F487066

General Info

Members Datasets Scaffolds Average Seq Length
969 502 1938 100

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_11997844|Ga0157376_119978442
Length 109
Sequence MNLAIIAAAPKPTTTWYLILSAVLFGVGTLGVMVRRNPLVLFMCVELMLNAVNLSFVAFAQAYGVGGQVFVFFVMTVAAAEAAVGLAIIIALFRHKQTVDLQNINLLKG

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
203 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
222 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
223 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
224 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
235 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
236 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
258 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
266 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
267 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
268 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
269 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
270 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
271 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
272 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
276 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
277 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
278 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
279 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
280 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
281 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
282 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
283 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
284 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
285 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
286 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
287 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
288 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
293 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
307 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
320 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
321 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
378 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
379 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
380 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
381 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
411 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
412 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
413 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
414 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
415 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
416 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
417 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
418 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
419 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
420 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
421 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
422 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
423 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
424 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
425 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
426 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
427 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
428 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
429 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
430 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
431 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
432 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
433 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
434 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
435 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
436 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
437 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
438 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
439 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
440 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
441 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
442 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
445 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
446 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
447 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
448 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
449 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
450 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
451 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
452 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
453 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
454 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
455 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
459 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
460 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
461 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
462 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
463 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
464 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
465 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
466 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
467 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
468 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
469 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
470 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
471 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
472 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
474 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
475 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
476 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
477 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
478 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
479 2643221585 Pelomonas sp. Root662 Isolate Unclassified
480 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
481 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
482 2643221656 Pelomonas sp. Root405 Isolate Unclassified
483 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
484 2734482264 Dyella sp. AD052 Isolate Unclassified
485 2738543009 Luteibacter sp. OK325 Isolate Unclassified
486 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
487 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
488 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
489 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
490 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
491 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
492 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
493 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
494 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
495 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
496 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
497 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
498 2919085039 Luteibacter sp. 1214 Isolate Unclassified
499 2919404418 Luteibacter sp. 3190 Isolate Unclassified
500 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
501 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
502 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 2.37
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0.41
Rhizoplane 2.68
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_11997844 3300014969 Bacteria 617
2 LJQas_1020049 3300000549 Bacteria 778
3 JGI24738J21930_10006379 3300002075 Bacteria 2772
4 JGI25152J39213_1025333 3300002773 Bacteria 983
5 JGI25406J46586_10017790 3300003203 Bacteria 2932
6 JGI25153J46596_10055107 3300003215 Bacteria 1114
7 Ga0006554J51385_1033774 3300003567 Bacteria 2186
8 Ga0006562J51391_1061648 3300003578 Bacteria 4010
9 Ga0055538_1000155 3300003751 Bacteria 46426
10 Ga0055539_1000205 3300003752 Bacteria 46426
11 Ga0055533_1000100 3300003756 Bacteria 111692
12 Ga0055533_1000207 3300003756 Bacteria 46426
13 Ga0055525_1000284 3300003759 Bacteria 46426
14 Ga0055525_1000947 3300003759 Bacteria 8022
15 Ga0055530_10014353 3300003791 Bacteria 2644
16 Ga0055531_10000310 3300003794 Bacteria 47933
17 Ga0055541_1000133 3300003841 Bacteria 46426
18 Ga0055543_1030932 3300004625 Bacteria 935
19 Ga0065165_1000028 3300005262 Bacteria 224430
20 Ga0065712_10391693 3300005290 Bacteria 741
21 Ga0070658_10003448 3300005327 Bacteria 12998
22 Ga0070658_10011571 3300005327 Bacteria 7077
23 Ga0070658_10238554 3300005327 Bacteria 1541
24 Ga0070658_10339180 3300005327 Bacteria 1285
25 Ga0070658_10368122 3300005327 Bacteria 1232
26 Ga0070658_10564196 3300005327 Bacteria 985
27 Ga0070658_10691620 3300005327 Bacteria 885
28 Ga0070658_11388562 3300005327 Bacteria 609
29 Ga0070676_10045115 3300005328 Bacteria 2567
30 Ga0070676_10126377 3300005328 Bacteria 1612
31 Ga0070676_10327830 3300005328 Bacteria 1046
32 Ga0070683_100026589 3300005329 Bacteria 5213
33 Ga0070683_100042213 3300005329 Bacteria 4199
34 Ga0070683_100053034 3300005329 Bacteria 3758
35 Ga0070683_100244034 3300005329 Bacteria 1708
36 Ga0070683_100361467 3300005329 Bacteria 1382
37 Ga0070683_100583988 3300005329 Bacteria 1069
38 Ga0070683_101823334 3300005329 Bacteria 585
39 Ga0070683_102390580 3300005329 Bacteria 506
40 Ga0070690_100117944 3300005330 Bacteria 1778
41 Ga0070690_100254849 3300005330 Bacteria 1242
42 Ga0070670_100194310 3300005331 Bacteria 1763
43 Ga0070670_100559842 3300005331 Bacteria 1020
44 Ga0070670_100814984 3300005331 Bacteria 843
45 Ga0070670_101004883 3300005331 Bacteria 759
46 Ga0070670_101581087 3300005331 Bacteria 603
47 Ga0068869_100052726 3300005334 Bacteria 2954
