga0070680_1001076363 237
248 3300005336 Ga0070680_100250794 Ga0070680_1002507942 237
249 3300005336 Ga0070680_100638141 Ga0070680_1006381411 237
250 3300005338 Ga0068868_100006530 Ga0068868_1000065308 237
251 3300005338 Ga0068868_100071322 Ga0068868_1000713225 237
252 3300005339 Ga0070660_100062076 Ga0070660_1000620763 237
253 3300005344 Ga0070661_100047556 Ga0070661_1000475563 237
254 3300005344 Ga0070661_100107749 Ga0070661_1001077492 237
255 3300005347 Ga0070668_100032434 Ga0070668_1000324344 237
256 3300005353 Ga0070669_100098899 Ga0070669_1000988992 237
257 3300005354 Ga0070675_100280787 Ga0070675_1002807872 237
258 3300005355 Ga0070671_100043889 Ga0070671_1000438893 237
259 3300005365 Ga0070688_100304949 Ga0070688_1003049492 237
260 3300005406 Ga0070703_10098924 Ga0070703_100989241 237
261 3300005434 Ga0070709_10000423 Ga0070709_100004232 237
262 3300005434 Ga0070709_10036190 Ga0070709_100361903 237
263 3300005434 Ga0070709_10040857 Ga0070709_100408572 237
264 3300005434 Ga0070709_10466381 Ga0070709_104663811 237
265 3300005435 Ga0070714_100014828 Ga0070714_10001482810 237
266 3300005435 Ga0070714_100021848 Ga0070714_1000218488 237
267 3300005435 Ga0070714_100029336 Ga0070714_1000293361 237
268 3300005435 Ga0070714_100195392 Ga0070714_1001953922 237
269 3300005435 Ga0070714_100338627 Ga0070714_1003386272 237
270 3300005436 Ga0070713_100000364 Ga0070713_10000036422 237
271 3300005436 Ga0070713_100002249 Ga0070713_1000022494 237
272 3300005436 Ga0070713_100005638 Ga0070713_1000056389 237
273 3300005436 Ga0070713_100091363 Ga0070713_1000913634 237
274 3300005436 Ga0070713_100098986 Ga0070713_1000989863 237
275 3300005436 Ga0070713_100133438 Ga0070713_1001334382 237
276 3300005436 Ga0070713_100134671 Ga0070713_1001346713 237
277 3300005436 Ga0070713_100252898 Ga0070713_1002528982 237
278 3300005436 Ga0070713_100309223 Ga0070713_1003092233 237
279 3300005436 Ga0070713_100368642 Ga0070713_1003686422 237
280 3300005436 Ga0070713_100464439 Ga0070713_1004644391 237
281 3300005437 Ga0070710_10023917 Ga0070710_100239173 237
282 3300005437 Ga0070710_10031205 Ga0070710_100312052 237
283 3300005437 Ga0070710_10031408 Ga0070710_100314084 237
284 3300005439 Ga0070711_100000191 Ga0070711_10000019119 237
285 3300005439 Ga0070711_100063203 Ga0070711_1000632033 237
286 3300005439 Ga0070711_100092324 Ga0070711_1000923242 237
287 3300005439 Ga0070711_100113461 Ga0070711_1001134611 237
288 3300005439 Ga0070711_100252627 Ga0070711_1002526272 237
289 3300005440 Ga0070705_100068395 Ga0070705_1000683951 237
290 3300005445 Ga0070708_100000356 Ga0070708_10000035624 237
291 3300005445 Ga0070708_100000459 Ga0070708_10000045933 237
292 3300005445 Ga0070708_100005339 Ga0070708_1000053398 237
293 3300005445 Ga0070708_100054805 Ga0070708_1000548057 237
294 3300005445 Ga0070708_100480428 Ga0070708_1004804282 237
295 3300005456 Ga0070678_100036448 Ga0070678_1000364484 237
296 3300005456 Ga0070678_100201334 Ga0070678_1002013341 237
297 3300005457 Ga0070662_100054645 Ga0070662_1000546452 237
298 3300005458 Ga0070681_10008803 Ga0070681_100088037 237
299 3300005458 Ga0070681_10054241 Ga0070681_100542413 237
300 3300005458 Ga0070681_10068582 Ga0070681_100685823 237
301 3300005458 Ga0070681_10077768 Ga0070681_100777685 237
302 3300005458 Ga0070681_10078202 Ga0070681_100782025 237
303 3300005458 Ga0070681_10162187 Ga0070681_101621872 237
304 3300005458 Ga0070681_10312591 Ga0070681_103125912 237
305 3300005458 Ga0070681_10612305 Ga0070681_106123051 237
306 3300005459 Ga0068867_100033809 Ga0068867_1000338092 237
307 3300005459 Ga0068867_100473323 Ga0068867_1004733232 237
308 3300005467 Ga0070706_100000278 Ga0070706_10000027824 237
309 3300005467 Ga0070706_100000514 Ga0070706_10000051424 237
310 3300005467 Ga0070706_100109917 Ga0070706_1001099172 237
311 3300005467 Ga0070706_100169474 Ga0070706_1001694743 237
312 3300005467 Ga0070706_100660911 Ga0070706_1006609111 237
313 3300005468 Ga0070707_100000662 Ga0070707_10000066216 237
314 3300005468 Ga0070707_100025509 Ga0070707_1000255099 237
315 3300005468 Ga0070707_100036339 Ga0070707_1000363395 237
316 3300005468 Ga0070707_100061516 Ga0070707_1000615162 237
317 3300005468 Ga0070707_100066623 Ga0070707_1000666232 237
318 3300005468 Ga0070707_100301057 Ga0070707_1003010572 237
319 3300005471 Ga0070698_100002449 Ga0070698_10000244925 237
320 3300005471 Ga0070698_100004533 Ga0070698_10000453311 237
321 3300005471 Ga0070698_100131141 Ga0070698_1001311413 237
322 3300005471 Ga0070698_100215092 Ga0070698_1002150922 237
323 3300005471 Ga0070698_100303576 Ga0070698_1003035762 237
324 3300005518 Ga0070699_100000441 Ga0070699_10000044120 237
325 3300005518 Ga0070699_100001725 Ga0070699_1000017253 237
326 3300005518 Ga0070699_100003886 Ga0070699_10000388612 237
327 3300005518 Ga0070699_100057839 Ga0070699_1000578393 237
328 3300005530 Ga0070679_100030101 Ga0070679_1000301013 237
329 3300005530 Ga0070679_100046215 Ga0070679_1000462154 237
330 3300005530 Ga0070679_100081564 Ga0070679_1000815644 237
331 3300005530 Ga0070679_100185732 Ga0070679_1001857323 237
332 3300005530 Ga0070679_100355777 Ga0070679_1003557772 237
333 3300005530 Ga0070679_100790781 Ga0070679_1007907811 237
334 3300005535 Ga0070684_100030620 Ga0070684_1000306205 237
335 3300005535 Ga0070684_100052579 Ga0070684_1000525793 237
336 3300005535 Ga0070684_100061067 Ga0070684_1000610672 237
337 3300005535 Ga0070684_100358534 Ga0070684_1003585341 237
338 3300005536 Ga0070697_100000975 Ga0070697_10000097524 237
339 3300005536 Ga0070697_100000993 Ga0070697_10000099311 237
340 3300005536 Ga0070697_100001451 Ga0070697_1000014519 237
341 3300005536 Ga0070697_100003489 Ga0070697_1000034892 237
