F487070

General Info

Members Datasets Scaffolds Average Seq Length
969 351 969 170

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0080117|Ga0395900_0080117_1180_1737
Length 185
Sequence MIPTEMKGGHMEAKQTAQSAAVGLLGRPLTISQIAVVVNDLEKTMEQYTKLLGWCPWNVYRHEPPRLHDTVLRGKPTDFTMLGAETHVGDMGFELLQPLEGPSIYKEWLEQRGEGLHHVAVMLHDFEESAELKRKFDEIGASILMGGRIGETIEFYYLDTEPSLKIVLESGSGHAIDLQPDYVYP

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
107 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
130 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
194 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
195 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
196 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
197 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
198 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
199 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
213 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
214 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
215 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
218 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
219 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.06
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10000079 3300003659 Bacteria 8855
2 Ga0058862_12117740 3300004803 Bacteria 871
3 Ga0065707_10010235 3300005295 Bacteria 2471
4 Ga0070658_10070640 3300005327 Bacteria 2859
5 Ga0070658_10158050 3300005327 Bacteria 1901
6 Ga0070676_10355974 3300005328 Bacteria 1007
7 Ga0070683_100003809 3300005329 Bacteria 12322
8 Ga0070683_100007853 3300005329 Bacteria 9036
9 Ga0070683_100150452 3300005329 Bacteria 2207
10 Ga0070683_100258732 3300005329 Bacteria 1655
11 Ga0070690_100036403 3300005330 Bacteria 3093
12 Ga0070690_100632894 3300005330 Unclassified 815
13 Ga0070670_100097446 3300005331 Bacteria 2530
14 Ga0070670_100127662 3300005331 Unclassified 2195
15 Ga0068869_100126332 3300005334 Bacteria 1961
16 Ga0070666_10025853 3300005335 Bacteria 3830
17 Ga0070680_100017429 3300005336 Bacteria 5664
18 Ga0070680_100442855 3300005336 Bacteria 1109
19 Ga0070682_100059017 3300005337 Bacteria 2421
20 Ga0070682_100214898 3300005337 Bacteria 1365
21 Ga0070682_100381584 3300005337 Unclassified 1060
22 Ga0070682_100398972 3300005337 Unclassified 1040
23 Ga0068868_100089213 3300005338 Bacteria 2482
24 Ga0068868_100211445 3300005338 Bacteria 1621
25 Ga0070660_100241205 3300005339 Bacteria 1472
26 Ga0070660_100273042 3300005339 Bacteria 1382
27 Ga0070660_100465144 3300005339 Bacteria 1050
28 Ga0070689_100021701 3300005340 Bacteria 4785
29 Ga0070689_100486184 3300005340 Bacteria 1055
30 Ga0070689_100782338 3300005340 Bacteria 838
31 Ga0070691_10019206 3300005341 Bacteria 3152
32 Ga0070691_10029378 3300005341 Bacteria 2571
33 Ga0070661_100013534 3300005344 Bacteria 5728
34 Ga0070692_10005873 3300005345 Bacteria 5282
35 Ga0070669_100083417 3300005353 Unclassified 2383
36 Ga0070669_100087974 3300005353 Bacteria 2324
37 Ga0070675_100020082 3300005354 Bacteria 5330
38 Ga0070675_100049160 3300005354 Bacteria 3460
39 Ga0070671_100115898 3300005355 Bacteria 2253
40 Ga0070671_100327979 3300005355 Bacteria 1304
41 Ga0070674_100128745 3300005356 Unclassified 1884
42 Ga0070674_101624573 3300005356 Unclassified 583
43 Ga0070673_100065880 3300005364 Bacteria 2891
44 Ga0070688_100060707 3300005365 Bacteria 2388
45 Ga0070688_100268818 3300005365 Unclassified 1221
46 Ga0070667_100045133 3300005367 Bacteria 3705
47 Ga0070709_10000898 3300005434 Bacteria 16586
48 Ga0070709_10011449 3300005434 Bacteria 4944
49 Ga0070709_10396537 3300005434 Bacteria 1029
50 Ga0070714_100002822 3300005435 Bacteria 12817
51 Ga0070714_100009138 3300005435 Bacteria 7776
52 Ga0070714_100128815 3300005435 Bacteria 2260
53 Ga0070714_100298801 3300005435 Bacteria 1500
54 Ga0070713_100005320 3300005436 Bacteria 8781
55 Ga0070713_100034459 3300005436 Bacteria 4067
56 Ga0070713_100097223 3300005436 Bacteria 2544
57 Ga0070713_100125631 3300005436 Bacteria 2256
58 Ga0070713_100188275 3300005436 Unclassified 1858
59 Ga0070713_100600576 3300005436 Bacteria 1045
60 Ga0070710_10000649 3300005437 Bacteria 16588
61 Ga0070710_10004332 3300005437 Bacteria 6724
62 Ga0070701_10097201 3300005438 Bacteria 1624
63 Ga0070711_100001246 3300005439 Bacteria 13779
64 Ga0070711_100008207 3300005439 Bacteria 6386
65 Ga0070711_100107809 3300005439 Bacteria 2039
66 Ga0070711_100155849 3300005439 Bacteria 1727
67 Ga0070711_100767814 3300005439 Bacteria 816
68 Ga0070705_100004180 3300005440 Bacteria 7053
69 Ga0070705_100085564 3300005440 Bacteria 1949
70 Ga0070705_100390086 3300005440 Bacteria 1028
71 Ga0070700_100028004 3300005441 Bacteria 3348
72 Ga0070694_100051839 3300005444 Bacteria 2772
73 Ga0070708_100008914 3300005445 Bacteria 8076
74 Ga0070708_100013905 3300005445 Bacteria 6611
75 Ga0070708_100017977 3300005445 Bacteria 5911
76 Ga0070708_100023693 3300005445 Bacteria 5223
77 Ga0070708_100026442 3300005445 Bacteria 4967
78 Ga0070708_100104212 3300005445 Bacteria 2601
79 Ga0070708_100112502 3300005445 Bacteria 2504
80 Ga0070708_100646013 3300005445 Bacteria 997
81 Ga0070663_100001262 3300005455 Bacteria 13900
82 Ga0070663_100039551 3300005455 Bacteria 3296
83 Ga0070678_100010703 3300005456 Bacteria 5617
84 Ga0070662_100205993 3300005457 Bacteria 1563
85 Ga0070662_100362063 3300005457 Unclassified 1190
86 Ga0070681_10145848 3300005458 Bacteria 2296
87 Ga0070681_10187369 3300005458 Bacteria 1989
88 Ga0070681_10484628 3300005458 Bacteria 1149
89 Ga0068867_100163342 3300005459 Bacteria 1758
90 Ga0070685_10026846 3300005466 Bacteria 3177
91 Ga0070706_100034040 3300005467 Bacteria 4704
92 Ga0070706_100037181 3300005467 Bacteria 4496
93 Ga0070706_100041193 3300005467 Bacteria 4264
94 Ga0070707_100033411 3300005468 Bacteria 4905
95 Ga0070707_100055256 3300005468 Bacteria 3806
96 Ga0070707_100103302 3300005468 Unclassified 2762
97 Ga0070707_100120487 3300005468 Bacteria 2547
98 Ga0070707_100136661 3300005468 Unclassified 2385
99 Ga0070698_100018588 3300005471 Bacteria 7316
100 Ga0070698_100053715 3300005471 Bacteria 4093
101 Ga0070698_100116886 3300005471 Bacteria 2629
102 Ga0070698_100134045 3300005471 Bacteria 2431
103 Ga0070698_100168932 3300005471 Unclassified 2128
104 Ga0070698_101229058 3300005471 Bacteria 699
105 Ga0070699_100011386 3300005518 Bacteria 7679
106 Ga0070699_100046263 3300005518 Bacteria 3766
107 Ga0070699_100052118 3300005518 Bacteria 3542
108 Ga0070699_100630020 3300005518 Unclassified 978
109 Ga0070699_101581426 3300005518 Unclassified 601
110 Ga0070679_100036814 3300005530 Bacteria 4856
111 Ga0070679_100070467 3300005530 Bacteria 3488
112 Ga0070679_101010839 3300005530 Bacteria 776
113 Ga0070684_100021226 3300005535 Bacteria 5399
114 Ga0070684_100040413 3300005535 Bacteria 4016
115 Ga0070684_100119349 3300005535 Bacteria 2371
116 Ga0070684_100268122 3300005535 Bacteria 1562
117 Ga0070697_100007671 3300005536 Bacteria 8402
118 Ga0070697_100063402 3300005536 Bacteria 3018
119 Ga0070697_100342605 3300005536 Unclassified 1290
120 Ga0070697_100731521 3300005536 Bacteria 874
121 Ga0070697_101233014 3300005536 Unclassified 667
122 Ga0068853_100097088 3300005539 Bacteria 2600
123 Ga0070686_100026093 3300005544 Bacteria 3522
124 Ga0070695_100153135 3300005545 Bacteria 1611
125 Ga0070695_100219796 3300005545 Bacteria 1368
126 Ga0070696_100054045 3300005546 Bacteria 2797
127 Ga0070696_100207734 3300005546 Bacteria 1464
128 Ga0070696_100698481 3300005546 Bacteria 827
129 Ga0070696_100734978 3300005546 Bacteria 807
130 Ga0070693_100140675 3300005547 Unclassified 1519
131 Ga0070693_100162490 3300005547 Bacteria 1423
132 Ga0070665_100701056 3300005548 Bacteria 1025
133 Ga0070704_100122701 3300005549 Bacteria 1999
134 Ga0070704_100123783 3300005549 Bacteria 1991
135 Ga0070704_101244716 3300005549 Unclassified 680
136 Ga0068855_100227677 3300005563 Bacteria 2089
137 Ga0070664_100006864 3300005564 Bacteria 9184
138 Ga0070664_100901662 3300005564 Unclassified 829
139 Ga0068857_100036849 3300005577 Bacteria 4333
140 Ga0068857_100056671 3300005577 Bacteria 3478
141 Ga0068857_100110737 3300005577 Bacteria 2467
142 Ga0068854_100046397 3300005578 Bacteria 3093
143 Ga0068856_100011336 3300005614 Bacteria 8649
144 Ga0068856_100361819 3300005614 Unclassified 1469
145 Ga0068856_100696391 3300005614 Unclassified 1036
146 Ga0068856_100900716 3300005614 Unclassified 903
147 Ga0070702_100008618 3300005615 Bacteria 4949
148 Ga0068852_100013437 3300005616 Bacteria 6267
149 Ga0068852_101279622 3300005616 Unclassified 755
150 Ga0068859_100048443 3300005617 Bacteria 4268
151 Ga0068859_100192264 3300005617 Bacteria 2125
152 Ga0068864_100107553 3300005618 Bacteria 2481
153 Ga0068864_100793406 3300005618 Bacteria 930
154 Ga0068866_10341972 3300005718 Bacteria 948
155 Ga0068861_100023428 3300005719 Bacteria 4452
156 Ga0068851_10015521 3300005834 Bacteria 3630
157 Ga0068870_10048833 3300005840 Bacteria 2230
158 Ga0068863_100067239 3300005841 Bacteria 3389
159 Ga0068863_100492248 3300005841 Bacteria 1207
160 Ga0068858_100035279 3300005842 Bacteria 4640
161 Ga0068858_100427567 3300005842 Bacteria 1274
162 Ga0068860_100045353 3300005843 Bacteria 4192
163 Ga0068860_100636532 3300005843 Bacteria 1074
164 Ga0068862_100056197 3300005844 Bacteria 3372
165 Ga0068862_100130513 3300005844 Bacteria 2222
166 Ga0081455_10088019 3300005937 Bacteria 2525
167 Ga0081538_10000538 3300005981 Bacteria 41759
168 Ga0081540_1001110 3300005983 Bacteria 23850
169 Ga0081540_1002815 3300005983 Bacteria 14081
170 Ga0081539_10097984 3300005985 Bacteria 1501
171 Ga0070717_10001468 3300006028 Bacteria 16299
172 Ga0070717_10011855 3300006028 Bacteria 6633
173 Ga0070717_10022914 3300006028 Bacteria 4941
174 Ga0070717_10032455 3300006028 Bacteria 4208
175 Ga0070717_10132918 3300006028 Bacteria 2141
176 Ga0070717_10264298 3300006028 Bacteria 1523
177 Ga0070717_10449154 3300006028 Bacteria 1162
178 Ga0070717_10684575 3300006028 Bacteria 931
179 Ga0070717_11284228 3300006028 Bacteria 665
180 Ga0070715_10001376 3300006163 Bacteria 7015
181 Ga0070715_10015253 3300006163 Bacteria 2862
182 Ga0070715_10077725 3300006163 Bacteria 1498
183 Ga0070715_10107307 3300006163 Bacteria 1312
184 Ga0070715_10186241 3300006163 Bacteria 1045
185 Ga0070716_100003048 3300006173 Bacteria 7818
186 Ga0070716_100005468 3300006173 Bacteria 6158
187 Ga0070716_100012587 3300006173 Bacteria 4291
188 Ga0070716_100148756 3300006173 Bacteria 1503
189 Ga0070716_100340044 3300006173 Bacteria 1058
190 Ga0070712_100007818 3300006175 Bacteria 6696
191 Ga0070712_100201313 3300006175 Bacteria 1564
192 Ga0070712_100204974 3300006175 Bacteria 1552
193 Ga0070712_100409598 3300006175 Bacteria 1121
194 Ga0070712_100841834 3300006175 Bacteria 789
195 Ga0097621_100060592 3300006237 Bacteria 3103
196 Ga0097621_100194789 3300006237 Bacteria 1757
197 Ga0097621_100808083 3300006237 Bacteria 869
198 Ga0068871_100087607 3300006358 Bacteria 2589
199 Ga0068871_100935193 3300006358 Bacteria 805
200 Ga0075428_100326426 3300006844 Bacteria 1649
201 Ga0075433_10006430 3300006852 Bacteria 9293
202 Ga0075433_10086522 3300006852 Unclassified 2767
203 Ga0075434_100010403 3300006871 Bacteria 8721
204 Ga0075434_100181401 3300006871 Unclassified 2125
205 Ga0075434_100185211 3300006871 Bacteria 2102
206 Ga0075434_100447620 3300006871 Bacteria 1313
207 Ga0075434_101111147 3300006871 Bacteria 804
208 Ga0068865_100158561 3300006881 Bacteria 1724
209 Ga0068865_100556061 3300006881 Unclassified 964
210 Ga0075436_100059844 3300006914 Unclassified 2631
211 Ga0075436_100087709 3300006914 Bacteria 2161
212 Ga0075436_100187822 3300006914 Unclassified 1462
213 Ga0097620_100048443 3300006931 Bacteria 4268
214 Ga0097620_100192262 3300006931 Bacteria 2125
215 Ga0075435_100015650 3300007076 Bacteria 5706
216 Ga0075435_100062813 3300007076 Bacteria 3015
217 Ga0075435_100147365 3300007076 Bacteria 1977
218 Ga0075435_100583994 3300007076 Bacteria 968
219 Ga0105251_10017383 3300009011 Bacteria 3856
220 Ga0105240_10164587 3300009093 Bacteria 2631
221 Ga0111539_10088325 3300009094 Bacteria 3642
222 Ga0111539_10822781 3300009094 Bacteria 1081
223 Ga0105245_10010094 3300009098 Bacteria 8226
224 Ga0105245_10062831 3300009098 Bacteria 3351
225 Ga0105245_10100888 3300009098 Bacteria 2671
226 Ga0105247_10037739 3300009101 Bacteria 2947
227 Ga0105247_10341959 3300009101 Bacteria 1050
228 Ga0105247_10604507 3300009101 Unclassified 814
229 Ga0114129_10007274 3300009147 Bacteria 15756
230 Ga0114129_10083341 3300009147 Bacteria 4442
231 Ga0114129_11591694 3300009147 Bacteria 800
232 Ga0105243_10045901 3300009148 Bacteria 3435
233 Ga0105241_10263547 3300009174 Bacteria 1465
234 Ga0105241_10443340 3300009174 Bacteria 1147
235 Ga0105241_10690029 3300009174 Bacteria 931
236 Ga0105242_10260774 3300009176 Bacteria 1565
237 Ga0105242_11883474 3300009176 Unclassified 638
238 Ga0105248_10061741 3300009177 Bacteria 4209
239 Ga0105248_10090347 3300009177 Bacteria 3448
240 Ga0105237_10197260 3300009545 Bacteria 2013
241 Ga0105237_10219032 3300009545 Bacteria 1904
242 Ga0105237_10481942 3300009545 Bacteria 1247
243 Ga0105237_10607368 3300009545 Bacteria 1101
244 Ga0105238_10382147 3300009551 Bacteria 1400
245 Ga0105238_10908589 3300009551 Unclassified 899
246 Ga0105249_10019483 3300009553 Bacteria 6054
247 Ga0099796_10047442 3300010159 Unclassified 1478
248 Ga0105239_11205846 3300010375 Bacteria 872
249 Ga0105246_10014986 3300011119 Bacteria 4885
250 Ga0157319_1009886 3300012497 Unclassified 759
251 Ga0157342_1000357 3300012507 Bacteria 2679
252 Ga0157342_1017220 3300012507 Bacteria 807
253 Ga0157373_10007594 3300013100 Bacteria 8059
254 Ga0157373_10606835 3300013100 Bacteria 797