48 Ga0070666_10669473 3300005335 Bacteria 760
49 Ga0070680_100001111 3300005336 Bacteria 19323
50 Ga0070680_100048545 3300005336 Bacteria 3460
51 Ga0070680_101719489 3300005336 Bacteria 544
52 Ga0070680_101944804 3300005336 Bacteria 510
53 Ga0068868_101508223 3300005338 Bacteria 629
54 Ga0068868_101613833 3300005338 Bacteria 610
55 Ga0070660_100541286 3300005339 Bacteria 971
56 Ga0070660_101180715 3300005339 Bacteria 649
57 Ga0070689_100040508 3300005340 Bacteria 3572
58 Ga0070689_101276798 3300005340 Bacteria 661
59 Ga0070689_101992526 3300005340 Bacteria 531
60 Ga0070661_100164706 3300005344 Bacteria 1681
61 Ga0070661_100167277 3300005344 Bacteria 1668
62 Ga0070661_100275338 3300005344 Bacteria 1304
63 Ga0070661_100303941 3300005344 Bacteria 1242
64 Ga0070661_101198879 3300005344 Bacteria 635
65 Ga0070661_101247530 3300005344 Bacteria 623
66 Ga0070661_101903415 3300005344 Bacteria 506
67 Ga0070692_10054841 3300005345 Bacteria 2082
68 Ga0070668_100116431 3300005347 Bacteria 2131
69 Ga0070668_100813502 3300005347 Bacteria 831
70 Ga0070668_100946918 3300005347 Bacteria 772
71 Ga0070669_100095390 3300005353 Bacteria 2237
72 Ga0070675_100004759 3300005354 Bacteria 10361
73 Ga0070675_100230725 3300005354 Bacteria 1615
74 Ga0070675_100245717 3300005354 Bacteria 1565
75 Ga0070675_100309384 3300005354 Bacteria 1394
76 Ga0070675_101587900 3300005354 Bacteria 603
77 Ga0070675_101730905 3300005354 Bacteria 577
78 Ga0070671_100175628 3300005355 Bacteria 1812
79 Ga0070671_100407398 3300005355 Bacteria 1164
80 Ga0070671_100516138 3300005355 Bacteria 1029
81 Ga0070671_100525976 3300005355 Bacteria 1019
82 Ga0070671_100945627 3300005355 Bacteria 754
83 Ga0070674_100401045 3300005356 Bacteria 1121
84 Ga0070673_100391182 3300005364 Bacteria 1241
85 Ga0070673_100663455 3300005364 Bacteria 955
86 Ga0070673_100770639 3300005364 Bacteria 887
87 Ga0070673_102002971 3300005364 Bacteria 550
88 Ga0070688_100018584 3300005365 Bacteria 4013
89 Ga0070659_100048436 3300005366 Bacteria 3339
90 Ga0070659_100184565 3300005366 Bacteria 1713
91 Ga0070659_100297699 3300005366 Bacteria 1345
92 Ga0070659_100308167 3300005366 Bacteria 1322
93 Ga0070659_100920587 3300005366 Bacteria 765
94 Ga0070667_100137301 3300005367 Bacteria 2138
95 Ga0070667_100654787 3300005367 Bacteria 970
96 Ga0070709_10009593 3300005434 Bacteria 5344
97 Ga0070709_10036089 3300005434 Bacteria 3009
98 Ga0070709_10056629 3300005434 Bacteria 2480
99 Ga0070709_11591162 3300005434 Bacteria 532
100 Ga0070714_100004697 3300005435 Bacteria 10327
101 Ga0070714_100029810 3300005435 Bacteria 4538
102 Ga0070714_100392216 3300005435 Bacteria 1311
103 Ga0070714_101598920 3300005435 Bacteria 637
104 Ga0070713_100000168 3300005436 Bacteria 43646
105 Ga0070713_100051526 3300005436 Bacteria 3404
106 Ga0070713_102055622 3300005436 Bacteria 554
107 Ga0070710_10106524 3300005437 Bacteria 1678
108 Ga0070710_10175492 3300005437 Bacteria 1338
109 Ga0070711_100115217 3300005439 Bacteria 1979
110 Ga0070711_100884414 3300005439 Bacteria 762
111 Ga0070700_100719378 3300005441 Bacteria 796
112 Ga0070694_100050054 3300005444 Bacteria 2815
113 Ga0070694_100092890 3300005444 Bacteria 2120
114 Ga0070663_100032502 3300005455 Bacteria 3597
115 Ga0070663_100114062 3300005455 Bacteria 2034
116 Ga0070678_100090584 3300005456 Bacteria 2345
117 Ga0070678_101610695 3300005456 Bacteria 610
118 Ga0070678_101705827 3300005456 Bacteria 593
119 Ga0070662_100146176 3300005457 Bacteria 1836
120 Ga0070662_100269442 3300005457 Bacteria 1374
121 Ga0070662_100840166 3300005457 Bacteria 782
122 Ga0070662_101342267 3300005457 Bacteria 616
123 Ga0070681_10023492 3300005458 Bacteria 6201
124 Ga0070681_10077854 3300005458 Bacteria 3273
125 Ga0070681_10324270 3300005458 Bacteria 1450
126 Ga0070681_10401530 3300005458 Bacteria 1282
127 Ga0070681_10791978 3300005458 Bacteria 865
128 Ga0068867_100010986 3300005459 Bacteria 6382
129 Ga0070685_10087289 3300005466 Bacteria 1882
130 Ga0070685_10093785 3300005466 Bacteria 1822
131 Ga0070706_100454631 3300005467 Bacteria 1192
132 Ga0070699_100230574 3300005518 Bacteria 1651
133 Ga0070679_100032089 3300005530 Bacteria 5194
134 Ga0070679_100888116 3300005530 Bacteria 835
135 Ga0070679_101108943 3300005530 Bacteria 736
136 Ga0070679_101290837 3300005530 Bacteria 676
137 Ga0070684_100017327 3300005535 Bacteria 5909
138 Ga0070684_100027011 3300005535 Bacteria 4840
139 Ga0070684_100063417 3300005535 Bacteria 3239
140 Ga0070684_100310942 3300005535 Bacteria 1447
141 Ga0070684_100562247 3300005535 Bacteria 1059
142 Ga0070684_100920190 3300005535 Bacteria 820
143 Ga0068853_100576328 3300005539 Bacteria 1067
144 Ga0068853_101749056 3300005539 Bacteria 603
145 Ga0070672_100114001 3300005543 Bacteria 2206
146 Ga0070672_100166475 3300005543 Bacteria 1831
147 Ga0070672_100265732 3300005543 Bacteria 1448
148 Ga0070672_100300661 3300005543 Bacteria 1360
149 Ga0070672_100567463 3300005543 Bacteria 986
150 Ga0070672_101092428 3300005543 Bacteria 709
151 Ga0070672_101306804 3300005543 Bacteria 648
152 Ga0070686_100639050 3300005544 Bacteria 842
153 Ga0070686_100971405 3300005544 Bacteria 695
154 Ga0070695_100318783 3300005545 Bacteria 1155
155 Ga0070695_100327524 3300005545 Bacteria 1141
156 Ga0070695_100520785 3300005545 Bacteria 923
157 Ga0070695_101534646 3300005545 Bacteria 555
158 Ga0070695_101637135 3300005545 Bacteria 538
159 Ga0070696_100113732 3300005546 Bacteria 1951
160 Ga0070696_100122741 3300005546 Bacteria 1882
161 Ga0070693_100012610 3300005547 Bacteria 4280
162 Ga0070693_100797629 3300005547 Bacteria 700
163 Ga0070704_100003924 3300005549 Bacteria 8562
164 Ga0070704_101408657 3300005549 Bacteria 640
165 Ga0068855_100004465 3300005563 Bacteria 17102
166 Ga0068855_100068633 3300005563 Bacteria 4127
167 Ga0068855_100334991 3300005563 Bacteria 1670
168 Ga0070664_100046540 3300005564 Bacteria 3663
169 Ga0070664_100071150 3300005564 Bacteria 2980
170 Ga0070664_100377929 3300005564 Bacteria 1293
171 Ga0070664_100402657 3300005564 Bacteria 1251
172 Ga0070664_100428124 3300005564 Bacteria 1213
173 Ga0070664_100492270 3300005564 Bacteria 1129
174 Ga0070664_101350123 3300005564 Bacteria 674
175 Ga0070664_101799579 3300005564 Bacteria 581
176 Ga0068857_100036956 3300005577 Bacteria 4325
177 Ga0068857_100091619 3300005577 Bacteria 2721
178 Ga0068857_100672225 3300005577 Bacteria 982
179 Ga0068854_100029527 3300005578 Bacteria 3796
180 Ga0068854_100395260 3300005578 Bacteria 1142
181 Ga0068856_100348838 3300005614 Bacteria 1499
182 Ga0068856_100358922 3300005614 Bacteria 1476
183 Ga0068856_100398126 3300005614 Bacteria 1397
184 Ga0070702_100973644 3300005615 Bacteria 670
185 Ga0068852_100228011 3300005616 Bacteria 1775
186 Ga0068852_100249695 3300005616 Bacteria 1699
187 Ga0068852_100345930 3300005616 Bacteria 1450
188 Ga0068852_100803720 3300005616 Bacteria 955
189 Ga0068859_100020486 3300005617 Bacteria 6637
190 Ga0068859_100531651 3300005617 Bacteria 1271
191 Ga0068859_102185738 3300005617 Bacteria 611
192 Ga0068864_100048790 3300005618 Bacteria 3641
193 Ga0068866_11271712 3300005718 Bacteria 534
194 Ga0068861_100248109 3300005719 Bacteria 1518
195 Ga0068861_100265826 3300005719 Bacteria 1471
196 Ga0068861_101091389 3300005719 Bacteria 767
197 Ga0068851_10233002 3300005834 Bacteria 1039
198 Ga0068851_10310274 3300005834 Bacteria 909
199 Ga0068870_10001350 3300005840 Bacteria 9905
200 Ga0068863_100345344 3300005841 Bacteria 1448
201 Ga0068863_101500322 3300005841 Bacteria 683
202 Ga0068858_100020744 3300005842 Bacteria 6139
203 Ga0068858_100086515 3300005842 Bacteria 2916
204 Ga0068858_102211906 3300005842 Bacteria 544
205 Ga0068860_100038331 3300005843 Bacteria 4584
206 Ga0068862_100088865 3300005844 Bacteria 2689
207 Ga0068862_100607312 3300005844 Bacteria 1051
208 Ga0081539_10000103 3300005985 Bacteria 197839
209 Ga0070717_10058340 3300006028 Bacteria 3192
210 Ga0070717_10471490 3300006028 Bacteria 1133
211 Ga0070717_10724409 3300006028 Bacteria 904
212 Ga0070712_100003656 3300006175 Bacteria 9482
213 Ga0070712_100211655 3300006175 Bacteria 1529
214 Ga0070712_100257583 3300006175 Bacteria 1397
215 Ga0075369_10019451 3300006186 Bacteria 2772
216 Ga0075366_10027909 3300006195 Bacteria 3312
217 Ga0075370_10050067 3300006353 Bacteria 2369
218 Ga0068871_100288671 3300006358 Bacteria 1437
219 Ga0075430_100191765 3300006846 Bacteria 1698
220 Ga0075430_100655505 3300006846 Bacteria 866
221 Ga0075430_101006359 3300006846 Bacteria 687
222 Ga0075431_100075350 3300006847 Bacteria 3482
223 Ga0075431_100204773 3300006847 Bacteria 2017
224 Ga0075431_101245805 3300006847 Bacteria 706
225 Ga0075433_10339054 3300006852 Bacteria 1329
226 Ga0075429_101055457 3300006880 Bacteria 710
227 Ga0075429_101408755 3300006880 Bacteria 607
228 Ga0068865_100236802 3300006881 Bacteria 1435
229 Ga0075436_100100836 3300006914 Bacteria 2011
230 Ga0075436_100560910 3300006914 Bacteria 839
231 Ga0097620_100020486 3300006931 Bacteria 6637
232 Ga0097620_100531639 3300006931 Bacteria 1271
233 Ga0097620_102185929 3300006931 Bacteria 611
234 Ga0079104_1016283 3300006946 Bacteria 2179
235 Ga0075435_100004837 3300007076 Bacteria 9322
236 Ga0075435_100483296 3300007076 Bacteria 1070
237 Ga0099794_10023946 3300007265 Bacteria 2798
238 Ga0099795_10003070 3300007788 Bacteria 4073
239 Ga0099795_10280020 3300007788 Bacteria 728
240 Ga0105251_10350811 3300009011 Bacteria 673
241 Ga0105240_10013785 3300009093 Bacteria 11074
242 Ga0105240_10302459 3300009093 Bacteria 1829
243 Ga0105240_10880214 3300009093 Bacteria 965
244 Ga0105240_12381192 3300009093 Bacteria 548
245 Ga0111539_10196609 3300009094 Bacteria 2352
246 Ga0111539_10458223 3300009094 Bacteria 1485
247 Ga0105245_12011763 3300009098 Bacteria 631
248 Ga0105247_11298443 3300009101 Bacteria 584