342 3300005536 Ga0070697_100005121 Ga0070697_1000051214 237
343 3300005536 Ga0070697_100028160 Ga0070697_1000281604 237
344 3300005536 Ga0070697_100063174 Ga0070697_1000631743 237
345 3300005536 Ga0070697_100523131 Ga0070697_1005231311 237
346 3300005536 Ga0070697_100530093 Ga0070697_1005300932 237
347 3300005536 Ga0070697_100547244 Ga0070697_1005472441 237
348 3300005539 Ga0068853_100335268 Ga0068853_1003352682 237
349 3300005544 Ga0070686_100037655 Ga0070686_1000376553 237
350 3300005544 Ga0070686_100332789 Ga0070686_1003327891 237
351 3300005545 Ga0070695_100207484 Ga0070695_1002074842 237
352 3300005546 Ga0070696_100180882 Ga0070696_1001808822 237
353 3300005546 Ga0070696_100192360 Ga0070696_1001923602 237
354 3300005547 Ga0070693_100024724 Ga0070693_1000247243 237
355 3300005547 Ga0070693_100060464 Ga0070693_1000604641 237
356 3300005547 Ga0070693_100061331 Ga0070693_1000613313 237
357 3300005547 Ga0070693_100276161 Ga0070693_1002761612 237
358 3300005548 Ga0070665_100013944 Ga0070665_1000139442 237
359 3300005563 Ga0068855_100086489 Ga0068855_1000864895 237
360 3300005563 Ga0068855_100122881 Ga0068855_1001228816 237
361 3300005563 Ga0068855_100131537 Ga0068855_1001315373 237
362 3300005563 Ga0068855_100131632 Ga0068855_1001316325 237
363 3300005563 Ga0068855_100153885 Ga0068855_1001538853 237
364 3300005564 Ga0070664_100000277 Ga0070664_10000027737 237
365 3300005564 Ga0070664_100056946 Ga0070664_1000569466 237
366 3300005577 Ga0068857_100011854 Ga0068857_1000118549 237
367 3300005577 Ga0068857_100015288 Ga0068857_1000152889 237
368 3300005577 Ga0068857_100087100 Ga0068857_1000871002 237
369 3300005578 Ga0068854_100015875 Ga0068854_1000158755 237
370 3300005578 Ga0068854_100028405 Ga0068854_1000284056 237
371 3300005578 Ga0068854_100151280 Ga0068854_1001512802 237
372 3300005578 Ga0068854_100155176 Ga0068854_1001551762 237
373 3300005614 Ga0068856_100018752 Ga0068856_1000187528 237
374 3300005614 Ga0068856_100036536 Ga0068856_1000365364 237
375 3300005614 Ga0068856_100101196 Ga0068856_1001011966 237
376 3300005614 Ga0068856_100102927 Ga0068856_1001029275 237
377 3300005614 Ga0068856_100241533 Ga0068856_1002415333 237
378 3300005614 Ga0068856_100390222 Ga0068856_1003902222 237
379 3300005614 Ga0068856_100597869 Ga0068856_1005978692 237
380 3300005614 Ga0068856_100621120 Ga0068856_1006211202 237
381 3300005616 Ga0068852_100018750 Ga0068852_1000187503 237
382 3300005616 Ga0068852_100037792 Ga0068852_1000377923 237
383 3300005616 Ga0068852_100077400 Ga0068852_1000774004 237
384 3300005617 Ga0068859_100013371 Ga0068859_10001337111 237
385 3300005617 Ga0068859_100017062 Ga0068859_1000170622 237
386 3300005618 Ga0068864_100012547 Ga0068864_1000125477 237
387 3300005618 Ga0068864_100347854 Ga0068864_1003478542 237
388 3300005834 Ga0068851_10105071 Ga0068851_101050712 237
389 3300005840 Ga0068870_10044634 Ga0068870_100446344 237
390 3300005841 Ga0068863_100044079 Ga0068863_1000440792 237
391 3300005841 Ga0068863_100068631 Ga0068863_1000686313 237
392 3300005841 Ga0068863_100451082 Ga0068863_1004510822 237
393 3300005842 Ga0068858_100020862 Ga0068858_1000208624 237
394 3300005842 Ga0068858_100047535 Ga0068858_1000475352 237
395 3300005843 Ga0068860_100018016 Ga0068860_1000180162 237
396 3300005843 Ga0068860_100025252 Ga0068860_1000252523 237
397 3300005843 Ga0068860_100173182 Ga0068860_1001731822 237
398 3300005843 Ga0068860_100252271 Ga0068860_1002522712 237
399 3300005844 Ga0068862_100116286 Ga0068862_1001162862 237
400 3300005983 Ga0081540_1096199 Ga0081540_10961992 237
401 3300006028 Ga0070717_10002614 Ga0070717_1000261415 237
402 3300006028 Ga0070717_10006374 Ga0070717_100063748 237
403 3300006028 Ga0070717_10006770 Ga0070717_1000677013 237
404 3300006028 Ga0070717_10022846 Ga0070717_100228463 237
405 3300006028 Ga0070717_10024604 Ga0070717_100246044 237
406 3300006028 Ga0070717_10200924 Ga0070717_102009243 237
407 3300006028 Ga0070717_10202099 Ga0070717_102020992 237
408 3300006173 Ga0070716_100005841 Ga0070716_1000058413 237
409 3300006173 Ga0070716_100012088 Ga0070716_1000120886 237
410 3300006173 Ga0070716_100016153 Ga0070716_1000161536 237
411 3300006173 Ga0070716_100023979 Ga0070716_1000239792 237
412 3300006173 Ga0070716_100037411 Ga0070716_1000374112 237
413 3300006173 Ga0070716_100056250 Ga0070716_1000562502 237
414 3300006173 Ga0070716_100471755 Ga0070716_1004717551 237
415 3300006175 Ga0070712_100000593 Ga0070712_10000059325 237
416 3300006175 Ga0070712_100001135 Ga0070712_10000113510 237
417 3300006175 Ga0070712_100003022 Ga0070712_10000302210 237
418 3300006175 Ga0070712_100004622 Ga0070712_1000046228 237
419 3300006175 Ga0070712_100056210 Ga0070712_1000562102 237
420 3300006175 Ga0070712_100118675 Ga0070712_1001186753 237
421 3300006175 Ga0070712_100202118 Ga0070712_1002021182 237
422 3300006237 Ga0097621_100007525 Ga0097621_1000075255 237
423 3300006237 Ga0097621_100013773 Ga0097621_1000137737 237
424 3300006237 Ga0097621_100070515 Ga0097621_1000705152 237
425 3300006237 Ga0097621_100073449 Ga0097621_1000734496 237
426 3300006237 Ga0097621_100157200 Ga0097621_1001572003 237
427 3300006358 Ga0068871_100014064 Ga0068871_1000140644 237
428 3300006358 Ga0068871_100026575 Ga0068871_1000265757 237
429 3300006358 Ga0068871_100071804 Ga0068871_1000718042 237
430 3300006358 Ga0068871_100072335 Ga0068871_1000723356 237
431 3300006358 Ga0068871_100084357 Ga0068871_1000843572 237
432 3300006358 Ga0068871_100159495 Ga0068871_1001594954 237
433 3300006871 Ga0075434_100000230 Ga0075434_10000023024 237
434 3300006871 Ga0075434_100005131 Ga0075434_10000513110 237
435 3300006881 Ga0068865_100006206 Ga0068865_1000062062 237
