F487070
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 969 | 351 | 969 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0080117|Ga0395900_0080117_1180_1737 |
| Length | 185 |
| Sequence | MIPTEMKGGHMEAKQTAQSAAVGLLGRPLTISQIAVVVNDLEKTMEQYTKLLGWCPWNVYRHEPPRLHDTVLRGKPTDFTMLGAETHVGDMGFELLQPLEGPSIYKEWLEQRGEGLHHVAVMLHDFEESAELKRKFDEIGASILMGGRIGETIEFYYLDTEPSLKIVLESGSGHAIDLQPDYVYP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 107 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 130 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 214 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 215 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 216 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 217 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 219 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.17 |
| Metatranscriptomes | 0.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.06 |
| Rhizosphere | 93.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10000079 | 3300003659 | Bacteria | 8855 |
| 2 | Ga0058862_12117740 | 3300004803 | Bacteria | 871 |
| 3 | Ga0065707_10010235 | 3300005295 | Bacteria | 2471 |
| 4 | Ga0070658_10070640 | 3300005327 | Bacteria | 2859 |
| 5 | Ga0070658_10158050 | 3300005327 | Bacteria | 1901 |
| 6 | Ga0070676_10355974 | 3300005328 | Bacteria | 1007 |
| 7 | Ga0070683_100003809 | 3300005329 | Bacteria | 12322 |
| 8 | Ga0070683_100007853 | 3300005329 | Bacteria | 9036 |
| 9 | Ga0070683_100150452 | 3300005329 | Bacteria | 2207 |
| 10 | Ga0070683_100258732 | 3300005329 | Bacteria | 1655 |
| 11 | Ga0070690_100036403 | 3300005330 | Bacteria | 3093 |
| 12 | Ga0070690_100632894 | 3300005330 | Unclassified | 815 |
| 13 | Ga0070670_100097446 | 3300005331 | Bacteria | 2530 |
| 14 | Ga0070670_100127662 | 3300005331 | Unclassified | 2195 |
| 15 | Ga0068869_100126332 | 3300005334 | Bacteria | 1961 |
| 16 | Ga0070666_10025853 | 3300005335 | Bacteria | 3830 |
| 17 | Ga0070680_100017429 | 3300005336 | Bacteria | 5664 |
| 18 | Ga0070680_100442855 | 3300005336 | Bacteria | 1109 |
| 19 | Ga0070682_100059017 | 3300005337 | Bacteria | 2421 |
| 20 | Ga0070682_100214898 | 3300005337 | Bacteria | 1365 |
| 21 | Ga0070682_100381584 | 3300005337 | Unclassified | 1060 |
| 22 | Ga0070682_100398972 | 3300005337 | Unclassified | 1040 |
| 23 | Ga0068868_100089213 | 3300005338 | Bacteria | 2482 |
| 24 | Ga0068868_100211445 | 3300005338 | Bacteria | 1621 |
| 25 | Ga0070660_100241205 | 3300005339 | Bacteria | 1472 |
| 26 | Ga0070660_100273042 | 3300005339 | Bacteria | 1382 |
| 27 | Ga0070660_100465144 | 3300005339 | Bacteria | 1050 |
| 28 | Ga0070689_100021701 | 3300005340 | Bacteria | 4785 |
| 29 | Ga0070689_100486184 | 3300005340 | Bacteria | 1055 |
| 30 | Ga0070689_100782338 | 3300005340 | Bacteria | 838 |
| 31 | Ga0070691_10019206 | 3300005341 | Bacteria | 3152 |
| 32 | Ga0070691_10029378 | 3300005341 | Bacteria | 2571 |
| 33 | Ga0070661_100013534 | 3300005344 | Bacteria | 5728 |
| 34 | Ga0070692_10005873 | 3300005345 | Bacteria | 5282 |
| 35 | Ga0070669_100083417 | 3300005353 | Unclassified | 2383 |
| 36 | Ga0070669_100087974 | 3300005353 | Bacteria | 2324 |
| 37 | Ga0070675_100020082 | 3300005354 | Bacteria | 5330 |
| 38 | Ga0070675_100049160 | 3300005354 | Bacteria | 3460 |
| 39 | Ga0070671_100115898 | 3300005355 | Bacteria | 2253 |
| 40 | Ga0070671_100327979 | 3300005355 | Bacteria | 1304 |
| 41 | Ga0070674_100128745 | 3300005356 | Unclassified | 1884 |
| 42 | Ga0070674_101624573 | 3300005356 | Unclassified | 583 |
| 43 | Ga0070673_100065880 | 3300005364 | Bacteria | 2891 |
| 44 | Ga0070688_100060707 | 3300005365 | Bacteria | 2388 |
| 45 | Ga0070688_100268818 | 3300005365 | Unclassified | 1221 |
| 46 | Ga0070667_100045133 | 3300005367 | Bacteria | 3705 |
| 47 | Ga0070709_10000898 | 3300005434 | Bacteria | 16586 |
| 48 | Ga0070709_10011449 | 3300005434 | Bacteria | 4944 |
| 49 | Ga0070709_10396537 | 3300005434 | Bacteria | 1029 |
| 50 | Ga0070714_100002822 | 3300005435 | Bacteria | 12817 |
| 51 | Ga0070714_100009138 | 3300005435 | Bacteria | 7776 |
| 52 | Ga0070714_100128815 | 3300005435 | Bacteria | 2260 |
| 53 | Ga0070714_100298801 | 3300005435 | Bacteria | 1500 |
| 54 | Ga0070713_100005320 | 3300005436 | Bacteria | 8781 |
| 55 | Ga0070713_100034459 | 3300005436 | Bacteria | 4067 |
| 56 | Ga0070713_100097223 | 3300005436 | Bacteria | 2544 |
| 57 | Ga0070713_100125631 | 3300005436 | Bacteria | 2256 |
| 58 | Ga0070713_100188275 | 3300005436 | Unclassified | 1858 |
| 59 | Ga0070713_100600576 | 3300005436 | Bacteria | 1045 |
| 60 | Ga0070710_10000649 | 3300005437 | Bacteria | 16588 |
| 61 | Ga0070710_10004332 | 3300005437 | Bacteria | 6724 |
| 62 | Ga0070701_10097201 | 3300005438 | Bacteria | 1624 |
| 63 | Ga0070711_100001246 | 3300005439 | Bacteria | 13779 |
| 64 | Ga0070711_100008207 | 3300005439 | Bacteria | 6386 |
| 65 | Ga0070711_100107809 | 3300005439 | Bacteria | 2039 |
| 66 | Ga0070711_100155849 | 3300005439 | Bacteria | 1727 |
| 67 | Ga0070711_100767814 | 3300005439 | Bacteria | 816 |
| 68 | Ga0070705_100004180 | 3300005440 | Bacteria | 7053 |
| 69 | Ga0070705_100085564 | 3300005440 | Bacteria | 1949 |
| 70 | Ga0070705_100390086 | 3300005440 | Bacteria | 1028 |
| 71 | Ga0070700_100028004 | 3300005441 | Bacteria | 3348 |
| 72 | Ga0070694_100051839 | 3300005444 | Bacteria | 2772 |
| 73 | Ga0070708_100008914 | 3300005445 | Bacteria | 8076 |
| 74 | Ga0070708_100013905 | 3300005445 | Bacteria | 6611 |
| 75 | Ga0070708_100017977 | 3300005445 | Bacteria | 5911 |
| 76 | Ga0070708_100023693 | 3300005445 | Bacteria | 5223 |
| 77 | Ga0070708_100026442 | 3300005445 | Bacteria | 4967 |
| 78 | Ga0070708_100104212 | 3300005445 | Bacteria | 2601 |
| 79 | Ga0070708_100112502 | 3300005445 | Bacteria | 2504 |
| 80 | Ga0070708_100646013 | 3300005445 | Bacteria | 997 |
| 81 | Ga0070663_100001262 | 3300005455 | Bacteria | 13900 |
| 82 | Ga0070663_100039551 | 3300005455 | Bacteria | 3296 |
| 83 | Ga0070678_100010703 | 3300005456 | Bacteria | 5617 |
| 84 | Ga0070662_100205993 | 3300005457 | Bacteria | 1563 |
| 85 | Ga0070662_100362063 | 3300005457 | Unclassified | 1190 |
| 86 | Ga0070681_10145848 | 3300005458 | Bacteria | 2296 |
| 87 | Ga0070681_10187369 | 3300005458 | Bacteria | 1989 |
| 88 | Ga0070681_10484628 | 3300005458 | Bacteria | 1149 |
| 89 | Ga0068867_100163342 | 3300005459 | Bacteria | 1758 |
| 90 | Ga0070685_10026846 | 3300005466 | Bacteria | 3177 |
| 91 | Ga0070706_100034040 | 3300005467 | Bacteria | 4704 |
| 92 | Ga0070706_100037181 | 3300005467 | Bacteria | 4496 |
| 93 | Ga0070706_100041193 | 3300005467 | Bacteria | 4264 |
| 94 | Ga0070707_100033411 | 3300005468 | Bacteria | 4905 |
| 95 | Ga0070707_100055256 | 3300005468 | Bacteria | 3806 |
| 96 | Ga0070707_100103302 | 3300005468 | Unclassified | 2762 |
| 97 | Ga0070707_100120487 | 3300005468 | Bacteria | 2547 |
| 98 | Ga0070707_100136661 | 3300005468 | Unclassified | 2385 |
| 99 | Ga0070698_100018588 | 3300005471 | Bacteria | 7316 |
| 100 | Ga0070698_100053715 | 3300005471 | Bacteria | 4093 |
| 101 | Ga0070698_100116886 | 3300005471 | Bacteria | 2629 |
| 102 | Ga0070698_100134045 | 3300005471 | Bacteria | 2431 |
| 103 | Ga0070698_100168932 | 3300005471 | Unclassified | 2128 |
| 104 | Ga0070698_101229058 | 3300005471 | Bacteria | 699 |
| 105 | Ga0070699_100011386 | 3300005518 | Bacteria | 7679 |
| 106 | Ga0070699_100046263 | 3300005518 | Bacteria | 3766 |
| 107 | Ga0070699_100052118 | 3300005518 | Bacteria | 3542 |
| 108 | Ga0070699_100630020 | 3300005518 | Unclassified | 978 |
| 109 | Ga0070699_101581426 | 3300005518 | Unclassified | 601 |
| 110 | Ga0070679_100036814 | 3300005530 | Bacteria | 4856 |
| 111 | Ga0070679_100070467 | 3300005530 | Bacteria | 3488 |
| 112 | Ga0070679_101010839 | 3300005530 | Bacteria | 776 |
| 113 | Ga0070684_100021226 | 3300005535 | Bacteria | 5399 |
| 114 | Ga0070684_100040413 | 3300005535 | Bacteria | 4016 |
| 115 | Ga0070684_100119349 | 3300005535 | Bacteria | 2371 |
| 116 | Ga0070684_100268122 | 3300005535 | Bacteria | 1562 |
| 117 | Ga0070697_100007671 | 3300005536 | Bacteria | 8402 |
| 118 | Ga0070697_100063402 | 3300005536 | Bacteria | 3018 |
| 119 | Ga0070697_100342605 | 3300005536 | Unclassified | 1290 |
| 120 | Ga0070697_100731521 | 3300005536 | Bacteria | 874 |
| 121 | Ga0070697_101233014 | 3300005536 | Unclassified | 667 |
| 122 | Ga0068853_100097088 | 3300005539 | Bacteria | 2600 |
| 123 | Ga0070686_100026093 | 3300005544 | Bacteria | 3522 |
| 124 | Ga0070695_100153135 | 3300005545 | Bacteria | 1611 |
| 125 | Ga0070695_100219796 | 3300005545 | Bacteria | 1368 |
| 126 | Ga0070696_100054045 | 3300005546 | Bacteria | 2797 |
| 127 | Ga0070696_100207734 | 3300005546 | Bacteria | 1464 |
| 128 | Ga0070696_100698481 | 3300005546 | Bacteria | 827 |
| 129 | Ga0070696_100734978 | 3300005546 | Bacteria | 807 |
| 130 | Ga0070693_100140675 | 3300005547 | Unclassified | 1519 |
| 131 | Ga0070693_100162490 | 3300005547 | Bacteria | 1423 |
| 132 | Ga0070665_100701056 | 3300005548 | Bacteria | 1025 |
| 133 | Ga0070704_100122701 | 3300005549 | Bacteria | 1999 |
| 134 | Ga0070704_100123783 | 3300005549 | Bacteria | 1991 |
| 135 | Ga0070704_101244716 | 3300005549 | Unclassified | 680 |
| 136 | Ga0068855_100227677 | 3300005563 | Bacteria | 2089 |
| 137 | Ga0070664_100006864 | 3300005564 | Bacteria | 9184 |
| 138 | Ga0070664_100901662 | 3300005564 | Unclassified | 829 |
| 139 | Ga0068857_100036849 | 3300005577 | Bacteria | 4333 |
| 140 | Ga0068857_100056671 | 3300005577 | Bacteria | 3478 |
| 141 | Ga0068857_100110737 | 3300005577 | Bacteria | 2467 |
| 142 | Ga0068854_100046397 | 3300005578 | Bacteria | 3093 |
| 143 | Ga0068856_100011336 | 3300005614 | Bacteria | 8649 |
| 144 | Ga0068856_100361819 | 3300005614 | Unclassified | 1469 |
| 145 | Ga0068856_100696391 | 3300005614 | Unclassified | 1036 |
| 146 | Ga0068856_100900716 | 3300005614 | Unclassified | 903 |
| 147 | Ga0070702_100008618 | 3300005615 | Bacteria | 4949 |
| 148 | Ga0068852_100013437 | 3300005616 | Bacteria | 6267 |
| 149 | Ga0068852_101279622 | 3300005616 | Unclassified | 755 |
| 150 | Ga0068859_100048443 | 3300005617 | Bacteria | 4268 |
| 151 | Ga0068859_100192264 | 3300005617 | Bacteria | 2125 |
| 152 | Ga0068864_100107553 | 3300005618 | Bacteria | 2481 |
| 153 | Ga0068864_100793406 | 3300005618 | Bacteria | 930 |
| 154 | Ga0068866_10341972 | 3300005718 | Bacteria | 948 |
| 155 | Ga0068861_100023428 | 3300005719 | Bacteria | 4452 |
| 156 | Ga0068851_10015521 | 3300005834 | Bacteria | 3630 |
| 157 | Ga0068870_10048833 | 3300005840 | Bacteria | 2230 |
| 158 | Ga0068863_100067239 | 3300005841 | Bacteria | 3389 |
| 159 | Ga0068863_100492248 | 3300005841 | Bacteria | 1207 |
| 160 | Ga0068858_100035279 | 3300005842 | Bacteria | 4640 |
| 161 | Ga0068858_100427567 | 3300005842 | Bacteria | 1274 |
| 162 | Ga0068860_100045353 | 3300005843 | Bacteria | 4192 |
| 163 | Ga0068860_100636532 | 3300005843 | Bacteria | 1074 |
| 164 | Ga0068862_100056197 | 3300005844 | Bacteria | 3372 |
| 165 | Ga0068862_100130513 | 3300005844 | Bacteria | 2222 |
| 166 | Ga0081455_10088019 | 3300005937 | Bacteria | 2525 |
| 167 | Ga0081538_10000538 | 3300005981 | Bacteria | 41759 |
| 168 | Ga0081540_1001110 | 3300005983 | Bacteria | 23850 |
| 169 | Ga0081540_1002815 | 3300005983 | Bacteria | 14081 |
| 170 | Ga0081539_10097984 | 3300005985 | Bacteria | 1501 |
| 171 | Ga0070717_10001468 | 3300006028 | Bacteria | 16299 |
| 172 | Ga0070717_10011855 | 3300006028 | Bacteria | 6633 |