249 Ga0114129_11524445 3300009147 Bacteria 821
250 Ga0114129_12938087 3300009147 Bacteria 562
251 Ga0105243_10046635 3300009148 Bacteria 3409
252 Ga0105243_11778904 3300009148 Bacteria 647
253 Ga0105242_12427266 3300009176 Bacteria 572
254 Ga0105248_10187820 3300009177 Bacteria 2328
255 Ga0105248_11247886 3300009177 Bacteria 840
256 Ga0105237_10039956 3300009545 Bacteria 4733
257 Ga0105237_12592574 3300009545 Bacteria 518
258 Ga0105238_10061680 3300009551 Bacteria 3751
259 Ga0105238_10434183 3300009551 Bacteria 1309
260 Ga0105238_10657967 3300009551 Bacteria 1058
261 Ga0105238_10797331 3300009551 Bacteria 960
262 Ga0105238_11095629 3300009551 Bacteria 819
263 Ga0105249_10948572 3300009553 Bacteria 928
264 Ga0105249_11055526 3300009553 Bacteria 882
265 Ga0105249_13487615 3300009553 Bacteria 506
266 Ga0099796_10458075 3300010159 Bacteria 568
267 Ga0105239_10025227 3300010375 Bacteria 6547
268 Ga0105239_11405377 3300010375 Bacteria 806
269 Ga0105239_12174877 3300010375 Bacteria 645
270 Ga0105246_10411305 3300011119 Bacteria 1126
271 Ga0105246_10852407 3300011119 Bacteria 813
272 Ga0105246_11041459 3300011119 Bacteria 743
273 Ga0157347_1020377 3300012502 Bacteria 772
274 Ga0157373_10348239 3300013100 Bacteria 1056
275 Ga0157373_10572287 3300013100 Bacteria 821
276 Ga0157371_10111548 3300013102 Bacteria 1941
277 Ga0157371_10385107 3300013102 Bacteria 1024
278 Ga0157371_11164409 3300013102 Bacteria 593
279 Ga0157370_10027470 3300013104 Bacteria 5611
280 Ga0157370_10044296 3300013104 Bacteria 4278
281 Ga0157370_10286338 3300013104 Bacteria 1522
282 Ga0157370_10315306 3300013104 Bacteria 1443
283 Ga0157370_11789799 3300013104 Bacteria 551
284 Ga0157369_10155261 3300013105 Bacteria 2418
285 Ga0157369_10646827 3300013105 Bacteria 1090
286 Ga0157369_11329576 3300013105 Bacteria 732
287 Ga0157369_12252195 3300013105 Bacteria 552
288 Ga0157374_11279188 3300013296 Bacteria 755
289 Ga0157374_12313574 3300013296 Bacteria 565
290 Ga0157378_10506210 3300013297 Bacteria 1207
291 Ga0157378_10920836 3300013297 Bacteria 906
292 Ga0157378_11115765 3300013297 Bacteria 826
293 Ga0157378_11387265 3300013297 Bacteria 745
294 Ga0163162_10460780 3300013306 Bacteria 1403
295 Ga0163162_10555845 3300013306 Bacteria 1276
296 Ga0163162_10670238 3300013306 Bacteria 1160
297 Ga0163162_11735111 3300013306 Bacteria 713
298 Ga0163162_12903158 3300013306 Bacteria 551
299 Ga0157372_10051984 3300013307 Bacteria 4561
300 Ga0157372_10079293 3300013307 Bacteria 3713
301 Ga0157372_10463378 3300013307 Bacteria 1477
302 Ga0157375_10141341 3300013308 Bacteria 2534
303 Ga0157375_10709640 3300013308 Bacteria 1159
304 Ga0157375_11113680 3300013308 Bacteria 924
305 Ga0163163_10352776 3300014325 Bacteria 1527
306 Ga0163163_11550547 3300014325 Bacteria 724
307 Ga0163163_12860585 3300014325 Bacteria 539
308 Ga0157380_10396090 3300014326 Bacteria 1308
309 Ga0157380_12000636 3300014326 Bacteria 641
310 Ga0182008_10002555 3300014497 Bacteria 11332
311 Ga0182008_10013374 3300014497 Bacteria 4316
312 Ga0182008_10273328 3300014497 Bacteria 877
313 Ga0157377_10364316 3300014745 Bacteria 974
314 Ga0157377_10657886 3300014745 Bacteria 755
315 Ga0157377_11365740 3300014745 Bacteria 557
316 Ga0157379_10648618 3300014968 Bacteria 988
317 Ga0157376_10605332 3300014969 Bacteria 1091
318 Ga0157376_10894730 3300014969 Bacteria 905
319 Ga0157376_11892112 3300014969 Bacteria 633
320 Ga0157376_13009303 3300014969 Bacteria 510
321 Ga0182006_1000465 3300015261 Bacteria 31795
322 Ga0182007_10007704 3300015262 Bacteria 4484
323 Ga0182007_10282251 3300015262 Bacteria 605
324 Ga0182005_1000078 3300015265 Bacteria 77287
325 Ga0209784_100002 3300025224 Bacteria 1753105
326 Ga0209566_100003 3300025225 Bacteria 1753105
327 Ga0209674_100003 3300025226 Bacteria 2196646
328 Ga0209674_100004 3300025226 Bacteria 1753105
329 Ga0209563_100006 3300025230 Bacteria 1753105
330 Ga0209563_100017 3300025230 Bacteria 796449
331 Ga0209677_100003 3300025253 Bacteria 1753105
332 Ga0209677_100467 3300025253 Bacteria 23243
333 Ga0209051_1011278 3300025303 Bacteria 4427
334 Ga0209257_1000032 3300025304 Bacteria 680354
335 Ga0207697_10117564 3300025315 Bacteria 1142
336 Ga0207656_10131262 3300025321 Bacteria 1174
337 Ga0207656_10303200 3300025321 Bacteria 791
338 Ga0207656_10485358 3300025321 Bacteria 626
339 Ga0207656_10497700 3300025321 Bacteria 618
340 Ga0207682_10301251 3300025893 Bacteria 751
341 Ga0207682_10383952 3300025893 Bacteria 663
342 Ga0207682_10495084 3300025893 Bacteria 579
343 Ga0207692_10081066 3300025898 Bacteria 1736
344 Ga0207692_10283405 3300025898 Bacteria 1003
345 Ga0207642_10198671 3300025899 Bacteria 1106
346 Ga0207647_10068185 3300025904 Bacteria 2154
347 Ga0207685_10219732 3300025905 Bacteria 903
348 Ga0207699_10010032 3300025906 Bacteria 4737
349 Ga0207699_10019110 3300025906 Bacteria 3646
350 Ga0207699_10074048 3300025906 Bacteria 2091
351 Ga0207699_10391367 3300025906 Bacteria 988
352 Ga0207645_10117231 3300025907 Bacteria 1727
353 Ga0207645_10128707 3300025907 Bacteria 1647
354 Ga0207645_10196254 3300025907 Bacteria 1327
355 Ga0207643_10008540 3300025908 Bacteria 5493
356 Ga0207705_10020296 3300025909 Bacteria 4751
357 Ga0207705_10066042 3300025909 Bacteria 2616
358 Ga0207705_10083344 3300025909 Bacteria 2332
359 Ga0207705_10480128 3300025909 Bacteria 965
360 Ga0207705_10480231 3300025909 Bacteria 965
361 Ga0207705_10563023 3300025909 Bacteria 886
362 Ga0207707_10008443 3300025912 Bacteria 8933
363 Ga0207707_10188488 3300025912 Bacteria 1800
364 Ga0207707_10681211 3300025912 Bacteria 865
365 Ga0207707_11121705 3300025912 Bacteria 640
366 Ga0207695_10001853 3300025913 Bacteria 33132
367 Ga0207695_10003759 3300025913 Bacteria 21064
368 Ga0207695_10037174 3300025913 Bacteria 5255
369 Ga0207671_10013287 3300025914 Bacteria 6567
370 Ga0207693_10003536 3300025915 Bacteria 13345
371 Ga0207693_10113785 3300025915 Bacteria 2123
372 Ga0207693_10122685 3300025915 Bacteria 2041
373 Ga0207663_10004765 3300025916 Bacteria 6778
374 Ga0207663_10088813 3300025916 Bacteria 2045
375 Ga0207660_10000108 3300025917 Bacteria 46937
376 Ga0207660_10184576 3300025917 Bacteria 1622
377 Ga0207660_10187336 3300025917 Bacteria 1610
378 Ga0207660_10473100 3300025917 Bacteria 1015
379 Ga0207660_11189932 3300025917 Bacteria 620
380 Ga0207660_11726346 3300025917 Bacteria 503
381 Ga0207662_10040598 3300025918 Bacteria 2736
382 Ga0207662_10823619 3300025918 Bacteria 655
383 Ga0207657_10134465 3300025919 Bacteria 2024
384 Ga0207657_10192341 3300025919 Bacteria 1645
385 Ga0207657_10624397 3300025919 Bacteria 840
386 Ga0207649_10059611 3300025920 Bacteria 2395
387 Ga0207649_10284652 3300025920 Bacteria 1203
388 Ga0207649_10448539 3300025920 Bacteria 973
389 Ga0207652_10461974 3300025921 Bacteria 1144
390 Ga0207652_11793562 3300025921 Bacteria 519
391 Ga0207646_11875752 3300025922 Bacteria 511
392 Ga0207681_10037004 3300025923 Bacteria 3223
393 Ga0207694_10037025 3300025924 Bacteria 3745
394 Ga0207650_10039405 3300025925 Bacteria 3453
395 Ga0207650_10163241 3300025925 Bacteria 1766
396 Ga0207650_10172409 3300025925 Bacteria 1720
397 Ga0207650_11455561 3300025925 Bacteria 583
398 Ga0207659_10037462 3300025926 Bacteria 3368
399 Ga0207659_10216485 3300025926 Bacteria 1538
400 Ga0207659_10574573 3300025926 Bacteria 959
401 Ga0207659_11323980 3300025926 Bacteria 618
402 Ga0207687_11615204 3300025927 Bacteria 556
403 Ga0207687_11800710 3300025927 Bacteria 524
404 Ga0207700_10026068 3300025928 Bacteria 4071
405 Ga0207700_10143131 3300025928 Bacteria 1967
406 Ga0207700_10153827 3300025928 Bacteria 1903
407 Ga0207700_10694998 3300025928 Bacteria 908
408 Ga0207664_10026276 3300025929 Bacteria 4399
409 Ga0207664_10040338 3300025929 Bacteria 3630
410 Ga0207644_10607647 3300025931 Bacteria 908
411 Ga0207690_10181149 3300025932 Bacteria 1586
412 Ga0207690_10213555 3300025932 Bacteria 1472
413 Ga0207690_11402236 3300025932 Bacteria 584
414 Ga0207706_10120698 3300025933 Bacteria 2305
415 Ga0207706_10249799 3300025933 Bacteria 1550
416 Ga0207706_10427236 3300025933 Bacteria 1147
417 Ga0207706_10612496 3300025933 Bacteria 935
418 Ga0207686_10211190 3300025934 Bacteria 1395
419 Ga0207709_10834611 3300025935 Bacteria 746
420 Ga0207709_11242391 3300025935 Bacteria 615
421 Ga0207709_11347797 3300025935 Bacteria 590
422 Ga0207670_10015446 3300025936 Bacteria 4563
423 Ga0207670_11220513 3300025936 Bacteria 637
424 Ga0207669_10330718 3300025937 Bacteria 1170
425 Ga0207669_10509609 3300025937 Bacteria 964
426 Ga0207704_10061975 3300025938 Bacteria 2323
427 Ga0207704_10432381 3300025938 Bacteria 1046
428 Ga0207665_10844310 3300025939 Bacteria 725
429 Ga0207665_11212508 3300025939 Bacteria 602
430 Ga0207691_10003241 3300025940 Bacteria 15858
431 Ga0207691_10034050 3300025940 Bacteria 4741
432 Ga0207691_10159600 3300025940 Bacteria 1979
433 Ga0207691_10464926 3300025940 Bacteria 1076
434 Ga0207691_10541450 3300025940 Bacteria 987
435 Ga0207691_11410422 3300025940 Bacteria 572
436 Ga0207711_10116293 3300025941 Bacteria 2384
437 Ga0207711_10148571 3300025941 Bacteria 2113
438 Ga0207711_10263813 3300025941 Bacteria 1584
439 Ga0207689_10060980 3300025942 Bacteria 3102
440 Ga0207661_10046637 3300025944 Bacteria 3436
441 Ga0207661_10148680 3300025944 Bacteria 2023
442 Ga0207661_10440636 3300025944 Bacteria 1185
443 Ga0207661_10453473 3300025944 Bacteria 1168
444 Ga0207661_10538442 3300025944 Bacteria 1069
445 Ga0207679_10094142 3300025945 Bacteria 2325
446 Ga0207679_10115434 3300025945 Bacteria 2127
447 Ga0207679_10275936 3300025945 Bacteria 1440
448 Ga0207679_10369007 3300025945 Bacteria 1256
449 Ga0207679_10469775 3300025945 Bacteria 1118
450 Ga0207679_11832344 3300025945 Bacteria 554
451 Ga0207667_10000438 3300025949 Bacteria 55784
452 Ga0207667_10054147 3300025949 Bacteria 4220