436 3300006881 Ga0068865_100165105 Ga0068865_1001651052 237
437 3300006914 Ga0075436_100000510 Ga0075436_10000051014 237
438 3300006914 Ga0075436_100012852 Ga0075436_1000128523 237
439 3300006914 Ga0075436_100013001 Ga0075436_1000130014 237
440 3300006914 Ga0075436_100032647 Ga0075436_1000326473 237
441 3300006914 Ga0075436_100040669 Ga0075436_1000406693 237
442 3300006931 Ga0097620_100013371 Ga0097620_10001337111 237
443 3300006931 Ga0097620_100017062 Ga0097620_1000170622 237
444 3300007076 Ga0075435_100000389 Ga0075435_10000038924 237
445 3300007076 Ga0075435_100045994 Ga0075435_1000459943 237
446 3300007076 Ga0075435_100333245 Ga0075435_1003332452 237
447 3300007788 Ga0099795_10007913 Ga0099795_100079134 237
448 3300009093 Ga0105240_10029138 Ga0105240_100291389 237
449 3300009093 Ga0105240_10037261 Ga0105240_100372614 237
450 3300009093 Ga0105240_10066274 Ga0105240_100662744 237
451 3300009093 Ga0105240_10098360 Ga0105240_100983603 237
452 3300009093 Ga0105240_10301875 Ga0105240_103018752 237
453 3300009093 Ga0105240_10351030 Ga0105240_103510301 237
454 3300009093 Ga0105240_10546511 Ga0105240_105465112 237
455 3300009093 Ga0105240_10566055 Ga0105240_105660552 237
456 3300009098 Ga0105245_10005238 Ga0105245_1000523811 237
457 3300009098 Ga0105245_10121450 Ga0105245_101214502 237
458 3300009101 Ga0105247_10019238 Ga0105247_100192384 237
459 3300009101 Ga0105247_10132378 Ga0105247_101323782 237
460 3300009147 Ga0114129_10030197 Ga0114129_100301973 237
461 3300009148 Ga0105243_10017394 Ga0105243_100173943 237
462 3300009174 Ga0105241_10036407 Ga0105241_100364073 237
463 3300009174 Ga0105241_10060464 Ga0105241_100604643 237
464 3300009174 Ga0105241_10243630 Ga0105241_102436302 237
465 3300009174 Ga0105241_10308570 Ga0105241_103085703 237
466 3300009176 Ga0105242_10286600 Ga0105242_102866002 237
467 3300009176 Ga0105242_10347723 Ga0105242_103477232 237
468 3300009176 Ga0105242_10443105 Ga0105242_104431052 237
469 3300009177 Ga0105248_10087800 Ga0105248_100878001 237
470 3300009177 Ga0105248_10168623 Ga0105248_101686232 237
471 3300009177 Ga0105248_10211826 Ga0105248_102118263 237
472 3300009177 Ga0105248_10256836 Ga0105248_102568363 237
473 3300009177 Ga0105248_10449093 Ga0105248_104490932 237
474 3300009545 Ga0105237_10016610 Ga0105237_100166104 237
475 3300009545 Ga0105237_10059544 Ga0105237_100595443 237
476 3300009545 Ga0105237_10096007 Ga0105237_100960073 237
477 3300009545 Ga0105237_10178865 Ga0105237_101788652 237
478 3300009545 Ga0105237_10193165 Ga0105237_101931652 237
479 3300009545 Ga0105237_10618325 Ga0105237_106183252 237
480 3300009551 Ga0105238_10004639 Ga0105238_1000463917 237
481 3300009551 Ga0105238_10121061 Ga0105238_101210612 237
482 3300009551 Ga0105238_10122762 Ga0105238_101227625 237
483 3300009553 Ga0105249_10017780 Ga0105249_100177809 237
484 3300010159 Ga0099796_10059515 Ga0099796_100595152 237
485 3300010375 Ga0105239_10116116 Ga0105239_101161162 237
486 3300010375 Ga0105239_10295798 Ga0105239_102957982 237
487 3300010375 Ga0105239_11123062 Ga0105239_111230621 237
488 3300011119 Ga0105246_10018819 Ga0105246_100188195 237
489 3300011119 Ga0105246_10104324 Ga0105246_101043243 237
490 3300011119 Ga0105246_10307490 Ga0105246_103074902 237
491 3300013100 Ga0157373_10016891 Ga0157373_100168914 237
492 3300013100 Ga0157373_10082678 Ga0157373_100826784 237
493 3300013100 Ga0157373_10092181 Ga0157373_100921811 237
494 3300013102 Ga0157371_10016410 Ga0157371_100164107 237
495 3300013104 Ga0157370_10124040 Ga0157370_101240404 237
496 3300013105 Ga0157369_10075050 Ga0157369_100750502 237
497 3300013105 Ga0157369_10077234 Ga0157369_100772344 237
498 3300013105 Ga0157369_10109693 Ga0157369_101096932 237
499 3300013105 Ga0157369_10196641 Ga0157369_101966412 237
500 3300013296 Ga0157374_10053416 Ga0157374_100534162 237
501 3300013296 Ga0157374_10056630 Ga0157374_100566303 237
502 3300013296 Ga0157374_10094140 Ga0157374_100941402 237
503 3300013296 Ga0157374_10094974 Ga0157374_100949742 237
504 3300013296 Ga0157374_10314730 Ga0157374_103147302 237
505 3300013296 Ga0157374_10327687 Ga0157374_103276871 237
506 3300013296 Ga0157374_10598803 Ga0157374_105988031 237
507 3300013297 Ga0157378_10000411 Ga0157378_1000041131 237
508 3300013297 Ga0157378_10000516 Ga0157378_100005162 237
509 3300013297 Ga0157378_10000641 Ga0157378_1000064133 237
510 3300013297 Ga0157378_10023476 Ga0157378_100234762 237
511 3300013297 Ga0157378_10027505 Ga0157378_100275057 237
512 3300013297 Ga0157378_10044668 Ga0157378_100446683 237
513 3300013297 Ga0157378_10260721 Ga0157378_102607213 237
514 3300013297 Ga0157378_10400508 Ga0157378_104005082 237
515 3300013297 Ga0157378_10815642 Ga0157378_108156422 237
516 3300013306 Ga0163162_10020357 Ga0163162_100203576 237
517 3300013306 Ga0163162_10322933 Ga0163162_103229334 237
518 3300013306 Ga0163162_10701539 Ga0163162_107015392 237
519 3300013306 Ga0163162_11210431 Ga0163162_112104311 237
520 3300013307 Ga0157372_10029430 Ga0157372_100294308 237
521 3300013307 Ga0157372_10087746 Ga0157372_100877462 237
522 3300013307 Ga0157372_10117278 Ga0157372_101172783 237
523 3300013307 Ga0157372_10133152 Ga0157372_101331522 237
524 3300013307 Ga0157372_10163271 Ga0157372_101632711 237
525 3300013307 Ga0157372_10238753 Ga0157372_102387532 237
526 3300013307 Ga0157372_10464426 Ga0157372_104644263 237
527 3300013308 Ga0157375_10273036 Ga0157375_102730362 237
528 3300014325 Ga0163163_10038186 Ga0163163_100381861 237
529 3300014325 Ga0163163_10060784 Ga0163163_100607845 237
530 3300014325 Ga0163163_10085804 Ga0163163_100858043 237
531 3300014968 Ga0157379_10004402 Ga0157379_100044024 237