| 173 | Ga0070717_10022914 | 3300006028 | Bacteria | 4941 |
| 174 | Ga0070717_10032455 | 3300006028 | Bacteria | 4208 |
| 175 | Ga0070717_10132918 | 3300006028 | Bacteria | 2141 |
| 176 | Ga0070717_10264298 | 3300006028 | Bacteria | 1523 |
| 177 | Ga0070717_10449154 | 3300006028 | Bacteria | 1162 |
| 178 | Ga0070717_10684575 | 3300006028 | Bacteria | 931 |
| 179 | Ga0070717_11284228 | 3300006028 | Bacteria | 665 |
| 180 | Ga0070715_10001376 | 3300006163 | Bacteria | 7015 |
| 181 | Ga0070715_10015253 | 3300006163 | Bacteria | 2862 |
| 182 | Ga0070715_10077725 | 3300006163 | Bacteria | 1498 |
| 183 | Ga0070715_10107307 | 3300006163 | Bacteria | 1312 |
| 184 | Ga0070715_10186241 | 3300006163 | Bacteria | 1045 |
| 185 | Ga0070716_100003048 | 3300006173 | Bacteria | 7818 |
| 186 | Ga0070716_100005468 | 3300006173 | Bacteria | 6158 |
| 187 | Ga0070716_100012587 | 3300006173 | Bacteria | 4291 |
| 188 | Ga0070716_100148756 | 3300006173 | Bacteria | 1503 |
| 189 | Ga0070716_100340044 | 3300006173 | Bacteria | 1058 |
| 190 | Ga0070712_100007818 | 3300006175 | Bacteria | 6696 |
| 191 | Ga0070712_100201313 | 3300006175 | Bacteria | 1564 |
| 192 | Ga0070712_100204974 | 3300006175 | Bacteria | 1552 |
| 193 | Ga0070712_100409598 | 3300006175 | Bacteria | 1121 |
| 194 | Ga0070712_100841834 | 3300006175 | Bacteria | 789 |
| 195 | Ga0097621_100060592 | 3300006237 | Bacteria | 3103 |
| 196 | Ga0097621_100194789 | 3300006237 | Bacteria | 1757 |
| 197 | Ga0097621_100808083 | 3300006237 | Bacteria | 869 |
| 198 | Ga0068871_100087607 | 3300006358 | Bacteria | 2589 |
| 199 | Ga0068871_100935193 | 3300006358 | Bacteria | 805 |
| 200 | Ga0075428_100326426 | 3300006844 | Bacteria | 1649 |
| 201 | Ga0075433_10006430 | 3300006852 | Bacteria | 9293 |
| 202 | Ga0075433_10086522 | 3300006852 | Unclassified | 2767 |
| 203 | Ga0075434_100010403 | 3300006871 | Bacteria | 8721 |
| 204 | Ga0075434_100181401 | 3300006871 | Unclassified | 2125 |
| 205 | Ga0075434_100185211 | 3300006871 | Bacteria | 2102 |
| 206 | Ga0075434_100447620 | 3300006871 | Bacteria | 1313 |
| 207 | Ga0075434_101111147 | 3300006871 | Bacteria | 804 |
| 208 | Ga0068865_100158561 | 3300006881 | Bacteria | 1724 |
| 209 | Ga0068865_100556061 | 3300006881 | Unclassified | 964 |
| 210 | Ga0075436_100059844 | 3300006914 | Unclassified | 2631 |
| 211 | Ga0075436_100087709 | 3300006914 | Bacteria | 2161 |
| 212 | Ga0075436_100187822 | 3300006914 | Unclassified | 1462 |
| 213 | Ga0097620_100048443 | 3300006931 | Bacteria | 4268 |
| 214 | Ga0097620_100192262 | 3300006931 | Bacteria | 2125 |
| 215 | Ga0075435_100015650 | 3300007076 | Bacteria | 5706 |
| 216 | Ga0075435_100062813 | 3300007076 | Bacteria | 3015 |
| 217 | Ga0075435_100147365 | 3300007076 | Bacteria | 1977 |
| 218 | Ga0075435_100583994 | 3300007076 | Bacteria | 968 |
| 219 | Ga0105251_10017383 | 3300009011 | Bacteria | 3856 |
| 220 | Ga0105240_10164587 | 3300009093 | Bacteria | 2631 |
| 221 | Ga0111539_10088325 | 3300009094 | Bacteria | 3642 |
| 222 | Ga0111539_10822781 | 3300009094 | Bacteria | 1081 |
| 223 | Ga0105245_10010094 | 3300009098 | Bacteria | 8226 |
| 224 | Ga0105245_10062831 | 3300009098 | Bacteria | 3351 |
| 225 | Ga0105245_10100888 | 3300009098 | Bacteria | 2671 |
| 226 | Ga0105247_10037739 | 3300009101 | Bacteria | 2947 |
| 227 | Ga0105247_10341959 | 3300009101 | Bacteria | 1050 |
| 228 | Ga0105247_10604507 | 3300009101 | Unclassified | 814 |
| 229 | Ga0114129_10007274 | 3300009147 | Bacteria | 15756 |
| 230 | Ga0114129_10083341 | 3300009147 | Bacteria | 4442 |
| 231 | Ga0114129_11591694 | 3300009147 | Bacteria | 800 |
| 232 | Ga0105243_10045901 | 3300009148 | Bacteria | 3435 |
| 233 | Ga0105241_10263547 | 3300009174 | Bacteria | 1465 |
| 234 | Ga0105241_10443340 | 3300009174 | Bacteria | 1147 |
| 235 | Ga0105241_10690029 | 3300009174 | Bacteria | 931 |
| 236 | Ga0105242_10260774 | 3300009176 | Bacteria | 1565 |
| 237 | Ga0105242_11883474 | 3300009176 | Unclassified | 638 |
| 238 | Ga0105248_10061741 | 3300009177 | Bacteria | 4209 |
| 239 | Ga0105248_10090347 | 3300009177 | Bacteria | 3448 |
| 240 | Ga0105237_10197260 | 3300009545 | Bacteria | 2013 |
| 241 | Ga0105237_10219032 | 3300009545 | Bacteria | 1904 |
| 242 | Ga0105237_10481942 | 3300009545 | Bacteria | 1247 |
| 243 | Ga0105237_10607368 | 3300009545 | Bacteria | 1101 |
| 244 | Ga0105238_10382147 | 3300009551 | Bacteria | 1400 |
| 245 | Ga0105238_10908589 | 3300009551 | Unclassified | 899 |
| 246 | Ga0105249_10019483 | 3300009553 | Bacteria | 6054 |
| 247 | Ga0099796_10047442 | 3300010159 | Unclassified | 1478 |
| 248 | Ga0105239_11205846 | 3300010375 | Bacteria | 872 |
| 249 | Ga0105246_10014986 | 3300011119 | Bacteria | 4885 |
| 250 | Ga0157319_1009886 | 3300012497 | Unclassified | 759 |
| 251 | Ga0157342_1000357 | 3300012507 | Bacteria | 2679 |
| 252 | Ga0157342_1017220 | 3300012507 | Bacteria | 807 |
| 253 | Ga0157373_10007594 | 3300013100 | Bacteria | 8059 |
| 254 | Ga0157373_10606835 | 3300013100 | Bacteria | 797 |
| 255 | Ga0157371_10138477 | 3300013102 | Bacteria | 1734 |
| 256 | Ga0157370_10132030 | 3300013104 | Bacteria | 2329 |
| 257 | Ga0157369_10092910 | 3300013105 | Bacteria | 3221 |
| 258 | Ga0157369_10853882 | 3300013105 | Bacteria | 934 |
| 259 | Ga0157369_10858699 | 3300013105 | Bacteria | 931 |
| 260 | Ga0157369_11419298 | 3300013105 | Unclassified | 707 |
| 261 | Ga0157374_10010592 | 3300013296 | Bacteria | 7936 |
| 262 | Ga0157374_10238950 | 3300013296 | Bacteria | 1786 |
| 263 | Ga0157378_10149261 | 3300013297 | Bacteria | 2177 |
| 264 | Ga0157378_10161991 | 3300013297 | Bacteria | 2092 |
| 265 | Ga0157378_10963931 | 3300013297 | Bacteria | 886 |
| 266 | Ga0157378_11565988 | 3300013297 | Bacteria | 704 |
| 267 | Ga0163162_10242507 | 3300013306 | Bacteria | 1933 |
| 268 | Ga0157372_10342228 | 3300013307 | Bacteria | 1742 |
| 269 | Ga0157372_11395631 | 3300013307 | Bacteria | 808 |
| 270 | Ga0157372_11859312 | 3300013307 | Unclassified | 692 |
| 271 | Ga0157372_12133173 | 3300013307 | Unclassified | 644 |
| 272 | Ga0157375_10182194 | 3300013308 | Bacteria | 2252 |
| 273 | Ga0157375_10257876 | 3300013308 | Bacteria | 1905 |
| 274 | Ga0157375_10845312 | 3300013308 | Bacteria | 1062 |
| 275 | Ga0163163_10010901 | 3300014325 | Bacteria | 8209 |
| 276 | Ga0163163_10141014 | 3300014325 | Bacteria | 2452 |
| 277 | Ga0163163_10252588 | 3300014325 | Bacteria | 1814 |
| 278 | Ga0163163_10546335 | 3300014325 | Bacteria | 1221 |
| 279 | Ga0157380_10116313 | 3300014326 | Bacteria | 2257 |
| 280 | Ga0157377_10005520 | 3300014745 | Bacteria | 5951 |
| 281 | Ga0157377_10018876 | 3300014745 | Bacteria | 3593 |
| 282 | Ga0157379_10002408 | 3300014968 | Bacteria | 15631 |
| 283 | Ga0157379_10539556 | 3300014968 | Bacteria | 1084 |
| 284 | Ga0157376_10041457 | 3300014969 | Bacteria | 3769 |
| 285 | Ga0157376_10076153 | 3300014969 | Bacteria | 2866 |
| 286 | Ga0163161_10021461 | 3300017792 | Bacteria | 4538 |
| 287 | Ga0206356_11554725 | 3300020070 | Bacteria | 1796 |
| 288 | Ga0154015_1065643 | 3300020610 | Bacteria | 715 |
| 289 | Ga0213876_10018060 | 3300021384 | Bacteria | 3722 |
| 290 | Ga0213875_10001833 | 3300021388 | Bacteria | 13205 |
| 291 | Ga0213875_10020598 | 3300021388 | Bacteria | 3163 |
| 292 | Ga0213875_10027793 | 3300021388 | Bacteria | 2691 |
| 293 | Ga0213871_10008344 | 3300021441 | Bacteria | 2281 |
| 294 | Ga0224712_10017697 | 3300022467 | Bacteria | 2368 |
| 295 | Ga0224712_10097660 | 3300022467 | Bacteria | 1241 |
| 296 | Ga0224712_10170286 | 3300022467 | Unclassified | 976 |
| 297 | Ga0224572_1000045 | 3300024225 | Bacteria | 7577 |
| 298 | Ga0224572_1008572 | 3300024225 | Unclassified | 1893 |
| 299 | Ga0228598_1033823 | 3300024227 | Bacteria | 1008 |
| 300 | Ga0228598_1066173 | 3300024227 | Unclassified | 721 |
| 301 | Ga0207692_10027121 | 3300025898 | Bacteria | 2694 |
| 302 | Ga0207692_10112100 | 3300025898 | Bacteria | 1514 |
| 303 | Ga0207692_10229445 | 3300025898 | Bacteria | 1104 |
| 304 | Ga0207692_10284694 | 3300025898 | Bacteria | 1001 |
| 305 | Ga0207642_10062716 | 3300025899 | Bacteria | 1735 |
| 306 | Ga0207710_10035399 | 3300025900 | Bacteria | 2197 |
| 307 | Ga0207688_10004338 | 3300025901 | Bacteria | 7731 |
| 308 | Ga0207688_10185593 | 3300025901 | Bacteria | 1242 |
| 309 | Ga0207647_10014384 | 3300025904 | Bacteria | 5455 |
| 310 | Ga0207685_10014244 | 3300025905 | Bacteria | 2485 |
| 311 | Ga0207685_10033747 | 3300025905 | Bacteria | 1852 |
| 312 | Ga0207685_10066486 | 3300025905 | Bacteria | 1447 |
| 313 | Ga0207685_10108183 | 3300025905 | Unclassified | 1201 |
| 314 | Ga0207685_10162507 | 3300025905 | Bacteria | 1021 |
| 315 | Ga0207699_10000902 | 3300025906 | Bacteria | 14193 |
| 316 | Ga0207699_10010790 | 3300025906 | Bacteria | 4597 |
| 317 | Ga0207699_10013718 | 3300025906 | Bacteria | 4156 |
| 318 | Ga0207699_10025050 | 3300025906 | Bacteria | 3271 |
| 319 | Ga0207699_10029022 | 3300025906 | Bacteria | 3081 |
| 320 | Ga0207699_10322950 | 3300025906 | Bacteria | 1083 |
| 321 | Ga0207645_10269087 | 3300025907 | Bacteria | 1130 |
| 322 | Ga0207643_10034728 | 3300025908 | Bacteria | 2826 |
| 323 | Ga0207705_10033404 | 3300025909 | Bacteria | 3675 |
| 324 | Ga0207684_10001101 | 3300025910 | Bacteria | 30211 |
| 325 | Ga0207684_10009747 | 3300025910 | Bacteria | 8471 |
| 326 | Ga0207684_10047286 | 3300025910 | Bacteria | 3649 |
| 327 | Ga0207684_10061469 | 3300025910 | Bacteria | 3190 |
| 328 | Ga0207684_10061734 | 3300025910 | Bacteria | 3182 |
| 329 | Ga0207684_10236433 | 3300025910 | Bacteria | 1576 |
| 330 | Ga0207684_10285314 | 3300025910 | Bacteria | 1424 |
| 331 | Ga0207684_10726939 | 3300025910 | Unclassified | 842 |
| 332 | Ga0207707_10145737 | 3300025912 | Bacteria | 2070 |
| 333 | Ga0207695_10419786 | 3300025913 | Bacteria | 1222 |
| 334 | Ga0207671_10104756 | 3300025914 | Bacteria | 2146 |
| 335 | Ga0207671_10558026 | 3300025914 | Unclassified | 913 |
| 336 | Ga0207693_10004702 | 3300025915 | Bacteria | 11487 |
| 337 | Ga0207693_10006820 | 3300025915 | Bacteria | 9431 |
| 338 | Ga0207693_10029965 | 3300025915 | Bacteria | 4294 |
| 339 | Ga0207693_10037841 | 3300025915 | Bacteria | 3802 |
| 340 | Ga0207693_10114809 | 3300025915 | Bacteria | 2113 |
| 341 | Ga0207663_10001184 | 3300025916 | Bacteria | 12036 |
| 342 | Ga0207663_10048742 | 3300025916 | Bacteria | 2624 |
| 343 | Ga0207663_10063205 | 3300025916 | Bacteria | 2356 |
| 344 | Ga0207663_10346641 | 3300025916 | Bacteria | 1123 |
| 345 | Ga0207663_10350583 | 3300025916 | Bacteria | 1117 |
| 346 | Ga0207663_10917180 | 3300025916 | Unclassified | 701 |
| 347 | Ga0207660_10187749 | 3300025917 | Bacteria | 1608 |
| 348 | Ga0207662_10002153 | 3300025918 | Bacteria | 9810 |
| 349 | Ga0207657_10006511 | 3300025919 | Bacteria | 12098 |
| 350 | Ga0207657_10161579 | 3300025919 | Bacteria | 1819 |
| 351 | Ga0207657_10408873 | 3300025919 | Bacteria | 1067 |
| 352 | Ga0207649_10215709 | 3300025920 | Bacteria | 1364 |
| 353 | Ga0207652_10076597 | 3300025921 | Bacteria | 2918 |
| 354 | Ga0207646_10005472 | 3300025922 | Bacteria | 13351 |
| 355 | Ga0207646_10014190 | 3300025922 | Bacteria | 7573 |
| 356 | Ga0207646_10103407 | 3300025922 | Bacteria | 2554 |
| 357 | Ga0207646_10124397 | 3300025922 | Bacteria | 2318 |
| 358 | Ga0207646_10216439 | 3300025922 | Bacteria | 1730 |
| 359 | Ga0207646_10237375 | 3300025922 | Bacteria | 1647 |
| 360 | Ga0207646_10428883 | 3300025922 | Bacteria | 1193 |
| 361 | Ga0207681_10478146 | 3300025923 | Unclassified | 1017 |