453 Ga0207667_10080431 3300025949 Bacteria 3376
454 Ga0207667_10120706 3300025949 Bacteria 2701
455 Ga0207667_10532629 3300025949 Bacteria 1189
456 Ga0207667_11078949 3300025949 Bacteria 787
457 Ga0207667_11779875 3300025949 Bacteria 581
458 Ga0207651_10044954 3300025960 Bacteria 2959
459 Ga0207651_10049833 3300025960 Bacteria 2840
460 Ga0207651_10592134 3300025960 Bacteria 968
461 Ga0207651_11912507 3300025960 Bacteria 533
462 Ga0207712_11111599 3300025961 Bacteria 704
463 Ga0207712_11180360 3300025961 Bacteria 683
464 Ga0207712_11858715 3300025961 Bacteria 539
465 Ga0207668_10170685 3300025972 Bacteria 1705
466 Ga0207668_10813330 3300025972 Bacteria 828
467 Ga0207668_11650884 3300025972 Bacteria 579
468 Ga0207640_10164010 3300025981 Bacteria 1648
469 Ga0207658_10207146 3300025986 Bacteria 1641
470 Ga0207658_10334431 3300025986 Bacteria 1315
471 Ga0207658_10553881 3300025986 Bacteria 1029
472 Ga0207677_10558543 3300026023 Bacteria 999
473 Ga0207677_10874560 3300026023 Bacteria 809
474 Ga0207677_11010063 3300026023 Bacteria 755
475 Ga0207703_10320070 3300026035 Bacteria 1420
476 Ga0207639_10335709 3300026041 Bacteria 1346
477 Ga0207678_10228246 3300026067 Bacteria 1594
478 Ga0207678_10286314 3300026067 Bacteria 1415
479 Ga0207678_11119896 3300026067 Bacteria 697
480 Ga0207678_11339925 3300026067 Bacteria 633
481 Ga0207708_10567734 3300026075 Bacteria 958
482 Ga0207708_11487935 3300026075 Bacteria 595
483 Ga0207708_11562456 3300026075 Bacteria 580
484 Ga0207702_10100428 3300026078 Bacteria 2553
485 Ga0207702_10297815 3300026078 Bacteria 1530
486 Ga0207702_10714697 3300026078 Bacteria 988
487 Ga0207702_12128198 3300026078 Bacteria 550
488 Ga0207641_10234602 3300026088 Bacteria 1707
489 Ga0207641_10605511 3300026088 Bacteria 1073
490 Ga0207648_10009384 3300026089 Bacteria 9367
491 Ga0207648_11342871 3300026089 Bacteria 672
492 Ga0207676_10528943 3300026095 Bacteria 1123
493 Ga0207674_10019328 3300026116 Bacteria 7380
494 Ga0207674_10030258 3300026116 Bacteria 5694
495 Ga0207674_10471185 3300026116 Bacteria 1214
496 Ga0207674_11842393 3300026116 Bacteria 572
497 Ga0207675_100281049 3300026118 Bacteria 1617
498 Ga0207675_100560854 3300026118 Bacteria 1142
499 Ga0207675_100702801 3300026118 Bacteria 1020
500 Ga0207675_100762188 3300026118 Bacteria 979
501 Ga0207683_10188565 3300026121 Bacteria 1871
502 Ga0207683_10227218 3300026121 Bacteria 1701
503 Ga0207683_10406459 3300026121 Bacteria 1253
504 Ga0207698_10203459 3300026142 Bacteria 1775
505 Ga0207698_10212653 3300026142 Bacteria 1741
506 Ga0207698_10577776 3300026142 Bacteria 1105
507 Ga0207698_11302213 3300026142 Bacteria 741
508 Ga0209281_1015504 3300027111 Bacteria 1587
509 Ga0209969_1006876 3300027360 Bacteria 1603
510 Ga0209969_1064622 3300027360 Bacteria 579
511 Ga0209967_1002057 3300027364 Bacteria 2596
512 Ga0209996_1012602 3300027395 Bacteria 1137
513 Ga0210000_1000359 3300027462 Bacteria 6419
514 Ga0210000_1021166 3300027462 Bacteria 994
515 Ga0209179_1076816 3300027512 Bacteria 735
516 Ga0209968_1057529 3300027526 Bacteria 682
517 Ga0209968_1076531 3300027526 Bacteria 599
518 Ga0209999_1000555 3300027543 Bacteria 5868
519 Ga0209983_1046924 3300027665 Bacteria 941
520 Ga0209282_1125663 3300027666 Bacteria 1276
521 Ga0209588_1035122 3300027671 Bacteria 1611
522 Ga0209971_1006039 3300027682 Bacteria 2871
523 Ga0209974_10006308 3300027876 Bacteria 4145
524 Ga0209974_10016099 3300027876 Bacteria 2482
525 Ga0265355_1020574 3300028036 Bacteria 570
526 Ga0268265_10974493 3300028380 Bacteria 836
527 Ga0268265_11266507 3300028380 Bacteria 737
528 Ga0268264_10359998 3300028381 Bacteria 1387
529 Ga0265338_10460300 3300028800 Bacteria 900
530 Ga0316182_1388674 3300030745 Bacteria 1705
531 Ga0307408_100542836 3300031548 Bacteria 1025
532 Ga0307408_101042820 3300031548 Bacteria 756
533 Ga0307408_101318191 3300031548 Bacteria 677
534 Ga0316575_10000032 3300031665 Bacteria 33845
535 Ga0316575_10007166 3300031665 Bacteria 4035
536 Ga0316575_10208096 3300031665 Bacteria 815
537 Ga0316579_10000922 3300031691 Bacteria 10216
538 Ga0316579_10003486 3300031691 Bacteria 6145
539 Ga0316576_10505678 3300031727 Bacteria 888
540 Ga0316578_10019379 3300031728 Bacteria 3744
541 Ga0316578_10038835 3300031728 Bacteria 2748
542 Ga0307405_10302791 3300031731 Bacteria 1213
543 Ga0307405_11720673 3300031731 Bacteria 556
544 Ga0307413_10775714 3300031824 Bacteria 803
545 Ga0307410_10137989 3300031852 Bacteria 1800
546 Ga0307410_10643308 3300031852 Bacteria 889
547 Ga0307406_10053066 3300031901 Bacteria 2581
548 Ga0307406_10124064 3300031901 Bacteria 1801
549 Ga0307406_10333259 3300031901 Bacteria 1179
550 Ga0307406_11680663 3300031901 Bacteria 562
551 Ga0307412_10388759 3300031911 Bacteria 1132
552 Ga0307412_11207745 3300031911 Bacteria 677
553 Ga0307409_100321415 3300031995 Bacteria 1448
554 Ga0307409_100725525 3300031995 Bacteria 995
555 Ga0307409_100959655 3300031995 Bacteria 871
556 Ga0307409_101849815 3300031995 Bacteria 633
557 Ga0307409_102158352 3300031995 Bacteria 587
558 Ga0307416_100071671 3300032002 Bacteria 2880
559 Ga0307416_100094290 3300032002 Bacteria 2581
560 Ga0307416_100995760 3300032002 Bacteria 941
561 Ga0307416_101643754 3300032002 Bacteria 747
562 Ga0307416_101978192 3300032002 Bacteria 686
563 Ga0307416_102411812 3300032002 Bacteria 625
564 Ga0307416_102631432 3300032002 Bacteria 600
565 Ga0307414_10201808 3300032004 Bacteria 1618
566 Ga0307414_11979702 3300032004 Bacteria 544
567 Ga0307414_12178846 3300032004 Bacteria 518
568 Ga0307411_10189389 3300032005 Bacteria 1569
569 Ga0307411_10244153 3300032005 Bacteria 1408
570 Ga0307411_10288180 3300032005 Bacteria 1310
571 Ga0307415_100523335 3300032126 Bacteria 1041
572 Ga0307415_100606156 3300032126 Bacteria 975
573 Ga0307415_100911094 3300032126 Bacteria 811
574 Ga0307415_101085684 3300032126 Bacteria 748
575 Ga0316583_10003578 3300032133 Bacteria 5488
576 Ga0316583_10012848 3300032133 Bacteria 3021
577 Ga0316583_10110681 3300032133 Bacteria 957
578 Ga0316593_10236263 3300032168 Bacteria 681
579 Ga0373926_0012427 3300035083 Bacteria 2878
580 Ga0373926_0081631 3300035083 Bacteria 1196
581 Ga0373934_0000613 3300035086 Bacteria 12584
582 Ga0373944_0043393 3300035089 Bacteria 1397
583 Ga0373952_0161086 3300035092 Bacteria 636
584 Ga0373923_0021276 3300035111 Bacteria 2530
585 Ga0373945_0096315 3300035116 Bacteria 1153
586 Ga0373956_0097835 3300035119 Bacteria 1358
587 Ga0373957_0011425 3300035120 Bacteria 2964
588 Ga0373960_0038491 3300035121 Bacteria 1371
589 Ga0373943_0967145 3300035170 Bacteria 510
590 Ga0373946_0066655 3300035171 Bacteria 1544
591 Ga0373955_0000555 3300035172 Bacteria 15870
592 Ga0373942_0160572 3300035207 Bacteria 727
593 Ga0316574_0311636 3300035398 Bacteria 1000
594 Ga0373924_0031046 3300035410 Bacteria 2146
595 Ga0373935_0015507 3300035692 Bacteria 4607
596 Ga0373935_0518439 3300035692 Bacteria 867
597 Ga0373935_0568069 3300035692 Bacteria 828
598 Ga0373935_1182297 3300035692 Bacteria 570
599 Ga0373927_0027933 3300035695 Bacteria 3682
600 Ga0373927_0104013 3300035695 Bacteria 1848
601 Ga0373927_0164642 3300035695 Bacteria 1453
602 Ga0373933_0000055 3300035724 Bacteria 67484
603 Ga0373947_0037687 3300035725 Bacteria 2870
604 Ga0373947_0043390 3300035725 Bacteria 2686
605 Ga0373937_0000450 3300036401 Bacteria 37946
606 Ga0373937_0386729 3300036401 Bacteria 1327
607 Ga0316582_0000229 3300036647 Bacteria 18476
608 Ga0316582_0010275 3300036647 Bacteria 5119
609 Ga0316582_0131791 3300036647 Bacteria 1680
610 Ga0316584_0062296 3300036712 Bacteria 2794
611 Ga0316584_0124699 3300036712 Bacteria 1924
612 Ga0373925_0533729 3300037068 Bacteria 964
613 Ga0373925_0743704 3300037068 Bacteria 808
614 Ga0373925_1281198 3300037068 Bacteria 602
615 Ga0316581_0016222 3300037588 Bacteria 2137
616 Ga0316581_0018143 3300037588 Bacteria 2040
617 Ga0436364_0497955 3300037853 Bacteria 739
618 Ga0395901_0933184 3300038443 Bacteria 848
619 Ga0395901_1686137 3300038443 Bacteria 585
620 Ga0436365_0350682 3300039437 Bacteria 711
621 Ga0436365_1200738 3300039437 Bacteria 961
622 Ga0436365_1592469 3300039437 Bacteria 1269
623 Ga0436361_0730207 3300039447 Bacteria 2322
624 Ga0436361_1079523 3300039447 Bacteria 3333
625 Ga0439436_0140609 3300041404 Bacteria 679
626 Ga0439439_0249705 3300041406 Bacteria 526
627 Ga0439461_0062686 3300041410 Bacteria 847
628 Ga0451841_0300790 3300041498 Bacteria 582
629 Ga0451845_0910423 3300041501 Bacteria 676
630 Ga0451847_0780003 3300041503 Bacteria 529
631 Ga0451853_3739149 3300041512 Bacteria 817
632 Ga0439445_0190724 3300042004 Bacteria 604
633 Ga0439445_0224983 3300042004 Bacteria 557
634 Ga0439449_0046339 3300042007 Bacteria 1611
635 Ga0439452_034928 3300042010 Bacteria 1212
636 Ga0439455_0033113 3300042012 Bacteria 1295
637 Ga0439457_100883 3300042014 Bacteria 673
638 Ga0450912_004316 3300042116 Bacteria 1050
639 Ga0450917_003459 3300042120 Bacteria 1144
640 Ga0450923_116922 3300042125 Bacteria 626
641 Ga0450888_002272 3300042126 Bacteria 1889
642 Ga0450890_009447 3300042127 Bacteria 1249
643 Ga0450891_000222 3300042129 Bacteria 5702
644 Ga0450892_001107 3300042130 Bacteria 2814
645 Ga0450903_020990 3300042138 Bacteria 1010
646 Ga0439434_0095027 3300042435 Bacteria 956
647 Ga0439444_0002332 3300042437 Bacteria 2584
648 Ga0439459_0017764 3300042438 Bacteria 1330
649 Ga0450893_0000472 3300042532 Bacteria 5678
650 Ga0451577_0804129 3300042876 Bacteria 849
651 Ga0439440_0114816 3300042993 Bacteria 744
652 Ga0439440_0140568 3300042993 Bacteria 685
653 Ga0453683_0074998 3300044673 Bacteria 2118
654 Ga0453683_0518135 3300044673 Bacteria 774
655 Ga0453684_0743783 3300044712 Bacteria 1062
656 Ga0453684_0872633 3300044712 Bacteria 965
657 Ga0451576_0072908 3300045051 Bacteria 3573
658 Ga0451576_1661229 3300045051 Bacteria 662