532 3300014969 Ga0157376_10155309 Ga0157376_101553092 237
533 3300014969 Ga0157376_10198242 Ga0157376_101982422 237
534 3300014969 Ga0157376_10216896 Ga0157376_102168962 237
535 3300015262 Ga0182007_10006522 Ga0182007_100065226 237
536 3300015262 Ga0182007_10096360 Ga0182007_100963601 237
537 3300019161 Ga0184602_100587 Ga0184602_1005871 237
538 3300019183 Ga0184601_138509 Ga0184601_1385092 237
539 3300019188 Ga0184599_124137 Ga0184599_1241373 237
540 3300019190 Ga0184600_107512 Ga0184600_1075125 237
541 3300020069 Ga0197907_10394153 Ga0197907_103941531 237
542 3300020069 Ga0197907_10527156 Ga0197907_105271562 237
543 3300020069 Ga0197907_10662566 Ga0197907_106625662 237
544 3300020070 Ga0206356_10049636 Ga0206356_100496363 237
545 3300020070 Ga0206356_10051902 Ga0206356_100519022 237
546 3300020070 Ga0206356_10833199 Ga0206356_108331991 237
547 3300020070 Ga0206356_11173081 Ga0206356_111730813 237
548 3300020070 Ga0206356_11476520 Ga0206356_114765201 237
549 3300020070 Ga0206356_11803998 Ga0206356_118039982 237
550 3300020076 Ga0206355_1040840 Ga0206355_10408402 237
551 3300020076 Ga0206355_1106755 Ga0206355_11067551 237
552 3300020076 Ga0206355_1328072 Ga0206355_13280722 237
553 3300020077 Ga0206351_10678473 Ga0206351_106784732 237
554 3300020077 Ga0206351_10806319 Ga0206351_108063192 237
555 3300020078 Ga0206352_10443739 Ga0206352_104437392 237
556 3300020078 Ga0206352_10818178 Ga0206352_108181782 237
557 3300020080 Ga0206350_10297924 Ga0206350_102979242 237
558 3300020080 Ga0206350_10978419 Ga0206350_109784192 237
559 3300020081 Ga0206354_10240356 Ga0206354_102403562 237
560 3300020081 Ga0206354_10881815 Ga0206354_108818152 237
561 3300020082 Ga0206353_11188867 Ga0206353_111888671 237
562 3300020082 Ga0206353_11403828 Ga0206353_114038282 237
563 3300020610 Ga0154015_1684329 Ga0154015_16843292 237
564 3300020610 Ga0154015_1706975 Ga0154015_17069752 237
565 3300022467 Ga0224712_10020119 Ga0224712_100201192 237
566 3300022467 Ga0224712_10053142 Ga0224712_100531422 237
567 3300022467 Ga0224712_10068472 Ga0224712_100684722 237
568 3300022467 Ga0224712_10119152 Ga0224712_101191522 237
569 3300022467 Ga0224712_10128781 Ga0224712_101287811 237
570 3300022730 Ga0224570_100717 Ga0224570_1007173 237
571 3300022732 Ga0224569_100499 Ga0224569_1004993 237
572 3300023547 Ga0247554_100062 Ga0247554_1000623 237
573 3300024227 Ga0228598_1000213 Ga0228598_100021313 237
574 3300024227 Ga0228598_1000513 Ga0228598_10005134 237
575 3300025321 Ga0207656_10013964 Ga0207656_100139642 237
576 3300025321 Ga0207656_10026011 Ga0207656_100260112 237
577 3300025885 Ga0207653_10129640 Ga0207653_101296401 237
578 3300025898 Ga0207692_10006388 Ga0207692_100063888 237
579 3300025898 Ga0207692_10013131 Ga0207692_100131314 237
580 3300025898 Ga0207692_10020497 Ga0207692_100204972 237
581 3300025899 Ga0207642_10062870 Ga0207642_100628702 237
582 3300025903 Ga0207680_10338107 Ga0207680_103381071 237
583 3300025904 Ga0207647_10006875 Ga0207647_1000687510 237
584 3300025904 Ga0207647_10019145 Ga0207647_100191456 237
585 3300025905 Ga0207685_10038470 Ga0207685_100384703 237
586 3300025906 Ga0207699_10002321 Ga0207699_100023212 237
587 3300025906 Ga0207699_10014274 Ga0207699_100142744 237
588 3300025906 Ga0207699_10020090 Ga0207699_100200903 237
589 3300025906 Ga0207699_10021232 Ga0207699_100212323 237
590 3300025906 Ga0207699_10055306 Ga0207699_100553064 237
591 3300025906 Ga0207699_10297324 Ga0207699_102973241 237
592 3300025907 Ga0207645_10004038 Ga0207645_100040383 237
593 3300025910 Ga0207684_10000614 Ga0207684_1000061434 237
594 3300025910 Ga0207684_10001048 Ga0207684_1000104823 237
595 3300025910 Ga0207684_10003017 Ga0207684_1000301726 237
596 3300025910 Ga0207684_10541969 Ga0207684_105419691 237
597 3300025911 Ga0207654_10052456 Ga0207654_100524563 237
598 3300025911 Ga0207654_10097758 Ga0207654_100977583 237
599 3300025911 Ga0207654_10148662 Ga0207654_101486622 237
600 3300025912 Ga0207707_10003361 Ga0207707_100033612 237
601 3300025912 Ga0207707_10007456 Ga0207707_100074567 237
602 3300025912 Ga0207707_10018585 Ga0207707_100185855 237
603 3300025912 Ga0207707_10021611 Ga0207707_100216118 237
604 3300025912 Ga0207707_10127170 Ga0207707_101271702 237
605 3300025912 Ga0207707_10168596 Ga0207707_101685962 237
606 3300025912 Ga0207707_10287986 Ga0207707_102879862 237
607 3300025912 Ga0207707_10299411 Ga0207707_102994112 237
608 3300025913 Ga0207695_10007039 Ga0207695_1000703911 237
609 3300025913 Ga0207695_10008453 Ga0207695_1000845317 237
610 3300025913 Ga0207695_10081934 Ga0207695_100819346 237
611 3300025913 Ga0207695_10150454 Ga0207695_101504542 237
612 3300025913 Ga0207695_10172513 Ga0207695_101725132 237
613 3300025914 Ga0207671_10042349 Ga0207671_100423493 237
614 3300025914 Ga0207671_10068785 Ga0207671_100687852 237
615 3300025914 Ga0207671_10074923 Ga0207671_100749233 237
616 3300025914 Ga0207671_10122703 Ga0207671_101227033 237
617 3300025915 Ga0207693_10000026 Ga0207693_1000002670 237
618 3300025915 Ga0207693_10000922 Ga0207693_1000092221 237
619 3300025915 Ga0207693_10001260 Ga0207693_1000126011 237
620 3300025915 Ga0207693_10004232 Ga0207693_100042325 237
621 3300025915 Ga0207693_10041078 Ga0207693_100410783 237
622 3300025915 Ga0207693_10306845 Ga0207693_103068451 237
623 3300025916 Ga0207663_10006104 Ga0207663_100061049 237
624 3300025916 Ga0207663_10027488 Ga0207663_100274882 237
625 3300025916 Ga0207663_10031788 Ga0207663_100317881 237
626 3300025916 Ga0207663_10062577 Ga0207663_100625773 237
627 3300025916 Ga0207663_10140657 Ga0207663_101406572 237
628 3300025917 Ga0207660_10023735 Ga0207660_100237353 237