255 Ga0157371_10138477 3300013102 Bacteria 1734
256 Ga0157370_10132030 3300013104 Bacteria 2329
257 Ga0157369_10092910 3300013105 Bacteria 3221
258 Ga0157369_10853882 3300013105 Bacteria 934
259 Ga0157369_10858699 3300013105 Bacteria 931
260 Ga0157369_11419298 3300013105 Unclassified 707
261 Ga0157374_10010592 3300013296 Bacteria 7936
262 Ga0157374_10238950 3300013296 Bacteria 1786
263 Ga0157378_10149261 3300013297 Bacteria 2177
264 Ga0157378_10161991 3300013297 Bacteria 2092
265 Ga0157378_10963931 3300013297 Bacteria 886
266 Ga0157378_11565988 3300013297 Bacteria 704
267 Ga0163162_10242507 3300013306 Bacteria 1933
268 Ga0157372_10342228 3300013307 Bacteria 1742
269 Ga0157372_11395631 3300013307 Bacteria 808
270 Ga0157372_11859312 3300013307 Unclassified 692
271 Ga0157372_12133173 3300013307 Unclassified 644
272 Ga0157375_10182194 3300013308 Bacteria 2252
273 Ga0157375_10257876 3300013308 Bacteria 1905
274 Ga0157375_10845312 3300013308 Bacteria 1062
275 Ga0163163_10010901 3300014325 Bacteria 8209
276 Ga0163163_10141014 3300014325 Bacteria 2452
277 Ga0163163_10252588 3300014325 Bacteria 1814
278 Ga0163163_10546335 3300014325 Bacteria 1221
279 Ga0157380_10116313 3300014326 Bacteria 2257
280 Ga0157377_10005520 3300014745 Bacteria 5951
281 Ga0157377_10018876 3300014745 Bacteria 3593
282 Ga0157379_10002408 3300014968 Bacteria 15631
283 Ga0157379_10539556 3300014968 Bacteria 1084
284 Ga0157376_10041457 3300014969 Bacteria 3769
285 Ga0157376_10076153 3300014969 Bacteria 2866
286 Ga0163161_10021461 3300017792 Bacteria 4538
287 Ga0206356_11554725 3300020070 Bacteria 1796
288 Ga0154015_1065643 3300020610 Bacteria 715
289 Ga0213876_10018060 3300021384 Bacteria 3722
290 Ga0213875_10001833 3300021388 Bacteria 13205
291 Ga0213875_10020598 3300021388 Bacteria 3163
292 Ga0213875_10027793 3300021388 Bacteria 2691
293 Ga0213871_10008344 3300021441 Bacteria 2281
294 Ga0224712_10017697 3300022467 Bacteria 2368
295 Ga0224712_10097660 3300022467 Bacteria 1241
296 Ga0224712_10170286 3300022467 Unclassified 976
297 Ga0224572_1000045 3300024225 Bacteria 7577
298 Ga0224572_1008572 3300024225 Unclassified 1893
299 Ga0228598_1033823 3300024227 Bacteria 1008
300 Ga0228598_1066173 3300024227 Unclassified 721
301 Ga0207692_10027121 3300025898 Bacteria 2694
302 Ga0207692_10112100 3300025898 Bacteria 1514
303 Ga0207692_10229445 3300025898 Bacteria 1104
304 Ga0207692_10284694 3300025898 Bacteria 1001
305 Ga0207642_10062716 3300025899 Bacteria 1735
306 Ga0207710_10035399 3300025900 Bacteria 2197
307 Ga0207688_10004338 3300025901 Bacteria 7731
308 Ga0207688_10185593 3300025901 Bacteria 1242
309 Ga0207647_10014384 3300025904 Bacteria 5455
310 Ga0207685_10014244 3300025905 Bacteria 2485
311 Ga0207685_10033747 3300025905 Bacteria 1852
312 Ga0207685_10066486 3300025905 Bacteria 1447
313 Ga0207685_10108183 3300025905 Unclassified 1201
314 Ga0207685_10162507 3300025905 Bacteria 1021
315 Ga0207699_10000902 3300025906 Bacteria 14193
316 Ga0207699_10010790 3300025906 Bacteria 4597
317 Ga0207699_10013718 3300025906 Bacteria 4156
318 Ga0207699_10025050 3300025906 Bacteria 3271
319 Ga0207699_10029022 3300025906 Bacteria 3081
320 Ga0207699_10322950 3300025906 Bacteria 1083
321 Ga0207645_10269087 3300025907 Bacteria 1130
322 Ga0207643_10034728 3300025908 Bacteria 2826
323 Ga0207705_10033404 3300025909 Bacteria 3675
324 Ga0207684_10001101 3300025910 Bacteria 30211
325 Ga0207684_10009747 3300025910 Bacteria 8471
326 Ga0207684_10047286 3300025910 Bacteria 3649
327 Ga0207684_10061469 3300025910 Bacteria 3190
328 Ga0207684_10061734 3300025910 Bacteria 3182
329 Ga0207684_10236433 3300025910 Bacteria 1576
330 Ga0207684_10285314 3300025910 Bacteria 1424
331 Ga0207684_10726939 3300025910 Unclassified 842
332 Ga0207707_10145737 3300025912 Bacteria 2070
333 Ga0207695_10419786 3300025913 Bacteria 1222
334 Ga0207671_10104756 3300025914 Bacteria 2146
335 Ga0207671_10558026 3300025914 Unclassified 913
336 Ga0207693_10004702 3300025915 Bacteria 11487
337 Ga0207693_10006820 3300025915 Bacteria 9431
338 Ga0207693_10029965 3300025915 Bacteria 4294
339 Ga0207693_10037841 3300025915 Bacteria 3802
340 Ga0207693_10114809 3300025915 Bacteria 2113
341 Ga0207663_10001184 3300025916 Bacteria 12036
342 Ga0207663_10048742 3300025916 Bacteria 2624
343 Ga0207663_10063205 3300025916 Bacteria 2356
344 Ga0207663_10346641 3300025916 Bacteria 1123
345 Ga0207663_10350583 3300025916 Bacteria 1117
346 Ga0207663_10917180 3300025916 Unclassified 701
347 Ga0207660_10187749 3300025917 Bacteria 1608
348 Ga0207662_10002153 3300025918 Bacteria 9810
349 Ga0207657_10006511 3300025919 Bacteria 12098
350 Ga0207657_10161579 3300025919 Bacteria 1819
351 Ga0207657_10408873 3300025919 Bacteria 1067
352 Ga0207649_10215709 3300025920 Bacteria 1364
353 Ga0207652_10076597 3300025921 Bacteria 2918
354 Ga0207646_10005472 3300025922 Bacteria 13351
355 Ga0207646_10014190 3300025922 Bacteria 7573
356 Ga0207646_10103407 3300025922 Bacteria 2554
357 Ga0207646_10124397 3300025922 Bacteria 2318
358 Ga0207646_10216439 3300025922 Bacteria 1730
359 Ga0207646_10237375 3300025922 Bacteria 1647
360 Ga0207646_10428883 3300025922 Bacteria 1193
361 Ga0207681_10478146 3300025923 Unclassified 1017
362 Ga0207694_10185297 3300025924 Unclassified 1689
363 Ga0207694_10238407 3300025924 Bacteria 1486
364 Ga0207650_10168691 3300025925 Bacteria 1738
365 Ga0207659_10116968 3300025926 Bacteria 2036
366 Ga0207659_10758132 3300025926 Unclassified 833
367 Ga0207687_10036137 3300025927 Bacteria 3364
368 Ga0207687_10183670 3300025927 Bacteria 1622
369 Ga0207700_10000414 3300025928 Bacteria 25014
370 Ga0207700_10001073 3300025928 Bacteria 15767
371 Ga0207700_10031567 3300025928 Bacteria 3765
372 Ga0207700_10036128 3300025928 Bacteria 3565
373 Ga0207700_10052750 3300025928 Bacteria 3042
374 Ga0207700_10069517 3300025928 Bacteria 2703
375 Ga0207700_10304829 3300025928 Bacteria 1376
376 Ga0207700_10579970 3300025928 Bacteria 997
377 Ga0207700_11431221 3300025928 Bacteria 614
378 Ga0207664_10000678 3300025929 Bacteria 23434
379 Ga0207664_10004822 3300025929 Bacteria 9169
380 Ga0207664_10010813 3300025929 Bacteria 6460
381 Ga0207664_10020088 3300025929 Bacteria 4945
382 Ga0207664_10025989 3300025929 Bacteria 4419
383 Ga0207664_10026465 3300025929 Bacteria 4385
384 Ga0207664_10053030 3300025929 Bacteria 3208
385 Ga0207664_10098918 3300025929 Unclassified 2406
386 Ga0207664_10107248 3300025929 Bacteria 2317
387 Ga0207664_10110634 3300025929 Bacteria 2284
388 Ga0207664_10165850 3300025929 Bacteria 1887
389 Ga0207664_10263166 3300025929 Bacteria 1509
390 Ga0207664_10351648 3300025929 Unclassified 1304
391 Ga0207644_10668641 3300025931 Bacteria 865
392 Ga0207690_10153596 3300025932 Bacteria 1709
393 Ga0207706_10141147 3300025933 Bacteria 2119
394 Ga0207706_10210132 3300025933 Bacteria 1706
395 Ga0207686_10034626 3300025934 Bacteria 3024
396 Ga0207709_10029554 3300025935 Bacteria 3180
397 Ga0207670_10047244 3300025936 Bacteria 2865
398 Ga0207670_10095599 3300025936 Bacteria 2111
399 Ga0207670_10710998 3300025936 Bacteria 832
400 Ga0207665_10001619 3300025939 Bacteria 15177
401 Ga0207665_10001749 3300025939 Bacteria 14579
402 Ga0207665_10001957 3300025939 Bacteria 13852
403 Ga0207665_10008150 3300025939 Bacteria 6916
404 Ga0207665_10013823 3300025939 Bacteria 5308
405 Ga0207665_10076791 3300025939 Bacteria 2291
406 Ga0207665_10091180 3300025939 Bacteria 2113
407 Ga0207711_10189798 3300025941 Bacteria 1872
408 Ga0207711_10334743 3300025941 Bacteria 1400
409 Ga0207689_10001908 3300025942 Bacteria 19711
410 Ga0207661_10032384 3300025944 Bacteria 4049
411 Ga0207661_10094743 3300025944 Bacteria 2494
412 Ga0207661_10150708 3300025944 Unclassified 2010
413 Ga0207661_10291618 3300025944 Unclassified 1460
414 Ga0207661_10482381 3300025944 Bacteria 1132
415 Ga0207679_10004671 3300025945 Bacteria 8533
416 Ga0207679_10065914 3300025945 Bacteria 2712
417 Ga0207679_10619395 3300025945 Bacteria 977
418 Ga0207667_10110508 3300025949 Bacteria 2835
419 Ga0207667_10719865 3300025949 Bacteria 999
420 Ga0207651_10433555 3300025960 Bacteria 1124
421 Ga0207712_10399140 3300025961 Bacteria 1155
422 Ga0207640_10296443 3300025981 Bacteria 1277
423 Ga0207640_11339504 3300025981 Bacteria 640
424 Ga0207658_10054810 3300025986 Bacteria 2952
425 Ga0207677_10020233 3300026023 Bacteria 4037
426 Ga0207703_10078467 3300026035 Bacteria 2743
427 Ga0207639_10166876 3300026041 Bacteria 1861
428 Ga0207678_10002509 3300026067 Bacteria 16704
429 Ga0207708_10028936 3300026075 Bacteria 4196
430 Ga0207708_10202255 3300026075 Bacteria 1585
431 Ga0207708_10344040 3300026075 Bacteria 1222
432 Ga0207702_10018650 3300026078 Bacteria 5740
433 Ga0207702_10111160 3300026078 Bacteria 2436
434 Ga0207641_10564040 3300026088 Unclassified 1111
435 Ga0207648_10066245 3300026089 Bacteria 3150
436 Ga0207676_10087847 3300026095 Bacteria 2543
437 Ga0207676_10566137 3300026095 Bacteria 1087
438 Ga0207674_10003114 3300026116 Bacteria 20468
439 Ga0207674_10053372 3300026116 Bacteria 4120
440 Ga0207674_10200176 3300026116 Bacteria 1947
441 Ga0207675_100003405 3300026118 Bacteria 15530
442 Ga0207683_10001732 3300026121 Bacteria 19433
443 Ga0207683_10049142 3300026121 Bacteria 3691
444 Ga0207698_10390234 3300026142 Bacteria 1327
445 Ga0209588_1213537 3300027671 Bacteria 598
446 Ga0207428_10513458 3300027907 Bacteria 869
447 Ga0268265_10083304 3300028380 Bacteria 2532
448 Ga0268265_10429920 3300028380 Bacteria 1228
449 Ga0268264_10612459 3300028381 Bacteria 1074
450 Ga0265337_1021791 3300028556 Bacteria 1993
451 Ga0265326_10109137 3300028558 Bacteria 786
452 Ga0265319_1000473 3300028563 Bacteria 28398
453 Ga0265319_1036444 3300028563 Bacteria 1682
454 Ga0265334_10049111 3300028573 Bacteria 1624
455 Ga0265334_10234650 3300028573 Bacteria 633
456 Ga0265318_10119217 3300028577 Bacteria 970
457 Ga0265318_10139369 3300028577 Bacteria 891
458 Ga0265322_10002593 3300028654 Bacteria 5556
459 Ga0265336_10014829 3300028666 Bacteria 2575
460 Ga0265336_10066371 3300028666 Bacteria 1080
461 Ga0265338_10001840 3300028800 Bacteria 33293
462 Ga0265338_10140174 3300028800 Bacteria 1895
463 Ga0265338_10320811 3300028800 Bacteria 1121
464 Ga0265324_10016769 3300029957 Bacteria 2668
465 Ga0265330_10142509 3300031235 Bacteria 1019
466 Ga0265332_10060322 3300031238 Bacteria 1623
467 Ga0265332_10213042 3300031238 Bacteria 802
468 Ga0265328_10147042 3300031239 Unclassified 886
469 Ga0265320_10044744 3300031240 Bacteria 2179
470 Ga0265320_10122416 3300031240 Bacteria 1185
471 Ga0265320_10264010 3300031240 Bacteria 763
472 Ga0265329_10038284 3300031242 Bacteria 1543
473 Ga0265340_10103489 3300031247 Bacteria 1322
474 Ga0265331_10096929 3300031250 Bacteria 1360
475 Ga0265316_10024760 3300031344 Bacteria 5018
476 Ga0265313_10089758 3300031595 Bacteria 1382
477 Ga0265314_10058135 3300031711 Bacteria 2651
478 Ga0373930_0022589 3300034816 Bacteria 1245
479 Ga0373948_0012442 3300034817 Bacteria 1520
480 Ga0373958_0010609 3300034819 Bacteria 1541
481 Ga0373938_0014755 3300034957 Bacteria 1504
482 Ga0373926_0003143 3300035083 Bacteria 5301
483 Ga0373926_0067459 3300035083 Unclassified 1310
484 Ga0373926_0085108 3300035083 Bacteria 1172
485 Ga0373928_0012133 3300035084 Bacteria 1715
486 Ga0373929_0023731 3300035085 Bacteria 1262
487 Ga0373929_0063218 3300035085 Bacteria 871
488 Ga0373929_0219846 3300035085 Unclassified 540
489 Ga0373934_0001673 3300035086 Bacteria 8143
490 Ga0373934_0008531 3300035086 Bacteria 3819
491 Ga0373934_0110315 3300035086 Unclassified 1115
492 Ga0373934_0143888 3300035086 Bacteria 975
493 Ga0373940_0006439 3300035088 Bacteria 2604
494 Ga0373940_0054979 3300035088 Bacteria 1126
495 Ga0373944_0000424 3300035089 Bacteria 9670
496 Ga0373944_0010456 3300035089 Bacteria 2530
497 Ga0373949_0116180 3300035090 Unclassified 747
498 Ga0373951_0105280 3300035091 Unclassified 754
499 Ga0373952_0003468 3300035092 Bacteria 2847
500 Ga0373923_0004966 3300035111 Bacteria 4470
501 Ga0373923_0014469 3300035111 Bacteria 2964
502 Ga0373923_0015962 3300035111 Unclassified 2843
503 Ga0373923_0028048 3300035111 Bacteria 2250
504 Ga0373923_0075480 3300035111 Bacteria 1455
505 Ga0373923_0126538 3300035111 Bacteria 1145
506 Ga0373923_0535437 3300035111 Unclassified 573
507 Ga0373932_0009086 3300035112 Bacteria 2384
508 Ga0373936_0000169 3300035113 Bacteria 21812
509 Ga0373936_0004876 3300035113 Bacteria 5057
510 Ga0373936_0041039 3300035113 Bacteria 1855
511 Ga0373936_0079737 3300035113 Bacteria 1361
512 Ga0373936_0179339 3300035113 Bacteria 929
513 Ga0373939_0030493 3300035114 Bacteria 1551
514 Ga0373941_0054135 3300035115 Bacteria 1285
515 Ga0373945_0000510 3300035116 Bacteria 11054
516 Ga0373945_0005840 3300035116 Bacteria 3950
517 Ga0373945_0016220 3300035116 Bacteria 2509
518 Ga0373945_0031182 3300035116 Bacteria 1883
519 Ga0373953_0000044 3300035117 Bacteria 32505
520 Ga0373953_0038149 3300035117 Bacteria 1899
521 Ga0373953_0063896 3300035117 Bacteria 1509
522 Ga0373953_0101951 3300035117 Unclassified 1208
523 Ga0373953_0271537 3300035117 Bacteria 738
524 Ga0373954_0001593 3300035118 Bacteria 9264
525 Ga0373954_0074046 3300035118 Bacteria 1621
526 Ga0373954_0099461 3300035118 Bacteria 1402
527 Ga0373954_0102459 3300035118 Unclassified 1382
528 Ga0373956_0000249 3300035119 Bacteria 21409
529 Ga0373956_0002560 3300035119 Bacteria 7390
530 Ga0373956_0031045 3300035119 Unclassified 2339
531 Ga0373956_0595288 3300035119 Unclassified 528
532 Ga0373957_0000107 3300035120 Bacteria 20022
533 Ga0373957_0015871 3300035120 Bacteria 2599
534 Ga0373957_0055526 3300035120 Bacteria 1523
535 Ga0373957_0448071 3300035120 Unclassified 558
536 Ga0373960_0023596 3300035121 Bacteria 1657
537 Ga0373943_0001153 3300035170 Bacteria 11799