659 Ga0451576_2252183 3300045051 Bacteria 559
660 Ga0466967_1666302 3300045976 Bacteria 635
661 Ga0495592_0002705 3300046454 Bacteria 12543
662 Ga0495592_0825445 3300046454 Bacteria 549
663 Ga0495629_0011314 3300046459 Bacteria 6483
664 Ga0495629_0064592 3300046459 Bacteria 2556
665 Ga0495629_0142153 3300046459 Bacteria 1669
666 Ga0495651_0000996 3300046462 Bacteria 21980
667 Ga0495651_0647505 3300046462 Bacteria 663
668 Ga0495653_0000195 3300046463 Bacteria 49244
669 Ga0495650_0012788 3300046471 Bacteria 4492
670 Ga0495580_0008769 3300046472 Bacteria 8008
671 Ga0495580_0048643 3300046472 Bacteria 3001
672 Ga0495580_0068932 3300046472 Bacteria 2472
673 Ga0495582_0041545 3300046473 Bacteria 2534
674 Ga0495582_0215716 3300046473 Bacteria 1097
675 Ga0495582_0538044 3300046473 Bacteria 675
676 Ga0495582_0725799 3300046473 Bacteria 575
677 Ga0495639_0008494 3300046475 Bacteria 4403
678 Ga0495639_0089033 3300046475 Bacteria 1446
679 Ga0495639_0120029 3300046475 Bacteria 1254
680 Ga0495664_0054273 3300046477 Bacteria 2383
681 Ga0495594_0036114 3300046499 Bacteria 2694
682 Ga0495594_0274194 3300046499 Bacteria 961
683 Ga0495594_0695554 3300046499 Bacteria 575
684 Ga0495596_0103789 3300046500 Bacteria 1104
685 Ga0495596_0334621 3300046500 Bacteria 589
686 Ga0495583_0008785 3300046506 Bacteria 6126
687 Ga0495606_0006532 3300046507 Bacteria 10727
688 Ga0495608_0000085 3300046511 Bacteria 68124
689 Ga0495608_0662561 3300046511 Bacteria 623
690 Ga0495628_0034222 3300046516 Bacteria 4088
691 Ga0495630_0011652 3300046517 Bacteria 6372
692 Ga0495630_0022736 3300046517 Bacteria 4631
693 Ga0495630_0155017 3300046517 Bacteria 1743
694 Ga0495630_1355860 3300046517 Bacteria 535
695 Ga0495663_0062093 3300046525 Bacteria 1176
696 Ga0495663_0082676 3300046525 Bacteria 1036
697 Ga0495663_0213062 3300046525 Bacteria 677
698 Ga0495666_0184231 3300046526 Bacteria 963
699 Ga0495642_0053050 3300046528 Bacteria 1670
700 Ga0495652_0008685 3300046529 Bacteria 9262
701 Ga0495654_0368700 3300046530 Bacteria 575
702 Ga0495665_0005306 3300046531 Bacteria 6945
703 Ga0495665_0103981 3300046531 Bacteria 1490
704 Ga0495665_0106728 3300046531 Bacteria 1469
705 Ga0495665_0652993 3300046531 Bacteria 523
706 Ga0495640_0304947 3300046533 Bacteria 988
707 Ga0495587_0000114 3300046536 Bacteria 61671
708 Ga0495598_0189898 3300046537 Bacteria 737
709 Ga0495621_0006211 3300046539 Bacteria 3475
710 Ga0495621_0204629 3300046539 Bacteria 795
711 Ga0495621_0254339 3300046539 Bacteria 718
712 Ga0495645_0000144 3300046543 Bacteria 48490
713 Ga0495645_0629896 3300046543 Bacteria 657
714 Ga0495667_0000241 3300046559 Bacteria 35516
715 Ga0495667_0082166 3300046559 Bacteria 2094
716 Ga0495667_0459167 3300046559 Bacteria 800
717 Ga0495668_0107838 3300046616 Bacteria 1523
718 Ga0495634_0261307 3300046642 Bacteria 1056
719 Ga0495625_0152379 3300046660 Bacteria 1553
720 Ga0495625_0534897 3300046660 Bacteria 712
721 Ga0495635_0000253 3300046663 Bacteria 34161
722 Ga0495635_0336897 3300046663 Bacteria 1008
723 Ga0495635_0889632 3300046663 Bacteria 571
724 Ga0495659_0241169 3300046664 Bacteria 751
725 Ga0495659_0302271 3300046664 Bacteria 676
726 Ga0495588_0066857 3300046674 Bacteria 1866
727 Ga0495588_0126015 3300046674 Bacteria 1350
728 Ga0495588_0298141 3300046674 Bacteria 849
729 Ga0495588_0439476 3300046674 Bacteria 685
730 Ga0495657_0000210 3300046675 Bacteria 52663
731 Ga0495657_0254549 3300046675 Bacteria 1056
732 Ga0495599_0000436 3300046678 Bacteria 23725
733 Ga0495623_0000305 3300046679 Bacteria 31845
734 Ga0495646_0011487 3300046680 Bacteria 5621
735 Ga0495658_0001556 3300046683 Bacteria 11985
736 Ga0495658_0489290 3300046683 Bacteria 787
737 Ga0495669_0003327 3300046684 Bacteria 6614
738 Ga0495669_0162795 3300046684 Bacteria 1059
739 Ga0495669_0366748 3300046684 Bacteria 697
740 Ga0495669_0560199 3300046684 Bacteria 556
741 Ga0495613_0065654 3300046689 Bacteria 2652
742 Ga0495613_0068004 3300046689 Bacteria 2599
743 Ga0495613_0694257 3300046689 Bacteria 670
744 Ga0495649_0012212 3300046694 Bacteria 5008
745 Ga0495589_0045800 3300046794 Bacteria 2172
746 Ga0495600_0000023 3300046809 Bacteria 94401
747 Ga0495581_0009338 3300047315 Bacteria 5676
748 Ga0495604_0000251 3300047317 Bacteria 47665
749 Ga0495604_0245664 3300047317 Bacteria 1222
750 Ga0495604_0567091 3300047317 Bacteria 731
751 Ga0495636_0077133 3300047318 Bacteria 1430
752 Ga0495674_0040004 3300047319 Bacteria 4197
753 Ga0495674_0461643 3300047319 Bacteria 1019
754 Ga0495672_0003697 3300047320 Bacteria 12916
755 Ga0495672_0167004 3300047320 Bacteria 1126
756 Ga0495680_0006224 3300047322 Bacteria 11126
757 Ga0495675_0005468 3300047444 Bacteria 7750
758 Ga0495675_0416813 3300047444 Bacteria 781
759 Ga0495685_054585 3300047447 Bacteria 1352
760 Ga0495684_0000037 3300047471 Bacteria 106933
761 Ga0495686_0009043 3300047472 Bacteria 7228
762 Ga0495593_0153212 3300047673 Bacteria 1165
763 Ga0495593_0172241 3300047673 Bacteria 1091
764 Ga0495593_0659117 3300047673 Bacteria 525
765 Ga0495602_0002980 3300048088 Bacteria 17361
766 Ga0495602_0523073 3300048088 Bacteria 826
767 Ga0495602_0661447 3300048088 Bacteria 712
768 Ga0495614_0003629 3300048089 Bacteria 6920
769 Ga0495615_0030918 3300048090 Bacteria 1281
770 Ga0496100_0338633 3300048903 Bacteria 1134
771 Ga0496100_0706097 3300048903 Bacteria 787
772 Ga0496101_1373097 3300048904 Bacteria 551
773 Ga0496104_0115322 3300048907 Bacteria 2577
774 Ga0496104_0405684 3300048907 Bacteria 1275
775 Ga0496104_0433022 3300048907 Bacteria 1227
776 Ga0496104_0708472 3300048907 Bacteria 914
777 Ga0496105_0008533 3300048908 Bacteria 7960
778 Ga0496105_0179939 3300048908 Bacteria 1732
779 Ga0496106_0076551 3300048909 Bacteria 2565
780 Ga0496106_1420676 3300048909 Bacteria 536
781 Ga0496107_0170082 3300048910 Bacteria 1617
782 Ga0496108_0270466 3300048911 Bacteria 1479
783 Ga0496109_0186466 3300048912 Bacteria 1949
784 Ga0496109_0706940 3300048912 Bacteria 945
785 Ga0496110_0385554 3300048913 Bacteria 1277
786 Ga0496111_0659780 3300048914 Bacteria 763
787 Ga0496111_1077685 3300048914 Bacteria 573
788 Ga0496112_0016641 3300048915 Bacteria 6895
789 Ga0496113_0301778 3300048916 Bacteria 1282
790 Ga0496114_0110142 3300048917 Bacteria 2358
791 Ga0496114_0451355 3300048917 Bacteria 1139
792 Ga0496115_0218617 3300048918 Bacteria 1572
793 Ga0496115_0385705 3300048918 Bacteria 1139
794 Ga0496115_0640522 3300048918 Bacteria 841
795 Ga0496115_0669474 3300048918 Bacteria 819
796 Ga0496117_0000278 3300048920 Bacteria 95496
797 Ga0496124_0875548 3300048927 Bacteria 548
798 Ga0496125_0113300 3300048928 Bacteria 1957
799 Ga0501306_053080 3300049127 Bacteria 654
800 Ga0501308_005184 3300049128 Bacteria 1287
801 Ga0501309_000129 3300049129 Bacteria 4661
802 Ga0501310_000219 3300049130 Bacteria 5455
803 Ga0501304_001129 3300049160 Bacteria 1642
804 Ga0501305_000428 3300049161 Bacteria 3421
805 Ga0501307_005139 3300049162 Bacteria 1368
806 Ga0501292_053519 3300049515 Bacteria 720
807 Ga0501294_024649 3300049517 Bacteria 672
808 Ga0501299_050248 3300049522 Bacteria 860
809 Ga0501299_215354 3300049522 Bacteria 516
810 Ga0501300_000306 3300049523 Bacteria 7395
811 Ga0501311_000655 3300049527 Bacteria 2575
812 Ga0501311_038849 3300049527 Bacteria 716
813 Ga0501312_001901 3300049528 Bacteria 2163
814 Ga0501313_005114 3300049529 Bacteria 1373
815 Ga0501314_000050 3300049530 Bacteria 5184
816 Ga0501315_001210 3300049531 Bacteria 2135
817 Ga0501315_027922 3300049531 Bacteria 799
818 Ga0501316_030814 3300049532 Bacteria 717
819 Ga0501317_002747 3300049533 Bacteria 1692
820 Ga0501318_012445 3300049534 Bacteria 975
821 Ga0501321_027411 3300049537 Bacteria 744
822 Ga0501325_017376 3300049541 Bacteria 728
823 Ga0501033_0040060 3300049570 Bacteria 3498
824 Ga0501033_0932162 3300049570 Bacteria 583
825 Ga0501034_0126349 3300049571 Bacteria 2542
826 Ga0501034_0252901 3300049571 Bacteria 1706
827 Ga0501036_0058733 3300049572 Bacteria 3259
828 Ga0501036_0310142 3300049572 Bacteria 1319
829 Ga0501036_0956207 3300049572 Bacteria 702
830 Ga0501037_0033043 3300049573 Bacteria 3822
831 Ga0501037_0474293 3300049573 Bacteria 851
832 Ga0501038_0030062 3300049574 Bacteria 4810
833 Ga0501039_0129507 3300049575 Bacteria 1980
834 Ga0501039_0138074 3300049575 Bacteria 1915
835 Ga0501039_0558671 3300049575 Bacteria 898
836 Ga0501041_0461416 3300049577 Bacteria 807
837 Ga0501042_0759586 3300049578 Bacteria 705
838 Ga0501043_0007959 3300049579 Bacteria 8372
839 Ga0501043_0445092 3300049579 Bacteria 974
840 Ga0501046_0195899 3300049580 Bacteria 1505
841 Ga0501046_0299501 3300049580 Bacteria 1175
842 Ga0501047_0034967 3300049581 Bacteria 4852
843 Ga0501047_0694399 3300049581 Bacteria 835
844 Ga0501048_0282626 3300049582 Bacteria 1180
845 Ga0501048_1094189 3300049582 Bacteria 573
846 Ga0501068_0126379 3300049584 Bacteria 1597
847 Ga0501069_0278331 3300049585 Bacteria 979
848 Ga0501070_0712859 3300049586 Bacteria 793
849 Ga0501071_0119317 3300049587 Bacteria 1954
850 Ga0501071_0233595 3300049587 Bacteria 1386
851 Ga0501071_1007948 3300049587 Bacteria 643
852 Ga0501072_0275302 3300049588 Bacteria 1339
853 Ga0501073_0009894 3300049589 Bacteria 7018
854 Ga0501073_0238113 3300049589 Bacteria 1257
855 Ga0501074_0016929 3300049590 Bacteria 5289
856 Ga0501074_0470645 3300049590 Bacteria 891
857 Ga0501075_0712888 3300049591 Bacteria 764
858 Ga0501075_1055326 3300049591 Bacteria 617
859 Ga0501076_0361483 3300049592 Bacteria 1192
860 Ga0501076_0620888 3300049592 Bacteria 892
861 Ga0501077_0325612 3300049593 Bacteria 980
862 Ga0501077_1040063 3300049593 Bacteria 527
863 Ga0501198_128946 3300049649 Bacteria 540
864 Ga0501206_014163 3300049653 Bacteria 1094
865 Ga0501210_001725 3300049657 Bacteria 1287
866 Ga0501211_004106 3300049658 Bacteria 1490
867 Ga0501216_109924 3300049660 Bacteria 618