629 3300025917 Ga0207660_10085371 Ga0207660_100853713 237
630 3300025917 Ga0207660_10119042 Ga0207660_101190423 237
631 3300025919 Ga0207657_10006426 Ga0207657_100064262 237
632 3300025920 Ga0207649_10036883 Ga0207649_100368833 237
633 3300025920 Ga0207649_10058342 Ga0207649_100583423 237
634 3300025921 Ga0207652_10018223 Ga0207652_100182236 237
635 3300025921 Ga0207652_10061092 Ga0207652_100610921 237
636 3300025921 Ga0207652_10096820 Ga0207652_100968206 237
637 3300025922 Ga0207646_10001230 Ga0207646_1000123025 237
638 3300025922 Ga0207646_10004899 Ga0207646_1000489916 237
639 3300025922 Ga0207646_10241285 Ga0207646_102412852 237
640 3300025923 Ga0207681_10285150 Ga0207681_102851502 237
641 3300025924 Ga0207694_10000718 Ga0207694_1000071821 237
642 3300025924 Ga0207694_10044180 Ga0207694_100441804 237
643 3300025925 Ga0207650_10071395 Ga0207650_100713954 237
644 3300025927 Ga0207687_10056079 Ga0207687_100560793 237
645 3300025927 Ga0207687_10127310 Ga0207687_101273103 237
646 3300025928 Ga0207700_10004902 Ga0207700_100049026 237
647 3300025928 Ga0207700_10039497 Ga0207700_100394975 237
648 3300025928 Ga0207700_10087615 Ga0207700_100876153 237
649 3300025928 Ga0207700_10110922 Ga0207700_101109222 237
650 3300025928 Ga0207700_10142418 Ga0207700_101424183 237
651 3300025928 Ga0207700_10151903 Ga0207700_101519032 237
652 3300025928 Ga0207700_10212126 Ga0207700_102121261 237
653 3300025928 Ga0207700_10378013 Ga0207700_103780132 237
654 3300025929 Ga0207664_10000087 Ga0207664_1000008769 237
655 3300025929 Ga0207664_10032913 Ga0207664_100329132 237
656 3300025929 Ga0207664_10076602 Ga0207664_100766023 237
657 3300025929 Ga0207664_10102458 Ga0207664_101024582 237
658 3300025929 Ga0207664_10637139 Ga0207664_106371392 237
659 3300025931 Ga0207644_10030088 Ga0207644_100300883 237
660 3300025931 Ga0207644_10081911 Ga0207644_100819112 237
661 3300025932 Ga0207690_10207300 Ga0207690_102073002 237
662 3300025933 Ga0207706_10002545 Ga0207706_100025453 237
663 3300025934 Ga0207686_10138054 Ga0207686_101380543 237
664 3300025935 Ga0207709_10014728 Ga0207709_100147287 237
665 3300025936 Ga0207670_10449137 Ga0207670_104491372 237
666 3300025937 Ga0207669_10386970 Ga0207669_103869701 237
667 3300025938 Ga0207704_10012199 Ga0207704_100121992 237
668 3300025938 Ga0207704_10013374 Ga0207704_100133744 237
669 3300025938 Ga0207704_10065992 Ga0207704_100659924 237
670 3300025938 Ga0207704_10339944 Ga0207704_103399442 237
671 3300025938 Ga0207704_10387223 Ga0207704_103872232 237
672 3300025939 Ga0207665_10001798 Ga0207665_1000179821 237
673 3300025939 Ga0207665_10012476 Ga0207665_100124766 237
674 3300025939 Ga0207665_10019095 Ga0207665_100190953 237
675 3300025939 Ga0207665_10042405 Ga0207665_100424053 237
676 3300025939 Ga0207665_10071183 Ga0207665_100711832 237
677 3300025939 Ga0207665_10080999 Ga0207665_100809992 237
678 3300025939 Ga0207665_10086009 Ga0207665_100860092 237
679 3300025939 Ga0207665_10147286 Ga0207665_101472862 237
680 3300025939 Ga0207665_10270932 Ga0207665_102709322 237
681 3300025940 Ga0207691_10416654 Ga0207691_104166542 237
682 3300025941 Ga0207711_10024877 Ga0207711_100248775 237
683 3300025941 Ga0207711_10102246 Ga0207711_101022463 237
684 3300025941 Ga0207711_10382048 Ga0207711_103820482 237
685 3300025941 Ga0207711_10385399 Ga0207711_103853992 237
686 3300025942 Ga0207689_10000542 Ga0207689_100005422 237
687 3300025942 Ga0207689_10027283 Ga0207689_100272837 237
688 3300025942 Ga0207689_10032344 Ga0207689_100323444 237
689 3300025944 Ga0207661_10125253 Ga0207661_101252532 237
690 3300025944 Ga0207661_10127104 Ga0207661_101271042 237
691 3300025944 Ga0207661_10436222 Ga0207661_104362222 237
692 3300025945 Ga0207679_10232910 Ga0207679_102329101 237
693 3300025949 Ga0207667_10000245 Ga0207667_100002452 237
694 3300025949 Ga0207667_10002261 Ga0207667_100022612 237
695 3300025949 Ga0207667_10008140 Ga0207667_100081402 237
696 3300025949 Ga0207667_10046387 Ga0207667_100463872 237
697 3300025949 Ga0207667_10132398 Ga0207667_101323983 237
698 3300025949 Ga0207667_10360439 Ga0207667_103604392 237
699 3300025960 Ga0207651_10192162 Ga0207651_101921622 237
700 3300025961 Ga0207712_10066602 Ga0207712_100666022 237
701 3300025972 Ga0207668_10501201 Ga0207668_105012012 237
702 3300025981 Ga0207640_10008195 Ga0207640_100081954 237
703 3300025981 Ga0207640_10010596 Ga0207640_100105966 237
704 3300025981 Ga0207640_10058331 Ga0207640_100583312 237
705 3300025981 Ga0207640_10198997 Ga0207640_101989971 237
706 3300025981 Ga0207640_10343797 Ga0207640_103437972 237
707 3300025981 Ga0207640_10624275 Ga0207640_106242751 237
708 3300026023 Ga0207677_10004281 Ga0207677_100042815 237
709 3300026023 Ga0207677_10004546 Ga0207677_100045469 237
710 3300026023 Ga0207677_10008537 Ga0207677_100085379 237
711 3300026023 Ga0207677_10024595 Ga0207677_100245954 237
712 3300026035 Ga0207703_10003490 Ga0207703_100034902 237
713 3300026035 Ga0207703_10013683 Ga0207703_100136833 237
714 3300026035 Ga0207703_10041811 Ga0207703_100418112 237
715 3300026035 Ga0207703_10050418 Ga0207703_100504186 237
716 3300026041 Ga0207639_10060468 Ga0207639_100604685 237
717 3300026041 Ga0207639_10064124 Ga0207639_100641242 237
718 3300026041 Ga0207639_10117426 Ga0207639_101174262 237
719 3300026067 Ga0207678_10001612 Ga0207678_1000161211 237
720 3300026078 Ga0207702_10001276 Ga0207702_1000127625 237
721 3300026078 Ga0207702_10001425 Ga0207702_100014252 237
722 3300026078 Ga0207702_10003851 Ga0207702_1000385119 237
723 3300026078 Ga0207702_10041975 Ga0207702_100419756 237
724 3300026078 Ga0207702_10127482 Ga0207702_101274824 237
725 3300026078 Ga0207702_10282887 Ga0207702_102828873 237