538 Ga0373943_0014124 3300035170 Bacteria 3611
539 Ga0373943_0105846 3300035170 Bacteria 1477
540 Ga0373943_0117413 3300035170 Bacteria 1410
541 Ga0373943_0239269 3300035170 Bacteria 1017
542 Ga0373943_0399531 3300035170 Bacteria 793
543 Ga0373943_0521346 3300035170 Unclassified 696
544 Ga0373946_0000662 3300035171 Bacteria 11546
545 Ga0373946_0012809 3300035171 Bacteria 3144
546 Ga0373946_0016314 3300035171 Bacteria 2829
547 Ga0373946_0049738 3300035171 Bacteria 1749
548 Ga0373946_0052605 3300035171 Bacteria 1708
549 Ga0373955_0000014 3300035172 Bacteria 72349
550 Ga0373955_0008188 3300035172 Bacteria 4842
551 Ga0373955_0016247 3300035172 Bacteria 3660
552 Ga0373955_0039673 3300035172 Bacteria 2514
553 Ga0373942_0168645 3300035207 Bacteria 712
554 Ga0373961_0046653 3300035241 Bacteria 1270
555 Ga0373961_0052308 3300035241 Bacteria 1216
556 Ga0373962_0006182 3300035242 Bacteria 2896
557 Ga0373962_0092929 3300035242 Bacteria 931
558 Ga0373924_0000783 3300035410 Bacteria 9890
559 Ga0373924_0004123 3300035410 Bacteria 5059
560 Ga0373924_0018801 3300035410 Bacteria 2669
561 Ga0373924_0133753 3300035410 Unclassified 1079
562 Ga0373924_0220861 3300035410 Unclassified 837
563 Ga0373931_0028101 3300035691 Bacteria 2876
564 Ga0373931_0123127 3300035691 Bacteria 1484
565 Ga0373931_0364589 3300035691 Bacteria 907
566 Ga0373935_0003437 3300035692 Bacteria 9204
567 Ga0373935_0003809 3300035692 Bacteria 8799
568 Ga0373935_0092064 3300035692 Bacteria 1986
569 Ga0373935_0159058 3300035692 Bacteria 1538
570 Ga0373935_0196307 3300035692 Unclassified 1392
571 Ga0373927_0007125 3300035695 Bacteria 7588
572 Ga0373927_0025699 3300035695 Bacteria 3849
573 Ga0373927_0120942 3300035695 Bacteria 1709
574 Ga0373927_0330436 3300035695 Bacteria 1004
575 Ga0373927_0385345 3300035695 Bacteria 924
576 Ga0373933_0000021 3300035724 Bacteria 96820
577 Ga0373933_0019370 3300035724 Bacteria 3843
578 Ga0373933_0040439 3300035724 Bacteria 2747
579 Ga0373933_0055188 3300035724 Bacteria 2382
580 Ga0373933_0076051 3300035724 Bacteria 2050
581 Ga0373933_0103794 3300035724 Bacteria 1766
582 Ga0373933_0111676 3300035724 Bacteria 1705
583 Ga0373947_0002831 3300035725 Bacteria 10354
584 Ga0373947_0013227 3300035725 Bacteria 4730
585 Ga0373947_0036935 3300035725 Bacteria 2897
586 Ga0373947_0167059 3300035725 Bacteria 1426
587 Ga0373947_0355086 3300035725 Bacteria 984
588 Ga0373947_0568094 3300035725 Unclassified 772
589 Ga0373937_0000032 3300036401 Bacteria 120148
590 Ga0373937_0009545 3300036401 Bacteria 8440
591 Ga0373937_0105354 3300036401 Bacteria 2620
592 Ga0373937_0175143 3300036401 Bacteria 2013
593 Ga0373937_0185996 3300036401 Bacteria 1951
594 Ga0373937_0189466 3300036401 Bacteria 1932
595 Ga0373937_1401962 3300036401 Bacteria 646
596 Ga0373925_0003785 3300037068 Bacteria 11635
597 Ga0373925_0018494 3300037068 Bacteria 5065
598 Ga0373925_0019909 3300037068 Bacteria 4881
599 Ga0373925_0026700 3300037068 Bacteria 4226
600 Ga0373925_0052371 3300037068 Bacteria 3049
601 Ga0373925_0101945 3300037068 Bacteria 2207
602 Ga0373925_0735375 3300037068 Bacteria 813
603 Ga0395900_0080117 3300037418 Bacteria 3356
604 Ga0395900_0994425 3300037418 Bacteria 759
605 Ga0395898_1014523 3300037466 Unclassified 765
606 Ga0436364_0183340 3300037853 Bacteria 6804
607 Ga0436364_0604676 3300037853 Bacteria 3834
608 Ga0436364_0700779 3300037853 Bacteria 638
609 Ga0436364_0791858 3300037853 Bacteria 1312
610 Ga0436364_0799387 3300037853 Bacteria 1029
611 Ga0436364_1045514 3300037853 Bacteria 7555
612 Ga0436364_1530016 3300037853 Bacteria 29546
613 Ga0395901_0066827 3300038443 Bacteria 3744
614 Ga0395901_1077115 3300038443 Bacteria 775
615 Ga0436365_0006186 3300039437 Bacteria 5882
616 Ga0436365_0414192 3300039437 Unclassified 1304
617 Ga0436360_0254464 3300039438 Bacteria 5468
618 Ga0436360_0613585 3300039438 Bacteria 637
619 Ga0436361_0437895 3300039447 Unclassified 673
620 Ga0436363_1006539 3300039450 Bacteria 1033
621 Ga0436362_0133374 3300039453 Unclassified 2746
622 Ga0436362_1235364 3300039453 Bacteria 621
623 Ga0451577_0190051 3300042876 Bacteria 1852
624 Ga0453683_0585969 3300044673 Unclassified 727
625 Ga0466961_0035451 3300044693 Bacteria 3204
626 Ga0466963_0004005 3300044694 Bacteria 8518
627 Ga0466963_0104402 3300044694 Bacteria 1942
628 Ga0466963_0168131 3300044694 Unclassified 1528
629 Ga0466964_0026502 3300044706 Bacteria 2269
630 Ga0466964_0345870 3300044706 Bacteria 763
631 Ga0466971_0011049 3300044719 Bacteria 3953
632 Ga0466968_0142875 3300044735 Bacteria 1096
633 Ga0466968_0283705 3300044735 Bacteria 793
634 Ga0466960_0115376 3300044901 Bacteria 1400
635 Ga0466959_0069272 3300045049 Bacteria 2556
636 Ga0466959_0145430 3300045049 Bacteria 1673
637 Ga0451576_0016352 3300045051 Bacteria 8191
638 Ga0466958_0005440 3300045836 Bacteria 6855
639 Ga0466958_0018937 3300045836 Bacteria 4002
640 Ga0466958_0136487 3300045836 Bacteria 1543
641 Ga0466958_0443623 3300045836 Unclassified 840
642 Ga0466958_0527056 3300045836 Bacteria 767
643 Ga0466967_0073155 3300045976 Bacteria 3074
644 Ga0466967_0084996 3300045976 Bacteria 2864
645 Ga0466967_0283710 3300045976 Bacteria 1589
646 Ga0466967_0476053 3300045976 Bacteria 1223
647 Ga0466967_0701712 3300045976 Bacteria 1002
648 Ga0466967_1200630 3300045976 Bacteria 756
649 Ga0495592_0000079 3300046454 Bacteria 85581
650 Ga0495592_0004732 3300046454 Bacteria 9988
651 Ga0495592_0015295 3300046454 Bacteria 5822
652 Ga0495592_0046539 3300046454 Bacteria 3233
653 Ga0495592_0062050 3300046454 Bacteria 2745
654 Ga0495592_0076844 3300046454 Bacteria 2422
655 Ga0495592_0407419 3300046454 Bacteria 860
656 Ga0495603_0005012 3300046455 Bacteria 7921
657 Ga0495603_0179823 3300046455 Bacteria 1224
658 Ga0495629_0002832 3300046459 Bacteria 13257
659 Ga0495629_0010491 3300046459 Bacteria 6739
660 Ga0495629_0044212 3300046459 Bacteria 3126
661 Ga0495629_0053279 3300046459 Bacteria 2831
662 Ga0495629_0102201 3300046459 Bacteria 2000
663 Ga0495641_0012845 3300046461 Bacteria 4649
664 Ga0495641_0018849 3300046461 Bacteria 3548
665 Ga0495641_0046108 3300046461 Bacteria 2005
666 Ga0495641_0051286 3300046461 Bacteria 1885
667 Ga0495651_0000010 3300046462 Bacteria 148763
668 Ga0495651_0116402 3300046462 Unclassified 1969
669 Ga0495651_0152028 3300046462 Bacteria 1667
670 Ga0495651_0217564 3300046462 Bacteria 1324
671 Ga0495651_0565824 3300046462 Unclassified 720
672 Ga0495653_0000601 3300046463 Bacteria 27606
673 Ga0495653_0002817 3300046463 Bacteria 13876
674 Ga0495653_0016804 3300046463 Bacteria 5954
675 Ga0495653_0070654 3300046463 Bacteria 2612
676 Ga0495653_0154459 3300046463 Bacteria 1600
677 Ga0495653_0178895 3300046463 Bacteria 1457
678 Ga0495653_0406284 3300046463 Unclassified 864
679 Ga0495580_0010328 3300046472 Bacteria 7278
680 Ga0495580_0229540 3300046472 Bacteria 1274
681 Ga0495580_0259587 3300046472 Bacteria 1188
682 Ga0495582_0012503 3300046473 Bacteria 4678
683 Ga0495582_0021981 3300046473 Bacteria 3490
684 Ga0495582_0038330 3300046473 Bacteria 2637
685 Ga0495582_0039599 3300046473 Bacteria 2594
686 Ga0495582_0075559 3300046473 Bacteria 1866
687 Ga0495639_0015642 3300046475 Bacteria 3290
688 Ga0495639_0017037 3300046475 Bacteria 3155
689 Ga0495639_0117673 3300046475 Bacteria 1265
690 Ga0495662_0004269 3300046476 Bacteria 7187
691 Ga0495662_0018100 3300046476 Bacteria 3408
692 Ga0495662_0018801 3300046476 Bacteria 3344
693 Ga0495662_0037551 3300046476 Unclassified 2339
694 Ga0495664_0001749 3300046477 Bacteria 11547
695 Ga0495664_0023680 3300046477 Bacteria 3564
696 Ga0495664_0029956 3300046477 Bacteria 3185
697 Ga0495664_0062041 3300046477 Bacteria 2225
698 Ga0495664_0119016 3300046477 Unclassified 1597
699 Ga0495664_0138606 3300046477 Bacteria 1474
700 Ga0495664_0259613 3300046477 Unclassified 1050
701 Ga0495664_0379735 3300046477 Bacteria 849
702 Ga0495584_0246304 3300046491 Unclassified 909
703 Ga0495594_0199205 3300046499 Unclassified 1141
704 Ga0495594_0212843 3300046499 Bacteria 1102
705 Ga0495608_0000037 3300046511 Bacteria 125064
706 Ga0495608_0005687 3300046511 Bacteria 8899
707 Ga0495608_0018014 3300046511 Bacteria 4879
708 Ga0495608_0041204 3300046511 Bacteria 3091
709 Ga0495608_0080670 3300046511 Bacteria 2115
710 Ga0495608_0686021 3300046511 Unclassified 610
711 Ga0495618_0040555 3300046514 Bacteria 2930
712 Ga0495618_0122905 3300046514 Bacteria 1662
713 Ga0495618_0295127 3300046514 Bacteria 1008
714 Ga0495618_0500474 3300046514 Unclassified 732
715 Ga0495628_0000227 3300046516 Bacteria 49431
716 Ga0495628_0024931 3300046516 Bacteria 4891
717 Ga0495628_0050817 3300046516 Bacteria 3279
718 Ga0495628_0090413 3300046516 Bacteria 2370
719 Ga0495628_0128663 3300046516 Bacteria 1938
720 Ga0495628_0264377 3300046516 Unclassified 1281
721 Ga0495628_0392707 3300046516 Bacteria 1014
722 Ga0495630_0037661 3300046517 Bacteria 3616
723 Ga0495630_0045136 3300046517 Bacteria 3292
724 Ga0495630_0061310 3300046517 Bacteria 2824
725 Ga0495630_0579897 3300046517 Bacteria 860
726 Ga0495666_0012325 3300046526 Bacteria 4263
727 Ga0495666_0014163 3300046526 Bacteria 3974
728 Ga0495666_0035084 3300046526 Bacteria 2446
729 Ga0495652_0000180 3300046529 Bacteria 71646
730 Ga0495652_0004139 3300046529 Bacteria 13989
731 Ga0495652_0076114 3300046529 Bacteria 2785
732 Ga0495652_0172292 3300046529 Bacteria 1669
733 Ga0495652_0290739 3300046529 Bacteria 1192
734 Ga0495652_0319814 3300046529 Unclassified 1121
735 Ga0495665_0003325 3300046531 Bacteria 8716
736 Ga0495665_0004279 3300046531 Bacteria 7716
737 Ga0495665_0029323 3300046531 Bacteria 2948
738 Ga0495665_0186939 3300046531 Bacteria 1075
739 Ga0495640_0015063 3300046533 Bacteria 5826
740 Ga0495640_0021658 3300046533 Bacteria 4711
741 Ga0495640_0069518 3300046533 Bacteria 2368
742 Ga0495640_0073053 3300046533 Bacteria 2297
743 Ga0495640_0109030 3300046533 Bacteria 1811
744 Ga0495640_0204268 3300046533 Unclassified 1251
745 Ga0495640_0318587 3300046533 Bacteria 963
746 Ga0495640_0621329 3300046533 Unclassified 651
747 Ga0495586_0032980 3300046535 Bacteria 2778
748 Ga0495586_0038569 3300046535 Bacteria 2567
749 Ga0495586_0056060 3300046535 Bacteria 2136
750 Ga0495587_0000024 3300046536 Bacteria 148753
751 Ga0495587_0053075 3300046536 Bacteria 2390
752 Ga0495587_0099410 3300046536 Bacteria 1677
753 Ga0495587_0120169 3300046536 Bacteria 1505
754 Ga0495645_0018464 3300046543 Bacteria 5008
755 Ga0495645_0027452 3300046543 Bacteria 4137
756 Ga0495645_0042705 3300046543 Bacteria 3306
757 Ga0495645_0053793 3300046543 Bacteria 2926
758 Ga0495645_0072780 3300046543 Unclassified 2476
759 Ga0495645_0077148 3300046543 Bacteria 2396
760 Ga0495645_0084013 3300046543 Bacteria 2280
761 Ga0495645_0157521 3300046543 Bacteria 1572
762 Ga0495645_0459726 3300046543 Bacteria 801
763 Ga0495622_0259848 3300046557 Unclassified 762
764 Ga0495667_0000024 3300046559 Bacteria 168313
765 Ga0495667_0010521 3300046559 Bacteria 6259
766 Ga0495667_0026991 3300046559 Bacteria 3870
767 Ga0495667_0030425 3300046559 Bacteria 3627
768 Ga0495667_0045697 3300046559 Bacteria 2898
769 Ga0495667_0053431 3300046559 Bacteria 2660
770 Ga0495667_0143989 3300046559 Bacteria 1535
771 Ga0495667_0146617 3300046559 Bacteria 1520
772 Ga0495656_0542518 3300046615 Unclassified 619
773 Ga0495634_0019496 3300046642 Bacteria 4817
774 Ga0495634_0060263 3300046642 Bacteria 2525
775 Ga0495634_0077617 3300046642 Bacteria 2177
776 Ga0495635_0000698 3300046663 Bacteria 21638
777 Ga0495635_0013834 3300046663 Bacteria 5643
778 Ga0495635_0054615 3300046663 Bacteria 2751
779 Ga0495635_0612478 3300046663 Bacteria 710
780 Ga0495588_0018741 3300046674 Bacteria 3379
781 Ga0495588_0250534 3300046674 Archaea 934
782 Ga0495657_0000121 3300046675 Bacteria 69526
783 Ga0495657_0014491 3300046675 Bacteria 5786
784 Ga0495657_0041672 3300046675 Bacteria 3140
785 Ga0495657_0073922 3300046675 Bacteria 2218
786 Ga0495657_0094247 3300046675 Bacteria 1915
787 Ga0495657_0147544 3300046675 Bacteria 1462
788 Ga0495657_0468455 3300046675 Unclassified 736
789 Ga0495599_0000362 3300046678 Bacteria 26767
790 Ga0495599_0014531 3300046678 Bacteria 4875
791 Ga0495599_0018542 3300046678 Bacteria 4335
792 Ga0495599_0021944 3300046678 Bacteria 3984
793 Ga0495599_0096896 3300046678 Unclassified 1839
794 Ga0495599_0146454 3300046678 Bacteria 1464
795 Ga0495623_0003314 3300046679 Bacteria 10644
796 Ga0495623_0023619 3300046679 Bacteria 3967
797 Ga0495623_0041927 3300046679 Bacteria 2917
798 Ga0495623_0118084 3300046679 Bacteria 1600
799 Ga0495623_0268593 3300046679 Bacteria 953
800 Ga0495623_0396265 3300046679 Unclassified 743
801 Ga0495646_0003516 3300046680 Bacteria 9759
802 Ga0495646_0023360 3300046680 Bacteria 3893
803 Ga0495646_0034742 3300046680 Bacteria 3129
804 Ga0495646_0044147 3300046680 Bacteria 2726
805 Ga0495646_0051383 3300046680 Unclassified 2495
806 Ga0495646_0056228 3300046680 Bacteria 2360
807 Ga0495646_0064842 3300046680 Bacteria 2164
808 Ga0495646_0194680 3300046680 Bacteria 1106
809 Ga0495647_0008177 3300046681 Bacteria 3515
810 Ga0495647_0011994 3300046681 Bacteria 2977
811 Ga0495647_0144790 3300046681 Bacteria 1015
812 Ga0495658_0003636 3300046683 Bacteria 7633
813 Ga0495658_0010930 3300046683 Bacteria 4550
814 Ga0495613_0037126 3300046689 Bacteria 3612
815 Ga0495613_0089011 3300046689 Bacteria 2236
816 Ga0495613_0113891 3300046689 Bacteria 1947
817 Ga0495624_0046194 3300046690 Bacteria 2769
818 Ga0495624_0050108 3300046690 Bacteria 2646
819 Ga0495624_0055880 3300046690 Bacteria 2485
820 Ga0495624_0102059 3300046690 Bacteria 1766
821 Ga0495624_0149783 3300046690 Unclassified 1427
822 Ga0495624_0371633 3300046690 Unclassified 859
823 Ga0495624_0503305 3300046690 Bacteria 725
824 Ga0495600_0000659 3300046809 Bacteria 17938