868 Ga0501222_020639 3300049662 Bacteria 881
869 Ga0501223_024425 3300049663 Bacteria 1176
870 Ga0501223_046172 3300049663 Bacteria 845
871 Ga0501223_135690 3300049663 Bacteria 527
872 Ga0501227_004174 3300049665 Bacteria 3107
873 Ga0501233_003475 3300049668 Bacteria 2834
874 Ga0501235_003946 3300049669 Bacteria 3210
875 Ga0501239_039619 3300049672 Bacteria 648
876 Ga0501243_109855 3300049675 Bacteria 564
877 Ga0501243_137035 3300049675 Bacteria 515
878 Ga0501249_008085 3300049679 Bacteria 2182
879 Ga0501253_063853 3300049683 Bacteria 799
880 Ga0501255_016054 3300049684 Bacteria 921
881 Ga0501258_002063 3300049687 Bacteria 1728
882 Ga0501221_003510 3300049704 Bacteria 2582
883 Ga0501225_0003592 3300049705 Bacteria 4676
884 Ga0501229_038397 3300049706 Bacteria 676
885 Ga0501234_077211 3300049707 Bacteria 583
886 Ga0501079_0264274 3300049741 Bacteria 1345
887 Ga0501079_1522117 3300049741 Bacteria 526
888 Ga0501080_0008652 3300049742 Bacteria 9241
889 Ga0501080_0057515 3300049742 Bacteria 3620
890 Ga0501081_0119454 3300049743 Bacteria 1876
891 Ga0501083_0035946 3300049744 Bacteria 3382
892 Ga0501262_004570 3300049759 Bacteria 1609
893 Ga0501267_000175 3300049764 Bacteria 4374
894 Ga0501271_006347 3300049768 Bacteria 1172
895 Ga0501272_032672 3300049769 Bacteria 667
896 Ga0501275_076951 3300049772 Bacteria 535
897 Ga0501283_048226 3300049779 Bacteria 750
898 Ga0501035_0268059 3300049822 Bacteria 1446
899 Ga0501035_0674645 3300049822 Bacteria 836
900 Ga0501044_0015304 3300049823 Bacteria 8262
901 Ga0501044_0525921 3300049823 Bacteria 1082
902 nmdc:mga03683_622358_c1 3300050489 Bacteria 530
903 nmdc:mga0k408_25245_c2 3300050493 Bacteria 2413
904 nmdc:mga07m45_7457_c1 3300050496 Bacteria 5592
905 nmdc:mga09592_852973_c1 3300050508 Bacteria 768
906 nmdc:mga0qj67_60894_c1 3300050509 Bacteria 2996
907 nmdc:mga0qj67_638307_c1 3300050509 Bacteria 850
908 nmdc:mga0qj67_643432_c1 3300050509 Bacteria 846
909 nmdc:mga06r32_441888_c1 3300050510 Bacteria 1281
910 nmdc:mga06r32_687524_c1 3300050510 Bacteria 989
911 nmdc:mga08y16_107923_c1 3300050511 Bacteria 2898
912 nmdc:mga0n895_2003095_c1 3300050512 Bacteria 537
913 nmdc:mga0n895_766365_c1 3300050512 Bacteria 957
914 nmdc:mga0rr50_1745688_c1 3300050513 Bacteria 524
915 nmdc:mga0rr50_385862_c1 3300050513 Bacteria 1182
916 nmdc:mga08x19_192665_c1 3300050514 Bacteria 1395
917 nmdc:mga08x19_312301_c1 3300050514 Bacteria 1093
918 nmdc:mga0a205_238225_c1 3300050515 Bacteria 1701
919 Ga0495601_0002235 3300053077 Bacteria 10903
920 Ga0495601_0590726 3300053077 Bacteria 713
921 Ga0495612_0000577 3300053078 Bacteria 14757
922 Ga0495612_0478171 3300053078 Bacteria 570
923 Ga0495655_0297108 3300053083 Bacteria 554
924 Ga0495595_0011132 3300053084 Bacteria 3756
925 Ga0495619_0006426 3300053085 Bacteria 7446
926 Ga0500651_0700854 3300053093 Bacteria 541
927 Ga0500608_199548 3300053122 Bacteria 828
928 Ga0500568_0168736 3300053139 Bacteria 806
929 Ga0500604_0064906 3300053151 Bacteria 1154
930 Ga0500627_0292841 3300053158 Bacteria 712
931 Ga0500633_0277547 3300053160 Bacteria 620
932 Ga0500636_0105745 3300053177 Bacteria 1595
933 Ga0500636_0495408 3300053177 Bacteria 541
934 Ga0501084_0547311 3300054114 Bacteria 978
935 Ga0590071_032829 3300059421 Bacteria 1240
936 Ga0590074_029865 3300059423 Bacteria 961
937 Ga0590075_170084 3300059424 Bacteria 576
938 Ga0587076_016241 3300059645 Bacteria 1172
939 Ga0501082_0653376 3300060353 Bacteria 920
940 Ga0501082_0717548 3300060353 Bacteria 875
941 2511385534 2511231026 Bacteria 5225445
942 2521557732 2521172590 Bacteria 5047645
943 2553002847 2551306416 Bacteria 6152985
944 2595446621 2593339238 Bacteria 4182970
945 2595451887 2593339239 Bacteria 4124669
946 2643935861 2643221585 Bacteria 5812563
947 2644221322 2643221639 Bacteria 6649903
948 2644257920 2643221646 Bacteria 6433402
949 2644317644 2643221656 Bacteria 5809961
950 2721026753 2718218334 Bacteria 4765486
951 2735837693 2734482264 Unclassified 5014763
952 2739228298 2738543009 Bacteria 4944499
953 2765570096 2765235838 Bacteria 5445269
954 2819615135 2818991449 Bacteria 5518009
955 2839096964 2839094727 Bacteria 5534556
956 2842918033 2842914999 Bacteria 4419378
957 2842919508 2842918807 Bacteria 4289178
958 2904441528 2904439833 Bacteria 5931679
959 2904531542 2904530477 Bacteria 5876334
960 2904586821 2904584206 Bacteria 6028872
961 2904593146 2904589729 Bacteria 6113573
962 2904603008 2904601388 Bacteria 5884906
963 2919050833 2919046199 Bacteria 5567169
964 2919083971 2919079590 Bacteria 5946433
965 2919087717 2919085039 Bacteria 4532964
966 2919404961 2919404418 Bacteria 4232372
967 2923510937 2923510766 Bacteria 5926163
968 2928130909 2928130867 Bacteria 5467269
969 2953998027 2953994433 Bacteria 4303959
970 Ga0157376_11997844
971 LJQas_1020049
972 JGI24738J21930_10006379
973 JGI25152J39213_1025333
974 JGI25406J46586_10017790
975 JGI25153J46596_10055107
976 Ga0006554J51385_1033774
977 Ga0006562J51391_1061648
978 Ga0055538_1000155
979 Ga0055539_1000205
980 Ga0055533_1000100
981 Ga0055533_1000207
982 Ga0055525_1000284
983 Ga0055525_1000947
984 Ga0055530_10014353
985 Ga0055531_10000310
986 Ga0055541_1000133
987 Ga0055543_1030932
988 Ga0065165_1000028
989 Ga0065712_10391693
990 Ga0070658_10003448
991 Ga0070658_10011571
992 Ga0070658_10238554
993 Ga0070658_10339180
994 Ga0070658_10368122
995 Ga0070658_10564196
996 Ga0070658_10691620
997 Ga0070658_11388562
998 Ga0070676_10045115
999 Ga0070676_10126377
1000 Ga0070676_10327830
1001 Ga0070683_100026589
1002 Ga0070683_100042213
1003 Ga0070683_100053034
1004 Ga0070683_100244034
1005 Ga0070683_100361467
1006 Ga0070683_100583988
1007 Ga0070683_101823334
1008 Ga0070683_102390580
1009 Ga0070690_100117944
1010 Ga0070690_100254849
1011 Ga0070670_100194310
1012 Ga0070670_100559842
1013 Ga0070670_100814984
1014 Ga0070670_101004883
1015 Ga0070670_101581087
1016 Ga0068869_100052726
1017 Ga0070666_10669473
1018 Ga0070680_100001111
1019 Ga0070680_100048545
1020 Ga0070680_101719489
1021 Ga0070680_101944804
1022 Ga0068868_101508223
1023 Ga0068868_101613833
1024 Ga0070660_100541286
1025 Ga0070660_101180715
1026 Ga0070689_100040508
1027 Ga0070689_101276798
1028 Ga0070689_101992526
1029 Ga0070661_100164706
1030 Ga0070661_100167277
1031 Ga0070661_100275338
1032 Ga0070661_100303941
1033 Ga0070661_101198879
1034 Ga0070661_101247530
1035 Ga0070661_101903415
1036 Ga0070692_10054841
1037 Ga0070668_100116431
1038 Ga0070668_100813502
1039 Ga0070668_100946918
1040 Ga0070669_100095390
1041 Ga0070675_100004759
1042 Ga0070675_100230725
1043 Ga0070675_100245717
1044 Ga0070675_100309384
1045 Ga0070675_101587900
1046 Ga0070675_101730905
1047 Ga0070671_100175628
1048 Ga0070671_100407398
1049 Ga0070671_100516138
1050 Ga0070671_100525976
1051 Ga0070671_100945627
1052 Ga0070674_100401045
1053 Ga0070673_100391182
1054 Ga0070673_100663455
1055 Ga0070673_100770639
1056 Ga0070673_102002971
1057 Ga0070688_100018584
1058 Ga0070659_100048436
1059 Ga0070659_100184565
1060 Ga0070659_100297699
1061 Ga0070659_100308167
1062 Ga0070659_100920587
1063 Ga0070667_100137301
1064 Ga0070667_100654787
1065 Ga0070709_10009593
1066 Ga0070709_10036089
1067 Ga0070709_10056629
1068 Ga0070709_11591162
1069 Ga0070714_100004697
1070 Ga0070714_100029810
1071 Ga0070714_100392216
1072 Ga0070714_101598920
1073 Ga0070713_100000168
1074 Ga0070713_100051526
1075 Ga0070713_102055622
1076 Ga0070710_10106524
1077 Ga0070710_10175492
1078 Ga0070711_100115217
1079 Ga0070711_100884414
1080 Ga0070700_100719378
1081 Ga0070694_100050054
1082 Ga0070694_100092890
1083 Ga0070663_100032502
1084 Ga0070663_100114062
1085 Ga0070678_100090584
1086 Ga0070678_101610695
1087 Ga0070678_101705827
1088 Ga0070662_100146176
1089 Ga0070662_100269442
1090 Ga0070662_100840166
1091 Ga0070662_101342267
1092 Ga0070681_10023492
1093 Ga0070681_10077854
1094 Ga0070681_10324270
1095 Ga0070681_10401530
1096 Ga0070681_10791978
1097 Ga0068867_100010986
1098 Ga0070685_10087289
1099 Ga0070685_10093785
1100 Ga0070706_100454631
1101 Ga0070699_100230574
1102 Ga0070679_100032089
1103 Ga0070679_100888116
1104 Ga0070679_101108943
1105 Ga0070679_101290837
1106 Ga0070684_100017327
1107 Ga0070684_100027011
1108 Ga0070684_100063417
1109 Ga0070684_100310942
1110 Ga0070684_100562247
1111 Ga0070684_100920190
1112 Ga0068853_100576328
1113 Ga0068853_101749056
1114 Ga0070672_100114001
1115 Ga0070672_100166475
1116 Ga0070672_100265732
1117 Ga0070672_100300661
1118 Ga0070672_100567463
1119 Ga0070672_101092428
1120 Ga0070672_101306804
1121 Ga0070686_100639050
1122 Ga0070686_100971405
1123 Ga0070695_100318783
1124 Ga0070695_100327524
1125 Ga0070695_100520785
1126 Ga0070695_101534646
1127 Ga0070695_101637135
1128 Ga0070696_100113732
1129 Ga0070696_100122741
1130 Ga0070693_100012610
1131 Ga0070693_100797629
1132 Ga0070704_100003924
1133 Ga0070704_101408657
1134 Ga0068855_100004465
1135 Ga0068855_100068633
1136 Ga0068855_100334991
1137 Ga0070664_100046540
1138 Ga0070664_100071150
1139 Ga0070664_100377929
1140 Ga0070664_100402657
1141 Ga0070664_100428124
1142 Ga0070664_100492270
1143 Ga0070664_101350123
1144 Ga0070664_101799579
1145 Ga0068857_100036956
1146 Ga0068857_100091619
1147 Ga0068857_100672225
1148 Ga0068854_100029527
1149 Ga0068854_100395260
1150 Ga0068856_100348838
1151 Ga0068856_100358922
1152 Ga0068856_100398126
1153 Ga0070702_100973644
1154 Ga0068852_100228011
1155 Ga0068852_100249695
1156 Ga0068852_100345930
1157 Ga0068852_100803720
1158 Ga0068859_100020486
1159 Ga0068859_100531651
1160 Ga0068859_102185738
1161 Ga0068864_100048790
1162 Ga0068866_11271712
1163 Ga0068861_100248109
1164 Ga0068861_100265826
1165 Ga0068861_101091389
1166 Ga0068851_10233002
1167 Ga0068851_10310274
1168 Ga0068870_10001350
1169 Ga0068863_100345344
1170 Ga0068863_101500322
1171 Ga0068858_100020744