726 3300026078 Ga0207702_10564251 Ga0207702_105642511 237
727 3300026088 Ga0207641_10045230 Ga0207641_100452303 237
728 3300026088 Ga0207641_10245130 Ga0207641_102451302 237
729 3300026088 Ga0207641_10386607 Ga0207641_103866072 237
730 3300026089 Ga0207648_10023379 Ga0207648_100233794 237
731 3300026089 Ga0207648_10103312 Ga0207648_101033122 237
732 3300026095 Ga0207676_10046329 Ga0207676_100463295 237
733 3300026095 Ga0207676_10051605 Ga0207676_100516053 237
734 3300026095 Ga0207676_10497192 Ga0207676_104971921 237
735 3300026116 Ga0207674_10000864 Ga0207674_100008642 237
736 3300026116 Ga0207674_10018522 Ga0207674_1001852210 237
737 3300026116 Ga0207674_10041099 Ga0207674_100410996 237
738 3300026116 Ga0207674_10100633 Ga0207674_101006332 237
739 3300026121 Ga0207683_10051020 Ga0207683_100510205 237
740 3300026121 Ga0207683_10080116 Ga0207683_100801164 237
741 3300026121 Ga0207683_10174724 Ga0207683_101747243 237
742 3300026142 Ga0207698_10089386 Ga0207698_100893862 237
743 3300026142 Ga0207698_10205590 Ga0207698_102055904 237
744 3300026142 Ga0207698_10720062 Ga0207698_107200622 237
745 3300028017 Ga0265356_1000279 Ga0265356_10002794 237
746 3300028379 Ga0268266_10023242 Ga0268266_100232423 237
747 3300028380 Ga0268265_10209553 Ga0268265_102095533 237
748 3300028381 Ga0268264_10017321 Ga0268264_100173212 237
749 3300028381 Ga0268264_10209769 Ga0268264_102097694 237
750 3300028381 Ga0268264_10224831 Ga0268264_102248313 237
751 3300028381 Ga0268264_10270162 Ga0268264_102701623 237
752 3300028800 Ga0265338_10002857 Ga0265338_1000285724 237
753 3300028800 Ga0265338_10056425 Ga0265338_100564253 237
754 3300028800 Ga0265338_10152496 Ga0265338_101524962 237
755 3300028800 Ga0265338_10157549 Ga0265338_101575492 237
756 3300028800 Ga0265338_10158627 Ga0265338_101586272 237
757 3300028800 Ga0265338_10307499 Ga0265338_103074992 237
758 3300030760 Ga0265762_1000268 Ga0265762_10002683 237
759 3300030760 Ga0265762_1001772 Ga0265762_10017724 237
760 3300030760 Ga0265762_1015375 Ga0265762_10153752 237
761 3300030760 Ga0265762_1015712 Ga0265762_10157121 237
762 3300030763 Ga0265763_1010057 Ga0265763_10100571 237
763 3300030863 Ga0265766_1000373 Ga0265766_10003733 237
764 3300030877 Ga0265777_101167 Ga0265777_1011672 237
765 3300030877 Ga0265777_101745 Ga0265777_1017452 237
766 3300030879 Ga0265765_1012638 Ga0265765_10126381 237
767 3300031090 Ga0265760_10000694 Ga0265760_1000069417 237
768 3300031090 Ga0265760_10011555 Ga0265760_100115552 237
769 3300031090 Ga0265760_10016330 Ga0265760_100163303 237
770 3300031090 Ga0265760_10017826 Ga0265760_100178265 237
771 3300031090 Ga0265760_10035955 Ga0265760_100359552 237
772 3300031239 Ga0265328_10008639 Ga0265328_100086395 237
773 3300031240 Ga0265320_10169513 Ga0265320_101695131 237
774 3300031241 Ga0265325_10003007 Ga0265325_100030077 237
775 3300031241 Ga0265325_10047694 Ga0265325_100476942 237
776 3300031241 Ga0265325_10088259 Ga0265325_100882592 237
777 3300031247 Ga0265340_10005004 Ga0265340_1000500411 237
778 3300031250 Ga0265331_10012160 Ga0265331_100121607 237
779 3300031251 Ga0265327_10051700 Ga0265327_100517002 237
780 3300031344 Ga0265316_10024062 Ga0265316_100240627 237
781 3300031344 Ga0265316_10070945 Ga0265316_100709453 237
782 3300031595 Ga0265313_10002540 Ga0265313_100025409 237
783 3300031595 Ga0265313_10037261 Ga0265313_100372613 237
784 3300031711 Ga0265314_10015736 Ga0265314_100157363 237
785 3300031712 Ga0265342_10031116 Ga0265342_100311166 237
786 3300032120 Ga0316053_100082 Ga0316053_1000824 237
787 3300033545 Ga0316214_1000473 Ga0316214_10004734 237
788 3300035083 Ga0373926_0003574 Ga0373926_0003574_56_808 237
789 3300035083 Ga0373926_0088992 Ga0373926_0088992_110_862 237
790 3300035083 Ga0373926_0089301 Ga0373926_0089301_61_774 237
791 3300035086 Ga0373934_0087673 Ga0373934_0087673_172_924 237
792 3300035086 Ga0373934_0126980 Ga0373934_0126980_136_888 237
793 3300035111 Ga0373923_0021599 Ga0373923_0021599_1249_2001 237
794 3300035113 Ga0373936_0012061 Ga0373936_0012061_465_1217 237
795 3300035113 Ga0373936_0023335 Ga0373936_0023335_1547_2299 237
796 3300035117 Ga0373953_0121023 Ga0373953_0121023_327_1079 237
797 3300035118 Ga0373954_0150956 Ga0373954_0150956_62_811 237
798 3300035170 Ga0373943_0000594 Ga0373943_0000594_361_1113 237
799 3300035170 Ga0373943_0196682 Ga0373943_0196682_301_1014 237
800 3300035171 Ga0373946_0011730 Ga0373946_0011730_2499_3251 237
801 3300035171 Ga0373946_0032109 Ga0373946_0032109_1011_1763 237
802 3300035171 Ga0373946_0055918 Ga0373946_0055918_300_1049 237
803 3300035172 Ga0373955_0097240 Ga0373955_0097240_400_1152 237
804 3300035172 Ga0373955_0111755 Ga0373955_0111755_629_1381 237
805 3300035172 Ga0373955_0128990 Ga0373955_0128990_549_1301 237
806 3300035207 Ga0373942_0099938 Ga0373942_0099938_81_833 237
807 3300035242 Ga0373962_0018042 Ga0373962_0018042_361_1113 237
808 3300035410 Ga0373924_0037264 Ga0373924_0037264_1238_1951 237
809 3300035691 Ga0373931_0127825 Ga0373931_0127825_252_1004 237
810 3300035691 Ga0373931_0277239 Ga0373931_0277239_17_730 237
811 3300035692 Ga0373935_0001675 Ga0373935_0001675_2057_2809 237
812 3300035692 Ga0373935_0008518 Ga0373935_0008518_453_1205 237
813 3300035692 Ga0373935_0044338 Ga0373935_0044338_38_790 237
814 3300035695 Ga0373927_0000747 Ga0373927_0000747_18124_18876 237
815 3300035695 Ga0373927_0272728 Ga0373927_0272728_68_820 237
816 3300035724 Ga0373933_0090555 Ga0373933_0090555_1013_1765 237
817 3300035725 Ga0373947_0000971 Ga0373947_0000971_1084_1836 237
818 3300035725 Ga0373947_0001211 Ga0373947_0001211_12476_13228 237
819 3300036401 Ga0373937_0021575 Ga0373937_0021575_1574_2323 237