| 362 | Ga0207694_10185297 | 3300025924 | Unclassified | 1689 |
| 363 | Ga0207694_10238407 | 3300025924 | Bacteria | 1486 |
| 364 | Ga0207650_10168691 | 3300025925 | Bacteria | 1738 |
| 365 | Ga0207659_10116968 | 3300025926 | Bacteria | 2036 |
| 366 | Ga0207659_10758132 | 3300025926 | Unclassified | 833 |
| 367 | Ga0207687_10036137 | 3300025927 | Bacteria | 3364 |
| 368 | Ga0207687_10183670 | 3300025927 | Bacteria | 1622 |
| 369 | Ga0207700_10000414 | 3300025928 | Bacteria | 25014 |
| 370 | Ga0207700_10001073 | 3300025928 | Bacteria | 15767 |
| 371 | Ga0207700_10031567 | 3300025928 | Bacteria | 3765 |
| 372 | Ga0207700_10036128 | 3300025928 | Bacteria | 3565 |
| 373 | Ga0207700_10052750 | 3300025928 | Bacteria | 3042 |
| 374 | Ga0207700_10069517 | 3300025928 | Bacteria | 2703 |
| 375 | Ga0207700_10304829 | 3300025928 | Bacteria | 1376 |
| 376 | Ga0207700_10579970 | 3300025928 | Bacteria | 997 |
| 377 | Ga0207700_11431221 | 3300025928 | Bacteria | 614 |
| 378 | Ga0207664_10000678 | 3300025929 | Bacteria | 23434 |
| 379 | Ga0207664_10004822 | 3300025929 | Bacteria | 9169 |
| 380 | Ga0207664_10010813 | 3300025929 | Bacteria | 6460 |
| 381 | Ga0207664_10020088 | 3300025929 | Bacteria | 4945 |
| 382 | Ga0207664_10025989 | 3300025929 | Bacteria | 4419 |
| 383 | Ga0207664_10026465 | 3300025929 | Bacteria | 4385 |
| 384 | Ga0207664_10053030 | 3300025929 | Bacteria | 3208 |
| 385 | Ga0207664_10098918 | 3300025929 | Unclassified | 2406 |
| 386 | Ga0207664_10107248 | 3300025929 | Bacteria | 2317 |
| 387 | Ga0207664_10110634 | 3300025929 | Bacteria | 2284 |
| 388 | Ga0207664_10165850 | 3300025929 | Bacteria | 1887 |
| 389 | Ga0207664_10263166 | 3300025929 | Bacteria | 1509 |
| 390 | Ga0207664_10351648 | 3300025929 | Unclassified | 1304 |
| 391 | Ga0207644_10668641 | 3300025931 | Bacteria | 865 |
| 392 | Ga0207690_10153596 | 3300025932 | Bacteria | 1709 |
| 393 | Ga0207706_10141147 | 3300025933 | Bacteria | 2119 |
| 394 | Ga0207706_10210132 | 3300025933 | Bacteria | 1706 |
| 395 | Ga0207686_10034626 | 3300025934 | Bacteria | 3024 |
| 396 | Ga0207709_10029554 | 3300025935 | Bacteria | 3180 |
| 397 | Ga0207670_10047244 | 3300025936 | Bacteria | 2865 |
| 398 | Ga0207670_10095599 | 3300025936 | Bacteria | 2111 |
| 399 | Ga0207670_10710998 | 3300025936 | Bacteria | 832 |
| 400 | Ga0207665_10001619 | 3300025939 | Bacteria | 15177 |
| 401 | Ga0207665_10001749 | 3300025939 | Bacteria | 14579 |
| 402 | Ga0207665_10001957 | 3300025939 | Bacteria | 13852 |
| 403 | Ga0207665_10008150 | 3300025939 | Bacteria | 6916 |
| 404 | Ga0207665_10013823 | 3300025939 | Bacteria | 5308 |
| 405 | Ga0207665_10076791 | 3300025939 | Bacteria | 2291 |
| 406 | Ga0207665_10091180 | 3300025939 | Bacteria | 2113 |
| 407 | Ga0207711_10189798 | 3300025941 | Bacteria | 1872 |
| 408 | Ga0207711_10334743 | 3300025941 | Bacteria | 1400 |
| 409 | Ga0207689_10001908 | 3300025942 | Bacteria | 19711 |
| 410 | Ga0207661_10032384 | 3300025944 | Bacteria | 4049 |
| 411 | Ga0207661_10094743 | 3300025944 | Bacteria | 2494 |
| 412 | Ga0207661_10150708 | 3300025944 | Unclassified | 2010 |
| 413 | Ga0207661_10291618 | 3300025944 | Unclassified | 1460 |
| 414 | Ga0207661_10482381 | 3300025944 | Bacteria | 1132 |
| 415 | Ga0207679_10004671 | 3300025945 | Bacteria | 8533 |
| 416 | Ga0207679_10065914 | 3300025945 | Bacteria | 2712 |
| 417 | Ga0207679_10619395 | 3300025945 | Bacteria | 977 |
| 418 | Ga0207667_10110508 | 3300025949 | Bacteria | 2835 |
| 419 | Ga0207667_10719865 | 3300025949 | Bacteria | 999 |
| 420 | Ga0207651_10433555 | 3300025960 | Bacteria | 1124 |
| 421 | Ga0207712_10399140 | 3300025961 | Bacteria | 1155 |
| 422 | Ga0207640_10296443 | 3300025981 | Bacteria | 1277 |
| 423 | Ga0207640_11339504 | 3300025981 | Bacteria | 640 |
| 424 | Ga0207658_10054810 | 3300025986 | Bacteria | 2952 |
| 425 | Ga0207677_10020233 | 3300026023 | Bacteria | 4037 |
| 426 | Ga0207703_10078467 | 3300026035 | Bacteria | 2743 |
| 427 | Ga0207639_10166876 | 3300026041 | Bacteria | 1861 |
| 428 | Ga0207678_10002509 | 3300026067 | Bacteria | 16704 |
| 429 | Ga0207708_10028936 | 3300026075 | Bacteria | 4196 |
| 430 | Ga0207708_10202255 | 3300026075 | Bacteria | 1585 |
| 431 | Ga0207708_10344040 | 3300026075 | Bacteria | 1222 |
| 432 | Ga0207702_10018650 | 3300026078 | Bacteria | 5740 |
| 433 | Ga0207702_10111160 | 3300026078 | Bacteria | 2436 |
| 434 | Ga0207641_10564040 | 3300026088 | Unclassified | 1111 |
| 435 | Ga0207648_10066245 | 3300026089 | Bacteria | 3150 |
| 436 | Ga0207676_10087847 | 3300026095 | Bacteria | 2543 |
| 437 | Ga0207676_10566137 | 3300026095 | Bacteria | 1087 |
| 438 | Ga0207674_10003114 | 3300026116 | Bacteria | 20468 |
| 439 | Ga0207674_10053372 | 3300026116 | Bacteria | 4120 |
| 440 | Ga0207674_10200176 | 3300026116 | Bacteria | 1947 |
| 441 | Ga0207675_100003405 | 3300026118 | Bacteria | 15530 |
| 442 | Ga0207683_10001732 | 3300026121 | Bacteria | 19433 |
| 443 | Ga0207683_10049142 | 3300026121 | Bacteria | 3691 |
| 444 | Ga0207698_10390234 | 3300026142 | Bacteria | 1327 |
| 445 | Ga0209588_1213537 | 3300027671 | Bacteria | 598 |
| 446 | Ga0207428_10513458 | 3300027907 | Bacteria | 869 |
| 447 | Ga0268265_10083304 | 3300028380 | Bacteria | 2532 |
| 448 | Ga0268265_10429920 | 3300028380 | Bacteria | 1228 |
| 449 | Ga0268264_10612459 | 3300028381 | Bacteria | 1074 |
| 450 | Ga0265337_1021791 | 3300028556 | Bacteria | 1993 |
| 451 | Ga0265326_10109137 | 3300028558 | Bacteria | 786 |
| 452 | Ga0265319_1000473 | 3300028563 | Bacteria | 28398 |
| 453 | Ga0265319_1036444 | 3300028563 | Bacteria | 1682 |
| 454 | Ga0265334_10049111 | 3300028573 | Bacteria | 1624 |
| 455 | Ga0265334_10234650 | 3300028573 | Bacteria | 633 |
| 456 | Ga0265318_10119217 | 3300028577 | Bacteria | 970 |
| 457 | Ga0265318_10139369 | 3300028577 | Bacteria | 891 |
| 458 | Ga0265322_10002593 | 3300028654 | Bacteria | 5556 |
| 459 | Ga0265336_10014829 | 3300028666 | Bacteria | 2575 |
| 460 | Ga0265336_10066371 | 3300028666 | Bacteria | 1080 |
| 461 | Ga0265338_10001840 | 3300028800 | Bacteria | 33293 |
| 462 | Ga0265338_10140174 | 3300028800 | Bacteria | 1895 |
| 463 | Ga0265338_10320811 | 3300028800 | Bacteria | 1121 |
| 464 | Ga0265324_10016769 | 3300029957 | Bacteria | 2668 |
| 465 | Ga0265330_10142509 | 3300031235 | Bacteria | 1019 |
| 466 | Ga0265332_10060322 | 3300031238 | Bacteria | 1623 |
| 467 | Ga0265332_10213042 | 3300031238 | Bacteria | 802 |
| 468 | Ga0265328_10147042 | 3300031239 | Unclassified | 886 |
| 469 | Ga0265320_10044744 | 3300031240 | Bacteria | 2179 |
| 470 | Ga0265320_10122416 | 3300031240 | Bacteria | 1185 |
| 471 | Ga0265320_10264010 | 3300031240 | Bacteria | 763 |
| 472 | Ga0265329_10038284 | 3300031242 | Bacteria | 1543 |
| 473 | Ga0265340_10103489 | 3300031247 | Bacteria | 1322 |
| 474 | Ga0265331_10096929 | 3300031250 | Bacteria | 1360 |
| 475 | Ga0265316_10024760 | 3300031344 | Bacteria | 5018 |
| 476 | Ga0265313_10089758 | 3300031595 | Bacteria | 1382 |
| 477 | Ga0265314_10058135 | 3300031711 | Bacteria | 2651 |
| 478 | Ga0373930_0022589 | 3300034816 | Bacteria | 1245 |
| 479 | Ga0373948_0012442 | 3300034817 | Bacteria | 1520 |
| 480 | Ga0373958_0010609 | 3300034819 | Bacteria | 1541 |
| 481 | Ga0373938_0014755 | 3300034957 | Bacteria | 1504 |
| 482 | Ga0373926_0003143 | 3300035083 | Bacteria | 5301 |
| 483 | Ga0373926_0067459 | 3300035083 | Unclassified | 1310 |
| 484 | Ga0373926_0085108 | 3300035083 | Bacteria | 1172 |
| 485 | Ga0373928_0012133 | 3300035084 | Bacteria | 1715 |
| 486 | Ga0373929_0023731 | 3300035085 | Bacteria | 1262 |
| 487 | Ga0373929_0063218 | 3300035085 | Bacteria | 871 |
| 488 | Ga0373929_0219846 | 3300035085 | Unclassified | 540 |
| 489 | Ga0373934_0001673 | 3300035086 | Bacteria | 8143 |
| 490 | Ga0373934_0008531 | 3300035086 | Bacteria | 3819 |
| 491 | Ga0373934_0110315 | 3300035086 | Unclassified | 1115 |
| 492 | Ga0373934_0143888 | 3300035086 | Bacteria | 975 |
| 493 | Ga0373940_0006439 | 3300035088 | Bacteria | 2604 |
| 494 | Ga0373940_0054979 | 3300035088 | Bacteria | 1126 |
| 495 | Ga0373944_0000424 | 3300035089 | Bacteria | 9670 |
| 496 | Ga0373944_0010456 | 3300035089 | Bacteria | 2530 |
| 497 | Ga0373949_0116180 | 3300035090 | Unclassified | 747 |
| 498 | Ga0373951_0105280 | 3300035091 | Unclassified | 754 |
| 499 | Ga0373952_0003468 | 3300035092 | Bacteria | 2847 |
| 500 | Ga0373923_0004966 | 3300035111 | Bacteria | 4470 |
| 501 | Ga0373923_0014469 | 3300035111 | Bacteria | 2964 |
| 502 | Ga0373923_0015962 | 3300035111 | Unclassified | 2843 |
| 503 | Ga0373923_0028048 | 3300035111 | Bacteria | 2250 |
| 504 | Ga0373923_0075480 | 3300035111 | Bacteria | 1455 |
| 505 | Ga0373923_0126538 | 3300035111 | Bacteria | 1145 |
| 506 | Ga0373923_0535437 | 3300035111 | Unclassified | 573 |
| 507 | Ga0373932_0009086 | 3300035112 | Bacteria | 2384 |
| 508 | Ga0373936_0000169 | 3300035113 | Bacteria | 21812 |
| 509 | Ga0373936_0004876 | 3300035113 | Bacteria | 5057 |
| 510 | Ga0373936_0041039 | 3300035113 | Bacteria | 1855 |
| 511 | Ga0373936_0079737 | 3300035113 | Bacteria | 1361 |
| 512 | Ga0373936_0179339 | 3300035113 | Bacteria | 929 |
| 513 | Ga0373939_0030493 | 3300035114 | Bacteria | 1551 |
| 514 | Ga0373941_0054135 | 3300035115 | Bacteria | 1285 |
| 515 | Ga0373945_0000510 | 3300035116 | Bacteria | 11054 |
| 516 | Ga0373945_0005840 | 3300035116 | Bacteria | 3950 |
| 517 | Ga0373945_0016220 | 3300035116 | Bacteria | 2509 |
| 518 | Ga0373945_0031182 | 3300035116 | Bacteria | 1883 |
| 519 | Ga0373953_0000044 | 3300035117 | Bacteria | 32505 |
| 520 | Ga0373953_0038149 | 3300035117 | Bacteria | 1899 |
| 521 | Ga0373953_0063896 | 3300035117 | Bacteria | 1509 |
| 522 | Ga0373953_0101951 | 3300035117 | Unclassified | 1208 |
| 523 | Ga0373953_0271537 | 3300035117 | Bacteria | 738 |
| 524 | Ga0373954_0001593 | 3300035118 | Bacteria | 9264 |
| 525 | Ga0373954_0074046 | 3300035118 | Bacteria | 1621 |
| 526 | Ga0373954_0099461 | 3300035118 | Bacteria | 1402 |
| 527 | Ga0373954_0102459 | 3300035118 | Unclassified | 1382 |
| 528 | Ga0373956_0000249 | 3300035119 | Bacteria | 21409 |
| 529 | Ga0373956_0002560 | 3300035119 | Bacteria | 7390 |
| 530 | Ga0373956_0031045 | 3300035119 | Unclassified | 2339 |
| 531 | Ga0373956_0595288 | 3300035119 | Unclassified | 528 |
| 532 | Ga0373957_0000107 | 3300035120 | Bacteria | 20022 |
| 533 | Ga0373957_0015871 | 3300035120 | Bacteria | 2599 |
| 534 | Ga0373957_0055526 | 3300035120 | Bacteria | 1523 |
| 535 | Ga0373957_0448071 | 3300035120 | Unclassified | 558 |
| 536 | Ga0373960_0023596 | 3300035121 | Bacteria | 1657 |
| 537 | Ga0373943_0001153 | 3300035170 | Bacteria | 11799 |
| 538 | Ga0373943_0014124 | 3300035170 | Bacteria | 3611 |
| 539 | Ga0373943_0105846 | 3300035170 | Bacteria | 1477 |
| 540 | Ga0373943_0117413 | 3300035170 | Bacteria | 1410 |
| 541 | Ga0373943_0239269 | 3300035170 | Bacteria | 1017 |
| 542 | Ga0373943_0399531 | 3300035170 | Bacteria | 793 |
| 543 | Ga0373943_0521346 | 3300035170 | Unclassified | 696 |
| 544 | Ga0373946_0000662 | 3300035171 | Bacteria | 11546 |
| 545 | Ga0373946_0012809 | 3300035171 | Bacteria | 3144 |
| 546 | Ga0373946_0016314 | 3300035171 | Bacteria | 2829 |
| 547 | Ga0373946_0049738 | 3300035171 | Bacteria | 1749 |
| 548 | Ga0373946_0052605 | 3300035171 | Bacteria | 1708 |
| 549 | Ga0373955_0000014 | 3300035172 | Bacteria | 72349 |
| 550 | Ga0373955_0008188 | 3300035172 | Bacteria | 4842 |
| 551 | Ga0373955_0016247 | 3300035172 | Bacteria | 3660 |
| 552 | Ga0373955_0039673 | 3300035172 | Bacteria | 2514 |