825 Ga0495600_0008867 3300046809 Bacteria 6196
826 Ga0495600_0047247 3300046809 Bacteria 2807
827 Ga0495600_0048758 3300046809 Bacteria 2762
828 Ga0495600_0104981 3300046809 Bacteria 1841
829 Ga0495581_0005385 3300047315 Bacteria 7403
830 Ga0495581_0008932 3300047315 Bacteria 5801
831 Ga0495581_0030686 3300047315 Bacteria 3113
832 Ga0495581_0048480 3300047315 Bacteria 2453
833 Ga0495581_0075137 3300047315 Bacteria 1955
834 Ga0495604_0000024 3300047317 Bacteria 148542
835 Ga0495604_0012952 3300047317 Bacteria 6646
836 Ga0495604_0015781 3300047317 Bacteria 6028
837 Ga0495604_0259145 3300047317 Bacteria 1182
838 Ga0495604_0819330 3300047317 Bacteria 585
839 Ga0495674_0002024 3300047319 Bacteria 19933
840 Ga0495674_0008562 3300047319 Bacteria 9735
841 Ga0495674_0022932 3300047319 Bacteria 5751
842 Ga0495674_0048649 3300047319 Bacteria 3751
843 Ga0495674_0065338 3300047319 Bacteria 3160
844 Ga0495674_0083049 3300047319 Bacteria 2746
845 Ga0495674_0090219 3300047319 Bacteria 2619
846 Ga0495674_0190378 3300047319 Bacteria 1705
847 Ga0495674_0426765 3300047319 Unclassified 1067
848 Ga0495674_0624790 3300047319 Unclassified 851
849 Ga0495676_0064787 3300047321 Bacteria 2839
850 Ga0495676_0119630 3300047321 Bacteria 1918
851 Ga0495676_0163022 3300047321 Bacteria 1575
852 Ga0495676_0175035 3300047321 Bacteria 1507
853 Ga0495680_0000005 3300047322 Bacteria 168308
854 Ga0495680_0013934 3300047322 Bacteria 6991
855 Ga0495680_0031216 3300047322 Bacteria 4339
856 Ga0495680_0057905 3300047322 Bacteria 2995
857 Ga0495680_0070658 3300047322 Bacteria 2660
858 Ga0495680_0076994 3300047322 Bacteria 2528
859 Ga0495680_1100908 3300047322 Unclassified 502
860 Ga0495675_0000732 3300047444 Bacteria 20520
861 Ga0495675_0005970 3300047444 Bacteria 7445
862 Ga0495675_0030343 3300047444 Bacteria 3449
863 Ga0495684_0001943 3300047471 Bacteria 16581
864 Ga0495684_0008935 3300047471 Bacteria 7739
865 Ga0495684_0010765 3300047471 Bacteria 7068
866 Ga0495684_0058922 3300047471 Bacteria 2924
867 Ga0495684_0070817 3300047471 Bacteria 2650
868 Ga0495684_0312173 3300047471 Bacteria 1126
869 Ga0495684_0983038 3300047471 Unclassified 537
870 Ga0495593_0021069 3300047673 Bacteria 3644
871 Ga0495593_0035403 3300047673 Bacteria 2711
872 Ga0495593_0068069 3300047673 Bacteria 1853
873 Ga0495593_0072795 3300047673 Bacteria 1783
874 Ga0495602_0000198 3300048088 Bacteria 56006
875 Ga0495602_0053659 3300048088 Bacteria 3567
876 Ga0495602_0059659 3300048088 Bacteria 3328
877 Ga0495602_0130272 3300048088 Bacteria 2007
878 Ga0495602_0267754 3300048088 Bacteria 1264
879 Ga0495602_0469776 3300048088 Bacteria 884
880 Ga0495614_0020687 3300048089 Bacteria 2844
881 Ga0495614_0036387 3300048089 Bacteria 2113
882 Ga0495614_0181299 3300048089 Unclassified 947
883 Ga0496101_0080830 3300048904 Bacteria 2402
884 Ga0496101_0085737 3300048904 Bacteria 2334
885 Ga0496102_0250511 3300048905 Bacteria 1670
886 Ga0496102_0391820 3300048905 Unclassified 1307
887 Ga0496102_0558887 3300048905 Bacteria 1067
888 Ga0496102_0698364 3300048905 Unclassified 937
889 Ga0496103_0027389 3300048906 Bacteria 3453
890 Ga0496103_0102809 3300048906 Bacteria 1810
891 Ga0496104_0001194 3300048907 Bacteria 22354
892 Ga0496104_0003348 3300048907 Bacteria 13840
893 Ga0496104_0070595 3300048907 Bacteria 3320
894 Ga0496105_0002102 3300048908 Bacteria 14413
895 Ga0496105_0017097 3300048908 Bacteria 5807
896 Ga0496105_0021205 3300048908 Bacteria 5257
897 Ga0496105_0036418 3300048908 Bacteria 4053
898 Ga0496105_0526975 3300048908 Bacteria 925
899 Ga0496106_0077453 3300048909 Bacteria 2549
900 Ga0496106_0106910 3300048909 Bacteria 2175
901 Ga0496107_0014906 3300048910 Bacteria 5442
902 Ga0496107_0059599 3300048910 Bacteria 2762
903 Ga0496107_0404652 3300048910 Unclassified 1015
904 Ga0496107_0551692 3300048910 Bacteria 853
905 Ga0496108_0003022 3300048911 Bacteria 13525
906 Ga0496108_0009578 3300048911 Bacteria 7849
907 Ga0496108_0012378 3300048911 Bacteria 6943
908 Ga0496108_0811023 3300048911 Bacteria 807
909 Ga0496109_0002157 3300048912 Bacteria 16358
910 Ga0496109_0052702 3300048912 Bacteria 3709
911 Ga0496109_0057856 3300048912 Bacteria 3540
912 Ga0496109_0077274 3300048912 Bacteria 3063
913 Ga0496110_1100508 3300048913 Bacteria 703
914 Ga0496111_0040374 3300048914 Bacteria 3347
915 Ga0496111_0366943 3300048914 Bacteria 1065
916 Ga0496111_0378927 3300048914 Unclassified 1046
917 Ga0496111_0598530 3300048914 Bacteria 807
918 Ga0496112_0000183 3300048915 Bacteria 40211
919 Ga0496112_0074470 3300048915 Bacteria 3357
920 Ga0496112_0267886 3300048915 Bacteria 1657
921 Ga0496112_0605908 3300048915 Unclassified 1027
922 Ga0496113_0006788 3300048916 Bacteria 7296
923 Ga0496113_0062251 3300048916 Bacteria 2817
924 Ga0496113_0230052 3300048916 Bacteria 1478
925 Ga0496113_0257040 3300048916 Bacteria 1395
926 Ga0496113_0550442 3300048916 Bacteria 925
927 Ga0496114_0102641 3300048917 Bacteria 2443
928 Ga0496114_0123518 3300048917 Bacteria 2229
929 Ga0496114_0865525 3300048917 Bacteria 784
930 Ga0496115_0033108 3300048918 Bacteria 4079
931 Ga0496115_0039179 3300048918 Bacteria 3762
932 Ga0496126_0103220 3300048929 Bacteria 2492
933 Ga0501067_0186267 3300049583 Bacteria 1156
934 Ga0501069_0417035 3300049585 Unclassified 796
935 Ga0501070_0458591 3300049586 Bacteria 1027
936 nmdc:mga05p37_38778_c1 3300050507 Bacteria 5846
937 nmdc:mga08y16_132685_c1 3300050511 Bacteria 2589
938 nmdc:mga08y16_241691_c1 3300050511 Unclassified 1866
939 nmdc:mga0n895_1244633_c1 3300050512 Bacteria 717
940 nmdc:mga0n895_246939_c1 3300050512 Bacteria 1811
941 nmdc:mga0n895_26838_c1 3300050512 Bacteria 5463
942 nmdc:mga0n895_40493_c1 3300050512 Bacteria 4526
943 nmdc:mga0n895_68643_c1 3300050512 Unclassified 3512
944 nmdc:mga0rr50_157268_c1 3300050513 Bacteria 1842
945 nmdc:mga0rr50_9469_c1 3300050513 Bacteria 6125
946 nmdc:mga0rr50_99288_c1 3300050513 Bacteria 2284
947 nmdc:mga08x19_1093308_c1 3300050514 Bacteria 566
948 nmdc:mga08x19_200024_c1 3300050514 Unclassified 1369
949 nmdc:mga08x19_41570_c1 3300050514 Bacteria 2928
950 nmdc:mga08x19_520385_c1 3300050514 Bacteria 841
951 nmdc:mga0a205_12658_c1 3300050515 Bacteria 7813
952 Ga0495601_0009875 3300053077 Bacteria 5651
953 Ga0495601_0047827 3300053077 Bacteria 2693
954 Ga0495601_0067835 3300053077 Bacteria 2272
955 Ga0495601_0102629 3300053077 Bacteria 1848
956 Ga0495601_0295806 3300053077 Bacteria 1055
957 Ga0495601_0395566 3300053077 Bacteria 896
958 Ga0495601_0697041 3300053077 Unclassified 648
959 Ga0495612_0030649 3300053078 Bacteria 2166
960 Ga0495595_0006614 3300053084 Bacteria 4731
961 Ga0495595_0015601 3300053084 Bacteria 3240
962 Ga0495595_0033595 3300053084 Bacteria 2315
963 Ga0495619_0004020 3300053085 Bacteria 9418
964 Ga0495619_0016223 3300053085 Bacteria 4714
965 Ga0495619_0112723 3300053085 Bacteria 1859
966 Ga0587071_096023 3300060344 Unclassified 679
967 Ga0587111_0122827 3300060346 Unclassified 671
968 Ga0466962_0038621 3300061719 Bacteria 2286
969 Ga0466962_0087618 3300061719 Unclassified 1491

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0230052 Ga0496113_0230052_16_453 145
2 3300026075 Ga0207708_10344040 Ga0207708_103440402 148
3 3300005981 Ga0081538_10000538 Ga0081538_100005386 156
4 3300035119 Ga0373956_0595288 Ga0373956_0595288_38_508 156
5 3300047322 Ga0495680_1100908 Ga0495680_1100908_14_484 156
6 3300047471 Ga0495684_0983038 Ga0495684_0983038_32_502 156
7 3300009098 Ga0105245_10010094 Ga0105245_100100944 157
8 3300009101 Ga0105247_10341959 Ga0105247_103419592 157
9 3300009174 Ga0105241_10263547 Ga0105241_102635472 157
10 3300009177 Ga0105248_10061741 Ga0105248_100617413 157
11 3300009545 Ga0105237_10219032 Ga0105237_102190322 157
12 3300009551 Ga0105238_10382147 Ga0105238_103821472 157
13 3300013104 Ga0157370_10132030 Ga0157370_101320302 157
14 3300013105 Ga0157369_10092910 Ga0157369_100929104 157
15 3300013296 Ga0157374_10010592 Ga0157374_100105923 157
16 3300013297 Ga0157378_10161991 Ga0157378_101619912 157
17 3300013297 Ga0157378_11565988 Ga0157378_115659882 157
18 3300013308 Ga0157375_10182194 Ga0157375_101821942 157
19 3300014325 Ga0163163_10010901 Ga0163163_100109015 157
20 3300014968 Ga0157379_10002408 Ga0157379_1000240812 157
21 3300014969 Ga0157376_10041457 Ga0157376_100414573 157
22 3300035085 Ga0373929_0219846 Ga0373929_0219846_33_506 157
23 3300035086 Ga0373934_0001673 Ga0373934_0001673_1917_2390 157
24 3300035090 Ga0373949_0116180 Ga0373949_0116180_234_707 157
25 3300035111 Ga0373923_0014469 Ga0373923_0014469_1931_2404 157
26 3300035111 Ga0373923_0535437 Ga0373923_0535437_72_545 157
27 3300035113 Ga0373936_0041039 Ga0373936_0041039_1271_1744 157
28 3300035113 Ga0373936_0179339 Ga0373936_0179339_20_493 157
29 3300035117 Ga0373953_0000044 Ga0373953_0000044_9265_9738 157
30 3300035118 Ga0373954_0001593 Ga0373954_0001593_6992_7465 157
31 3300035118 Ga0373954_0102459 Ga0373954_0102459_363_836 157
32 3300035119 Ga0373956_0000249 Ga0373956_0000249_19593_20066 157
33 3300035120 Ga0373957_0000107 Ga0373957_0000107_2254_2727 157
34 3300035170 Ga0373943_0105846 Ga0373943_0105846_268_741 157
35 3300035171 Ga0373946_0052605 Ga0373946_0052605_661_1134 157
36 3300035172 Ga0373955_0000014 Ga0373955_0000014_37762_38235 157
37 3300035172 Ga0373955_0016247 Ga0373955_0016247_2193_2666 157
38 3300035410 Ga0373924_0000783 Ga0373924_0000783_2728_3201 157
39 3300035410 Ga0373924_0018801 Ga0373924_0018801_257_730 157
40 3300035691 Ga0373931_0364589 Ga0373931_0364589_10_483 157
41 3300035695 Ga0373927_0385345 Ga0373927_0385345_193_666 157
42 3300035724 Ga0373933_0000021 Ga0373933_0000021_11458_11931 157
43 3300035724 Ga0373933_0076051 Ga0373933_0076051_190_663 157
44 3300035724 Ga0373933_0111676 Ga0373933_0111676_27_500 157
45 3300035725 Ga0373947_0167059 Ga0373947_0167059_26_499 157
46 3300036401 Ga0373937_0000032 Ga0373937_0000032_85117_85590 157
47 3300036401 Ga0373937_0175143 Ga0373937_0175143_971_1444 157
48 3300046454 Ga0495592_0000079 Ga0495592_0000079_63164_63637 157
49 3300046455 Ga0495603_0179823 Ga0495603_0179823_495_968 157
50 3300046459 Ga0495629_0053279 Ga0495629_0053279_598_1071 157
51 3300046462 Ga0495651_0000010 Ga0495651_0000010_63164_63637 157
52 3300046463 Ga0495653_0000601 Ga0495653_0000601_981_1454 157
53 3300046473 Ga0495582_0038330 Ga0495582_0038330_1142_1615 157
54 3300046475 Ga0495639_0117673 Ga0495639_0117673_328_801 157
55 3300046477 Ga0495664_0119016 Ga0495664_0119016_1097_1570 157
56 3300046511 Ga0495608_0000037 Ga0495608_0000037_45762_46235 157
57 3300046511 Ga0495608_0686021 Ga0495608_0686021_112_585 157
58 3300046514 Ga0495618_0500474 Ga0495618_0500474_243_716 157
59 3300046516 Ga0495628_0000227 Ga0495628_0000227_39258_39731 157
60 3300046516 Ga0495628_0392707 Ga0495628_0392707_256_729 157
61 3300046526 Ga0495666_0014163 Ga0495666_0014163_33_506 157
62 3300046529 Ga0495652_0000180 Ga0495652_0000180_49133_49606 157
63 3300046533 Ga0495640_0318587 Ga0495640_0318587_255_728 157
64 3300046535 Ga0495586_0056060 Ga0495586_0056060_884_1357 157
65 3300046536 Ga0495587_0000024 Ga0495587_0000024_85116_85589 157
66 3300046543 Ga0495645_0084013 Ga0495645_0084013_1788_2261 157
67 3300046559 Ga0495667_0000024 Ga0495667_0000024_104675_105148 157
68 3300046675 Ga0495657_0000121 Ga0495657_0000121_63152_63625 157
69 3300046678 Ga0495599_0000362 Ga0495599_0000362_26121_26594 157
70 3300046679 Ga0495623_0003314 Ga0495623_0003314_44_517 157
71 3300046679 Ga0495623_0118084 Ga0495623_0118084_642_1115 157
72 3300046680 Ga0495646_0064842 Ga0495646_0064842_1210_1683 157
73 3300046681 Ga0495647_0144790 Ga0495647_0144790_297_770 157
74 3300046690 Ga0495624_0050108 Ga0495624_0050108_1929_2402 157
75 3300046809 Ga0495600_0000659 Ga0495600_0000659_12495_12968 157
76 3300047315 Ga0495581_0075137 Ga0495581_0075137_1269_1742 157
77 3300047317 Ga0495604_0000024 Ga0495604_0000024_84933_85406 157
78 3300047319 Ga0495674_0090219 Ga0495674_0090219_1682_2155 157
79 3300047319 Ga0495674_0624790 Ga0495674_0624790_345_818 157
80 3300047321 Ga0495676_0163022 Ga0495676_0163022_876_1349 157
81 3300047322 Ga0495680_0000005 Ga0495680_0000005_63140_63613 157
82 3300047444 Ga0495675_0000732 Ga0495675_0000732_19538_20011 157
83 3300047673 Ga0495593_0068069 Ga0495593_0068069_1129_1602 157
84 3300048088 Ga0495602_0000198 Ga0495602_0000198_34559_35032 157
85 3300048088 Ga0495602_0469776 Ga0495602_0469776_374_847 157
86 3300048905 Ga0496102_0391820 Ga0496102_0391820_363_836 157
87 3300048905 Ga0496102_0558887 Ga0496102_0558887_450_923 157
88 3300048908 Ga0496105_0021205 Ga0496105_0021205_1439_1912 157
89 3300048914 Ga0496111_0378927 Ga0496111_0378927_208_681 157
90 3300048915 Ga0496112_0074470 Ga0496112_0074470_2334_2807 157
91 3300048917 Ga0496114_0865525 Ga0496114_0865525_61_534 157
92 3300050512 nmdc:mga0n895_246939_c1 nmdc:mga0n895_246939_c1_331_804 157
93 3300050513 nmdc:mga0rr50_99288_c1 nmdc:mga0rr50_99288_c1_246_719 157
94 3300050514 nmdc:mga08x19_1093308_c1 nmdc:mga08x19_1093308_c1_31_504 157
95 3300053077 Ga0495601_0697041 Ga0495601_0697041_103_576 157
96 3300053078 Ga0495612_0030649 Ga0495612_0030649_613_1086 157
97 3300053084 Ga0495595_0006614 Ga0495595_0006614_1356_1829 157
98 3300025900 Ga0207710_10035399 Ga0207710_100353992 158
99 3300005356 Ga0070674_100128745 Ga0070674_1001287452 159
100 3300006881 Ga0068865_100556061 Ga0068865_1005560612 159
101 3300028556 Ga0265337_1021791 Ga0265337_10217911 160
102 3300037418 Ga0395900_0994425 Ga0395900_0994425_44_535 162
103 3300038443 Ga0395901_1077115 Ga0395901_1077115_87_578 162
104 3300005338 Ga0068868_100089213 Ga0068868_1000892131 163
105 3300005341 Ga0070691_10029378 Ga0070691_100293783 163
106 3300005535 Ga0070684_100119349 Ga0070684_1001193493 163