820 3300036401 Ga0373937_0040661 Ga0373937_0040661_3330_4082 237
821 3300036401 Ga0373937_0054915 Ga0373937_0054915_220_972 237
822 3300036401 Ga0373937_0179904 Ga0373937_0179904_1018_1770 237
823 3300036401 Ga0373937_0240705 Ga0373937_0240705_282_1034 237
824 3300036401 Ga0373937_0979633 Ga0373937_0979633_57_770 237
825 3300037068 Ga0373925_0039256 Ga0373925_0039256_742_1494 237
826 3300037068 Ga0373925_0174457 Ga0373925_0174457_197_949 237
827 3300037068 Ga0373925_0175752 Ga0373925_0175752_919_1671 237
828 3300037418 Ga0395900_0698613 Ga0395900_0698613_179_928 237
829 3300037466 Ga0395898_0020412 Ga0395898_0020412_338_1087 237
830 3300037471 Ga0395905_0659058 Ga0395905_0659058_86_835 237
831 3300039437 Ga0436365_1839081 Ga0436365_1839081_35_787 237
832 3300039450 Ga0436363_1122218 Ga0436363_1122218_466_1218 237
833 3300042876 Ga0451577_0082373 Ga0451577_0082373_925_1677 237
834 3300044684 Ga0466966_0115682 Ga0466966_0115682_113_862 237
835 3300044684 Ga0466966_0143822 Ga0466966_0143822_632_1381 237
836 3300044694 Ga0466963_0000986 Ga0466963_0000986_12039_12788 237
837 3300044706 Ga0466964_0028661 Ga0466964_0028661_871_1620 237
838 3300044706 Ga0466964_0048034 Ga0466964_0048034_96_848 237
839 3300044765 Ga0466970_0122543 Ga0466970_0122543_507_1256 237
840 3300044842 Ga0466957_0000324 Ga0466957_0000324_13888_14637 237
841 3300045049 Ga0466959_0011621 Ga0466959_0011621_3733_4482 237
842 3300045051 Ga0451576_0092322 Ga0451576_0092322_2303_3055 237
843 3300045051 Ga0451576_0346190 Ga0451576_0346190_134_886 237
844 3300045051 Ga0451576_0405387 Ga0451576_0405387_498_1211 237
845 3300045051 Ga0451576_0437311 Ga0451576_0437311_157_870 237
846 3300045836 Ga0466958_0016862 Ga0466958_0016862_3235_3984 237
847 3300045836 Ga0466958_0034939 Ga0466958_0034939_448_1197 237
848 3300045976 Ga0466967_0041428 Ga0466967_0041428_2201_2950 237
849 3300045976 Ga0466967_0110685 Ga0466967_0110685_1591_2340 237
850 3300045976 Ga0466967_0170640 Ga0466967_0170640_20_733 237
851 3300046459 Ga0495629_0053519 Ga0495629_0053519_829_1581 237
852 3300046459 Ga0495629_0288172 Ga0495629_0288172_337_1089 237
853 3300046462 Ga0495651_0022857 Ga0495651_0022857_2395_3144 237
854 3300046462 Ga0495651_0165050 Ga0495651_0165050_398_1150 237
855 3300046472 Ga0495580_0001673 Ga0495580_0001673_15421_16173 237
856 3300046472 Ga0495580_0001845 Ga0495580_0001845_4218_4970 237
857 3300046472 Ga0495580_0005545 Ga0495580_0005545_2168_2920 237
858 3300046472 Ga0495580_0016664 Ga0495580_0016664_3863_4615 237
859 3300046472 Ga0495580_0018154 Ga0495580_0018154_1680_2432 237
860 3300046472 Ga0495580_0118241 Ga0495580_0118241_746_1498 237
861 3300046472 Ga0495580_0133362 Ga0495580_0133362_168_920 237
862 3300046472 Ga0495580_0181217 Ga0495580_0181217_372_1124 237
863 3300046472 Ga0495580_0361148 Ga0495580_0361148_33_785 237
864 3300046473 Ga0495582_0000596 Ga0495582_0000596_14574_15326 237
865 3300046473 Ga0495582_0082239 Ga0495582_0082239_28_741 237
866 3300046473 Ga0495582_0107609 Ga0495582_0107609_589_1338 237
867 3300046476 Ga0495662_0272273 Ga0495662_0272273_13_765 237
868 3300046516 Ga0495628_0102363 Ga0495628_0102363_266_1018 237
869 3300046526 Ga0495666_0021051 Ga0495666_0021051_242_994 237
870 3300046526 Ga0495666_0092719 Ga0495666_0092719_367_1080 237
871 3300046531 Ga0495665_0000974 Ga0495665_0000974_1044_1796 237
872 3300046531 Ga0495665_0131102 Ga0495665_0131102_169_921 237
873 3300046675 Ga0495657_0223755 Ga0495657_0223755_371_1123 237
874 3300046683 Ga0495658_0049778 Ga0495658_0049778_1363_2115 237
875 3300046683 Ga0495658_0057450 Ga0495658_0057450_754_1506 237
876 3300046683 Ga0495658_0096862 Ga0495658_0096862_465_1214 237
877 3300046684 Ga0495669_0000669 Ga0495669_0000669_12901_13614 237
878 3300046690 Ga0495624_0182823 Ga0495624_0182823_473_1186 237
879 3300047315 Ga0495581_0167444 Ga0495581_0167444_457_1209 237
880 3300047319 Ga0495674_0013768 Ga0495674_0013768_4626_5378 237
881 3300047319 Ga0495674_0046446 Ga0495674_0046446_1634_2386 237
882 3300047444 Ga0495675_0085365 Ga0495675_0085365_824_1576 237
883 3300047471 Ga0495684_0133954 Ga0495684_0133954_319_1071 237
884 3300048088 Ga0495602_0078631 Ga0495602_0078631_270_1019 237
885 3300048088 Ga0495602_0285483 Ga0495602_0285483_261_974 237
886 3300048903 Ga0496100_0104235 Ga0496100_0104235_892_1644 237
887 3300048903 Ga0496100_0250095 Ga0496100_0250095_20_733 237
888 3300048904 Ga0496101_0086194 Ga0496101_0086194_1264_2016 237
889 3300048904 Ga0496101_0242897 Ga0496101_0242897_540_1253 237
890 3300048904 Ga0496101_0773977 Ga0496101_0773977_33_746 237
891 3300048905 Ga0496102_0003212 Ga0496102_0003212_6246_6998 237
892 3300048905 Ga0496102_0016554 Ga0496102_0016554_888_1637 237
893 3300048905 Ga0496102_0238756 Ga0496102_0238756_32_784 237
894 3300048905 Ga0496102_0283500 Ga0496102_0283500_611_1363 237
895 3300048906 Ga0496103_0002380 Ga0496103_0002380_1531_2283 237
896 3300048906 Ga0496103_0039142 Ga0496103_0039142_498_1247 237
897 3300048907 Ga0496104_0025955 Ga0496104_0025955_3581_4333 237
898 3300048907 Ga0496104_0220731 Ga0496104_0220731_471_1223 237
899 3300048907 Ga0496104_0288112 Ga0496104_0288112_27_779 237
900 3300048907 Ga0496104_0923870 Ga0496104_0923870_53_766 237
901 3300048908 Ga0496105_0307859 Ga0496105_0307859_162_914 237
902 3300048909 Ga0496106_0063431 Ga0496106_0063431_651_1403 237
903 3300048909 Ga0496106_0322373 Ga0496106_0322373_37_789 237
904 3300048910 Ga0496107_0078051 Ga0496107_0078051_1056_1808 237
905 3300048910 Ga0496107_0284470 Ga0496107_0284470_447_1199 237
906 3300048911 Ga0496108_0022698 Ga0496108_0022698_2336_3049 237
907 3300048912 Ga0496109_0038156 Ga0496109_0038156_1704_2417 237