| 553 | Ga0373942_0168645 | 3300035207 | Bacteria | 712 |
| 554 | Ga0373961_0046653 | 3300035241 | Bacteria | 1270 |
| 555 | Ga0373961_0052308 | 3300035241 | Bacteria | 1216 |
| 556 | Ga0373962_0006182 | 3300035242 | Bacteria | 2896 |
| 557 | Ga0373962_0092929 | 3300035242 | Bacteria | 931 |
| 558 | Ga0373924_0000783 | 3300035410 | Bacteria | 9890 |
| 559 | Ga0373924_0004123 | 3300035410 | Bacteria | 5059 |
| 560 | Ga0373924_0018801 | 3300035410 | Bacteria | 2669 |
| 561 | Ga0373924_0133753 | 3300035410 | Unclassified | 1079 |
| 562 | Ga0373924_0220861 | 3300035410 | Unclassified | 837 |
| 563 | Ga0373931_0028101 | 3300035691 | Bacteria | 2876 |
| 564 | Ga0373931_0123127 | 3300035691 | Bacteria | 1484 |
| 565 | Ga0373931_0364589 | 3300035691 | Bacteria | 907 |
| 566 | Ga0373935_0003437 | 3300035692 | Bacteria | 9204 |
| 567 | Ga0373935_0003809 | 3300035692 | Bacteria | 8799 |
| 568 | Ga0373935_0092064 | 3300035692 | Bacteria | 1986 |
| 569 | Ga0373935_0159058 | 3300035692 | Bacteria | 1538 |
| 570 | Ga0373935_0196307 | 3300035692 | Unclassified | 1392 |
| 571 | Ga0373927_0007125 | 3300035695 | Bacteria | 7588 |
| 572 | Ga0373927_0025699 | 3300035695 | Bacteria | 3849 |
| 573 | Ga0373927_0120942 | 3300035695 | Bacteria | 1709 |
| 574 | Ga0373927_0330436 | 3300035695 | Bacteria | 1004 |
| 575 | Ga0373927_0385345 | 3300035695 | Bacteria | 924 |
| 576 | Ga0373933_0000021 | 3300035724 | Bacteria | 96820 |
| 577 | Ga0373933_0019370 | 3300035724 | Bacteria | 3843 |
| 578 | Ga0373933_0040439 | 3300035724 | Bacteria | 2747 |
| 579 | Ga0373933_0055188 | 3300035724 | Bacteria | 2382 |
| 580 | Ga0373933_0076051 | 3300035724 | Bacteria | 2050 |
| 581 | Ga0373933_0103794 | 3300035724 | Bacteria | 1766 |
| 582 | Ga0373933_0111676 | 3300035724 | Bacteria | 1705 |
| 583 | Ga0373947_0002831 | 3300035725 | Bacteria | 10354 |
| 584 | Ga0373947_0013227 | 3300035725 | Bacteria | 4730 |
| 585 | Ga0373947_0036935 | 3300035725 | Bacteria | 2897 |
| 586 | Ga0373947_0167059 | 3300035725 | Bacteria | 1426 |
| 587 | Ga0373947_0355086 | 3300035725 | Bacteria | 984 |
| 588 | Ga0373947_0568094 | 3300035725 | Unclassified | 772 |
| 589 | Ga0373937_0000032 | 3300036401 | Bacteria | 120148 |
| 590 | Ga0373937_0009545 | 3300036401 | Bacteria | 8440 |
| 591 | Ga0373937_0105354 | 3300036401 | Bacteria | 2620 |
| 592 | Ga0373937_0175143 | 3300036401 | Bacteria | 2013 |
| 593 | Ga0373937_0185996 | 3300036401 | Bacteria | 1951 |
| 594 | Ga0373937_0189466 | 3300036401 | Bacteria | 1932 |
| 595 | Ga0373937_1401962 | 3300036401 | Bacteria | 646 |
| 596 | Ga0373925_0003785 | 3300037068 | Bacteria | 11635 |
| 597 | Ga0373925_0018494 | 3300037068 | Bacteria | 5065 |
| 598 | Ga0373925_0019909 | 3300037068 | Bacteria | 4881 |
| 599 | Ga0373925_0026700 | 3300037068 | Bacteria | 4226 |
| 600 | Ga0373925_0052371 | 3300037068 | Bacteria | 3049 |
| 601 | Ga0373925_0101945 | 3300037068 | Bacteria | 2207 |
| 602 | Ga0373925_0735375 | 3300037068 | Bacteria | 813 |
| 603 | Ga0395900_0080117 | 3300037418 | Bacteria | 3356 |
| 604 | Ga0395900_0994425 | 3300037418 | Bacteria | 759 |
| 605 | Ga0395898_1014523 | 3300037466 | Unclassified | 765 |
| 606 | Ga0436364_0183340 | 3300037853 | Bacteria | 6804 |
| 607 | Ga0436364_0604676 | 3300037853 | Bacteria | 3834 |
| 608 | Ga0436364_0700779 | 3300037853 | Bacteria | 638 |
| 609 | Ga0436364_0791858 | 3300037853 | Bacteria | 1312 |
| 610 | Ga0436364_0799387 | 3300037853 | Bacteria | 1029 |
| 611 | Ga0436364_1045514 | 3300037853 | Bacteria | 7555 |
| 612 | Ga0436364_1530016 | 3300037853 | Bacteria | 29546 |
| 613 | Ga0395901_0066827 | 3300038443 | Bacteria | 3744 |
| 614 | Ga0395901_1077115 | 3300038443 | Bacteria | 775 |
| 615 | Ga0436365_0006186 | 3300039437 | Bacteria | 5882 |
| 616 | Ga0436365_0414192 | 3300039437 | Unclassified | 1304 |
| 617 | Ga0436360_0254464 | 3300039438 | Bacteria | 5468 |
| 618 | Ga0436360_0613585 | 3300039438 | Bacteria | 637 |
| 619 | Ga0436361_0437895 | 3300039447 | Unclassified | 673 |
| 620 | Ga0436363_1006539 | 3300039450 | Bacteria | 1033 |
| 621 | Ga0436362_0133374 | 3300039453 | Unclassified | 2746 |
| 622 | Ga0436362_1235364 | 3300039453 | Bacteria | 621 |
| 623 | Ga0451577_0190051 | 3300042876 | Bacteria | 1852 |
| 624 | Ga0453683_0585969 | 3300044673 | Unclassified | 727 |
| 625 | Ga0466961_0035451 | 3300044693 | Bacteria | 3204 |
| 626 | Ga0466963_0004005 | 3300044694 | Bacteria | 8518 |
| 627 | Ga0466963_0104402 | 3300044694 | Bacteria | 1942 |
| 628 | Ga0466963_0168131 | 3300044694 | Unclassified | 1528 |
| 629 | Ga0466964_0026502 | 3300044706 | Bacteria | 2269 |
| 630 | Ga0466964_0345870 | 3300044706 | Bacteria | 763 |
| 631 | Ga0466971_0011049 | 3300044719 | Bacteria | 3953 |
| 632 | Ga0466968_0142875 | 3300044735 | Bacteria | 1096 |
| 633 | Ga0466968_0283705 | 3300044735 | Bacteria | 793 |
| 634 | Ga0466960_0115376 | 3300044901 | Bacteria | 1400 |
| 635 | Ga0466959_0069272 | 3300045049 | Bacteria | 2556 |
| 636 | Ga0466959_0145430 | 3300045049 | Bacteria | 1673 |
| 637 | Ga0451576_0016352 | 3300045051 | Bacteria | 8191 |
| 638 | Ga0466958_0005440 | 3300045836 | Bacteria | 6855 |
| 639 | Ga0466958_0018937 | 3300045836 | Bacteria | 4002 |
| 640 | Ga0466958_0136487 | 3300045836 | Bacteria | 1543 |
| 641 | Ga0466958_0443623 | 3300045836 | Unclassified | 840 |
| 642 | Ga0466958_0527056 | 3300045836 | Bacteria | 767 |
| 643 | Ga0466967_0073155 | 3300045976 | Bacteria | 3074 |
| 644 | Ga0466967_0084996 | 3300045976 | Bacteria | 2864 |
| 645 | Ga0466967_0283710 | 3300045976 | Bacteria | 1589 |
| 646 | Ga0466967_0476053 | 3300045976 | Bacteria | 1223 |
| 647 | Ga0466967_0701712 | 3300045976 | Bacteria | 1002 |
| 648 | Ga0466967_1200630 | 3300045976 | Bacteria | 756 |
| 649 | Ga0495592_0000079 | 3300046454 | Bacteria | 85581 |
| 650 | Ga0495592_0004732 | 3300046454 | Bacteria | 9988 |
| 651 | Ga0495592_0015295 | 3300046454 | Bacteria | 5822 |
| 652 | Ga0495592_0046539 | 3300046454 | Bacteria | 3233 |
| 653 | Ga0495592_0062050 | 3300046454 | Bacteria | 2745 |
| 654 | Ga0495592_0076844 | 3300046454 | Bacteria | 2422 |
| 655 | Ga0495592_0407419 | 3300046454 | Bacteria | 860 |
| 656 | Ga0495603_0005012 | 3300046455 | Bacteria | 7921 |
| 657 | Ga0495603_0179823 | 3300046455 | Bacteria | 1224 |
| 658 | Ga0495629_0002832 | 3300046459 | Bacteria | 13257 |
| 659 | Ga0495629_0010491 | 3300046459 | Bacteria | 6739 |
| 660 | Ga0495629_0044212 | 3300046459 | Bacteria | 3126 |
| 661 | Ga0495629_0053279 | 3300046459 | Bacteria | 2831 |
| 662 | Ga0495629_0102201 | 3300046459 | Bacteria | 2000 |
| 663 | Ga0495641_0012845 | 3300046461 | Bacteria | 4649 |
| 664 | Ga0495641_0018849 | 3300046461 | Bacteria | 3548 |
| 665 | Ga0495641_0046108 | 3300046461 | Bacteria | 2005 |
| 666 | Ga0495641_0051286 | 3300046461 | Bacteria | 1885 |
| 667 | Ga0495651_0000010 | 3300046462 | Bacteria | 148763 |
| 668 | Ga0495651_0116402 | 3300046462 | Unclassified | 1969 |
| 669 | Ga0495651_0152028 | 3300046462 | Bacteria | 1667 |
| 670 | Ga0495651_0217564 | 3300046462 | Bacteria | 1324 |
| 671 | Ga0495651_0565824 | 3300046462 | Unclassified | 720 |
| 672 | Ga0495653_0000601 | 3300046463 | Bacteria | 27606 |
| 673 | Ga0495653_0002817 | 3300046463 | Bacteria | 13876 |
| 674 | Ga0495653_0016804 | 3300046463 | Bacteria | 5954 |
| 675 | Ga0495653_0070654 | 3300046463 | Bacteria | 2612 |
| 676 | Ga0495653_0154459 | 3300046463 | Bacteria | 1600 |
| 677 | Ga0495653_0178895 | 3300046463 | Bacteria | 1457 |
| 678 | Ga0495653_0406284 | 3300046463 | Unclassified | 864 |
| 679 | Ga0495580_0010328 | 3300046472 | Bacteria | 7278 |
| 680 | Ga0495580_0229540 | 3300046472 | Bacteria | 1274 |
| 681 | Ga0495580_0259587 | 3300046472 | Bacteria | 1188 |
| 682 | Ga0495582_0012503 | 3300046473 | Bacteria | 4678 |
| 683 | Ga0495582_0021981 | 3300046473 | Bacteria | 3490 |
| 684 | Ga0495582_0038330 | 3300046473 | Bacteria | 2637 |
| 685 | Ga0495582_0039599 | 3300046473 | Bacteria | 2594 |
| 686 | Ga0495582_0075559 | 3300046473 | Bacteria | 1866 |
| 687 | Ga0495639_0015642 | 3300046475 | Bacteria | 3290 |
| 688 | Ga0495639_0017037 | 3300046475 | Bacteria | 3155 |
| 689 | Ga0495639_0117673 | 3300046475 | Bacteria | 1265 |
| 690 | Ga0495662_0004269 | 3300046476 | Bacteria | 7187 |
| 691 | Ga0495662_0018100 | 3300046476 | Bacteria | 3408 |
| 692 | Ga0495662_0018801 | 3300046476 | Bacteria | 3344 |
| 693 | Ga0495662_0037551 | 3300046476 | Unclassified | 2339 |
| 694 | Ga0495664_0001749 | 3300046477 | Bacteria | 11547 |
| 695 | Ga0495664_0023680 | 3300046477 | Bacteria | 3564 |
| 696 | Ga0495664_0029956 | 3300046477 | Bacteria | 3185 |
| 697 | Ga0495664_0062041 | 3300046477 | Bacteria | 2225 |
| 698 | Ga0495664_0119016 | 3300046477 | Unclassified | 1597 |
| 699 | Ga0495664_0138606 | 3300046477 | Bacteria | 1474 |
| 700 | Ga0495664_0259613 | 3300046477 | Unclassified | 1050 |
| 701 | Ga0495664_0379735 | 3300046477 | Bacteria | 849 |
| 702 | Ga0495584_0246304 | 3300046491 | Unclassified | 909 |
| 703 | Ga0495594_0199205 | 3300046499 | Unclassified | 1141 |
| 704 | Ga0495594_0212843 | 3300046499 | Bacteria | 1102 |
| 705 | Ga0495608_0000037 | 3300046511 | Bacteria | 125064 |
| 706 | Ga0495608_0005687 | 3300046511 | Bacteria | 8899 |
| 707 | Ga0495608_0018014 | 3300046511 | Bacteria | 4879 |
| 708 | Ga0495608_0041204 | 3300046511 | Bacteria | 3091 |
| 709 | Ga0495608_0080670 | 3300046511 | Bacteria | 2115 |
| 710 | Ga0495608_0686021 | 3300046511 | Unclassified | 610 |
| 711 | Ga0495618_0040555 | 3300046514 | Bacteria | 2930 |
| 712 | Ga0495618_0122905 | 3300046514 | Bacteria | 1662 |
| 713 | Ga0495618_0295127 | 3300046514 | Bacteria | 1008 |
| 714 | Ga0495618_0500474 | 3300046514 | Unclassified | 732 |
| 715 | Ga0495628_0000227 | 3300046516 | Bacteria | 49431 |
| 716 | Ga0495628_0024931 | 3300046516 | Bacteria | 4891 |
| 717 | Ga0495628_0050817 | 3300046516 | Bacteria | 3279 |
| 718 | Ga0495628_0090413 | 3300046516 | Bacteria | 2370 |
| 719 | Ga0495628_0128663 | 3300046516 | Bacteria | 1938 |
| 720 | Ga0495628_0264377 | 3300046516 | Unclassified | 1281 |
| 721 | Ga0495628_0392707 | 3300046516 | Bacteria | 1014 |
| 722 | Ga0495630_0037661 | 3300046517 | Bacteria | 3616 |
| 723 | Ga0495630_0045136 | 3300046517 | Bacteria | 3292 |
| 724 | Ga0495630_0061310 | 3300046517 | Bacteria | 2824 |
| 725 | Ga0495630_0579897 | 3300046517 | Bacteria | 860 |
| 726 | Ga0495666_0012325 | 3300046526 | Bacteria | 4263 |
| 727 | Ga0495666_0014163 | 3300046526 | Bacteria | 3974 |
| 728 | Ga0495666_0035084 | 3300046526 | Bacteria | 2446 |
| 729 | Ga0495652_0000180 | 3300046529 | Bacteria | 71646 |
| 730 | Ga0495652_0004139 | 3300046529 | Bacteria | 13989 |
| 731 | Ga0495652_0076114 | 3300046529 | Bacteria | 2785 |
| 732 | Ga0495652_0172292 | 3300046529 | Bacteria | 1669 |
| 733 | Ga0495652_0290739 | 3300046529 | Bacteria | 1192 |
| 734 | Ga0495652_0319814 | 3300046529 | Unclassified | 1121 |
| 735 | Ga0495665_0003325 | 3300046531 | Bacteria | 8716 |
| 736 | Ga0495665_0004279 | 3300046531 | Bacteria | 7716 |
| 737 | Ga0495665_0029323 | 3300046531 | Bacteria | 2948 |
| 738 | Ga0495665_0186939 | 3300046531 | Bacteria | 1075 |
| 739 | Ga0495640_0015063 | 3300046533 | Bacteria | 5826 |
| 740 | Ga0495640_0021658 | 3300046533 | Bacteria | 4711 |
| 741 | Ga0495640_0069518 | 3300046533 | Bacteria | 2368 |
| 742 | Ga0495640_0073053 | 3300046533 | Bacteria | 2297 |
| 743 | Ga0495640_0109030 | 3300046533 | Bacteria | 1811 |
| 744 | Ga0495640_0204268 | 3300046533 | Unclassified | 1251 |
| 745 | Ga0495640_0318587 | 3300046533 | Bacteria | 963 |