107 3300005546 Ga0070696_100207734 Ga0070696_1002077342 163
108 3300005549 Ga0070704_100123783 Ga0070704_1001237833 163
109 3300005563 Ga0068855_100227677 Ga0068855_1002276772 163
110 3300005577 Ga0068857_100110737 Ga0068857_1001107372 163
111 3300005614 Ga0068856_100361819 Ga0068856_1003618192 163
112 3300005617 Ga0068859_100192264 Ga0068859_1001922642 163
113 3300005841 Ga0068863_100067239 Ga0068863_1000672394 163
114 3300005842 Ga0068858_100035279 Ga0068858_1000352794 163
115 3300006163 Ga0070715_10015253 Ga0070715_100152532 163
116 3300006173 Ga0070716_100012587 Ga0070716_1000125872 163
117 3300006237 Ga0097621_100060592 Ga0097621_1000605923 163
118 3300006358 Ga0068871_100087607 Ga0068871_1000876072 163
119 3300006871 Ga0075434_100447620 Ga0075434_1004476203 163
120 3300006914 Ga0075436_100187822 Ga0075436_1001878223 163
121 3300006931 Ga0097620_100192262 Ga0097620_1001922623 163
122 3300025915 Ga0207693_10037841 Ga0207693_100378413 163
123 3300025916 Ga0207663_10346641 Ga0207663_103466412 163
124 3300025929 Ga0207664_10165850 Ga0207664_101658502 163
125 3300025939 Ga0207665_10013823 Ga0207665_100138233 163
126 3300025944 Ga0207661_10291618 Ga0207661_102916182 163
127 3300025961 Ga0207712_10399140 Ga0207712_103991402 163
128 3300026023 Ga0207677_10020233 Ga0207677_100202333 163
129 3300026078 Ga0207702_10111160 Ga0207702_101111603 163
130 3300026116 Ga0207674_10053372 Ga0207674_100533724 163
131 3300045836 Ga0466958_0136487 Ga0466958_0136487_604_1119 163
132 3300061719 Ga0466962_0087618 Ga0466962_0087618_285_800 163
133 3300005295 Ga0065707_10010235 Ga0065707_100102352 164
134 3300005329 Ga0070683_100150452 Ga0070683_1001504521 164
135 3300005331 Ga0070670_100127662 Ga0070670_1001276623 164
136 3300005337 Ga0070682_100381584 Ga0070682_1003815842 164
137 3300005338 Ga0068868_100211445 Ga0068868_1002114453 164
138 3300005339 Ga0070660_100273042 Ga0070660_1002730422 164
139 3300005340 Ga0070689_100486184 Ga0070689_1004861841 164
140 3300005353 Ga0070669_100083417 Ga0070669_1000834172 164
141 3300005354 Ga0070675_100020082 Ga0070675_1000200822 164
142 3300005356 Ga0070674_101624573 Ga0070674_1016245731 164
143 3300005365 Ga0070688_100060707 Ga0070688_1000607071 164
144 3300005438 Ga0070701_10097201 Ga0070701_100972012 164
145 3300005440 Ga0070705_100390086 Ga0070705_1003900863 164
146 3300005441 Ga0070700_100028004 Ga0070700_1000280044 164
147 3300005445 Ga0070708_100017977 Ga0070708_1000179778 164
148 3300005445 Ga0070708_100104212 Ga0070708_1001042124 164
149 3300005445 Ga0070708_100112502 Ga0070708_1001125023 164
150 3300005455 Ga0070663_100039551 Ga0070663_1000395512 164
151 3300005457 Ga0070662_100362063 Ga0070662_1003620632 164
152 3300005466 Ga0070685_10026846 Ga0070685_100268464 164
153 3300005467 Ga0070706_100041193 Ga0070706_1000411932 164
154 3300005468 Ga0070707_100033411 Ga0070707_1000334112 164
155 3300005471 Ga0070698_100018588 Ga0070698_1000185884 164
156 3300005471 Ga0070698_101229058 Ga0070698_1012290582 164
157 3300005518 Ga0070699_100046263 Ga0070699_1000462633 164
158 3300005535 Ga0070684_100040413 Ga0070684_1000404133 164
159 3300005536 Ga0070697_101233014 Ga0070697_1012330141 164
160 3300005546 Ga0070696_100698481 Ga0070696_1006984811 164
161 3300005577 Ga0068857_100056671 Ga0068857_1000566712 164
162 3300005615 Ga0070702_100008618 Ga0070702_1000086184 164
163 3300005618 Ga0068864_100793406 Ga0068864_1007934062 164
164 3300005842 Ga0068858_100427567 Ga0068858_1004275672 164
165 3300005844 Ga0068862_100130513 Ga0068862_1001305131 164
166 3300005985 Ga0081539_10097984 Ga0081539_100979842 164
167 3300009094 Ga0111539_10822781 Ga0111539_108227812 164
168 3300009098 Ga0105245_10062831 Ga0105245_100628311 164
169 3300009147 Ga0114129_10083341 Ga0114129_100833414 164
170 3300009176 Ga0105242_11883474 Ga0105242_118834741 164
171 3300013308 Ga0157375_10845312 Ga0157375_108453122 164
172 3300014325 Ga0163163_10252588 Ga0163163_102525881 164
173 3300014745 Ga0157377_10005520 Ga0157377_100055202 164
174 3300025901 Ga0207688_10185593 Ga0207688_101855932 164
175 3300025910 Ga0207684_10061469 Ga0207684_100614693 164
176 3300025919 Ga0207657_10161579 Ga0207657_101615792 164
177 3300025922 Ga0207646_10216439 Ga0207646_102164392 164
178 3300025922 Ga0207646_10237375 Ga0207646_102373752 164
179 3300025923 Ga0207681_10478146 Ga0207681_104781461 164
180 3300025927 Ga0207687_10036137 Ga0207687_100361371 164
181 3300025933 Ga0207706_10141147 Ga0207706_101411472 164
182 3300025936 Ga0207670_10095599 Ga0207670_100955992 164
183 3300025944 Ga0207661_10150708 Ga0207661_101507081 164
184 3300025945 Ga0207679_10004671 Ga0207679_100046717 164
185 3300026075 Ga0207708_10202255 Ga0207708_102022552 164
186 3300026116 Ga0207674_10200176 Ga0207674_102001762 164
187 3300027907 Ga0207428_10513458 Ga0207428_105134582 164
188 3300028380 Ga0268265_10083304 Ga0268265_100833042 164
189 3300028558 Ga0265326_10109137 Ga0265326_101091371 164
190 3300028573 Ga0265334_10049111 Ga0265334_100491112 164
191 3300028577 Ga0265318_10139369 Ga0265318_101393691 164
192 3300028654 Ga0265322_10002593 Ga0265322_100025932 164
193 3300028666 Ga0265336_10066371 Ga0265336_100663712 164
194 3300028800 Ga0265338_10140174 Ga0265338_101401742 164
195 3300029957 Ga0265324_10016769 Ga0265324_100167692 164
196 3300031235 Ga0265330_10142509 Ga0265330_101425091 164
197 3300031238 Ga0265332_10060322 Ga0265332_100603222 164
198 3300031239 Ga0265328_10147042 Ga0265328_101470422 164
199 3300031240 Ga0265320_10044744 Ga0265320_100447443 164
200 3300031240 Ga0265320_10264010 Ga0265320_102640102 164
201 3300031242 Ga0265329_10038284 Ga0265329_100382842 164
202 3300031250 Ga0265331_10096929 Ga0265331_100969292 164
203 3300031344 Ga0265316_10024760 Ga0265316_100247602 164
204 3300042876 Ga0451577_0190051 Ga0451577_0190051_1144_1647 164
205 3300044673 Ga0453683_0585969 Ga0453683_0585969_16_519 164
206 3300045051 Ga0451576_0016352 Ga0451576_0016352_5675_6178 164
207 3300046491 Ga0495584_0246304 Ga0495584_0246304_276_803 164
208 3300046615 Ga0495656_0542518 Ga0495656_0542518_57_590 164
209 3300048910 Ga0496107_0404652 Ga0496107_0404652_145_648 164
210 3300048911 Ga0496108_0009578 Ga0496108_0009578_3291_3794 164
211 3300048912 Ga0496109_0002157 Ga0496109_0002157_8599_9102 164
212 3300048915 Ga0496112_0605908 Ga0496112_0605908_256_759 164
213 3300049586 Ga0501070_0458591 Ga0501070_0458591_125_646 164
214 3300050511 nmdc:mga08y16_241691_c1 nmdc:mga08y16_241691_c1_261_764 164
215 3300005327 Ga0070658_10070640 Ga0070658_100706403 165
216 3300005329 Ga0070683_100003809 Ga0070683_1000038093 165
217 3300005336 Ga0070680_100442855 Ga0070680_1004428552 165
218 3300005339 Ga0070660_100465144 Ga0070660_1004651442 165
219 3300005458 Ga0070681_10187369 Ga0070681_101873693 165
220 3300005530 Ga0070679_100070467 Ga0070679_1000704672 165
221 3300009551 Ga0105238_10908589 Ga0105238_109085892 165
222 3300020610 Ga0154015_1065643 Ga0154015_10656432 165
223 3300021384 Ga0213876_10018060 Ga0213876_100180604 165
224 3300021388 Ga0213875_10027793 Ga0213875_100277932 165
225 3300021441 Ga0213871_10008344 Ga0213871_100083443 165
226 3300025919 Ga0207657_10408873 Ga0207657_104088732 165
227 3300025921 Ga0207652_10076597 Ga0207652_100765972 165
228 3300025944 Ga0207661_10032384 Ga0207661_100323843 165
229 3300025981 Ga0207640_11339504 Ga0207640_113395041 165
230 3300028563 Ga0265319_1000473 Ga0265319_10004731 165
231 3300028563 Ga0265319_1036444 Ga0265319_10364442 165
232 3300028573 Ga0265334_10234650 Ga0265334_102346501 165
233 3300028577 Ga0265318_10119217 Ga0265318_101192172 165
234 3300028800 Ga0265338_10320811 Ga0265338_103208112 165
235 3300031238 Ga0265332_10213042 Ga0265332_102130422 165
236 3300031240 Ga0265320_10122416 Ga0265320_101224161 165
237 3300031247 Ga0265340_10103489 Ga0265340_101034892 165
238 3300031595 Ga0265313_10089758 Ga0265313_100897582 165
239 3300031711 Ga0265314_10058135 Ga0265314_100581352 165
240 3300037418 Ga0395900_0080117 Ga0395900_0080117_1180_1737 165
241 3300037466 Ga0395898_1014523 Ga0395898_1014523_175_702 165
242 3300037853 Ga0436364_0183340 Ga0436364_0183340_5437_5964 165
243 3300037853 Ga0436364_0700779 Ga0436364_0700779_35_562 165
244 3300038443 Ga0395901_0066827 Ga0395901_0066827_677_1204 165
245 3300039437 Ga0436365_0006186 Ga0436365_0006186_1693_2220 165
246 3300039437 Ga0436365_0414192 Ga0436365_0414192_314_838 165
247 3300039438 Ga0436360_0254464 Ga0436360_0254464_3884_4408 165
248 3300039453 Ga0436362_0133374 Ga0436362_0133374_208_732 165
249 3300044693 Ga0466961_0035451 Ga0466961_0035451_1172_1696 165
250 3300044694 Ga0466963_0004005 Ga0466963_0004005_1773_2297 165
251 3300044694 Ga0466963_0168131 Ga0466963_0168131_177_701 165
252 3300044706 Ga0466964_0026502 Ga0466964_0026502_141_665 165
253 3300044706 Ga0466964_0345870 Ga0466964_0345870_82_606 165
254 3300044719 Ga0466971_0011049 Ga0466971_0011049_758_1282 165
255 3300044735 Ga0466968_0142875 Ga0466968_0142875_95_622 165
256 3300044901 Ga0466960_0115376 Ga0466960_0115376_810_1334 165
257 3300045049 Ga0466959_0069272 Ga0466959_0069272_1304_1828 165
258 3300045049 Ga0466959_0145430 Ga0466959_0145430_623_1147 165
259 3300045836 Ga0466958_0005440 Ga0466958_0005440_1587_2111 165
260 3300045836 Ga0466958_0018937 Ga0466958_0018937_2926_3450 165
261 3300045836 Ga0466958_0443623 Ga0466958_0443623_117_641 165
262 3300045976 Ga0466967_0073155 Ga0466967_0073155_2522_3046 165
263 3300045976 Ga0466967_0084996 Ga0466967_0084996_1426_1950 165
264 3300045976 Ga0466967_0476053 Ga0466967_0476053_79_603 165
265 3300045976 Ga0466967_0701712 Ga0466967_0701712_155_679 165
266 3300045976 Ga0466967_1200630 Ga0466967_1200630_32_559 165
267 3300048911 Ga0496108_0811023 Ga0496108_0811023_220_747 165
268 3300048913 Ga0496110_1100508 Ga0496110_1100508_163_690 165
269 3300049583 Ga0501067_0186267 Ga0501067_0186267_393_917 165
270 3300049585 Ga0501069_0417035 Ga0501069_0417035_88_612 165
271 3300061719 Ga0466962_0038621 Ga0466962_0038621_478_1002 165
272 3300005445 Ga0070708_100008914 Ga0070708_1000089148 168
273 3300005445 Ga0070708_100646013 Ga0070708_1006460132 168
274 3300005471 Ga0070698_100053715 Ga0070698_1000537152 168
275 3300005536 Ga0070697_100063402 Ga0070697_1000634024 168
276 3300006028 Ga0070717_10001468 Ga0070717_100014682 168
277 3300025922 Ga0207646_10124397 Ga0207646_101243973 168
278 3300005434 Ga0070709_10011449 Ga0070709_100114493 170
279 3300005435 Ga0070714_100002822 Ga0070714_10000282210 170
280 3300005436 Ga0070713_100125631 Ga0070713_1001256312 170
281 3300005439 Ga0070711_100155849 Ga0070711_1001558492 170
282 3300005439 Ga0070711_100767814 Ga0070711_1007678141 170
283 3300024225 Ga0224572_1008572 Ga0224572_10085721 170
284 3300024227 Ga0228598_1066173 Ga0228598_10661732 170
285 3300025906 Ga0207699_10029022 Ga0207699_100290222 170
286 3300025916 Ga0207663_10917180 Ga0207663_109171802 170
287 3300025928 Ga0207700_10036128 Ga0207700_100361283 170
288 3300025929 Ga0207664_10010813 Ga0207664_100108135 170
289 3300005329 Ga0070683_100258732 Ga0070683_1002587322 171
290 3300005330 Ga0070690_100632894 Ga0070690_1006328942 171
291 3300005340 Ga0070689_100782338 Ga0070689_1007823381 171
292 3300005355 Ga0070671_100327979 Ga0070671_1003279792 171
293 3300005518 Ga0070699_101581426 Ga0070699_1015814261 171
294 3300005536 Ga0070697_100731521 Ga0070697_1007315211 171
295 3300005564 Ga0070664_100901662 Ga0070664_1009016622 171
296 3300005618 Ga0068864_100107553 Ga0068864_1001075531 171
297 3300005843 Ga0068860_100636532 Ga0068860_1006365321 171
298 3300006028 Ga0070717_10264298 Ga0070717_102642982 171
299 3300007076 Ga0075435_100583994 Ga0075435_1005839942 171
300 3300013307 Ga0157372_12133173 Ga0157372_121331731 171
301 3300022467 Ga0224712_10170286 Ga0224712_101702861 171
302 3300025898 Ga0207692_10229445 Ga0207692_102294451 171
303 3300025914 Ga0207671_10558026 Ga0207671_105580262 171
304 3300025924 Ga0207694_10185297 Ga0207694_101852972 171
305 3300025928 Ga0207700_10579970 Ga0207700_105799702 171
306 3300025931 Ga0207644_10668641 Ga0207644_106686411 171
307 3300025936 Ga0207670_10710998 Ga0207670_107109981 171
308 3300025941 Ga0207711_10189798 Ga0207711_101897982 171
309 3300025949 Ga0207667_10719865 Ga0207667_107198651 171
310 3300026035 Ga0207703_10078467 Ga0207703_100784671 171
311 3300026095 Ga0207676_10566137 Ga0207676_105661372 171
312 3300028381 Ga0268264_10612459 Ga0268264_106124591 171
313 3300035083 Ga0373926_0085108 Ga0373926_0085108_10_531 171
314 3300035116 Ga0373945_0005840 Ga0373945_0005840_1953_2474 171
315 3300035117 Ga0373953_0271537 Ga0373953_0271537_14_535 171
316 3300035120 Ga0373957_0448071 Ga0373957_0448071_12_533 171
317 3300046454 Ga0495592_0062050 Ga0495592_0062050_1503_2024 171
318 3300046461 Ga0495641_0046108 Ga0495641_0046108_246_767 171
319 3300046463 Ga0495653_0178895 Ga0495653_0178895_267_788 171
320 3300046472 Ga0495580_0229540 Ga0495580_0229540_63_584 171
321 3300046526 Ga0495666_0035084 Ga0495666_0035084_538_1059 171
322 3300046531 Ga0495665_0029323 Ga0495665_0029323_1340_1861 171
323 3300046559 Ga0495667_0143989 Ga0495667_0143989_286_807 171
324 3300046663 Ga0495635_0054615 Ga0495635_0054615_995_1516 171
325 3300046674 Ga0495588_0250534 Ga0495588_0250534_352_873 171
326 3300046680 Ga0495646_0044147 Ga0495646_0044147_341_862 171
327 3300046689 Ga0495613_0113891 Ga0495613_0113891_876_1397 171
328 3300047317 Ga0495604_0259145 Ga0495604_0259145_115_636 171
329 3300048088 Ga0495602_0053659 Ga0495602_0053659_1412_1933 171
330 3300048907 Ga0496104_0003348 Ga0496104_0003348_8526_9047 171
331 3300048911 Ga0496108_0003022 Ga0496108_0003022_8891_9412 171
332 3300050514 nmdc:mga08x19_520385_c1 nmdc:mga08x19_520385_c1_14_535 171