1172 Ga0068858_100086515
1173 Ga0068858_102211906
1174 Ga0068860_100038331
1175 Ga0068862_100088865
1176 Ga0068862_100607312
1177 Ga0081539_10000103
1178 Ga0070717_10058340
1179 Ga0070717_10471490
1180 Ga0070717_10724409
1181 Ga0070712_100003656
1182 Ga0070712_100211655
1183 Ga0070712_100257583
1184 Ga0075369_10019451
1185 Ga0075366_10027909
1186 Ga0075370_10050067
1187 Ga0068871_100288671
1188 Ga0075430_100191765
1189 Ga0075430_100655505
1190 Ga0075430_101006359
1191 Ga0075431_100075350
1192 Ga0075431_100204773
1193 Ga0075431_101245805
1194 Ga0075433_10339054
1195 Ga0075429_101055457
1196 Ga0075429_101408755
1197 Ga0068865_100236802
1198 Ga0075436_100100836
1199 Ga0075436_100560910
1200 Ga0097620_100020486
1201 Ga0097620_100531639
1202 Ga0097620_102185929
1203 Ga0079104_1016283
1204 Ga0075435_100004837
1205 Ga0075435_100483296
1206 Ga0099794_10023946
1207 Ga0099795_10003070
1208 Ga0099795_10280020
1209 Ga0105251_10350811
1210 Ga0105240_10013785
1211 Ga0105240_10302459
1212 Ga0105240_10880214
1213 Ga0105240_12381192
1214 Ga0111539_10196609
1215 Ga0111539_10458223
1216 Ga0105245_12011763
1217 Ga0105247_11298443
1218 Ga0114129_11524445
1219 Ga0114129_12938087
1220 Ga0105243_10046635
1221 Ga0105243_11778904
1222 Ga0105242_12427266
1223 Ga0105248_10187820
1224 Ga0105248_11247886
1225 Ga0105237_10039956
1226 Ga0105237_12592574
1227 Ga0105238_10061680
1228 Ga0105238_10434183
1229 Ga0105238_10657967
1230 Ga0105238_10797331
1231 Ga0105238_11095629
1232 Ga0105249_10948572
1233 Ga0105249_11055526
1234 Ga0105249_13487615
1235 Ga0099796_10458075
1236 Ga0105239_10025227
1237 Ga0105239_11405377
1238 Ga0105239_12174877
1239 Ga0105246_10411305
1240 Ga0105246_10852407
1241 Ga0105246_11041459
1242 Ga0157347_1020377
1243 Ga0157373_10348239
1244 Ga0157373_10572287
1245 Ga0157371_10111548
1246 Ga0157371_10385107
1247 Ga0157371_11164409
1248 Ga0157370_10027470
1249 Ga0157370_10044296
1250 Ga0157370_10286338
1251 Ga0157370_10315306
1252 Ga0157370_11789799
1253 Ga0157369_10155261
1254 Ga0157369_10646827
1255 Ga0157369_11329576
1256 Ga0157369_12252195
1257 Ga0157374_11279188
1258 Ga0157374_12313574
1259 Ga0157378_10506210
1260 Ga0157378_10920836
1261 Ga0157378_11115765
1262 Ga0157378_11387265
1263 Ga0163162_10460780
1264 Ga0163162_10555845
1265 Ga0163162_10670238
1266 Ga0163162_11735111
1267 Ga0163162_12903158
1268 Ga0157372_10051984
1269 Ga0157372_10079293
1270 Ga0157372_10463378
1271 Ga0157375_10141341
1272 Ga0157375_10709640
1273 Ga0157375_11113680
1274 Ga0163163_10352776
1275 Ga0163163_11550547
1276 Ga0163163_12860585
1277 Ga0157380_10396090
1278 Ga0157380_12000636
1279 Ga0182008_10002555
1280 Ga0182008_10013374
1281 Ga0182008_10273328
1282 Ga0157377_10364316
1283 Ga0157377_10657886
1284 Ga0157377_11365740
1285 Ga0157379_10648618
1286 Ga0157376_10605332
1287 Ga0157376_10894730
1288 Ga0157376_11892112
1289 Ga0157376_13009303
1290 Ga0182006_1000465
1291 Ga0182007_10007704
1292 Ga0182007_10282251
1293 Ga0182005_1000078
1294 Ga0209784_100002
1295 Ga0209566_100003
1296 Ga0209674_100003
1297 Ga0209674_100004
1298 Ga0209563_100006
1299 Ga0209563_100017
1300 Ga0209677_100003
1301 Ga0209677_100467
1302 Ga0209051_1011278
1303 Ga0209257_1000032
1304 Ga0207697_10117564
1305 Ga0207656_10131262
1306 Ga0207656_10303200
1307 Ga0207656_10485358
1308 Ga0207656_10497700
1309 Ga0207682_10301251
1310 Ga0207682_10383952
1311 Ga0207682_10495084
1312 Ga0207692_10081066
1313 Ga0207692_10283405
1314 Ga0207642_10198671
1315 Ga0207647_10068185
1316 Ga0207685_10219732
1317 Ga0207699_10010032
1318 Ga0207699_10019110
1319 Ga0207699_10074048
1320 Ga0207699_10391367
1321 Ga0207645_10117231
1322 Ga0207645_10128707
1323 Ga0207645_10196254
1324 Ga0207643_10008540
1325 Ga0207705_10020296
1326 Ga0207705_10066042
1327 Ga0207705_10083344
1328 Ga0207705_10480128
1329 Ga0207705_10480231
1330 Ga0207705_10563023
1331 Ga0207707_10008443
1332 Ga0207707_10188488
1333 Ga0207707_10681211
1334 Ga0207707_11121705
1335 Ga0207695_10001853
1336 Ga0207695_10003759
1337 Ga0207695_10037174
1338 Ga0207671_10013287
1339 Ga0207693_10003536
1340 Ga0207693_10113785
1341 Ga0207693_10122685
1342 Ga0207663_10004765
1343 Ga0207663_10088813
1344 Ga0207660_10000108
1345 Ga0207660_10184576
1346 Ga0207660_10187336
1347 Ga0207660_10473100
1348 Ga0207660_11189932
1349 Ga0207660_11726346
1350 Ga0207662_10040598
1351 Ga0207662_10823619
1352 Ga0207657_10134465
1353 Ga0207657_10192341
1354 Ga0207657_10624397
1355 Ga0207649_10059611
1356 Ga0207649_10284652
1357 Ga0207649_10448539
1358 Ga0207652_10461974
1359 Ga0207652_11793562
1360 Ga0207646_11875752
1361 Ga0207681_10037004
1362 Ga0207694_10037025
1363 Ga0207650_10039405
1364 Ga0207650_10163241
1365 Ga0207650_10172409
1366 Ga0207650_11455561
1367 Ga0207659_10037462
1368 Ga0207659_10216485
1369 Ga0207659_10574573
1370 Ga0207659_11323980
1371 Ga0207687_11615204
1372 Ga0207687_11800710
1373 Ga0207700_10026068
1374 Ga0207700_10143131
1375 Ga0207700_10153827
1376 Ga0207700_10694998
1377 Ga0207664_10026276
1378 Ga0207664_10040338
1379 Ga0207644_10607647
1380 Ga0207690_10181149
1381 Ga0207690_10213555
1382 Ga0207690_11402236
1383 Ga0207706_10120698
1384 Ga0207706_10249799
1385 Ga0207706_10427236
1386 Ga0207706_10612496
1387 Ga0207686_10211190
1388 Ga0207709_10834611
1389 Ga0207709_11242391
1390 Ga0207709_11347797
1391 Ga0207670_10015446
1392 Ga0207670_11220513
1393 Ga0207669_10330718
1394 Ga0207669_10509609
1395 Ga0207704_10061975
1396 Ga0207704_10432381
1397 Ga0207665_10844310
1398 Ga0207665_11212508
1399 Ga0207691_10003241
1400 Ga0207691_10034050
1401 Ga0207691_10159600
1402 Ga0207691_10464926
1403 Ga0207691_10541450
1404 Ga0207691_11410422
1405 Ga0207711_10116293
1406 Ga0207711_10148571
1407 Ga0207711_10263813
1408 Ga0207689_10060980
1409 Ga0207661_10046637
1410 Ga0207661_10148680
1411 Ga0207661_10440636
1412 Ga0207661_10453473
1413 Ga0207661_10538442
1414 Ga0207679_10094142
1415 Ga0207679_10115434
1416 Ga0207679_10275936
1417 Ga0207679_10369007
1418 Ga0207679_10469775
1419 Ga0207679_11832344
1420 Ga0207667_10000438
1421 Ga0207667_10054147
1422 Ga0207667_10080431
1423 Ga0207667_10120706
1424 Ga0207667_10532629
1425 Ga0207667_11078949
1426 Ga0207667_11779875
1427 Ga0207651_10044954
1428 Ga0207651_10049833
1429 Ga0207651_10592134
1430 Ga0207651_11912507
1431 Ga0207712_11111599
1432 Ga0207712_11180360
1433 Ga0207712_11858715
1434 Ga0207668_10170685
1435 Ga0207668_10813330
1436 Ga0207668_11650884
1437 Ga0207640_10164010
1438 Ga0207658_10207146
1439 Ga0207658_10334431
1440 Ga0207658_10553881
1441 Ga0207677_10558543
1442 Ga0207677_10874560
1443 Ga0207677_11010063
1444 Ga0207703_10320070
1445 Ga0207639_10335709
1446 Ga0207678_10228246
1447 Ga0207678_10286314
1448 Ga0207678_11119896
1449 Ga0207678_11339925
1450 Ga0207708_10567734
1451 Ga0207708_11487935
1452 Ga0207708_11562456
1453 Ga0207702_10100428
1454 Ga0207702_10297815
1455 Ga0207702_10714697
1456 Ga0207702_12128198
1457 Ga0207641_10234602
1458 Ga0207641_10605511
1459 Ga0207648_10009384
1460 Ga0207648_11342871
1461 Ga0207676_10528943
1462 Ga0207674_10019328
1463 Ga0207674_10030258
1464 Ga0207674_10471185
1465 Ga0207674_11842393
1466 Ga0207675_100281049
1467 Ga0207675_100560854
1468 Ga0207675_100702801
1469 Ga0207675_100762188
1470 Ga0207683_10188565
1471 Ga0207683_10227218
1472 Ga0207683_10406459
1473 Ga0207698_10203459
1474 Ga0207698_10212653
1475 Ga0207698_10577776
1476 Ga0207698_11302213
1477 Ga0209281_1015504
1478 Ga0209969_1006876
1479 Ga0209969_1064622
1480 Ga0209967_1002057
1481 Ga0209996_1012602
1482 Ga0210000_1000359
1483 Ga0210000_1021166
1484 Ga0209179_1076816
1485 Ga0209968_1057529
1486 Ga0209968_1076531
1487 Ga0209999_1000555
1488 Ga0209983_1046924
1489 Ga0209282_1125663
1490 Ga0209588_1035122
1491 Ga0209971_1006039
1492 Ga0209974_10006308
1493 Ga0209974_10016099
1494 Ga0265355_1020574
1495 Ga0268265_10974493
1496 Ga0268265_11266507
1497 Ga0268264_10359998
1498 Ga0265338_10460300
1499 Ga0316182_1388674
1500 Ga0307408_100542836
1501 Ga0307408_101042820
1502 Ga0307408_101318191
1503 Ga0316575_10000032
1504 Ga0316575_10007166
1505 Ga0316575_10208096
1506 Ga0316579_10000922
1507 Ga0316579_10003486
1508 Ga0316576_10505678
1509 Ga0316578_10019379
1510 Ga0316578_10038835
1511 Ga0307405_10302791
1512 Ga0307405_11720673
1513 Ga0307413_10775714
1514 Ga0307410_10137989
1515 Ga0307410_10643308
1516 Ga0307406_10053066
1517 Ga0307406_10124064
1518 Ga0307406_10333259
1519 Ga0307406_11680663
1520 Ga0307412_10388759
1521 Ga0307412_11207745
1522 Ga0307409_100321415
1523 Ga0307409_100725525
1524 Ga0307409_100959655
1525 Ga0307409_101849815
1526 Ga0307409_102158352
1527 Ga0307416_100071671
1528 Ga0307416_100094290
1529 Ga0307416_100995760
1530 Ga0307416_101643754
1531 Ga0307416_101978192
1532 Ga0307416_102411812
1533 Ga0307416_102631432
1534 Ga0307414_10201808
1535 Ga0307414_11979702
1536 Ga0307414_12178846
1537 Ga0307411_10189389
1538 Ga0307411_10244153
1539 Ga0307411_10288180
1540 Ga0307415_100523335
1541 Ga0307415_100606156
1542 Ga0307415_100911094
1543 Ga0307415_101085684
1544 Ga0316583_10003578
1545 Ga0316583_10012848
1546 Ga0316583_10110681
1547 Ga0316593_10236263
1548 Ga0373926_0012427
1549 Ga0373926_0081631
1550 Ga0373934_0000613
1551 Ga0373944_0043393
1552 Ga0373952_0161086
1553 Ga0373923_0021276
1554 Ga0373945_0096315
1555 Ga0373956_0097835
1556 Ga0373957_0011425
1557 Ga0373960_0038491
1558 Ga0373943_0967145
1559 Ga0373946_0066655
1560 Ga0373955_0000555
1561 Ga0373942_0160572
1562 Ga0316574_0311636
1563 Ga0373924_0031046
1564 Ga0373935_0015507
1565 Ga0373935_0518439
1566 Ga0373935_0568069
1567 Ga0373935_1182297
1568 Ga0373927_0027933
1569 Ga0373927_0104013
1570 Ga0373927_0164642
1571 Ga0373933_0000055
1572 Ga0373947_0037687
1573 Ga0373947_0043390
1574 Ga0373937_0000450
1575 Ga0373937_0386729
1576 Ga0316582_0000229
1577 Ga0316582_0010275