| 746 | Ga0495640_0621329 | 3300046533 | Unclassified | 651 |
| 747 | Ga0495586_0032980 | 3300046535 | Bacteria | 2778 |
| 748 | Ga0495586_0038569 | 3300046535 | Bacteria | 2567 |
| 749 | Ga0495586_0056060 | 3300046535 | Bacteria | 2136 |
| 750 | Ga0495587_0000024 | 3300046536 | Bacteria | 148753 |
| 751 | Ga0495587_0053075 | 3300046536 | Bacteria | 2390 |
| 752 | Ga0495587_0099410 | 3300046536 | Bacteria | 1677 |
| 753 | Ga0495587_0120169 | 3300046536 | Bacteria | 1505 |
| 754 | Ga0495645_0018464 | 3300046543 | Bacteria | 5008 |
| 755 | Ga0495645_0027452 | 3300046543 | Bacteria | 4137 |
| 756 | Ga0495645_0042705 | 3300046543 | Bacteria | 3306 |
| 757 | Ga0495645_0053793 | 3300046543 | Bacteria | 2926 |
| 758 | Ga0495645_0072780 | 3300046543 | Unclassified | 2476 |
| 759 | Ga0495645_0077148 | 3300046543 | Bacteria | 2396 |
| 760 | Ga0495645_0084013 | 3300046543 | Bacteria | 2280 |
| 761 | Ga0495645_0157521 | 3300046543 | Bacteria | 1572 |
| 762 | Ga0495645_0459726 | 3300046543 | Bacteria | 801 |
| 763 | Ga0495622_0259848 | 3300046557 | Unclassified | 762 |
| 764 | Ga0495667_0000024 | 3300046559 | Bacteria | 168313 |
| 765 | Ga0495667_0010521 | 3300046559 | Bacteria | 6259 |
| 766 | Ga0495667_0026991 | 3300046559 | Bacteria | 3870 |
| 767 | Ga0495667_0030425 | 3300046559 | Bacteria | 3627 |
| 768 | Ga0495667_0045697 | 3300046559 | Bacteria | 2898 |
| 769 | Ga0495667_0053431 | 3300046559 | Bacteria | 2660 |
| 770 | Ga0495667_0143989 | 3300046559 | Bacteria | 1535 |
| 771 | Ga0495667_0146617 | 3300046559 | Bacteria | 1520 |
| 772 | Ga0495656_0542518 | 3300046615 | Unclassified | 619 |
| 773 | Ga0495634_0019496 | 3300046642 | Bacteria | 4817 |
| 774 | Ga0495634_0060263 | 3300046642 | Bacteria | 2525 |
| 775 | Ga0495634_0077617 | 3300046642 | Bacteria | 2177 |
| 776 | Ga0495635_0000698 | 3300046663 | Bacteria | 21638 |
| 777 | Ga0495635_0013834 | 3300046663 | Bacteria | 5643 |
| 778 | Ga0495635_0054615 | 3300046663 | Bacteria | 2751 |
| 779 | Ga0495635_0612478 | 3300046663 | Bacteria | 710 |
| 780 | Ga0495588_0018741 | 3300046674 | Bacteria | 3379 |
| 781 | Ga0495588_0250534 | 3300046674 | Archaea | 934 |
| 782 | Ga0495657_0000121 | 3300046675 | Bacteria | 69526 |
| 783 | Ga0495657_0014491 | 3300046675 | Bacteria | 5786 |
| 784 | Ga0495657_0041672 | 3300046675 | Bacteria | 3140 |
| 785 | Ga0495657_0073922 | 3300046675 | Bacteria | 2218 |
| 786 | Ga0495657_0094247 | 3300046675 | Bacteria | 1915 |
| 787 | Ga0495657_0147544 | 3300046675 | Bacteria | 1462 |
| 788 | Ga0495657_0468455 | 3300046675 | Unclassified | 736 |
| 789 | Ga0495599_0000362 | 3300046678 | Bacteria | 26767 |
| 790 | Ga0495599_0014531 | 3300046678 | Bacteria | 4875 |
| 791 | Ga0495599_0018542 | 3300046678 | Bacteria | 4335 |
| 792 | Ga0495599_0021944 | 3300046678 | Bacteria | 3984 |
| 793 | Ga0495599_0096896 | 3300046678 | Unclassified | 1839 |
| 794 | Ga0495599_0146454 | 3300046678 | Bacteria | 1464 |
| 795 | Ga0495623_0003314 | 3300046679 | Bacteria | 10644 |
| 796 | Ga0495623_0023619 | 3300046679 | Bacteria | 3967 |
| 797 | Ga0495623_0041927 | 3300046679 | Bacteria | 2917 |
| 798 | Ga0495623_0118084 | 3300046679 | Bacteria | 1600 |
| 799 | Ga0495623_0268593 | 3300046679 | Bacteria | 953 |
| 800 | Ga0495623_0396265 | 3300046679 | Unclassified | 743 |
| 801 | Ga0495646_0003516 | 3300046680 | Bacteria | 9759 |
| 802 | Ga0495646_0023360 | 3300046680 | Bacteria | 3893 |
| 803 | Ga0495646_0034742 | 3300046680 | Bacteria | 3129 |
| 804 | Ga0495646_0044147 | 3300046680 | Bacteria | 2726 |
| 805 | Ga0495646_0051383 | 3300046680 | Unclassified | 2495 |
| 806 | Ga0495646_0056228 | 3300046680 | Bacteria | 2360 |
| 807 | Ga0495646_0064842 | 3300046680 | Bacteria | 2164 |
| 808 | Ga0495646_0194680 | 3300046680 | Bacteria | 1106 |
| 809 | Ga0495647_0008177 | 3300046681 | Bacteria | 3515 |
| 810 | Ga0495647_0011994 | 3300046681 | Bacteria | 2977 |
| 811 | Ga0495647_0144790 | 3300046681 | Bacteria | 1015 |
| 812 | Ga0495658_0003636 | 3300046683 | Bacteria | 7633 |
| 813 | Ga0495658_0010930 | 3300046683 | Bacteria | 4550 |
| 814 | Ga0495613_0037126 | 3300046689 | Bacteria | 3612 |
| 815 | Ga0495613_0089011 | 3300046689 | Bacteria | 2236 |
| 816 | Ga0495613_0113891 | 3300046689 | Bacteria | 1947 |
| 817 | Ga0495624_0046194 | 3300046690 | Bacteria | 2769 |
| 818 | Ga0495624_0050108 | 3300046690 | Bacteria | 2646 |
| 819 | Ga0495624_0055880 | 3300046690 | Bacteria | 2485 |
| 820 | Ga0495624_0102059 | 3300046690 | Bacteria | 1766 |
| 821 | Ga0495624_0149783 | 3300046690 | Unclassified | 1427 |
| 822 | Ga0495624_0371633 | 3300046690 | Unclassified | 859 |
| 823 | Ga0495624_0503305 | 3300046690 | Bacteria | 725 |
| 824 | Ga0495600_0000659 | 3300046809 | Bacteria | 17938 |
| 825 | Ga0495600_0008867 | 3300046809 | Bacteria | 6196 |
| 826 | Ga0495600_0047247 | 3300046809 | Bacteria | 2807 |
| 827 | Ga0495600_0048758 | 3300046809 | Bacteria | 2762 |
| 828 | Ga0495600_0104981 | 3300046809 | Bacteria | 1841 |
| 829 | Ga0495581_0005385 | 3300047315 | Bacteria | 7403 |
| 830 | Ga0495581_0008932 | 3300047315 | Bacteria | 5801 |
| 831 | Ga0495581_0030686 | 3300047315 | Bacteria | 3113 |
| 832 | Ga0495581_0048480 | 3300047315 | Bacteria | 2453 |
| 833 | Ga0495581_0075137 | 3300047315 | Bacteria | 1955 |
| 834 | Ga0495604_0000024 | 3300047317 | Bacteria | 148542 |
| 835 | Ga0495604_0012952 | 3300047317 | Bacteria | 6646 |
| 836 | Ga0495604_0015781 | 3300047317 | Bacteria | 6028 |
| 837 | Ga0495604_0259145 | 3300047317 | Bacteria | 1182 |
| 838 | Ga0495604_0819330 | 3300047317 | Bacteria | 585 |
| 839 | Ga0495674_0002024 | 3300047319 | Bacteria | 19933 |
| 840 | Ga0495674_0008562 | 3300047319 | Bacteria | 9735 |
| 841 | Ga0495674_0022932 | 3300047319 | Bacteria | 5751 |
| 842 | Ga0495674_0048649 | 3300047319 | Bacteria | 3751 |
| 843 | Ga0495674_0065338 | 3300047319 | Bacteria | 3160 |
| 844 | Ga0495674_0083049 | 3300047319 | Bacteria | 2746 |
| 845 | Ga0495674_0090219 | 3300047319 | Bacteria | 2619 |
| 846 | Ga0495674_0190378 | 3300047319 | Bacteria | 1705 |
| 847 | Ga0495674_0426765 | 3300047319 | Unclassified | 1067 |
| 848 | Ga0495674_0624790 | 3300047319 | Unclassified | 851 |
| 849 | Ga0495676_0064787 | 3300047321 | Bacteria | 2839 |
| 850 | Ga0495676_0119630 | 3300047321 | Bacteria | 1918 |
| 851 | Ga0495676_0163022 | 3300047321 | Bacteria | 1575 |
| 852 | Ga0495676_0175035 | 3300047321 | Bacteria | 1507 |
| 853 | Ga0495680_0000005 | 3300047322 | Bacteria | 168308 |
| 854 | Ga0495680_0013934 | 3300047322 | Bacteria | 6991 |
| 855 | Ga0495680_0031216 | 3300047322 | Bacteria | 4339 |
| 856 | Ga0495680_0057905 | 3300047322 | Bacteria | 2995 |
| 857 | Ga0495680_0070658 | 3300047322 | Bacteria | 2660 |
| 858 | Ga0495680_0076994 | 3300047322 | Bacteria | 2528 |
| 859 | Ga0495680_1100908 | 3300047322 | Unclassified | 502 |
| 860 | Ga0495675_0000732 | 3300047444 | Bacteria | 20520 |
| 861 | Ga0495675_0005970 | 3300047444 | Bacteria | 7445 |
| 862 | Ga0495675_0030343 | 3300047444 | Bacteria | 3449 |
| 863 | Ga0495684_0001943 | 3300047471 | Bacteria | 16581 |
| 864 | Ga0495684_0008935 | 3300047471 | Bacteria | 7739 |
| 865 | Ga0495684_0010765 | 3300047471 | Bacteria | 7068 |
| 866 | Ga0495684_0058922 | 3300047471 | Bacteria | 2924 |
| 867 | Ga0495684_0070817 | 3300047471 | Bacteria | 2650 |
| 868 | Ga0495684_0312173 | 3300047471 | Bacteria | 1126 |
| 869 | Ga0495684_0983038 | 3300047471 | Unclassified | 537 |
| 870 | Ga0495593_0021069 | 3300047673 | Bacteria | 3644 |
| 871 | Ga0495593_0035403 | 3300047673 | Bacteria | 2711 |
| 872 | Ga0495593_0068069 | 3300047673 | Bacteria | 1853 |
| 873 | Ga0495593_0072795 | 3300047673 | Bacteria | 1783 |
| 874 | Ga0495602_0000198 | 3300048088 | Bacteria | 56006 |
| 875 | Ga0495602_0053659 | 3300048088 | Bacteria | 3567 |
| 876 | Ga0495602_0059659 | 3300048088 | Bacteria | 3328 |
| 877 | Ga0495602_0130272 | 3300048088 | Bacteria | 2007 |
| 878 | Ga0495602_0267754 | 3300048088 | Bacteria | 1264 |
| 879 | Ga0495602_0469776 | 3300048088 | Bacteria | 884 |
| 880 | Ga0495614_0020687 | 3300048089 | Bacteria | 2844 |
| 881 | Ga0495614_0036387 | 3300048089 | Bacteria | 2113 |
| 882 | Ga0495614_0181299 | 3300048089 | Unclassified | 947 |
| 883 | Ga0496101_0080830 | 3300048904 | Bacteria | 2402 |
| 884 | Ga0496101_0085737 | 3300048904 | Bacteria | 2334 |
| 885 | Ga0496102_0250511 | 3300048905 | Bacteria | 1670 |
| 886 | Ga0496102_0391820 | 3300048905 | Unclassified | 1307 |
| 887 | Ga0496102_0558887 | 3300048905 | Bacteria | 1067 |
| 888 | Ga0496102_0698364 | 3300048905 | Unclassified | 937 |
| 889 | Ga0496103_0027389 | 3300048906 | Bacteria | 3453 |
| 890 | Ga0496103_0102809 | 3300048906 | Bacteria | 1810 |
| 891 | Ga0496104_0001194 | 3300048907 | Bacteria | 22354 |
| 892 | Ga0496104_0003348 | 3300048907 | Bacteria | 13840 |
| 893 | Ga0496104_0070595 | 3300048907 | Bacteria | 3320 |
| 894 | Ga0496105_0002102 | 3300048908 | Bacteria | 14413 |
| 895 | Ga0496105_0017097 | 3300048908 | Bacteria | 5807 |
| 896 | Ga0496105_0021205 | 3300048908 | Bacteria | 5257 |
| 897 | Ga0496105_0036418 | 3300048908 | Bacteria | 4053 |
| 898 | Ga0496105_0526975 | 3300048908 | Bacteria | 925 |
| 899 | Ga0496106_0077453 | 3300048909 | Bacteria | 2549 |
| 900 | Ga0496106_0106910 | 3300048909 | Bacteria | 2175 |
| 901 | Ga0496107_0014906 | 3300048910 | Bacteria | 5442 |
| 902 | Ga0496107_0059599 | 3300048910 | Bacteria | 2762 |
| 903 | Ga0496107_0404652 | 3300048910 | Unclassified | 1015 |
| 904 | Ga0496107_0551692 | 3300048910 | Bacteria | 853 |
| 905 | Ga0496108_0003022 | 3300048911 | Bacteria | 13525 |
| 906 | Ga0496108_0009578 | 3300048911 | Bacteria | 7849 |
| 907 | Ga0496108_0012378 | 3300048911 | Bacteria | 6943 |
| 908 | Ga0496108_0811023 | 3300048911 | Bacteria | 807 |
| 909 | Ga0496109_0002157 | 3300048912 | Bacteria | 16358 |
| 910 | Ga0496109_0052702 | 3300048912 | Bacteria | 3709 |
| 911 | Ga0496109_0057856 | 3300048912 | Bacteria | 3540 |
| 912 | Ga0496109_0077274 | 3300048912 | Bacteria | 3063 |
| 913 | Ga0496110_1100508 | 3300048913 | Bacteria | 703 |
| 914 | Ga0496111_0040374 | 3300048914 | Bacteria | 3347 |
| 915 | Ga0496111_0366943 | 3300048914 | Bacteria | 1065 |
| 916 | Ga0496111_0378927 | 3300048914 | Unclassified | 1046 |
| 917 | Ga0496111_0598530 | 3300048914 | Bacteria | 807 |
| 918 | Ga0496112_0000183 | 3300048915 | Bacteria | 40211 |
| 919 | Ga0496112_0074470 | 3300048915 | Bacteria | 3357 |
| 920 | Ga0496112_0267886 | 3300048915 | Bacteria | 1657 |
| 921 | Ga0496112_0605908 | 3300048915 | Unclassified | 1027 |
| 922 | Ga0496113_0006788 | 3300048916 | Bacteria | 7296 |
| 923 | Ga0496113_0062251 | 3300048916 | Bacteria | 2817 |
| 924 | Ga0496113_0230052 | 3300048916 | Bacteria | 1478 |
| 925 | Ga0496113_0257040 | 3300048916 | Bacteria | 1395 |
| 926 | Ga0496113_0550442 | 3300048916 | Bacteria | 925 |
| 927 | Ga0496114_0102641 | 3300048917 | Bacteria | 2443 |
| 928 | Ga0496114_0123518 | 3300048917 | Bacteria | 2229 |
| 929 | Ga0496114_0865525 | 3300048917 | Bacteria | 784 |
| 930 | Ga0496115_0033108 | 3300048918 | Bacteria | 4079 |
| 931 | Ga0496115_0039179 | 3300048918 | Bacteria | 3762 |
| 932 | Ga0496126_0103220 | 3300048929 | Bacteria | 2492 |
| 933 | Ga0501067_0186267 | 3300049583 | Bacteria | 1156 |
| 934 | Ga0501069_0417035 | 3300049585 | Unclassified | 796 |
| 935 | Ga0501070_0458591 | 3300049586 | Bacteria | 1027 |
| 936 | nmdc:mga05p37_38778_c1 | 3300050507 | Bacteria | 5846 |
| 937 | nmdc:mga08y16_132685_c1 | 3300050511 | Bacteria | 2589 |