333 3300053077 Ga0495601_0047827 Ga0495601_0047827_2158_2679 171
334 3300060346 Ga0587111_0122827 Ga0587111_0122827_58_579 171
335 3300003659 JGI25404J52841_10000079 JGI25404J52841_100000797 172
336 3300004803 Ga0058862_12117740 Ga0058862_121177402 172
337 3300005327 Ga0070658_10158050 Ga0070658_101580502 172
338 3300005328 Ga0070676_10355974 Ga0070676_103559741 172
339 3300005329 Ga0070683_100007853 Ga0070683_1000078532 172
340 3300005330 Ga0070690_100036403 Ga0070690_1000364032 172
341 3300005331 Ga0070670_100097446 Ga0070670_1000974463 172
342 3300005334 Ga0068869_100126332 Ga0068869_1001263323 172
343 3300005335 Ga0070666_10025853 Ga0070666_100258533 172
344 3300005336 Ga0070680_100017429 Ga0070680_1000174295 172
345 3300005337 Ga0070682_100059017 Ga0070682_1000590172 172
346 3300005337 Ga0070682_100214898 Ga0070682_1002148981 172
347 3300005337 Ga0070682_100398972 Ga0070682_1003989722 172
348 3300005339 Ga0070660_100241205 Ga0070660_1002412052 172
349 3300005340 Ga0070689_100021701 Ga0070689_1000217013 172
350 3300005341 Ga0070691_10019206 Ga0070691_100192063 172
351 3300005344 Ga0070661_100013534 Ga0070661_1000135343 172
352 3300005345 Ga0070692_10005873 Ga0070692_100058735 172
353 3300005353 Ga0070669_100087974 Ga0070669_1000879742 172
354 3300005354 Ga0070675_100049160 Ga0070675_1000491602 172
355 3300005355 Ga0070671_100115898 Ga0070671_1001158982 172
356 3300005364 Ga0070673_100065880 Ga0070673_1000658802 172
357 3300005365 Ga0070688_100268818 Ga0070688_1002688182 172
358 3300005367 Ga0070667_100045133 Ga0070667_1000451332 172
359 3300005434 Ga0070709_10000898 Ga0070709_1000089814 172
360 3300005434 Ga0070709_10396537 Ga0070709_103965372 172
361 3300005435 Ga0070714_100009138 Ga0070714_1000091387 172
362 3300005435 Ga0070714_100128815 Ga0070714_1001288152 172
363 3300005435 Ga0070714_100298801 Ga0070714_1002988012 172
364 3300005436 Ga0070713_100005320 Ga0070713_1000053207 172
365 3300005436 Ga0070713_100034459 Ga0070713_1000344591 172
366 3300005436 Ga0070713_100097223 Ga0070713_1000972233 172
367 3300005436 Ga0070713_100188275 Ga0070713_1001882752 172
368 3300005436 Ga0070713_100600576 Ga0070713_1006005761 172
369 3300005437 Ga0070710_10000649 Ga0070710_1000064912 172
370 3300005437 Ga0070710_10004332 Ga0070710_100043327 172
371 3300005439 Ga0070711_100001246 Ga0070711_1000012467 172
372 3300005439 Ga0070711_100008207 Ga0070711_1000082072 172
373 3300005439 Ga0070711_100107809 Ga0070711_1001078092 172
374 3300005440 Ga0070705_100004180 Ga0070705_1000041803 172
375 3300005440 Ga0070705_100085564 Ga0070705_1000855642 172
376 3300005444 Ga0070694_100051839 Ga0070694_1000518394 172
377 3300005445 Ga0070708_100013905 Ga0070708_1000139053 172
378 3300005445 Ga0070708_100023693 Ga0070708_1000236935 172
379 3300005445 Ga0070708_100026442 Ga0070708_1000264421 172
380 3300005455 Ga0070663_100001262 Ga0070663_10000126212 172
381 3300005456 Ga0070678_100010703 Ga0070678_1000107034 172
382 3300005457 Ga0070662_100205993 Ga0070662_1002059932 172
383 3300005458 Ga0070681_10145848 Ga0070681_101458482 172
384 3300005458 Ga0070681_10484628 Ga0070681_104846281 172
385 3300005459 Ga0068867_100163342 Ga0068867_1001633422 172
386 3300005467 Ga0070706_100034040 Ga0070706_1000340404 172
387 3300005467 Ga0070706_100037181 Ga0070706_1000371812 172
388 3300005468 Ga0070707_100055256 Ga0070707_1000552563 172
389 3300005468 Ga0070707_100103302 Ga0070707_1001033022 172
390 3300005468 Ga0070707_100120487 Ga0070707_1001204873 172
391 3300005468 Ga0070707_100136661 Ga0070707_1001366611 172
392 3300005471 Ga0070698_100116886 Ga0070698_1001168861 172
393 3300005471 Ga0070698_100134045 Ga0070698_1001340452 172
394 3300005471 Ga0070698_100168932 Ga0070698_1001689322 172
395 3300005518 Ga0070699_100011386 Ga0070699_1000113861 172
396 3300005518 Ga0070699_100052118 Ga0070699_1000521184 172
397 3300005518 Ga0070699_100630020 Ga0070699_1006300201 172
398 3300005530 Ga0070679_100036814 Ga0070679_1000368144 172
399 3300005530 Ga0070679_101010839 Ga0070679_1010108391 172
400 3300005535 Ga0070684_100021226 Ga0070684_1000212266 172
401 3300005535 Ga0070684_100268122 Ga0070684_1002681222 172
402 3300005536 Ga0070697_100007671 Ga0070697_1000076716 172
403 3300005536 Ga0070697_100342605 Ga0070697_1003426052 172
404 3300005539 Ga0068853_100097088 Ga0068853_1000970883 172
405 3300005544 Ga0070686_100026093 Ga0070686_1000260932 172
406 3300005545 Ga0070695_100153135 Ga0070695_1001531352 172
407 3300005545 Ga0070695_100219796 Ga0070695_1002197961 172
408 3300005546 Ga0070696_100054045 Ga0070696_1000540452 172
409 3300005546 Ga0070696_100734978 Ga0070696_1007349782 172
410 3300005547 Ga0070693_100140675 Ga0070693_1001406751 172
411 3300005547 Ga0070693_100162490 Ga0070693_1001624902 172
412 3300005548 Ga0070665_100701056 Ga0070665_1007010562 172
413 3300005549 Ga0070704_100122701 Ga0070704_1001227011 172
414 3300005549 Ga0070704_101244716 Ga0070704_1012447161 172
415 3300005564 Ga0070664_100006864 Ga0070664_1000068645 172
416 3300005577 Ga0068857_100036849 Ga0068857_1000368494 172
417 3300005578 Ga0068854_100046397 Ga0068854_1000463974 172
418 3300005614 Ga0068856_100011336 Ga0068856_1000113365 172
419 3300005614 Ga0068856_100696391 Ga0068856_1006963912 172
420 3300005614 Ga0068856_100900716 Ga0068856_1009007161 172
421 3300005616 Ga0068852_100013437 Ga0068852_1000134374 172
422 3300005616 Ga0068852_101279622 Ga0068852_1012796221 172
423 3300005617 Ga0068859_100048443 Ga0068859_1000484434 172
424 3300005718 Ga0068866_10341972 Ga0068866_103419722 172
425 3300005719 Ga0068861_100023428 Ga0068861_1000234284 172
426 3300005834 Ga0068851_10015521 Ga0068851_100155213 172
427 3300005840 Ga0068870_10048833 Ga0068870_100488332 172
428 3300005841 Ga0068863_100492248 Ga0068863_1004922482 172
429 3300005843 Ga0068860_100045353 Ga0068860_1000453534 172
430 3300005844 Ga0068862_100056197 Ga0068862_1000561973 172
431 3300005937 Ga0081455_10088019 Ga0081455_100880192 172
432 3300005983 Ga0081540_1001110 Ga0081540_100111022 172
433 3300005983 Ga0081540_1002815 Ga0081540_10028156 172
434 3300006028 Ga0070717_10011855 Ga0070717_100118553 172
435 3300006028 Ga0070717_10022914 Ga0070717_100229143 172
436 3300006028 Ga0070717_10032455 Ga0070717_100324555 172
437 3300006028 Ga0070717_10132918 Ga0070717_101329183 172
438 3300006028 Ga0070717_10449154 Ga0070717_104491542 172
439 3300006028 Ga0070717_10684575 Ga0070717_106845752 172
440 3300006028 Ga0070717_11284228 Ga0070717_112842281 172
441 3300006163 Ga0070715_10001376 Ga0070715_100013764 172
442 3300006163 Ga0070715_10077725 Ga0070715_100777252 172
443 3300006163 Ga0070715_10107307 Ga0070715_101073072 172
444 3300006163 Ga0070715_10186241 Ga0070715_101862412 172
445 3300006173 Ga0070716_100003048 Ga0070716_1000030484 172
446 3300006173 Ga0070716_100005468 Ga0070716_1000054682 172
447 3300006173 Ga0070716_100148756 Ga0070716_1001487562 172
448 3300006173 Ga0070716_100340044 Ga0070716_1003400442 172
449 3300006175 Ga0070712_100007818 Ga0070712_1000078183 172
450 3300006175 Ga0070712_100201313 Ga0070712_1002013132 172
451 3300006175 Ga0070712_100204974 Ga0070712_1002049742 172
452 3300006175 Ga0070712_100409598 Ga0070712_1004095982 172
453 3300006175 Ga0070712_100841834 Ga0070712_1008418342 172
454 3300006237 Ga0097621_100194789 Ga0097621_1001947892 172
455 3300006237 Ga0097621_100808083 Ga0097621_1008080832 172
456 3300006358 Ga0068871_100935193 Ga0068871_1009351932 172
457 3300006844 Ga0075428_100326426 Ga0075428_1003264262 172
458 3300006852 Ga0075433_10006430 Ga0075433_100064307 172
459 3300006852 Ga0075433_10086522 Ga0075433_100865222 172
460 3300006871 Ga0075434_100010403 Ga0075434_1000104034 172
461 3300006871 Ga0075434_100181401 Ga0075434_1001814012 172
462 3300006871 Ga0075434_100185211 Ga0075434_1001852112 172
463 3300006871 Ga0075434_101111147 Ga0075434_1011111472 172
464 3300006881 Ga0068865_100158561 Ga0068865_1001585612 172
465 3300006914 Ga0075436_100059844 Ga0075436_1000598442 172
466 3300006914 Ga0075436_100087709 Ga0075436_1000877093 172
467 3300006931 Ga0097620_100048443 Ga0097620_1000484434 172
468 3300007076 Ga0075435_100015650 Ga0075435_1000156504 172
469 3300007076 Ga0075435_100062813 Ga0075435_1000628132 172
470 3300007076 Ga0075435_100147365 Ga0075435_1001473652 172
471 3300009011 Ga0105251_10017383 Ga0105251_100173833 172
472 3300009093 Ga0105240_10164587 Ga0105240_101645871 172
473 3300009094 Ga0111539_10088325 Ga0111539_100883252 172
474 3300009098 Ga0105245_10100888 Ga0105245_101008882 172
475 3300009101 Ga0105247_10037739 Ga0105247_100377392 172
476 3300009101 Ga0105247_10604507 Ga0105247_106045072 172
477 3300009147 Ga0114129_10007274 Ga0114129_100072749 172
478 3300009147 Ga0114129_11591694 Ga0114129_115916942 172
479 3300009148 Ga0105243_10045901 Ga0105243_100459013 172
480 3300009174 Ga0105241_10443340 Ga0105241_104433401 172
481 3300009174 Ga0105241_10690029 Ga0105241_106900292 172
482 3300009176 Ga0105242_10260774 Ga0105242_102607742 172
483 3300009177 Ga0105248_10090347 Ga0105248_100903474 172
484 3300009545 Ga0105237_10197260 Ga0105237_101972602 172
485 3300009545 Ga0105237_10481942 Ga0105237_104819421 172
486 3300009545 Ga0105237_10607368 Ga0105237_106073681 172
487 3300009553 Ga0105249_10019483 Ga0105249_100194833 172
488 3300010159 Ga0099796_10047442 Ga0099796_100474422 172
489 3300010375 Ga0105239_11205846 Ga0105239_112058462 172
490 3300011119 Ga0105246_10014986 Ga0105246_100149861 172
491 3300012497 Ga0157319_1009886 Ga0157319_10098862 172
492 3300012507 Ga0157342_1000357 Ga0157342_10003572 172
493 3300012507 Ga0157342_1017220 Ga0157342_10172201 172
494 3300013100 Ga0157373_10007594 Ga0157373_100075945 172
495 3300013100 Ga0157373_10606835 Ga0157373_106068351 172
496 3300013102 Ga0157371_10138477 Ga0157371_101384772 172
497 3300013105 Ga0157369_10853882 Ga0157369_108538821 172
498 3300013105 Ga0157369_10858699 Ga0157369_108586992 172
499 3300013105 Ga0157369_11419298 Ga0157369_114192981 172
500 3300013296 Ga0157374_10238950 Ga0157374_102389502 172
501 3300013297 Ga0157378_10149261 Ga0157378_101492611 172
502 3300013297 Ga0157378_10963931 Ga0157378_109639311 172
503 3300013306 Ga0163162_10242507 Ga0163162_102425072 172
504 3300013307 Ga0157372_10342228 Ga0157372_103422281 172
505 3300013307 Ga0157372_11395631 Ga0157372_113956312 172
506 3300013307 Ga0157372_11859312 Ga0157372_118593121 172
507 3300013308 Ga0157375_10257876 Ga0157375_102578762 172
508 3300014325 Ga0163163_10141014 Ga0163163_101410142 172
509 3300014325 Ga0163163_10546335 Ga0163163_105463352 172
510 3300014326 Ga0157380_10116313 Ga0157380_101163133 172
511 3300014745 Ga0157377_10018876 Ga0157377_100188764 172
512 3300014968 Ga0157379_10539556 Ga0157379_105395562 172
513 3300014969 Ga0157376_10076153 Ga0157376_100761533 172
514 3300017792 Ga0163161_10021461 Ga0163161_100214614 172
515 3300020070 Ga0206356_11554725 Ga0206356_115547253 172
516 3300021388 Ga0213875_10001833 Ga0213875_100018333 172
517 3300021388 Ga0213875_10020598 Ga0213875_100205982 172
518 3300022467 Ga0224712_10017697 Ga0224712_100176971 172
519 3300022467 Ga0224712_10097660 Ga0224712_100976602 172
520 3300024225 Ga0224572_1000045 Ga0224572_10000453 172
521 3300024227 Ga0228598_1033823 Ga0228598_10338231 172
522 3300025898 Ga0207692_10027121 Ga0207692_100271212 172
523 3300025898 Ga0207692_10112100 Ga0207692_101121001 172
524 3300025898 Ga0207692_10284694 Ga0207692_102846941 172
525 3300025899 Ga0207642_10062716 Ga0207642_100627162 172
526 3300025901 Ga0207688_10004338 Ga0207688_100043386 172
527 3300025904 Ga0207647_10014384 Ga0207647_100143845 172
528 3300025905 Ga0207685_10014244 Ga0207685_100142442 172
529 3300025905 Ga0207685_10033747 Ga0207685_100337472 172
530 3300025905 Ga0207685_10066486 Ga0207685_100664862 172
531 3300025905 Ga0207685_10108183 Ga0207685_101081832 172
532 3300025905 Ga0207685_10162507 Ga0207685_101625072 172
533 3300025906 Ga0207699_10000902 Ga0207699_1000090212 172
534 3300025906 Ga0207699_10010790 Ga0207699_100107902 172
535 3300025906 Ga0207699_10013718 Ga0207699_100137182 172
536 3300025906 Ga0207699_10025050 Ga0207699_100250503 172
537 3300025906 Ga0207699_10322950 Ga0207699_103229502 172
538 3300025907 Ga0207645_10269087 Ga0207645_102690872 172
539 3300025908 Ga0207643_10034728 Ga0207643_100347282 172
540 3300025909 Ga0207705_10033404 Ga0207705_100334044 172
541 3300025910 Ga0207684_10001101 Ga0207684_100011017 172
542 3300025910 Ga0207684_10009747 Ga0207684_100097472 172
543 3300025910 Ga0207684_10047286 Ga0207684_100472863 172
544 3300025910 Ga0207684_10061734 Ga0207684_100617341 172
545 3300025910 Ga0207684_10236433 Ga0207684_102364332 172
546 3300025910 Ga0207684_10285314 Ga0207684_102853141 172
547 3300025910 Ga0207684_10726939 Ga0207684_107269392 172
548 3300025912 Ga0207707_10145737 Ga0207707_101457372 172
549 3300025913 Ga0207695_10419786 Ga0207695_104197862 172
550 3300025914 Ga0207671_10104756 Ga0207671_101047563 172
551 3300025915 Ga0207693_10004702 Ga0207693_100047025 172
552 3300025915 Ga0207693_10006820 Ga0207693_100068205 172
553 3300025915 Ga0207693_10029965 Ga0207693_100299652 172
554 3300025915 Ga0207693_10114809 Ga0207693_101148092 172
555 3300025916 Ga0207663_10001184 Ga0207663_100011844 172
556 3300025916 Ga0207663_10048742 Ga0207663_100487423 172
557 3300025916 Ga0207663_10063205 Ga0207663_100632052 172
558 3300025916 Ga0207663_10350583 Ga0207663_103505832 172
559 3300025917 Ga0207660_10187749 Ga0207660_101877492 172
560 3300025918 Ga0207662_10002153 Ga0207662_100021538 172
561 3300025919 Ga0207657_10006511 Ga0207657_100065119 172
562 3300025920 Ga0207649_10215709 Ga0207649_102157092 172
563 3300025922 Ga0207646_10005472 Ga0207646_100054722 172