1578 Ga0316582_0131791
1579 Ga0316584_0062296
1580 Ga0316584_0124699
1581 Ga0373925_0533729
1582 Ga0373925_0743704
1583 Ga0373925_1281198
1584 Ga0316581_0016222
1585 Ga0316581_0018143
1586 Ga0436364_0497955
1587 Ga0395901_0933184
1588 Ga0395901_1686137
1589 Ga0436365_0350682
1590 Ga0436365_1200738
1591 Ga0436365_1592469
1592 Ga0436361_0730207
1593 Ga0436361_1079523
1594 Ga0439436_0140609
1595 Ga0439439_0249705
1596 Ga0439461_0062686
1597 Ga0451841_0300790
1598 Ga0451845_0910423
1599 Ga0451847_0780003
1600 Ga0451853_3739149
1601 Ga0439445_0190724
1602 Ga0439445_0224983
1603 Ga0439449_0046339
1604 Ga0439452_034928
1605 Ga0439455_0033113
1606 Ga0439457_100883
1607 Ga0450912_004316
1608 Ga0450917_003459
1609 Ga0450923_116922
1610 Ga0450888_002272
1611 Ga0450890_009447
1612 Ga0450891_000222
1613 Ga0450892_001107
1614 Ga0450903_020990
1615 Ga0439434_0095027
1616 Ga0439444_0002332
1617 Ga0439459_0017764
1618 Ga0450893_0000472
1619 Ga0451577_0804129
1620 Ga0439440_0114816
1621 Ga0439440_0140568
1622 Ga0453683_0074998
1623 Ga0453683_0518135
1624 Ga0453684_0743783
1625 Ga0453684_0872633
1626 Ga0451576_0072908
1627 Ga0451576_1661229
1628 Ga0451576_2252183
1629 Ga0466967_1666302
1630 Ga0495592_0002705
1631 Ga0495592_0825445
1632 Ga0495629_0011314
1633 Ga0495629_0064592
1634 Ga0495629_0142153
1635 Ga0495651_0000996
1636 Ga0495651_0647505
1637 Ga0495653_0000195
1638 Ga0495650_0012788
1639 Ga0495580_0008769
1640 Ga0495580_0048643
1641 Ga0495580_0068932
1642 Ga0495582_0041545
1643 Ga0495582_0215716
1644 Ga0495582_0538044
1645 Ga0495582_0725799
1646 Ga0495639_0008494
1647 Ga0495639_0089033
1648 Ga0495639_0120029
1649 Ga0495664_0054273
1650 Ga0495594_0036114
1651 Ga0495594_0274194
1652 Ga0495594_0695554
1653 Ga0495596_0103789
1654 Ga0495596_0334621
1655 Ga0495583_0008785
1656 Ga0495606_0006532
1657 Ga0495608_0000085
1658 Ga0495608_0662561
1659 Ga0495628_0034222
1660 Ga0495630_0011652
1661 Ga0495630_0022736
1662 Ga0495630_0155017
1663 Ga0495630_1355860
1664 Ga0495663_0062093
1665 Ga0495663_0082676
1666 Ga0495663_0213062
1667 Ga0495666_0184231
1668 Ga0495642_0053050
1669 Ga0495652_0008685
1670 Ga0495654_0368700
1671 Ga0495665_0005306
1672 Ga0495665_0103981
1673 Ga0495665_0106728
1674 Ga0495665_0652993
1675 Ga0495640_0304947
1676 Ga0495587_0000114
1677 Ga0495598_0189898
1678 Ga0495621_0006211
1679 Ga0495621_0204629
1680 Ga0495621_0254339
1681 Ga0495645_0000144
1682 Ga0495645_0629896
1683 Ga0495667_0000241
1684 Ga0495667_0082166
1685 Ga0495667_0459167
1686 Ga0495668_0107838
1687 Ga0495634_0261307
1688 Ga0495625_0152379
1689 Ga0495625_0534897
1690 Ga0495635_0000253
1691 Ga0495635_0336897
1692 Ga0495635_0889632
1693 Ga0495659_0241169
1694 Ga0495659_0302271
1695 Ga0495588_0066857
1696 Ga0495588_0126015
1697 Ga0495588_0298141
1698 Ga0495588_0439476
1699 Ga0495657_0000210
1700 Ga0495657_0254549
1701 Ga0495599_0000436
1702 Ga0495623_0000305
1703 Ga0495646_0011487
1704 Ga0495658_0001556
1705 Ga0495658_0489290
1706 Ga0495669_0003327
1707 Ga0495669_0162795
1708 Ga0495669_0366748
1709 Ga0495669_0560199
1710 Ga0495613_0065654
1711 Ga0495613_0068004
1712 Ga0495613_0694257
1713 Ga0495649_0012212
1714 Ga0495589_0045800
1715 Ga0495600_0000023
1716 Ga0495581_0009338
1717 Ga0495604_0000251
1718 Ga0495604_0245664
1719 Ga0495604_0567091
1720 Ga0495636_0077133
1721 Ga0495674_0040004
1722 Ga0495674_0461643
1723 Ga0495672_0003697
1724 Ga0495672_0167004
1725 Ga0495680_0006224
1726 Ga0495675_0005468
1727 Ga0495675_0416813
1728 Ga0495685_054585
1729 Ga0495684_0000037
1730 Ga0495686_0009043
1731 Ga0495593_0153212
1732 Ga0495593_0172241
1733 Ga0495593_0659117
1734 Ga0495602_0002980
1735 Ga0495602_0523073
1736 Ga0495602_0661447
1737 Ga0495614_0003629
1738 Ga0495615_0030918
1739 Ga0496100_0338633
1740 Ga0496100_0706097
1741 Ga0496101_1373097
1742 Ga0496104_0115322
1743 Ga0496104_0405684
1744 Ga0496104_0433022
1745 Ga0496104_0708472
1746 Ga0496105_0008533
1747 Ga0496105_0179939
1748 Ga0496106_0076551
1749 Ga0496106_1420676
1750 Ga0496107_0170082
1751 Ga0496108_0270466
1752 Ga0496109_0186466
1753 Ga0496109_0706940
1754 Ga0496110_0385554
1755 Ga0496111_0659780
1756 Ga0496111_1077685
1757 Ga0496112_0016641
1758 Ga0496113_0301778
1759 Ga0496114_0110142
1760 Ga0496114_0451355
1761 Ga0496115_0218617
1762 Ga0496115_0385705
1763 Ga0496115_0640522
1764 Ga0496115_0669474
1765 Ga0496117_0000278
1766 Ga0496124_0875548
1767 Ga0496125_0113300
1768 Ga0501306_053080
1769 Ga0501308_005184
1770 Ga0501309_000129
1771 Ga0501310_000219
1772 Ga0501304_001129
1773 Ga0501305_000428
1774 Ga0501307_005139
1775 Ga0501292_053519
1776 Ga0501294_024649
1777 Ga0501299_050248
1778 Ga0501299_215354
1779 Ga0501300_000306
1780 Ga0501311_000655
1781 Ga0501311_038849
1782 Ga0501312_001901
1783 Ga0501313_005114
1784 Ga0501314_000050
1785 Ga0501315_001210
1786 Ga0501315_027922
1787 Ga0501316_030814
1788 Ga0501317_002747
1789 Ga0501318_012445
1790 Ga0501321_027411
1791 Ga0501325_017376
1792 Ga0501033_0040060
1793 Ga0501033_0932162
1794 Ga0501034_0126349
1795 Ga0501034_0252901
1796 Ga0501036_0058733
1797 Ga0501036_0310142
1798 Ga0501036_0956207
1799 Ga0501037_0033043
1800 Ga0501037_0474293
1801 Ga0501038_0030062
1802 Ga0501039_0129507
1803 Ga0501039_0138074
1804 Ga0501039_0558671
1805 Ga0501041_0461416
1806 Ga0501042_0759586
1807 Ga0501043_0007959
1808 Ga0501043_0445092
1809 Ga0501046_0195899
1810 Ga0501046_0299501
1811 Ga0501047_0034967
1812 Ga0501047_0694399
1813 Ga0501048_0282626
1814 Ga0501048_1094189
1815 Ga0501068_0126379
1816 Ga0501069_0278331
1817 Ga0501070_0712859
1818 Ga0501071_0119317
1819 Ga0501071_0233595
1820 Ga0501071_1007948
1821 Ga0501072_0275302
1822 Ga0501073_0009894
1823 Ga0501073_0238113
1824 Ga0501074_0016929
1825 Ga0501074_0470645
1826 Ga0501075_0712888
1827 Ga0501075_1055326
1828 Ga0501076_0361483
1829 Ga0501076_0620888
1830 Ga0501077_0325612
1831 Ga0501077_1040063
1832 Ga0501198_128946
1833 Ga0501206_014163
1834 Ga0501210_001725
1835 Ga0501211_004106
1836 Ga0501216_109924
1837 Ga0501222_020639
1838 Ga0501223_024425
1839 Ga0501223_046172
1840 Ga0501223_135690
1841 Ga0501227_004174
1842 Ga0501233_003475
1843 Ga0501235_003946
1844 Ga0501239_039619
1845 Ga0501243_109855
1846 Ga0501243_137035
1847 Ga0501249_008085
1848 Ga0501253_063853
1849 Ga0501255_016054
1850 Ga0501258_002063
1851 Ga0501221_003510
1852 Ga0501225_0003592
1853 Ga0501229_038397
1854 Ga0501234_077211
1855 Ga0501079_0264274
1856 Ga0501079_1522117
1857 Ga0501080_0008652
1858 Ga0501080_0057515
1859 Ga0501081_0119454
1860 Ga0501083_0035946
1861 Ga0501262_004570
1862 Ga0501267_000175
1863 Ga0501271_006347
1864 Ga0501272_032672
1865 Ga0501275_076951
1866 Ga0501283_048226
1867 Ga0501035_0268059
1868 Ga0501035_0674645
1869 Ga0501044_0015304
1870 Ga0501044_0525921
1871 nmdc:mga03683_622358_c1
1872 nmdc:mga0k408_25245_c2
1873 nmdc:mga07m45_7457_c1
1874 nmdc:mga09592_852973_c1
1875 nmdc:mga0qj67_60894_c1
1876 nmdc:mga0qj67_638307_c1
1877 nmdc:mga0qj67_643432_c1
1878 nmdc:mga06r32_441888_c1
1879 nmdc:mga06r32_687524_c1
1880 nmdc:mga08y16_107923_c1
1881 nmdc:mga0n895_2003095_c1
1882 nmdc:mga0n895_766365_c1
1883 nmdc:mga0rr50_1745688_c1
1884 nmdc:mga0rr50_385862_c1
1885 nmdc:mga08x19_192665_c1
1886 nmdc:mga08x19_312301_c1
1887 nmdc:mga0a205_238225_c1
1888 Ga0495601_0002235
1889 Ga0495601_0590726
1890 Ga0495612_0000577
1891 Ga0495612_0478171
1892 Ga0495655_0297108
1893 Ga0495595_0011132
1894 Ga0495619_0006426
1895 Ga0500651_0700854
1896 Ga0500608_199548
1897 Ga0500568_0168736
1898 Ga0500604_0064906
1899 Ga0500627_0292841
1900 Ga0500633_0277547
1901 Ga0500636_0105745
1902 Ga0500636_0495408
1903 Ga0501084_0547311
1904 Ga0590071_032829
1905 Ga0590074_029865
1906 Ga0590075_170084
1907 Ga0587076_016241
1908 Ga0501082_0653376
1909 Ga0501082_0717548
1910 2511385534
1911 2521557732
1912 2553002847
1913 2595446621
1914 2595451887
1915 2643935861
1916 2644221322
1917 2644257920
1918 2644317644
1919 2721026753
1920 2735837693
1921 2739228298
1922 2765570096
1923 2819615135
1924 2839096964
1925 2842918033
1926 2842919508
1927 2904441528
1928 2904531542
1929 2904586821
1930 2904593146
1931 2904603008
1932 2919050833
1933 2919083971
1934 2919087717
1935 2919404961
1936 2923510937
1937 2928130909
1938 2953998027

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

16

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nci-assembly1.cif.gz_B crystal structure of cdp-chase: vector data collection 0.9268 8 41
6nch-assembly1.cif.gz_B crystal structure of cdp-chase: raster data collection 0.9251 8 41
4hfq-assembly1.cif.gz_B crystal structure of udp-x diphosphatase 0.9062 2 46
6inr-assembly1.cif.gz_A the crystal structure of phytoplasmal effector causing phyllody symptoms 1 (phyl1) 0.8833 2 49
4k2p-assembly2.cif.gz_B the structure of a quintuple mutant of the tiam1 ph-cc-ex domain 0.8722 2 44
ID Description Score Start End Superfamily
3q4iA01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9747 8 39 6.10.250.1120
3q1pA01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9714 8 39 6.10.250.1120
6nciA01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9607 8 39 6.10.250.1120
af_Q2FX96_176_237_1.20.5.1930 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9438 6 46 1.20.5.1930
6nciB01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.938 8 39 6.10.250.1120
ID Description Score Start End GO Terms
AF-A0A3R6Z6P1-F1-model_v4 ER membrane protein complex subunit 6 0.8855 2 49 GO:0016020
AF-A0A7J4NUR5-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.8737 1 59 GO:0016020
GO:0016491
AF-A0A3A9AE88-F1-model_v4 DUF2508 family protein 0.871 1 50
AF-A0A534KFM0-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.8363 1 61 GO:0016651
GO:0030964
GO:0042773
AF-A0A7J4NUR5-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.8078 1 59 GO:0016020
GO:0016491

Map