| 938 | nmdc:mga08y16_241691_c1 | 3300050511 | Unclassified | 1866 |
| 939 | nmdc:mga0n895_1244633_c1 | 3300050512 | Bacteria | 717 |
| 940 | nmdc:mga0n895_246939_c1 | 3300050512 | Bacteria | 1811 |
| 941 | nmdc:mga0n895_26838_c1 | 3300050512 | Bacteria | 5463 |
| 942 | nmdc:mga0n895_40493_c1 | 3300050512 | Bacteria | 4526 |
| 943 | nmdc:mga0n895_68643_c1 | 3300050512 | Unclassified | 3512 |
| 944 | nmdc:mga0rr50_157268_c1 | 3300050513 | Bacteria | 1842 |
| 945 | nmdc:mga0rr50_9469_c1 | 3300050513 | Bacteria | 6125 |
| 946 | nmdc:mga0rr50_99288_c1 | 3300050513 | Bacteria | 2284 |
| 947 | nmdc:mga08x19_1093308_c1 | 3300050514 | Bacteria | 566 |
| 948 | nmdc:mga08x19_200024_c1 | 3300050514 | Unclassified | 1369 |
| 949 | nmdc:mga08x19_41570_c1 | 3300050514 | Bacteria | 2928 |
| 950 | nmdc:mga08x19_520385_c1 | 3300050514 | Bacteria | 841 |
| 951 | nmdc:mga0a205_12658_c1 | 3300050515 | Bacteria | 7813 |
| 952 | Ga0495601_0009875 | 3300053077 | Bacteria | 5651 |
| 953 | Ga0495601_0047827 | 3300053077 | Bacteria | 2693 |
| 954 | Ga0495601_0067835 | 3300053077 | Bacteria | 2272 |
| 955 | Ga0495601_0102629 | 3300053077 | Bacteria | 1848 |
| 956 | Ga0495601_0295806 | 3300053077 | Bacteria | 1055 |
| 957 | Ga0495601_0395566 | 3300053077 | Bacteria | 896 |
| 958 | Ga0495601_0697041 | 3300053077 | Unclassified | 648 |
| 959 | Ga0495612_0030649 | 3300053078 | Bacteria | 2166 |
| 960 | Ga0495595_0006614 | 3300053084 | Bacteria | 4731 |
| 961 | Ga0495595_0015601 | 3300053084 | Bacteria | 3240 |
| 962 | Ga0495595_0033595 | 3300053084 | Bacteria | 2315 |
| 963 | Ga0495619_0004020 | 3300053085 | Bacteria | 9418 |
| 964 | Ga0495619_0016223 | 3300053085 | Bacteria | 4714 |
| 965 | Ga0495619_0112723 | 3300053085 | Bacteria | 1859 |
| 966 | Ga0587071_096023 | 3300060344 | Unclassified | 679 |
| 967 | Ga0587111_0122827 | 3300060346 | Unclassified | 671 |
| 968 | Ga0466962_0038621 | 3300061719 | Bacteria | 2286 |
| 969 | Ga0466962_0087618 | 3300061719 | Unclassified | 1491 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048916 | Ga0496113_0230052 | Ga0496113_0230052_16_453 | 145 |
| 2 | 3300026075 | Ga0207708_10344040 | Ga0207708_103440402 | 148 |
| 3 | 3300005981 | Ga0081538_10000538 | Ga0081538_100005386 | 156 |
| 4 | 3300035119 | Ga0373956_0595288 | Ga0373956_0595288_38_508 | 156 |
| 5 | 3300047322 | Ga0495680_1100908 | Ga0495680_1100908_14_484 | 156 |
| 6 | 3300047471 | Ga0495684_0983038 | Ga0495684_0983038_32_502 | 156 |
| 7 | 3300009098 | Ga0105245_10010094 | Ga0105245_100100944 | 157 |
| 8 | 3300009101 | Ga0105247_10341959 | Ga0105247_103419592 | 157 |
| 9 | 3300009174 | Ga0105241_10263547 | Ga0105241_102635472 | 157 |
| 10 | 3300009177 | Ga0105248_10061741 | Ga0105248_100617413 | 157 |
| 11 | 3300009545 | Ga0105237_10219032 | Ga0105237_102190322 | 157 |
| 12 | 3300009551 | Ga0105238_10382147 | Ga0105238_103821472 | 157 |
| 13 | 3300013104 | Ga0157370_10132030 | Ga0157370_101320302 | 157 |
| 14 | 3300013105 | Ga0157369_10092910 | Ga0157369_100929104 | 157 |
| 15 | 3300013296 | Ga0157374_10010592 | Ga0157374_100105923 | 157 |
| 16 | 3300013297 | Ga0157378_10161991 | Ga0157378_101619912 | 157 |
| 17 | 3300013297 | Ga0157378_11565988 | Ga0157378_115659882 | 157 |
| 18 | 3300013308 | Ga0157375_10182194 | Ga0157375_101821942 | 157 |
| 19 | 3300014325 | Ga0163163_10010901 | Ga0163163_100109015 | 157 |
| 20 | 3300014968 | Ga0157379_10002408 | Ga0157379_1000240812 | 157 |
| 21 | 3300014969 | Ga0157376_10041457 | Ga0157376_100414573 | 157 |
| 22 | 3300035085 | Ga0373929_0219846 | Ga0373929_0219846_33_506 | 157 |
| 23 | 3300035086 | Ga0373934_0001673 | Ga0373934_0001673_1917_2390 | 157 |
| 24 | 3300035090 | Ga0373949_0116180 | Ga0373949_0116180_234_707 | 157 |
| 25 | 3300035111 | Ga0373923_0014469 | Ga0373923_0014469_1931_2404 | 157 |
| 26 | 3300035111 | Ga0373923_0535437 | Ga0373923_0535437_72_545 | 157 |
| 27 | 3300035113 | Ga0373936_0041039 | Ga0373936_0041039_1271_1744 | 157 |
| 28 | 3300035113 | Ga0373936_0179339 | Ga0373936_0179339_20_493 | 157 |
| 29 | 3300035117 | Ga0373953_0000044 | Ga0373953_0000044_9265_9738 | 157 |
| 30 | 3300035118 | Ga0373954_0001593 | Ga0373954_0001593_6992_7465 | 157 |
| 31 | 3300035118 | Ga0373954_0102459 | Ga0373954_0102459_363_836 | 157 |
| 32 | 3300035119 | Ga0373956_0000249 | Ga0373956_0000249_19593_20066 | 157 |
| 33 | 3300035120 | Ga0373957_0000107 | Ga0373957_0000107_2254_2727 | 157 |
| 34 | 3300035170 | Ga0373943_0105846 | Ga0373943_0105846_268_741 | 157 |
| 35 | 3300035171 | Ga0373946_0052605 | Ga0373946_0052605_661_1134 | 157 |
| 36 | 3300035172 | Ga0373955_0000014 | Ga0373955_0000014_37762_38235 | 157 |
| 37 | 3300035172 | Ga0373955_0016247 | Ga0373955_0016247_2193_2666 | 157 |
| 38 | 3300035410 | Ga0373924_0000783 | Ga0373924_0000783_2728_3201 | 157 |
| 39 | 3300035410 | Ga0373924_0018801 | Ga0373924_0018801_257_730 | 157 |
| 40 | 3300035691 | Ga0373931_0364589 | Ga0373931_0364589_10_483 | 157 |
| 41 | 3300035695 | Ga0373927_0385345 | Ga0373927_0385345_193_666 | 157 |
| 42 | 3300035724 | Ga0373933_0000021 | Ga0373933_0000021_11458_11931 | 157 |
| 43 | 3300035724 | Ga0373933_0076051 | Ga0373933_0076051_190_663 | 157 |
| 44 | 3300035724 | Ga0373933_0111676 | Ga0373933_0111676_27_500 | 157 |
| 45 | 3300035725 | Ga0373947_0167059 | Ga0373947_0167059_26_499 | 157 |
| 46 | 3300036401 | Ga0373937_0000032 | Ga0373937_0000032_85117_85590 | 157 |
| 47 | 3300036401 | Ga0373937_0175143 | Ga0373937_0175143_971_1444 | 157 |
| 48 | 3300046454 | Ga0495592_0000079 | Ga0495592_0000079_63164_63637 | 157 |
| 49 | 3300046455 | Ga0495603_0179823 | Ga0495603_0179823_495_968 | 157 |
| 50 | 3300046459 | Ga0495629_0053279 | Ga0495629_0053279_598_1071 | 157 |
| 51 | 3300046462 | Ga0495651_0000010 | Ga0495651_0000010_63164_63637 | 157 |
| 52 | 3300046463 | Ga0495653_0000601 | Ga0495653_0000601_981_1454 | 157 |
| 53 | 3300046473 | Ga0495582_0038330 | Ga0495582_0038330_1142_1615 | 157 |
| 54 | 3300046475 | Ga0495639_0117673 | Ga0495639_0117673_328_801 | 157 |
| 55 | 3300046477 | Ga0495664_0119016 | Ga0495664_0119016_1097_1570 | 157 |
| 56 | 3300046511 | Ga0495608_0000037 | Ga0495608_0000037_45762_46235 | 157 |
| 57 | 3300046511 | Ga0495608_0686021 | Ga0495608_0686021_112_585 | 157 |
| 58 | 3300046514 | Ga0495618_0500474 | Ga0495618_0500474_243_716 | 157 |
| 59 | 3300046516 | Ga0495628_0000227 | Ga0495628_0000227_39258_39731 | 157 |
| 60 | 3300046516 | Ga0495628_0392707 | Ga0495628_0392707_256_729 | 157 |
| 61 | 3300046526 | Ga0495666_0014163 | Ga0495666_0014163_33_506 | 157 |
| 62 | 3300046529 | Ga0495652_0000180 | Ga0495652_0000180_49133_49606 | 157 |
| 63 | 3300046533 | Ga0495640_0318587 | Ga0495640_0318587_255_728 | 157 |
| 64 | 3300046535 | Ga0495586_0056060 | Ga0495586_0056060_884_1357 | 157 |
| 65 | 3300046536 | Ga0495587_0000024 | Ga0495587_0000024_85116_85589 | 157 |
| 66 | 3300046543 | Ga0495645_0084013 | Ga0495645_0084013_1788_2261 | 157 |
| 67 | 3300046559 | Ga0495667_0000024 | Ga0495667_0000024_104675_105148 | 157 |
| 68 | 3300046675 | Ga0495657_0000121 | Ga0495657_0000121_63152_63625 | 157 |
| 69 | 3300046678 | Ga0495599_0000362 | Ga0495599_0000362_26121_26594 | 157 |
| 70 | 3300046679 | Ga0495623_0003314 | Ga0495623_0003314_44_517 | 157 |
| 71 | 3300046679 | Ga0495623_0118084 | Ga0495623_0118084_642_1115 | 157 |
| 72 | 3300046680 | Ga0495646_0064842 | Ga0495646_0064842_1210_1683 | 157 |
| 73 | 3300046681 | Ga0495647_0144790 | Ga0495647_0144790_297_770 | 157 |
| 74 | 3300046690 | Ga0495624_0050108 | Ga0495624_0050108_1929_2402 | 157 |
| 75 | 3300046809 | Ga0495600_0000659 | Ga0495600_0000659_12495_12968 | 157 |
| 76 | 3300047315 | Ga0495581_0075137 | Ga0495581_0075137_1269_1742 | 157 |
| 77 | 3300047317 | Ga0495604_0000024 | Ga0495604_0000024_84933_85406 | 157 |
| 78 | 3300047319 | Ga0495674_0090219 | Ga0495674_0090219_1682_2155 | 157 |
| 79 | 3300047319 | Ga0495674_0624790 | Ga0495674_0624790_345_818 | 157 |
| 80 | 3300047321 | Ga0495676_0163022 | Ga0495676_0163022_876_1349 | 157 |
| 81 | 3300047322 | Ga0495680_0000005 | Ga0495680_0000005_63140_63613 | 157 |
| 82 | 3300047444 | Ga0495675_0000732 | Ga0495675_0000732_19538_20011 | 157 |
| 83 | 3300047673 | Ga0495593_0068069 | Ga0495593_0068069_1129_1602 | 157 |
| 84 | 3300048088 | Ga0495602_0000198 | Ga0495602_0000198_34559_35032 | 157 |
| 85 | 3300048088 | Ga0495602_0469776 | Ga0495602_0469776_374_847 | 157 |
| 86 | 3300048905 | Ga0496102_0391820 | Ga0496102_0391820_363_836 | 157 |
| 87 | 3300048905 | Ga0496102_0558887 | Ga0496102_0558887_450_923 | 157 |
| 88 | 3300048908 | Ga0496105_0021205 | Ga0496105_0021205_1439_1912 | 157 |
| 89 | 3300048914 | Ga0496111_0378927 | Ga0496111_0378927_208_681 | 157 |
| 90 | 3300048915 | Ga0496112_0074470 | Ga0496112_0074470_2334_2807 | 157 |
| 91 | 3300048917 | Ga0496114_0865525 | Ga0496114_0865525_61_534 | 157 |
| 92 | 3300050512 | nmdc:mga0n895_246939_c1 | nmdc:mga0n895_246939_c1_331_804 | 157 |
| 93 | 3300050513 | nmdc:mga0rr50_99288_c1 | nmdc:mga0rr50_99288_c1_246_719 | 157 |
| 94 | 3300050514 | nmdc:mga08x19_1093308_c1 | nmdc:mga08x19_1093308_c1_31_504 | 157 |
| 95 | 3300053077 | Ga0495601_0697041 | Ga0495601_0697041_103_576 | 157 |
| 96 | 3300053078 | Ga0495612_0030649 | Ga0495612_0030649_613_1086 | 157 |
| 97 | 3300053084 | Ga0495595_0006614 | Ga0495595_0006614_1356_1829 | 157 |
| 98 | 3300025900 | Ga0207710_10035399 | Ga0207710_100353992 | 158 |
| 99 | 3300005356 | Ga0070674_100128745 | Ga0070674_1001287452 | 159 |
| 100 | 3300006881 | Ga0068865_100556061 | Ga0068865_1005560612 | 159 |
| 101 | 3300028556 | Ga0265337_1021791 | Ga0265337_10217911 | 160 |
| 102 | 3300037418 | Ga0395900_0994425 | Ga0395900_0994425_44_535 | 162 |
| 103 | 3300038443 | Ga0395901_1077115 | Ga0395901_1077115_87_578 | 162 |
| 104 | 3300005338 | Ga0068868_100089213 | Ga0068868_1000892131 | 163 |
| 105 | 3300005341 | Ga0070691_10029378 | Ga0070691_100293783 | 163 |
| 106 | 3300005535 | Ga0070684_100119349 | Ga0070684_1001193493 | 163 |
| 107 | 3300005546 | Ga0070696_100207734 | Ga0070696_1002077342 | 163 |
| 108 | 3300005549 | Ga0070704_100123783 | Ga0070704_1001237833 | 163 |
| 109 | 3300005563 | Ga0068855_100227677 | Ga0068855_1002276772 | 163 |
| 110 | 3300005577 | Ga0068857_100110737 | Ga0068857_1001107372 | 163 |
| 111 | 3300005614 | Ga0068856_100361819 | Ga0068856_1003618192 | 163 |
| 112 | 3300005617 | Ga0068859_100192264 | Ga0068859_1001922642 | 163 |
| 113 | 3300005841 | Ga0068863_100067239 | Ga0068863_1000672394 | 163 |
| 114 | 3300005842 | Ga0068858_100035279 | Ga0068858_1000352794 | 163 |
| 115 | 3300006163 | Ga0070715_10015253 | Ga0070715_100152532 | 163 |
| 116 | 3300006173 | Ga0070716_100012587 | Ga0070716_1000125872 | 163 |
| 117 | 3300006237 | Ga0097621_100060592 | Ga0097621_1000605923 | 163 |
| 118 | 3300006358 | Ga0068871_100087607 | Ga0068871_1000876072 | 163 |
| 119 | 3300006871 | Ga0075434_100447620 | Ga0075434_1004476203 | 163 |
| 120 | 3300006914 | Ga0075436_100187822 | Ga0075436_1001878223 | 163 |
| 121 | 3300006931 | Ga0097620_100192262 | Ga0097620_1001922623 | 163 |
| 122 | 3300025915 | Ga0207693_10037841 | Ga0207693_100378413 | 163 |
| 123 | 3300025916 | Ga0207663_10346641 | Ga0207663_103466412 | 163 |
| 124 | 3300025929 | Ga0207664_10165850 | Ga0207664_101658502 | 163 |
| 125 | 3300025939 | Ga0207665_10013823 | Ga0207665_100138233 | 163 |
| 126 | 3300025944 | Ga0207661_10291618 | Ga0207661_102916182 | 163 |
| 127 | 3300025961 | Ga0207712_10399140 | Ga0207712_103991402 | 163 |
| 128 | 3300026023 | Ga0207677_10020233 | Ga0207677_100202333 | 163 |