564 3300025922 Ga0207646_10014190 Ga0207646_100141906 172
565 3300025922 Ga0207646_10103407 Ga0207646_101034072 172
566 3300025922 Ga0207646_10428883 Ga0207646_104288831 172
567 3300025924 Ga0207694_10238407 Ga0207694_102384072 172
568 3300025925 Ga0207650_10168691 Ga0207650_101686912 172
569 3300025926 Ga0207659_10116968 Ga0207659_101169683 172
570 3300025926 Ga0207659_10758132 Ga0207659_107581322 172
571 3300025927 Ga0207687_10183670 Ga0207687_101836702 172
572 3300025928 Ga0207700_10000414 Ga0207700_1000041424 172
573 3300025928 Ga0207700_10001073 Ga0207700_1000107314 172
574 3300025928 Ga0207700_10031567 Ga0207700_100315672 172
575 3300025928 Ga0207700_10052750 Ga0207700_100527502 172
576 3300025928 Ga0207700_10069517 Ga0207700_100695171 172
577 3300025928 Ga0207700_10304829 Ga0207700_103048292 172
578 3300025928 Ga0207700_11431221 Ga0207700_114312211 172
579 3300025929 Ga0207664_10000678 Ga0207664_1000067812 172
580 3300025929 Ga0207664_10004822 Ga0207664_100048227 172
581 3300025929 Ga0207664_10020088 Ga0207664_100200886 172
582 3300025929 Ga0207664_10025989 Ga0207664_100259892 172
583 3300025929 Ga0207664_10026465 Ga0207664_100264652 172
584 3300025929 Ga0207664_10053030 Ga0207664_100530302 172
585 3300025929 Ga0207664_10098918 Ga0207664_100989182 172
586 3300025929 Ga0207664_10107248 Ga0207664_101072483 172
587 3300025929 Ga0207664_10110634 Ga0207664_101106343 172
588 3300025929 Ga0207664_10263166 Ga0207664_102631662 172
589 3300025929 Ga0207664_10351648 Ga0207664_103516482 172
590 3300025932 Ga0207690_10153596 Ga0207690_101535962 172
591 3300025933 Ga0207706_10210132 Ga0207706_102101322 172
592 3300025934 Ga0207686_10034626 Ga0207686_100346262 172
593 3300025935 Ga0207709_10029554 Ga0207709_100295542 172
594 3300025936 Ga0207670_10047244 Ga0207670_100472442 172
595 3300025939 Ga0207665_10001619 Ga0207665_1000161911 172
596 3300025939 Ga0207665_10001749 Ga0207665_1000174910 172
597 3300025939 Ga0207665_10001957 Ga0207665_1000195714 172
598 3300025939 Ga0207665_10008150 Ga0207665_100081503 172
599 3300025939 Ga0207665_10076791 Ga0207665_100767912 172
600 3300025939 Ga0207665_10091180 Ga0207665_100911802 172
601 3300025941 Ga0207711_10334743 Ga0207711_103347432 172
602 3300025942 Ga0207689_10001908 Ga0207689_1000190817 172
603 3300025944 Ga0207661_10094743 Ga0207661_100947432 172
604 3300025944 Ga0207661_10482381 Ga0207661_104823812 172
605 3300025945 Ga0207679_10065914 Ga0207679_100659143 172
606 3300025945 Ga0207679_10619395 Ga0207679_106193952 172
607 3300025949 Ga0207667_10110508 Ga0207667_101105083 172
608 3300025960 Ga0207651_10433555 Ga0207651_104335552 172
609 3300025981 Ga0207640_10296443 Ga0207640_102964432 172
610 3300025986 Ga0207658_10054810 Ga0207658_100548102 172
611 3300026041 Ga0207639_10166876 Ga0207639_101668763 172
612 3300026067 Ga0207678_10002509 Ga0207678_1000250911 172
613 3300026075 Ga0207708_10028936 Ga0207708_100289364 172
614 3300026078 Ga0207702_10018650 Ga0207702_100186502 172
615 3300026088 Ga0207641_10564040 Ga0207641_105640402 172
616 3300026089 Ga0207648_10066245 Ga0207648_100662453 172
617 3300026095 Ga0207676_10087847 Ga0207676_100878473 172
618 3300026116 Ga0207674_10003114 Ga0207674_1000311418 172
619 3300026118 Ga0207675_100003405 Ga0207675_1000034053 172
620 3300026121 Ga0207683_10001732 Ga0207683_1000173212 172
621 3300026121 Ga0207683_10049142 Ga0207683_100491421 172
622 3300026142 Ga0207698_10390234 Ga0207698_103902342 172
623 3300027671 Ga0209588_1213537 Ga0209588_12135371 172
624 3300028380 Ga0268265_10429920 Ga0268265_104299202 172
625 3300028666 Ga0265336_10014829 Ga0265336_100148293 172
626 3300028800 Ga0265338_10001840 Ga0265338_100018407 172
627 3300034816 Ga0373930_0022589 Ga0373930_0022589_551_1069 172
628 3300034817 Ga0373948_0012442 Ga0373948_0012442_983_1501 172
629 3300034819 Ga0373958_0010609 Ga0373958_0010609_493_1011 172
630 3300034957 Ga0373938_0014755 Ga0373938_0014755_25_555 172
631 3300035083 Ga0373926_0003143 Ga0373926_0003143_3215_3733 172
632 3300035083 Ga0373926_0067459 Ga0373926_0067459_769_1287 172
633 3300035084 Ga0373928_0012133 Ga0373928_0012133_468_986 172
634 3300035085 Ga0373929_0023731 Ga0373929_0023731_646_1191 172
635 3300035085 Ga0373929_0063218 Ga0373929_0063218_201_719 172
636 3300035086 Ga0373934_0008531 Ga0373934_0008531_2661_3179 172
637 3300035086 Ga0373934_0110315 Ga0373934_0110315_390_908 172
638 3300035086 Ga0373934_0143888 Ga0373934_0143888_48_566 172
639 3300035088 Ga0373940_0006439 Ga0373940_0006439_808_1326 172
640 3300035088 Ga0373940_0054979 Ga0373940_0054979_557_1102 172
641 3300035089 Ga0373944_0000424 Ga0373944_0000424_3840_4358 172
642 3300035089 Ga0373944_0010456 Ga0373944_0010456_114_632 172
643 3300035091 Ga0373951_0105280 Ga0373951_0105280_114_632 172
644 3300035092 Ga0373952_0003468 Ga0373952_0003468_872_1402 172
645 3300035111 Ga0373923_0004966 Ga0373923_0004966_2290_2808 172
646 3300035111 Ga0373923_0015962 Ga0373923_0015962_352_870 172
647 3300035111 Ga0373923_0028048 Ga0373923_0028048_908_1426 172
648 3300035111 Ga0373923_0075480 Ga0373923_0075480_226_744 172
649 3300035111 Ga0373923_0126538 Ga0373923_0126538_65_583 172
650 3300035112 Ga0373932_0009086 Ga0373932_0009086_986_1504 172
651 3300035113 Ga0373936_0000169 Ga0373936_0000169_14929_15447 172
652 3300035113 Ga0373936_0004876 Ga0373936_0004876_3844_4362 172
653 3300035113 Ga0373936_0079737 Ga0373936_0079737_801_1319 172
654 3300035114 Ga0373939_0030493 Ga0373939_0030493_316_846 172
655 3300035115 Ga0373941_0054135 Ga0373941_0054135_362_880 172
656 3300035116 Ga0373945_0000510 Ga0373945_0000510_8710_9228 172
657 3300035116 Ga0373945_0016220 Ga0373945_0016220_1291_1809 172
658 3300035116 Ga0373945_0031182 Ga0373945_0031182_1135_1653 172
659 3300035117 Ga0373953_0038149 Ga0373953_0038149_613_1131 172
660 3300035117 Ga0373953_0063896 Ga0373953_0063896_708_1226 172
661 3300035117 Ga0373953_0101951 Ga0373953_0101951_369_887 172
662 3300035118 Ga0373954_0074046 Ga0373954_0074046_106_624 172
663 3300035118 Ga0373954_0099461 Ga0373954_0099461_52_570 172
664 3300035119 Ga0373956_0002560 Ga0373956_0002560_6062_6580 172
665 3300035119 Ga0373956_0031045 Ga0373956_0031045_1351_1869 172
666 3300035120 Ga0373957_0015871 Ga0373957_0015871_698_1216 172
667 3300035120 Ga0373957_0055526 Ga0373957_0055526_707_1225 172
668 3300035121 Ga0373960_0023596 Ga0373960_0023596_430_960 172
669 3300035170 Ga0373943_0001153 Ga0373943_0001153_8875_9393 172
670 3300035170 Ga0373943_0014124 Ga0373943_0014124_2170_2688 172
671 3300035170 Ga0373943_0117413 Ga0373943_0117413_701_1219 172
672 3300035170 Ga0373943_0239269 Ga0373943_0239269_195_713 172
673 3300035170 Ga0373943_0399531 Ga0373943_0399531_206_724 172
674 3300035170 Ga0373943_0521346 Ga0373943_0521346_69_587 172
675 3300035171 Ga0373946_0000662 Ga0373946_0000662_4848_5366 172
676 3300035171 Ga0373946_0012809 Ga0373946_0012809_2438_2956 172
677 3300035171 Ga0373946_0016314 Ga0373946_0016314_356_874 172
678 3300035171 Ga0373946_0049738 Ga0373946_0049738_666_1184 172
679 3300035172 Ga0373955_0008188 Ga0373955_0008188_4007_4525 172
680 3300035172 Ga0373955_0039673 Ga0373955_0039673_710_1228 172
681 3300035207 Ga0373942_0168645 Ga0373942_0168645_90_608 172
682 3300035241 Ga0373961_0046653 Ga0373961_0046653_404_934 172
683 3300035241 Ga0373961_0052308 Ga0373961_0052308_164_682 172
684 3300035242 Ga0373962_0006182 Ga0373962_0006182_458_988 172
685 3300035242 Ga0373962_0092929 Ga0373962_0092929_14_532 172
686 3300035410 Ga0373924_0004123 Ga0373924_0004123_1500_2018 172
687 3300035410 Ga0373924_0133753 Ga0373924_0133753_307_825 172
688 3300035410 Ga0373924_0220861 Ga0373924_0220861_131_649 172
689 3300035691 Ga0373931_0028101 Ga0373931_0028101_781_1311 172
690 3300035691 Ga0373931_0123127 Ga0373931_0123127_712_1230 172
691 3300035692 Ga0373935_0003437 Ga0373935_0003437_2506_3024 172
692 3300035692 Ga0373935_0003809 Ga0373935_0003809_7568_8086 172
693 3300035692 Ga0373935_0092064 Ga0373935_0092064_1201_1719 172
694 3300035692 Ga0373935_0159058 Ga0373935_0159058_358_876 172
695 3300035692 Ga0373935_0196307 Ga0373935_0196307_255_773 172
696 3300035695 Ga0373927_0007125 Ga0373927_0007125_3821_4339 172
697 3300035695 Ga0373927_0025699 Ga0373927_0025699_1304_1822 172
698 3300035695 Ga0373927_0120942 Ga0373927_0120942_1099_1617 172
699 3300035695 Ga0373927_0330436 Ga0373927_0330436_67_585 172
700 3300035724 Ga0373933_0019370 Ga0373933_0019370_887_1405 172
701 3300035724 Ga0373933_0040439 Ga0373933_0040439_62_580 172
702 3300035724 Ga0373933_0055188 Ga0373933_0055188_1202_1720 172
703 3300035724 Ga0373933_0103794 Ga0373933_0103794_54_572 172
704 3300035725 Ga0373947_0002831 Ga0373947_0002831_3656_4174 172
705 3300035725 Ga0373947_0013227 Ga0373947_0013227_3525_4043 172
706 3300035725 Ga0373947_0036935 Ga0373947_0036935_359_877 172
707 3300035725 Ga0373947_0355086 Ga0373947_0355086_369_887 172
708 3300035725 Ga0373947_0568094 Ga0373947_0568094_103_621 172
709 3300036401 Ga0373937_0009545 Ga0373937_0009545_4977_5495 172
710 3300036401 Ga0373937_0105354 Ga0373937_0105354_1092_1610 172
711 3300036401 Ga0373937_0185996 Ga0373937_0185996_1380_1898 172
712 3300036401 Ga0373937_0189466 Ga0373937_0189466_645_1163 172
713 3300036401 Ga0373937_1401962 Ga0373937_1401962_52_570 172
714 3300037068 Ga0373925_0003785 Ga0373925_0003785_8103_8621 172
715 3300037068 Ga0373925_0018494 Ga0373925_0018494_1859_2377 172
716 3300037068 Ga0373925_0019909 Ga0373925_0019909_570_1088 172
717 3300037068 Ga0373925_0026700 Ga0373925_0026700_1794_2312 172
718 3300037068 Ga0373925_0052371 Ga0373925_0052371_431_949 172
719 3300037068 Ga0373925_0101945 Ga0373925_0101945_1201_1719 172
720 3300037068 Ga0373925_0735375 Ga0373925_0735375_101_619 172
721 3300037853 Ga0436364_0604676 Ga0436364_0604676_234_752 172
722 3300037853 Ga0436364_0791858 Ga0436364_0791858_573_1091 172
723 3300037853 Ga0436364_0799387 Ga0436364_0799387_372_911 172
724 3300037853 Ga0436364_1045514 Ga0436364_1045514_280_798 172
725 3300037853 Ga0436364_1530016 Ga0436364_1530016_15109_15627 172
726 3300039438 Ga0436360_0613585 Ga0436360_0613585_71_589 172
727 3300039447 Ga0436361_0437895 Ga0436361_0437895_13_531 172
728 3300039450 Ga0436363_1006539 Ga0436363_1006539_436_954 172
729 3300039453 Ga0436362_1235364 Ga0436362_1235364_28_546 172
730 3300044694 Ga0466963_0104402 Ga0466963_0104402_1412_1930 172
731 3300044735 Ga0466968_0283705 Ga0466968_0283705_213_731 172
732 3300045836 Ga0466958_0527056 Ga0466958_0527056_117_635 172
733 3300045976 Ga0466967_0283710 Ga0466967_0283710_842_1360 172
734 3300046454 Ga0495592_0004732 Ga0495592_0004732_1182_1700 172
735 3300046454 Ga0495592_0015295 Ga0495592_0015295_5173_5691 172
736 3300046454 Ga0495592_0046539 Ga0495592_0046539_2120_2638 172
737 3300046454 Ga0495592_0076844 Ga0495592_0076844_746_1264 172
738 3300046454 Ga0495592_0407419 Ga0495592_0407419_71_589 172
739 3300046455 Ga0495603_0005012 Ga0495603_0005012_4035_4553 172
740 3300046459 Ga0495629_0002832 Ga0495629_0002832_10920_11438 172
741 3300046459 Ga0495629_0010491 Ga0495629_0010491_24_542 172
742 3300046459 Ga0495629_0044212 Ga0495629_0044212_242_760 172
743 3300046459 Ga0495629_0102201 Ga0495629_0102201_951_1469 172
744 3300046461 Ga0495641_0012845 Ga0495641_0012845_419_937 172
745 3300046461 Ga0495641_0018849 Ga0495641_0018849_760_1278 172
746 3300046461 Ga0495641_0051286 Ga0495641_0051286_544_1062 172
747 3300046462 Ga0495651_0116402 Ga0495651_0116402_1182_1700 172
748 3300046462 Ga0495651_0152028 Ga0495651_0152028_149_667 172
749 3300046462 Ga0495651_0217564 Ga0495651_0217564_336_854 172
750 3300046462 Ga0495651_0565824 Ga0495651_0565824_67_585 172
751 3300046463 Ga0495653_0002817 Ga0495653_0002817_250_768 172
752 3300046463 Ga0495653_0016804 Ga0495653_0016804_2235_2753 172
753 3300046463 Ga0495653_0070654 Ga0495653_0070654_808_1326 172
754 3300046463 Ga0495653_0154459 Ga0495653_0154459_330_848 172
755 3300046463 Ga0495653_0406284 Ga0495653_0406284_227_745 172
756 3300046472 Ga0495580_0010328 Ga0495580_0010328_6069_6587 172
757 3300046472 Ga0495580_0259587 Ga0495580_0259587_407_925 172
758 3300046473 Ga0495582_0012503 Ga0495582_0012503_2814_3332 172
759 3300046473 Ga0495582_0021981 Ga0495582_0021981_1150_1668 172
760 3300046473 Ga0495582_0039599 Ga0495582_0039599_24_542 172
761 3300046473 Ga0495582_0075559 Ga0495582_0075559_929_1447 172
762 3300046475 Ga0495639_0015642 Ga0495639_0015642_2734_3252 172
763 3300046475 Ga0495639_0017037 Ga0495639_0017037_567_1085 172
764 3300046476 Ga0495662_0004269 Ga0495662_0004269_6265_6783 172
765 3300046476 Ga0495662_0018100 Ga0495662_0018100_429_947 172
766 3300046476 Ga0495662_0018801 Ga0495662_0018801_79_597 172
767 3300046476 Ga0495662_0037551 Ga0495662_0037551_280_798 172
768 3300046477 Ga0495664_0001749 Ga0495664_0001749_8652_9170 172
769 3300046477 Ga0495664_0023680 Ga0495664_0023680_323_841 172
770 3300046477 Ga0495664_0029956 Ga0495664_0029956_880_1398 172
771 3300046477 Ga0495664_0062041 Ga0495664_0062041_1532_2050 172
772 3300046477 Ga0495664_0138606 Ga0495664_0138606_739_1257 172
773 3300046477 Ga0495664_0259613 Ga0495664_0259613_447_965 172
774 3300046477 Ga0495664_0379735 Ga0495664_0379735_50_568 172
775 3300046499 Ga0495594_0199205 Ga0495594_0199205_55_573 172
776 3300046499 Ga0495594_0212843 Ga0495594_0212843_191_709 172
777 3300046511 Ga0495608_0005687 Ga0495608_0005687_7738_8256 172
778 3300046511 Ga0495608_0018014 Ga0495608_0018014_1042_1560 172
779 3300046511 Ga0495608_0041204 Ga0495608_0041204_2541_3059 172
780 3300046511 Ga0495608_0080670 Ga0495608_0080670_766_1284 172
781 3300046514 Ga0495618_0040555 Ga0495618_0040555_2028_2546 172