908 3300048912 Ga0496109_0189690 Ga0496109_0189690_330_1082 237
909 3300048913 Ga0496110_0702414 Ga0496110_0702414_78_830 237
910 3300048914 Ga0496111_0057018 Ga0496111_0057018_1314_2027 237
911 3300048915 Ga0496112_0027473 Ga0496112_0027473_2989_3741 237
912 3300048915 Ga0496112_0038846 Ga0496112_0038846_3680_4429 237
913 3300048915 Ga0496112_0047142 Ga0496112_0047142_1429_2142 237
914 3300048915 Ga0496112_0057520 Ga0496112_0057520_2719_3471 237
915 3300048915 Ga0496112_0079924 Ga0496112_0079924_1132_1884 237
916 3300048915 Ga0496112_0172754 Ga0496112_0172754_1092_1844 237
917 3300048915 Ga0496112_0191638 Ga0496112_0191638_546_1298 237
918 3300048915 Ga0496112_0445977 Ga0496112_0445977_341_1093 237
919 3300048916 Ga0496113_0009232 Ga0496113_0009232_737_1489 237
920 3300048916 Ga0496113_0027888 Ga0496113_0027888_13_726 237
921 3300048917 Ga0496114_0060383 Ga0496114_0060383_1783_2535 237
922 3300048918 Ga0496115_0004694 Ga0496115_0004694_4471_5223 237
923 3300048918 Ga0496115_0084254 Ga0496115_0084254_488_1240 237
924 3300048918 Ga0496115_0087626 Ga0496115_0087626_788_1537 237
925 3300048918 Ga0496115_0145780 Ga0496115_0145780_1134_1886 237
926 3300048918 Ga0496115_0374922 Ga0496115_0374922_353_1105 237
927 3300050507 nmdc:mga05p37_300092_c1 nmdc:mga05p37_300092_c1_144_893 237
928 3300050512 nmdc:mga0n895_21442_c1 nmdc:mga0n895_21442_c1_3700_4452 237
929 3300050512 nmdc:mga0n895_26592_c1 nmdc:mga0n895_26592_c1_716_1465 237
930 3300050512 nmdc:mga0n895_344_c1 nmdc:mga0n895_344_c1_9887_10657 237
931 3300050513 nmdc:mga0rr50_350648_c1 nmdc:mga0rr50_350648_c1_359_1111 237
932 3300050513 nmdc:mga0rr50_37321_c1 nmdc:mga0rr50_37321_c1_1057_1809 237
933 3300050513 nmdc:mga0rr50_872_c1 nmdc:mga0rr50_872_c1_3035_3805 237
934 3300050514 nmdc:mga08x19_3391_c1 nmdc:mga08x19_3391_c1_6168_6938 237
935 3300050514 nmdc:mga08x19_3614_c1 nmdc:mga08x19_3614_c1_6782_7534 237
936 3300050514 nmdc:mga08x19_9637_c1 nmdc:mga08x19_9637_c1_79_831 237
937 3300050515 nmdc:mga0a205_7367_c1 nmdc:mga0a205_7367_c1_816_1586 237
938 3300053077 Ga0495601_0023927 Ga0495601_0023927_1684_2433 237
939 3300053077 Ga0495601_0427759 Ga0495601_0427759_52_804 237
940 3300053078 Ga0495612_0085918 Ga0495612_0085918_54_806 237
941 3300059478 Ga0587093_001841 Ga0587093_001841_1061_1810 237
942 3300059490 Ga0587066_000041 Ga0587066_000041_96_845 237
943 3300059491 Ga0587070_000114 Ga0587070_000114_63_812 237
944 3300059492 Ga0587073_0004031 Ga0587073_0004031_1276_2025 237
945 3300059492 Ga0587073_0007886 Ga0587073_0007886_584_1333 237
946 3300059492 Ga0587073_0034242 Ga0587073_0034242_52_804 237
947 3300059493 Ga0587077_000059 Ga0587077_000059_63_812 237
948 3300059503 Ga0587080_000447 Ga0587080_000447_2207_2956 237
949 3300059504 Ga0587082_000041 Ga0587082_000041_602_1351 237
950 3300059505 Ga0587083_0000140 Ga0587083_0000140_49_798 237
951 3300059506 Ga0587085_000049 Ga0587085_000049_3795_4544 237
952 3300059509 Ga0587089_001185 Ga0587089_001185_1051_1800 237
953 3300059511 Ga0587091_000037 Ga0587091_000037_5041_5790 237
954 3300059512 Ga0587092_000359 Ga0587092_000359_372_1121 237
955 3300059512 Ga0587092_008497 Ga0587092_008497_323_1072 237
956 3300059625 Ga0587113_000220 Ga0587113_000220_650_1399 237
957 3300059630 Ga0587128_005905 Ga0587128_005905_172_921 237
958 3300059639 Ga0587062_000813 Ga0587062_000813_1394_2143 237
959 3300059640 Ga0587067_000531 Ga0587067_000531_430_1179 237
960 3300059644 Ga0587075_000131 Ga0587075_000131_3054_3803 237
961 3300059645 Ga0587076_000182 Ga0587076_000182_441_1190 237
962 3300059645 Ga0587076_007119 Ga0587076_007119_245_994 237
963 3300059646 Ga0587078_000985 Ga0587078_000985_363_1112 237
964 3300059646 Ga0587078_002585 Ga0587078_002585_472_1221 237
965 3300059647 Ga0587079_000058 Ga0587079_000058_4775_5524 237
966 3300060243 Ga0587060_000766 Ga0587060_000766_976_1725 237
967 3300060344 Ga0587071_000028 Ga0587071_000028_2299_3048 237
968 3300060344 Ga0587071_015934 Ga0587071_015934_315_1064 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

12

240

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.988 2 237
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9876 1 237
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9863 2 237
4fuk-assembly1.cif.gz_A aminopeptidase from trypanosoma brucei 0.9859 2 237
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9837 2 237
ID Description Score Start End Superfamily
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9876 1 237 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9843 1 114 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9819 1 237 3.90.230.10
af_P9WK21_10_265_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9816 1 237 3.90.230.10
af_Q4D257_64_370_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9814 2 237 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A6I0E2C8-F1-model_v4 M24 family metallopeptidase 0.9997 4 96 GO:0005829
GO:0070006
AF-A0A1Q7AGF7-F1-model_v4 Multifunctional fusion protein [Includes: Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase); Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M)] 0.9982 10 237 GO:0004017
GO:0004239
GO:0005524
GO:0005829
GO:0006508
GO:0044209
GO:0046872
GO:0070006
AF-A0A250IPK0-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9973 1 237 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7C7DIY6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9959 2 237 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7C6TDM5-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9957 1 237 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
98.12 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map