| 129 | 3300026078 | Ga0207702_10111160 | Ga0207702_101111603 | 163 |
| 130 | 3300026116 | Ga0207674_10053372 | Ga0207674_100533724 | 163 |
| 131 | 3300045836 | Ga0466958_0136487 | Ga0466958_0136487_604_1119 | 163 |
| 132 | 3300061719 | Ga0466962_0087618 | Ga0466962_0087618_285_800 | 163 |
| 133 | 3300005295 | Ga0065707_10010235 | Ga0065707_100102352 | 164 |
| 134 | 3300005329 | Ga0070683_100150452 | Ga0070683_1001504521 | 164 |
| 135 | 3300005331 | Ga0070670_100127662 | Ga0070670_1001276623 | 164 |
| 136 | 3300005337 | Ga0070682_100381584 | Ga0070682_1003815842 | 164 |
| 137 | 3300005338 | Ga0068868_100211445 | Ga0068868_1002114453 | 164 |
| 138 | 3300005339 | Ga0070660_100273042 | Ga0070660_1002730422 | 164 |
| 139 | 3300005340 | Ga0070689_100486184 | Ga0070689_1004861841 | 164 |
| 140 | 3300005353 | Ga0070669_100083417 | Ga0070669_1000834172 | 164 |
| 141 | 3300005354 | Ga0070675_100020082 | Ga0070675_1000200822 | 164 |
| 142 | 3300005356 | Ga0070674_101624573 | Ga0070674_1016245731 | 164 |
| 143 | 3300005365 | Ga0070688_100060707 | Ga0070688_1000607071 | 164 |
| 144 | 3300005438 | Ga0070701_10097201 | Ga0070701_100972012 | 164 |
| 145 | 3300005440 | Ga0070705_100390086 | Ga0070705_1003900863 | 164 |
| 146 | 3300005441 | Ga0070700_100028004 | Ga0070700_1000280044 | 164 |
| 147 | 3300005445 | Ga0070708_100017977 | Ga0070708_1000179778 | 164 |
| 148 | 3300005445 | Ga0070708_100104212 | Ga0070708_1001042124 | 164 |
| 149 | 3300005445 | Ga0070708_100112502 | Ga0070708_1001125023 | 164 |
| 150 | 3300005455 | Ga0070663_100039551 | Ga0070663_1000395512 | 164 |
| 151 | 3300005457 | Ga0070662_100362063 | Ga0070662_1003620632 | 164 |
| 152 | 3300005466 | Ga0070685_10026846 | Ga0070685_100268464 | 164 |
| 153 | 3300005467 | Ga0070706_100041193 | Ga0070706_1000411932 | 164 |
| 154 | 3300005468 | Ga0070707_100033411 | Ga0070707_1000334112 | 164 |
| 155 | 3300005471 | Ga0070698_100018588 | Ga0070698_1000185884 | 164 |
| 156 | 3300005471 | Ga0070698_101229058 | Ga0070698_1012290582 | 164 |
| 157 | 3300005518 | Ga0070699_100046263 | Ga0070699_1000462633 | 164 |
| 158 | 3300005535 | Ga0070684_100040413 | Ga0070684_1000404133 | 164 |
| 159 | 3300005536 | Ga0070697_101233014 | Ga0070697_1012330141 | 164 |
| 160 | 3300005546 | Ga0070696_100698481 | Ga0070696_1006984811 | 164 |
| 161 | 3300005577 | Ga0068857_100056671 | Ga0068857_1000566712 | 164 |
| 162 | 3300005615 | Ga0070702_100008618 | Ga0070702_1000086184 | 164 |
| 163 | 3300005618 | Ga0068864_100793406 | Ga0068864_1007934062 | 164 |
| 164 | 3300005842 | Ga0068858_100427567 | Ga0068858_1004275672 | 164 |
| 165 | 3300005844 | Ga0068862_100130513 | Ga0068862_1001305131 | 164 |
| 166 | 3300005985 | Ga0081539_10097984 | Ga0081539_100979842 | 164 |
| 167 | 3300009094 | Ga0111539_10822781 | Ga0111539_108227812 | 164 |
| 168 | 3300009098 | Ga0105245_10062831 | Ga0105245_100628311 | 164 |
| 169 | 3300009147 | Ga0114129_10083341 | Ga0114129_100833414 | 164 |
| 170 | 3300009176 | Ga0105242_11883474 | Ga0105242_118834741 | 164 |
| 171 | 3300013308 | Ga0157375_10845312 | Ga0157375_108453122 | 164 |
| 172 | 3300014325 | Ga0163163_10252588 | Ga0163163_102525881 | 164 |
| 173 | 3300014745 | Ga0157377_10005520 | Ga0157377_100055202 | 164 |
| 174 | 3300025901 | Ga0207688_10185593 | Ga0207688_101855932 | 164 |
| 175 | 3300025910 | Ga0207684_10061469 | Ga0207684_100614693 | 164 |
| 176 | 3300025919 | Ga0207657_10161579 | Ga0207657_101615792 | 164 |
| 177 | 3300025922 | Ga0207646_10216439 | Ga0207646_102164392 | 164 |
| 178 | 3300025922 | Ga0207646_10237375 | Ga0207646_102373752 | 164 |
| 179 | 3300025923 | Ga0207681_10478146 | Ga0207681_104781461 | 164 |
| 180 | 3300025927 | Ga0207687_10036137 | Ga0207687_100361371 | 164 |
| 181 | 3300025933 | Ga0207706_10141147 | Ga0207706_101411472 | 164 |
| 182 | 3300025936 | Ga0207670_10095599 | Ga0207670_100955992 | 164 |
| 183 | 3300025944 | Ga0207661_10150708 | Ga0207661_101507081 | 164 |
| 184 | 3300025945 | Ga0207679_10004671 | Ga0207679_100046717 | 164 |
| 185 | 3300026075 | Ga0207708_10202255 | Ga0207708_102022552 | 164 |
| 186 | 3300026116 | Ga0207674_10200176 | Ga0207674_102001762 | 164 |
| 187 | 3300027907 | Ga0207428_10513458 | Ga0207428_105134582 | 164 |
| 188 | 3300028380 | Ga0268265_10083304 | Ga0268265_100833042 | 164 |
| 189 | 3300028558 | Ga0265326_10109137 | Ga0265326_101091371 | 164 |
| 190 | 3300028573 | Ga0265334_10049111 | Ga0265334_100491112 | 164 |
| 191 | 3300028577 | Ga0265318_10139369 | Ga0265318_101393691 | 164 |
| 192 | 3300028654 | Ga0265322_10002593 | Ga0265322_100025932 | 164 |
| 193 | 3300028666 | Ga0265336_10066371 | Ga0265336_100663712 | 164 |
| 194 | 3300028800 | Ga0265338_10140174 | Ga0265338_101401742 | 164 |
| 195 | 3300029957 | Ga0265324_10016769 | Ga0265324_100167692 | 164 |
| 196 | 3300031235 | Ga0265330_10142509 | Ga0265330_101425091 | 164 |
| 197 | 3300031238 | Ga0265332_10060322 | Ga0265332_100603222 | 164 |
| 198 | 3300031239 | Ga0265328_10147042 | Ga0265328_101470422 | 164 |
| 199 | 3300031240 | Ga0265320_10044744 | Ga0265320_100447443 | 164 |
| 200 | 3300031240 | Ga0265320_10264010 | Ga0265320_102640102 | 164 |
| 201 | 3300031242 | Ga0265329_10038284 | Ga0265329_100382842 | 164 |
| 202 | 3300031250 | Ga0265331_10096929 | Ga0265331_100969292 | 164 |
| 203 | 3300031344 | Ga0265316_10024760 | Ga0265316_100247602 | 164 |
| 204 | 3300042876 | Ga0451577_0190051 | Ga0451577_0190051_1144_1647 | 164 |
| 205 | 3300044673 | Ga0453683_0585969 | Ga0453683_0585969_16_519 | 164 |
| 206 | 3300045051 | Ga0451576_0016352 | Ga0451576_0016352_5675_6178 | 164 |
| 207 | 3300046491 | Ga0495584_0246304 | Ga0495584_0246304_276_803 | 164 |
| 208 | 3300046615 | Ga0495656_0542518 | Ga0495656_0542518_57_590 | 164 |
| 209 | 3300048910 | Ga0496107_0404652 | Ga0496107_0404652_145_648 | 164 |
| 210 | 3300048911 | Ga0496108_0009578 | Ga0496108_0009578_3291_3794 | 164 |
| 211 | 3300048912 | Ga0496109_0002157 | Ga0496109_0002157_8599_9102 | 164 |
| 212 | 3300048915 | Ga0496112_0605908 | Ga0496112_0605908_256_759 | 164 |
| 213 | 3300049586 | Ga0501070_0458591 | Ga0501070_0458591_125_646 | 164 |
| 214 | 3300050511 | nmdc:mga08y16_241691_c1 | nmdc:mga08y16_241691_c1_261_764 | 164 |
| 215 | 3300005327 | Ga0070658_10070640 | Ga0070658_100706403 | 165 |
| 216 | 3300005329 | Ga0070683_100003809 | Ga0070683_1000038093 | 165 |
| 217 | 3300005336 | Ga0070680_100442855 | Ga0070680_1004428552 | 165 |
| 218 | 3300005339 | Ga0070660_100465144 | Ga0070660_1004651442 | 165 |
| 219 | 3300005458 | Ga0070681_10187369 | Ga0070681_101873693 | 165 |
| 220 | 3300005530 | Ga0070679_100070467 | Ga0070679_1000704672 | 165 |
| 221 | 3300009551 | Ga0105238_10908589 | Ga0105238_109085892 | 165 |
| 222 | 3300020610 | Ga0154015_1065643 | Ga0154015_10656432 | 165 |
| 223 | 3300021384 | Ga0213876_10018060 | Ga0213876_100180604 | 165 |
| 224 | 3300021388 | Ga0213875_10027793 | Ga0213875_100277932 | 165 |
| 225 | 3300021441 | Ga0213871_10008344 | Ga0213871_100083443 | 165 |
| 226 | 3300025919 | Ga0207657_10408873 | Ga0207657_104088732 | 165 |
| 227 | 3300025921 | Ga0207652_10076597 | Ga0207652_100765972 | 165 |
| 228 | 3300025944 | Ga0207661_10032384 | Ga0207661_100323843 | 165 |
| 229 | 3300025981 | Ga0207640_11339504 | Ga0207640_113395041 | 165 |
| 230 | 3300028563 | Ga0265319_1000473 | Ga0265319_10004731 | 165 |
| 231 | 3300028563 | Ga0265319_1036444 | Ga0265319_10364442 | 165 |
| 232 | 3300028573 | Ga0265334_10234650 | Ga0265334_102346501 | 165 |
| 233 | 3300028577 | Ga0265318_10119217 | Ga0265318_101192172 | 165 |
| 234 | 3300028800 | Ga0265338_10320811 | Ga0265338_103208112 | 165 |
| 235 | 3300031238 | Ga0265332_10213042 | Ga0265332_102130422 | 165 |
| 236 | 3300031240 | Ga0265320_10122416 | Ga0265320_101224161 | 165 |
| 237 | 3300031247 | Ga0265340_10103489 | Ga0265340_101034892 | 165 |
| 238 | 3300031595 | Ga0265313_10089758 | Ga0265313_100897582 | 165 |
| 239 | 3300031711 | Ga0265314_10058135 | Ga0265314_100581352 | 165 |
| 240 | 3300037418 | Ga0395900_0080117 | Ga0395900_0080117_1180_1737 | 165 |
| 241 | 3300037466 | Ga0395898_1014523 | Ga0395898_1014523_175_702 | 165 |
| 242 | 3300037853 | Ga0436364_0183340 | Ga0436364_0183340_5437_5964 | 165 |
| 243 | 3300037853 | Ga0436364_0700779 | Ga0436364_0700779_35_562 | 165 |
| 244 | 3300038443 | Ga0395901_0066827 | Ga0395901_0066827_677_1204 | 165 |
| 245 | 3300039437 | Ga0436365_0006186 | Ga0436365_0006186_1693_2220 | 165 |
| 246 | 3300039437 | Ga0436365_0414192 | Ga0436365_0414192_314_838 | 165 |
| 247 | 3300039438 | Ga0436360_0254464 | Ga0436360_0254464_3884_4408 | 165 |
| 248 | 3300039453 | Ga0436362_0133374 | Ga0436362_0133374_208_732 | 165 |
| 249 | 3300044693 | Ga0466961_0035451 | Ga0466961_0035451_1172_1696 | 165 |
| 250 | 3300044694 | Ga0466963_0004005 | Ga0466963_0004005_1773_2297 | 165 |
| 251 | 3300044694 | Ga0466963_0168131 | Ga0466963_0168131_177_701 | 165 |
| 252 | 3300044706 | Ga0466964_0026502 | Ga0466964_0026502_141_665 | 165 |
| 253 | 3300044706 | Ga0466964_0345870 | Ga0466964_0345870_82_606 | 165 |
| 254 | 3300044719 | Ga0466971_0011049 | Ga0466971_0011049_758_1282 | 165 |
| 255 | 3300044735 | Ga0466968_0142875 | Ga0466968_0142875_95_622 | 165 |
| 256 | 3300044901 | Ga0466960_0115376 | Ga0466960_0115376_810_1334 | 165 |
| 257 | 3300045049 | Ga0466959_0069272 | Ga0466959_0069272_1304_1828 | 165 |
| 258 | 3300045049 | Ga0466959_0145430 | Ga0466959_0145430_623_1147 | 165 |
| 259 | 3300045836 | Ga0466958_0005440 | Ga0466958_0005440_1587_2111 | 165 |
| 260 | 3300045836 | Ga0466958_0018937 | Ga0466958_0018937_2926_3450 | 165 |
| 261 | 3300045836 | Ga0466958_0443623 | Ga0466958_0443623_117_641 | 165 |
| 262 | 3300045976 | Ga0466967_0073155 | Ga0466967_0073155_2522_3046 | 165 |
| 263 | 3300045976 | Ga0466967_0084996 | Ga0466967_0084996_1426_1950 | 165 |
| 264 | 3300045976 | Ga0466967_0476053 | Ga0466967_0476053_79_603 | 165 |
| 265 | 3300045976 | Ga0466967_0701712 | Ga0466967_0701712_155_679 | 165 |
| 266 | 3300045976 | Ga0466967_1200630 | Ga0466967_1200630_32_559 | 165 |
| 267 | 3300048911 | Ga0496108_0811023 | Ga0496108_0811023_220_747 | 165 |
| 268 | 3300048913 | Ga0496110_1100508 | Ga0496110_1100508_163_690 | 165 |
| 269 | 3300049583 | Ga0501067_0186267 | Ga0501067_0186267_393_917 | 165 |
| 270 | 3300049585 | Ga0501069_0417035 | Ga0501069_0417035_88_612 | 165 |
| 271 | 3300061719 | Ga0466962_0038621 | Ga0466962_0038621_478_1002 | 165 |
| 272 | 3300005445 | Ga0070708_100008914 | Ga0070708_1000089148 | 168 |
| 273 | 3300005445 | Ga0070708_100646013 | Ga0070708_1006460132 | 168 |
| 274 | 3300005471 | Ga0070698_100053715 | Ga0070698_1000537152 | 168 |
| 275 | 3300005536 | Ga0070697_100063402 | Ga0070697_1000634024 | 168 |
| 276 | 3300006028 | Ga0070717_10001468 | Ga0070717_100014682 | 168 |
| 277 | 3300025922 | Ga0207646_10124397 | Ga0207646_101243973 | 168 |
| 278 | 3300005434 | Ga0070709_10011449 | Ga0070709_100114493 | 170 |
| 279 | 3300005435 | Ga0070714_100002822 | Ga0070714_10000282210 | 170 |
| 280 | 3300005436 | Ga0070713_100125631 | Ga0070713_1001256312 | 170 |
| 281 | 3300005439 | Ga0070711_100155849 | Ga0070711_1001558492 | 170 |
| 282 | 3300005439 | Ga0070711_100767814 | Ga0070711_1007678141 | 170 |
| 283 | 3300024225 | Ga0224572_1008572 | Ga0224572_10085721 | 170 |
| 284 | 3300024227 | Ga0228598_1066173 | Ga0228598_10661732 | 170 |
| 285 | 3300025906 | Ga0207699_10029022 | Ga0207699_100290222 | 170 |
| 286 | 3300025916 | Ga0207663_10917180 | Ga0207663_109171802 | 170 |