782 3300046514 Ga0495618_0122905 Ga0495618_0122905_502_1020 172
783 3300046514 Ga0495618_0295127 Ga0495618_0295127_468_986 172
784 3300046516 Ga0495628_0024931 Ga0495628_0024931_468_986 172
785 3300046516 Ga0495628_0050817 Ga0495628_0050817_2236_2754 172
786 3300046516 Ga0495628_0090413 Ga0495628_0090413_589_1107 172
787 3300046516 Ga0495628_0128663 Ga0495628_0128663_950_1468 172
788 3300046516 Ga0495628_0264377 Ga0495628_0264377_700_1218 172
789 3300046517 Ga0495630_0037661 Ga0495630_0037661_1129_1647 172
790 3300046517 Ga0495630_0045136 Ga0495630_0045136_2726_3244 172
791 3300046517 Ga0495630_0061310 Ga0495630_0061310_148_666 172
792 3300046517 Ga0495630_0579897 Ga0495630_0579897_211_741 172
793 3300046526 Ga0495666_0012325 Ga0495666_0012325_1751_2269 172
794 3300046529 Ga0495652_0004139 Ga0495652_0004139_11415_11933 172
795 3300046529 Ga0495652_0076114 Ga0495652_0076114_1952_2470 172
796 3300046529 Ga0495652_0172292 Ga0495652_0172292_22_540 172
797 3300046529 Ga0495652_0290739 Ga0495652_0290739_222_740 172
798 3300046529 Ga0495652_0319814 Ga0495652_0319814_126_644 172
799 3300046531 Ga0495665_0003325 Ga0495665_0003325_1234_1752 172
800 3300046531 Ga0495665_0004279 Ga0495665_0004279_2893_3411 172
801 3300046531 Ga0495665_0186939 Ga0495665_0186939_343_861 172
802 3300046533 Ga0495640_0015063 Ga0495640_0015063_4691_5209 172
803 3300046533 Ga0495640_0021658 Ga0495640_0021658_583_1101 172
804 3300046533 Ga0495640_0069518 Ga0495640_0069518_1355_1873 172
805 3300046533 Ga0495640_0073053 Ga0495640_0073053_1731_2249 172
806 3300046533 Ga0495640_0109030 Ga0495640_0109030_385_903 172
807 3300046533 Ga0495640_0204268 Ga0495640_0204268_579_1097 172
808 3300046533 Ga0495640_0621329 Ga0495640_0621329_24_542 172
809 3300046535 Ga0495586_0032980 Ga0495586_0032980_1726_2244 172
810 3300046535 Ga0495586_0038569 Ga0495586_0038569_404_922 172
811 3300046536 Ga0495587_0053075 Ga0495587_0053075_986_1504 172
812 3300046536 Ga0495587_0099410 Ga0495587_0099410_818_1336 172
813 3300046536 Ga0495587_0120169 Ga0495587_0120169_184_702 172
814 3300046543 Ga0495645_0018464 Ga0495645_0018464_3312_3830 172
815 3300046543 Ga0495645_0027452 Ga0495645_0027452_1050_1568 172
816 3300046543 Ga0495645_0042705 Ga0495645_0042705_1357_1875 172
817 3300046543 Ga0495645_0053793 Ga0495645_0053793_2303_2821 172
818 3300046543 Ga0495645_0072780 Ga0495645_0072780_946_1464 172
819 3300046543 Ga0495645_0077148 Ga0495645_0077148_1008_1526 172
820 3300046543 Ga0495645_0157521 Ga0495645_0157521_748_1266 172
821 3300046543 Ga0495645_0459726 Ga0495645_0459726_123_641 172
822 3300046557 Ga0495622_0259848 Ga0495622_0259848_16_534 172
823 3300046559 Ga0495667_0010521 Ga0495667_0010521_2241_2759 172
824 3300046559 Ga0495667_0026991 Ga0495667_0026991_2298_2816 172
825 3300046559 Ga0495667_0030425 Ga0495667_0030425_2791_3309 172
826 3300046559 Ga0495667_0045697 Ga0495667_0045697_1999_2517 172
827 3300046559 Ga0495667_0053431 Ga0495667_0053431_90_608 172
828 3300046559 Ga0495667_0146617 Ga0495667_0146617_373_891 172
829 3300046642 Ga0495634_0019496 Ga0495634_0019496_1588_2106 172
830 3300046642 Ga0495634_0060263 Ga0495634_0060263_1287_1805 172
831 3300046642 Ga0495634_0077617 Ga0495634_0077617_149_667 172
832 3300046663 Ga0495635_0000698 Ga0495635_0000698_6180_6698 172
833 3300046663 Ga0495635_0013834 Ga0495635_0013834_4314_4832 172
834 3300046663 Ga0495635_0612478 Ga0495635_0612478_14_532 172
835 3300046674 Ga0495588_0018741 Ga0495588_0018741_460_978 172
836 3300046675 Ga0495657_0014491 Ga0495657_0014491_4393_4911 172
837 3300046675 Ga0495657_0041672 Ga0495657_0041672_325_843 172
838 3300046675 Ga0495657_0073922 Ga0495657_0073922_215_733 172
839 3300046675 Ga0495657_0094247 Ga0495657_0094247_90_608 172
840 3300046675 Ga0495657_0147544 Ga0495657_0147544_258_776 172
841 3300046675 Ga0495657_0468455 Ga0495657_0468455_119_637 172
842 3300046678 Ga0495599_0014531 Ga0495599_0014531_1954_2472 172
843 3300046678 Ga0495599_0018542 Ga0495599_0018542_2677_3195 172
844 3300046678 Ga0495599_0021944 Ga0495599_0021944_90_608 172
845 3300046678 Ga0495599_0096896 Ga0495599_0096896_196_714 172
846 3300046678 Ga0495599_0146454 Ga0495599_0146454_14_532 172
847 3300046679 Ga0495623_0023619 Ga0495623_0023619_637_1155 172
848 3300046679 Ga0495623_0041927 Ga0495623_0041927_2383_2901 172
849 3300046679 Ga0495623_0268593 Ga0495623_0268593_20_538 172
850 3300046679 Ga0495623_0396265 Ga0495623_0396265_105_623 172
851 3300046680 Ga0495646_0003516 Ga0495646_0003516_5554_6072 172
852 3300046680 Ga0495646_0023360 Ga0495646_0023360_1040_1558 172
853 3300046680 Ga0495646_0034742 Ga0495646_0034742_712_1230 172
854 3300046680 Ga0495646_0051383 Ga0495646_0051383_248_766 172
855 3300046680 Ga0495646_0056228 Ga0495646_0056228_342_860 172
856 3300046680 Ga0495646_0194680 Ga0495646_0194680_286_804 172
857 3300046681 Ga0495647_0008177 Ga0495647_0008177_2792_3310 172
858 3300046681 Ga0495647_0011994 Ga0495647_0011994_30_548 172
859 3300046683 Ga0495658_0003636 Ga0495658_0003636_942_1460 172
860 3300046683 Ga0495658_0010930 Ga0495658_0010930_2679_3197 172
861 3300046689 Ga0495613_0037126 Ga0495613_0037126_755_1273 172
862 3300046689 Ga0495613_0089011 Ga0495613_0089011_239_757 172
863 3300046690 Ga0495624_0046194 Ga0495624_0046194_2035_2553 172
864 3300046690 Ga0495624_0055880 Ga0495624_0055880_1855_2373 172
865 3300046690 Ga0495624_0102059 Ga0495624_0102059_966_1484 172
866 3300046690 Ga0495624_0149783 Ga0495624_0149783_131_649 172
867 3300046690 Ga0495624_0371633 Ga0495624_0371633_274_804 172
868 3300046690 Ga0495624_0503305 Ga0495624_0503305_172_690 172
869 3300046809 Ga0495600_0008867 Ga0495600_0008867_4261_4779 172
870 3300046809 Ga0495600_0047247 Ga0495600_0047247_583_1101 172
871 3300046809 Ga0495600_0048758 Ga0495600_0048758_2028_2546 172
872 3300046809 Ga0495600_0104981 Ga0495600_0104981_758_1276 172
873 3300047315 Ga0495581_0005385 Ga0495581_0005385_863_1381 172
874 3300047315 Ga0495581_0008932 Ga0495581_0008932_2459_2977 172
875 3300047315 Ga0495581_0030686 Ga0495581_0030686_696_1214 172
876 3300047315 Ga0495581_0048480 Ga0495581_0048480_297_815 172
877 3300047317 Ga0495604_0012952 Ga0495604_0012952_5339_5857 172
878 3300047317 Ga0495604_0015781 Ga0495604_0015781_741_1259 172
879 3300047317 Ga0495604_0819330 Ga0495604_0819330_13_531 172
880 3300047319 Ga0495674_0002024 Ga0495674_0002024_3528_4046 172
881 3300047319 Ga0495674_0008562 Ga0495674_0008562_4882_5400 172
882 3300047319 Ga0495674_0022932 Ga0495674_0022932_555_1073 172
883 3300047319 Ga0495674_0048649 Ga0495674_0048649_3124_3642 172
884 3300047319 Ga0495674_0065338 Ga0495674_0065338_16_534 172
885 3300047319 Ga0495674_0083049 Ga0495674_0083049_1287_1805 172
886 3300047319 Ga0495674_0190378 Ga0495674_0190378_1121_1639 172
887 3300047319 Ga0495674_0426765 Ga0495674_0426765_208_726 172
888 3300047321 Ga0495676_0064787 Ga0495676_0064787_770_1288 172
889 3300047321 Ga0495676_0119630 Ga0495676_0119630_1035_1553 172
890 3300047321 Ga0495676_0175035 Ga0495676_0175035_430_948 172
891 3300047322 Ga0495680_0013934 Ga0495680_0013934_1501_2019 172
892 3300047322 Ga0495680_0031216 Ga0495680_0031216_1045_1563 172
893 3300047322 Ga0495680_0057905 Ga0495680_0057905_1692_2210 172
894 3300047322 Ga0495680_0070658 Ga0495680_0070658_2053_2571 172
895 3300047322 Ga0495680_0076994 Ga0495680_0076994_964_1482 172
896 3300047444 Ga0495675_0005970 Ga0495675_0005970_4068_4586 172
897 3300047444 Ga0495675_0030343 Ga0495675_0030343_2542_3060 172
898 3300047471 Ga0495684_0001943 Ga0495684_0001943_7269_7787 172
899 3300047471 Ga0495684_0008935 Ga0495684_0008935_4263_4781 172
900 3300047471 Ga0495684_0010765 Ga0495684_0010765_2818_3336 172
901 3300047471 Ga0495684_0058922 Ga0495684_0058922_2028_2546 172
902 3300047471 Ga0495684_0070817 Ga0495684_0070817_1213_1731 172
903 3300047471 Ga0495684_0312173 Ga0495684_0312173_312_830 172
904 3300047673 Ga0495593_0021069 Ga0495593_0021069_1460_1978 172
905 3300047673 Ga0495593_0035403 Ga0495593_0035403_13_531 172
906 3300047673 Ga0495593_0072795 Ga0495593_0072795_507_1025 172
907 3300048088 Ga0495602_0059659 Ga0495602_0059659_132_650 172
908 3300048088 Ga0495602_0130272 Ga0495602_0130272_1417_1935 172
909 3300048088 Ga0495602_0267754 Ga0495602_0267754_566_1084 172
910 3300048089 Ga0495614_0020687 Ga0495614_0020687_1921_2439 172
911 3300048089 Ga0495614_0036387 Ga0495614_0036387_1076_1594 172
912 3300048089 Ga0495614_0181299 Ga0495614_0181299_393_911 172
913 3300048904 Ga0496101_0080830 Ga0496101_0080830_385_903 172
914 3300048904 Ga0496101_0085737 Ga0496101_0085737_1400_1918 172
915 3300048905 Ga0496102_0250511 Ga0496102_0250511_485_1003 172
916 3300048905 Ga0496102_0698364 Ga0496102_0698364_235_765 172
917 3300048906 Ga0496103_0027389 Ga0496103_0027389_2026_2544 172
918 3300048906 Ga0496103_0102809 Ga0496103_0102809_246_776 172
919 3300048907 Ga0496104_0001194 Ga0496104_0001194_7126_7644 172
920 3300048907 Ga0496104_0070595 Ga0496104_0070595_315_833 172
921 3300048908 Ga0496105_0002102 Ga0496105_0002102_7559_8077 172
922 3300048908 Ga0496105_0017097 Ga0496105_0017097_3173_3691 172
923 3300048908 Ga0496105_0036418 Ga0496105_0036418_2316_2846 172
924 3300048908 Ga0496105_0526975 Ga0496105_0526975_337_855 172
925 3300048909 Ga0496106_0077453 Ga0496106_0077453_1572_2090 172
926 3300048909 Ga0496106_0106910 Ga0496106_0106910_853_1383 172
927 3300048910 Ga0496107_0014906 Ga0496107_0014906_1010_1528 172
928 3300048910 Ga0496107_0059599 Ga0496107_0059599_352_897 172
929 3300048910 Ga0496107_0551692 Ga0496107_0551692_141_659 172
930 3300048911 Ga0496108_0012378 Ga0496108_0012378_2414_2932 172
931 3300048912 Ga0496109_0052702 Ga0496109_0052702_3140_3658 172
932 3300048912 Ga0496109_0057856 Ga0496109_0057856_1448_1978 172
933 3300048912 Ga0496109_0077274 Ga0496109_0077274_316_834 172
934 3300048914 Ga0496111_0040374 Ga0496111_0040374_1230_1748 172
935 3300048914 Ga0496111_0366943 Ga0496111_0366943_50_595 172
936 3300048914 Ga0496111_0598530 Ga0496111_0598530_107_625 172
937 3300048915 Ga0496112_0000183 Ga0496112_0000183_10077_10595 172
938 3300048915 Ga0496112_0267886 Ga0496112_0267886_499_1017 172
939 3300048916 Ga0496113_0006788 Ga0496113_0006788_5114_5632 172
940 3300048916 Ga0496113_0062251 Ga0496113_0062251_1652_2170 172
941 3300048916 Ga0496113_0257040 Ga0496113_0257040_816_1334 172
942 3300048916 Ga0496113_0550442 Ga0496113_0550442_195_740 172
943 3300048917 Ga0496114_0102641 Ga0496114_0102641_424_942 172
944 3300048917 Ga0496114_0123518 Ga0496114_0123518_201_719 172
945 3300048918 Ga0496115_0033108 Ga0496115_0033108_1074_1592 172
946 3300048918 Ga0496115_0039179 Ga0496115_0039179_2848_3378 172
947 3300048929 Ga0496126_0103220 Ga0496126_0103220_730_1248 172
948 3300050507 nmdc:mga05p37_38778_c1 nmdc:mga05p37_38778_c1_617_1135 172
949 3300050511 nmdc:mga08y16_132685_c1 nmdc:mga08y16_132685_c1_19_537 172
950 3300050512 nmdc:mga0n895_1244633_c1 nmdc:mga0n895_1244633_c1_23_541 172
951 3300050512 nmdc:mga0n895_26838_c1 nmdc:mga0n895_26838_c1_3104_3622 172
952 3300050512 nmdc:mga0n895_40493_c1 nmdc:mga0n895_40493_c1_2908_3438 172
953 3300050512 nmdc:mga0n895_68643_c1 nmdc:mga0n895_68643_c1_1220_1738 172
954 3300050513 nmdc:mga0rr50_157268_c1 nmdc:mga0rr50_157268_c1_468_986 172
955 3300050513 nmdc:mga0rr50_9469_c1 nmdc:mga0rr50_9469_c1_3188_3718 172
956 3300050514 nmdc:mga08x19_200024_c1 nmdc:mga08x19_200024_c1_36_566 172
957 3300050514 nmdc:mga08x19_41570_c1 nmdc:mga08x19_41570_c1_1763_2281 172
958 3300050515 nmdc:mga0a205_12658_c1 nmdc:mga0a205_12658_c1_2912_3430 172
959 3300053077 Ga0495601_0009875 Ga0495601_0009875_814_1332 172
960 3300053077 Ga0495601_0067835 Ga0495601_0067835_568_1086 172
961 3300053077 Ga0495601_0102629 Ga0495601_0102629_1135_1653 172
962 3300053077 Ga0495601_0295806 Ga0495601_0295806_317_835 172
963 3300053077 Ga0495601_0395566 Ga0495601_0395566_228_746 172
964 3300053084 Ga0495595_0015601 Ga0495595_0015601_1932_2450 172
965 3300053084 Ga0495595_0033595 Ga0495595_0033595_1604_2122 172
966 3300053085 Ga0495619_0004020 Ga0495619_0004020_4932_5450 172
967 3300053085 Ga0495619_0016223 Ga0495619_0016223_2869_3387 172
968 3300053085 Ga0495619_0112723 Ga0495619_0112723_1159_1677 172
969 3300060344 Ga0587071_096023 Ga0587071_096023_117_635 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

163

0.88

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

157

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gm5-assembly1.cif.gz_A-2 crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution 0.8528 13 160
3gm5-assembly1.cif.gz_A-2 crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution 0.8214 13 160
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.7378 14 160
6qh4-assembly1.cif.gz_C crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7208 14 159
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7115 17 159
ID Description Score Start End Superfamily
3gm5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8528 13 160 3.10.180.10
3gm5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8214 13 160 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7378 14 160 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.733 14 160 3.10.180.10
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7153 14 166 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1I3WZF3-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (VOC family protein) 0.9811 16 171 GO:0051213
AF-A0A7X1J1A0-F1-model_v4 VOC family protein 0.966 13 171
AF-A0A7J3FLD5-F1-model_v4 VOC family protein 0.9573 14 171
AF-A0A2D9NV91-F1-model_v4 deleted 0.9488 13 170
AF-A0A7J3FLD5-F1-model_v4 VOC family protein 0.9455 14 171

Feature Viewer

pLDDT pTM Quality
92.86 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map