| 287 | 3300025928 | Ga0207700_10036128 | Ga0207700_100361283 | 170 |
| 288 | 3300025929 | Ga0207664_10010813 | Ga0207664_100108135 | 170 |
| 289 | 3300005329 | Ga0070683_100258732 | Ga0070683_1002587322 | 171 |
| 290 | 3300005330 | Ga0070690_100632894 | Ga0070690_1006328942 | 171 |
| 291 | 3300005340 | Ga0070689_100782338 | Ga0070689_1007823381 | 171 |
| 292 | 3300005355 | Ga0070671_100327979 | Ga0070671_1003279792 | 171 |
| 293 | 3300005518 | Ga0070699_101581426 | Ga0070699_1015814261 | 171 |
| 294 | 3300005536 | Ga0070697_100731521 | Ga0070697_1007315211 | 171 |
| 295 | 3300005564 | Ga0070664_100901662 | Ga0070664_1009016622 | 171 |
| 296 | 3300005618 | Ga0068864_100107553 | Ga0068864_1001075531 | 171 |
| 297 | 3300005843 | Ga0068860_100636532 | Ga0068860_1006365321 | 171 |
| 298 | 3300006028 | Ga0070717_10264298 | Ga0070717_102642982 | 171 |
| 299 | 3300007076 | Ga0075435_100583994 | Ga0075435_1005839942 | 171 |
| 300 | 3300013307 | Ga0157372_12133173 | Ga0157372_121331731 | 171 |
| 301 | 3300022467 | Ga0224712_10170286 | Ga0224712_101702861 | 171 |
| 302 | 3300025898 | Ga0207692_10229445 | Ga0207692_102294451 | 171 |
| 303 | 3300025914 | Ga0207671_10558026 | Ga0207671_105580262 | 171 |
| 304 | 3300025924 | Ga0207694_10185297 | Ga0207694_101852972 | 171 |
| 305 | 3300025928 | Ga0207700_10579970 | Ga0207700_105799702 | 171 |
| 306 | 3300025931 | Ga0207644_10668641 | Ga0207644_106686411 | 171 |
| 307 | 3300025936 | Ga0207670_10710998 | Ga0207670_107109981 | 171 |
| 308 | 3300025941 | Ga0207711_10189798 | Ga0207711_101897982 | 171 |
| 309 | 3300025949 | Ga0207667_10719865 | Ga0207667_107198651 | 171 |
| 310 | 3300026035 | Ga0207703_10078467 | Ga0207703_100784671 | 171 |
| 311 | 3300026095 | Ga0207676_10566137 | Ga0207676_105661372 | 171 |
| 312 | 3300028381 | Ga0268264_10612459 | Ga0268264_106124591 | 171 |
| 313 | 3300035083 | Ga0373926_0085108 | Ga0373926_0085108_10_531 | 171 |
| 314 | 3300035116 | Ga0373945_0005840 | Ga0373945_0005840_1953_2474 | 171 |
| 315 | 3300035117 | Ga0373953_0271537 | Ga0373953_0271537_14_535 | 171 |
| 316 | 3300035120 | Ga0373957_0448071 | Ga0373957_0448071_12_533 | 171 |
| 317 | 3300046454 | Ga0495592_0062050 | Ga0495592_0062050_1503_2024 | 171 |
| 318 | 3300046461 | Ga0495641_0046108 | Ga0495641_0046108_246_767 | 171 |
| 319 | 3300046463 | Ga0495653_0178895 | Ga0495653_0178895_267_788 | 171 |
| 320 | 3300046472 | Ga0495580_0229540 | Ga0495580_0229540_63_584 | 171 |
| 321 | 3300046526 | Ga0495666_0035084 | Ga0495666_0035084_538_1059 | 171 |
| 322 | 3300046531 | Ga0495665_0029323 | Ga0495665_0029323_1340_1861 | 171 |
| 323 | 3300046559 | Ga0495667_0143989 | Ga0495667_0143989_286_807 | 171 |
| 324 | 3300046663 | Ga0495635_0054615 | Ga0495635_0054615_995_1516 | 171 |
| 325 | 3300046674 | Ga0495588_0250534 | Ga0495588_0250534_352_873 | 171 |
| 326 | 3300046680 | Ga0495646_0044147 | Ga0495646_0044147_341_862 | 171 |
| 327 | 3300046689 | Ga0495613_0113891 | Ga0495613_0113891_876_1397 | 171 |
| 328 | 3300047317 | Ga0495604_0259145 | Ga0495604_0259145_115_636 | 171 |
| 329 | 3300048088 | Ga0495602_0053659 | Ga0495602_0053659_1412_1933 | 171 |
| 330 | 3300048907 | Ga0496104_0003348 | Ga0496104_0003348_8526_9047 | 171 |
| 331 | 3300048911 | Ga0496108_0003022 | Ga0496108_0003022_8891_9412 | 171 |
| 332 | 3300050514 | nmdc:mga08x19_520385_c1 | nmdc:mga08x19_520385_c1_14_535 | 171 |
| 333 | 3300053077 | Ga0495601_0047827 | Ga0495601_0047827_2158_2679 | 171 |
| 334 | 3300060346 | Ga0587111_0122827 | Ga0587111_0122827_58_579 | 171 |
| 335 | 3300003659 | JGI25404J52841_10000079 | JGI25404J52841_100000797 | 172 |
| 336 | 3300004803 | Ga0058862_12117740 | Ga0058862_121177402 | 172 |
| 337 | 3300005327 | Ga0070658_10158050 | Ga0070658_101580502 | 172 |
| 338 | 3300005328 | Ga0070676_10355974 | Ga0070676_103559741 | 172 |
| 339 | 3300005329 | Ga0070683_100007853 | Ga0070683_1000078532 | 172 |
| 340 | 3300005330 | Ga0070690_100036403 | Ga0070690_1000364032 | 172 |
| 341 | 3300005331 | Ga0070670_100097446 | Ga0070670_1000974463 | 172 |
| 342 | 3300005334 | Ga0068869_100126332 | Ga0068869_1001263323 | 172 |
| 343 | 3300005335 | Ga0070666_10025853 | Ga0070666_100258533 | 172 |
| 344 | 3300005336 | Ga0070680_100017429 | Ga0070680_1000174295 | 172 |
| 345 | 3300005337 | Ga0070682_100059017 | Ga0070682_1000590172 | 172 |
| 346 | 3300005337 | Ga0070682_100214898 | Ga0070682_1002148981 | 172 |
| 347 | 3300005337 | Ga0070682_100398972 | Ga0070682_1003989722 | 172 |
| 348 | 3300005339 | Ga0070660_100241205 | Ga0070660_1002412052 | 172 |
| 349 | 3300005340 | Ga0070689_100021701 | Ga0070689_1000217013 | 172 |
| 350 | 3300005341 | Ga0070691_10019206 | Ga0070691_100192063 | 172 |
| 351 | 3300005344 | Ga0070661_100013534 | Ga0070661_1000135343 | 172 |
| 352 | 3300005345 | Ga0070692_10005873 | Ga0070692_100058735 | 172 |
| 353 | 3300005353 | Ga0070669_100087974 | Ga0070669_1000879742 | 172 |
| 354 | 3300005354 | Ga0070675_100049160 | Ga0070675_1000491602 | 172 |
| 355 | 3300005355 | Ga0070671_100115898 | Ga0070671_1001158982 | 172 |
| 356 | 3300005364 | Ga0070673_100065880 | Ga0070673_1000658802 | 172 |
| 357 | 3300005365 | Ga0070688_100268818 | Ga0070688_1002688182 | 172 |
| 358 | 3300005367 | Ga0070667_100045133 | Ga0070667_1000451332 | 172 |
| 359 | 3300005434 | Ga0070709_10000898 | Ga0070709_1000089814 | 172 |
| 360 | 3300005434 | Ga0070709_10396537 | Ga0070709_103965372 | 172 |
| 361 | 3300005435 | Ga0070714_100009138 | Ga0070714_1000091387 | 172 |
| 362 | 3300005435 | Ga0070714_100128815 | Ga0070714_1001288152 | 172 |
| 363 | 3300005435 | Ga0070714_100298801 | Ga0070714_1002988012 | 172 |
| 364 | 3300005436 | Ga0070713_100005320 | Ga0070713_1000053207 | 172 |
| 365 | 3300005436 | Ga0070713_100034459 | Ga0070713_1000344591 | 172 |
| 366 | 3300005436 | Ga0070713_100097223 | Ga0070713_1000972233 | 172 |
| 367 | 3300005436 | Ga0070713_100188275 | Ga0070713_1001882752 | 172 |
| 368 | 3300005436 | Ga0070713_100600576 | Ga0070713_1006005761 | 172 |
| 369 | 3300005437 | Ga0070710_10000649 | Ga0070710_1000064912 | 172 |
| 370 | 3300005437 | Ga0070710_10004332 | Ga0070710_100043327 | 172 |
| 371 | 3300005439 | Ga0070711_100001246 | Ga0070711_1000012467 | 172 |
| 372 | 3300005439 | Ga0070711_100008207 | Ga0070711_1000082072 | 172 |
| 373 | 3300005439 | Ga0070711_100107809 | Ga0070711_1001078092 | 172 |
| 374 | 3300005440 | Ga0070705_100004180 | Ga0070705_1000041803 | 172 |
| 375 | 3300005440 | Ga0070705_100085564 | Ga0070705_1000855642 | 172 |
| 376 | 3300005444 | Ga0070694_100051839 | Ga0070694_1000518394 | 172 |
| 377 | 3300005445 | Ga0070708_100013905 | Ga0070708_1000139053 | 172 |
| 378 | 3300005445 | Ga0070708_100023693 | Ga0070708_1000236935 | 172 |
| 379 | 3300005445 | Ga0070708_100026442 | Ga0070708_1000264421 | 172 |
| 380 | 3300005455 | Ga0070663_100001262 | Ga0070663_10000126212 | 172 |
| 381 | 3300005456 | Ga0070678_100010703 | Ga0070678_1000107034 | 172 |
| 382 | 3300005457 | Ga0070662_100205993 | Ga0070662_1002059932 | 172 |
| 383 | 3300005458 | Ga0070681_10145848 | Ga0070681_101458482 | 172 |
| 384 | 3300005458 | Ga0070681_10484628 | Ga0070681_104846281 | 172 |
| 385 | 3300005459 | Ga0068867_100163342 | Ga0068867_1001633422 | 172 |
| 386 | 3300005467 | Ga0070706_100034040 | Ga0070706_1000340404 | 172 |
| 387 | 3300005467 | Ga0070706_100037181 | Ga0070706_1000371812 | 172 |
| 388 | 3300005468 | Ga0070707_100055256 | Ga0070707_1000552563 | 172 |
| 389 | 3300005468 | Ga0070707_100103302 | Ga0070707_1001033022 | 172 |
| 390 | 3300005468 | Ga0070707_100120487 | Ga0070707_1001204873 | 172 |
| 391 | 3300005468 | Ga0070707_100136661 | Ga0070707_1001366611 | 172 |
| 392 | 3300005471 | Ga0070698_100116886 | Ga0070698_1001168861 | 172 |
| 393 | 3300005471 | Ga0070698_100134045 | Ga0070698_1001340452 | 172 |
| 394 | 3300005471 | Ga0070698_100168932 | Ga0070698_1001689322 | 172 |
| 395 | 3300005518 | Ga0070699_100011386 | Ga0070699_1000113861 | 172 |
| 396 | 3300005518 | Ga0070699_100052118 | Ga0070699_1000521184 | 172 |
| 397 | 3300005518 | Ga0070699_100630020 | Ga0070699_1006300201 | 172 |
| 398 | 3300005530 | Ga0070679_100036814 | Ga0070679_1000368144 | 172 |
| 399 | 3300005530 | Ga0070679_101010839 | Ga0070679_1010108391 | 172 |
| 400 | 3300005535 | Ga0070684_100021226 | Ga0070684_1000212266 | 172 |
| 401 | 3300005535 | Ga0070684_100268122 | Ga0070684_1002681222 | 172 |
| 402 | 3300005536 | Ga0070697_100007671 | Ga0070697_1000076716 | 172 |
| 403 | 3300005536 | Ga0070697_100342605 | Ga0070697_1003426052 | 172 |
| 404 | 3300005539 | Ga0068853_100097088 | Ga0068853_1000970883 | 172 |
| 405 | 3300005544 | Ga0070686_100026093 | Ga0070686_1000260932 | 172 |
| 406 | 3300005545 | Ga0070695_100153135 | Ga0070695_1001531352 | 172 |
| 407 | 3300005545 | Ga0070695_100219796 | Ga0070695_1002197961 | 172 |
| 408 | 3300005546 | Ga0070696_100054045 | Ga0070696_1000540452 | 172 |
| 409 | 3300005546 | Ga0070696_100734978 | Ga0070696_1007349782 | 172 |
| 410 | 3300005547 | Ga0070693_100140675 | Ga0070693_1001406751 | 172 |
| 411 | 3300005547 | Ga0070693_100162490 | Ga0070693_1001624902 | 172 |
| 412 | 3300005548 | Ga0070665_100701056 | Ga0070665_1007010562 | 172 |
| 413 | 3300005549 | Ga0070704_100122701 | Ga0070704_1001227011 | 172 |
| 414 | 3300005549 | Ga0070704_101244716 | Ga0070704_1012447161 | 172 |
| 415 | 3300005564 | Ga0070664_100006864 | Ga0070664_1000068645 | 172 |
| 416 | 3300005577 | Ga0068857_100036849 | Ga0068857_1000368494 | 172 |
| 417 | 3300005578 | Ga0068854_100046397 | Ga0068854_1000463974 | 172 |
| 418 | 3300005614 | Ga0068856_100011336 | Ga0068856_1000113365 | 172 |
| 419 | 3300005614 | Ga0068856_100696391 | Ga0068856_1006963912 | 172 |
| 420 | 3300005614 | Ga0068856_100900716 | Ga0068856_1009007161 | 172 |
| 421 | 3300005616 | Ga0068852_100013437 | Ga0068852_1000134374 | 172 |
| 422 | 3300005616 | Ga0068852_101279622 | Ga0068852_1012796221 | 172 |
| 423 | 3300005617 | Ga0068859_100048443 | Ga0068859_1000484434 | 172 |
| 424 | 3300005718 | Ga0068866_10341972 | Ga0068866_103419722 | 172 |
| 425 | 3300005719 | Ga0068861_100023428 | Ga0068861_1000234284 | 172 |
| 426 | 3300005834 | Ga0068851_10015521 | Ga0068851_100155213 | 172 |
| 427 | 3300005840 | Ga0068870_10048833 | Ga0068870_100488332 | 172 |
| 428 | 3300005841 | Ga0068863_100492248 | Ga0068863_1004922482 | 172 |
| 429 | 3300005843 | Ga0068860_100045353 | Ga0068860_1000453534 | 172 |
| 430 | 3300005844 | Ga0068862_100056197 | Ga0068862_1000561973 | 172 |
| 431 | 3300005937 | Ga0081455_10088019 | Ga0081455_100880192 | 172 |
| 432 | 3300005983 | Ga0081540_1001110 | Ga0081540_100111022 | 172 |
| 433 | 3300005983 | Ga0081540_1002815 | Ga0081540_10028156 | 172 |
| 434 | 3300006028 | Ga0070717_10011855 | Ga0070717_100118553 | 172 |
| 435 | 3300006028 | Ga0070717_10022914 | Ga0070717_100229143 | 172 |
| 436 | 3300006028 | Ga0070717_10032455 | Ga0070717_100324555 | 172 |
| 437 | 3300006028 | Ga0070717_10132918 | Ga0070717_101329183 | 172 |
| 438 | 3300006028 | Ga0070717_10449154 | Ga0070717_104491542 | 172 |
| 439 | 3300006028 | Ga0070717_10684575 | Ga0070717_106845752 | 172 |
| 440 | 3300006028 | Ga0070717_11284228 | Ga0070717_112842281 | 172 |
| 441 | 3300006163 | Ga0070715_10001376 | Ga0070715_100013764 | 172 |
| 442 | 3300006163 | Ga0070715_10077725 | Ga0070715_100777252 | 172 |
| 443 | 3300006163 | Ga0070715_10107307 | Ga0070715_101073072 | 172 |
| 444 | 3300006163 | Ga0070715_10186241 | Ga0070715_101862412 | 172 |
| 445 | 3300006173 | Ga0070716_100003048 | Ga0070716_1000030484 | 172 |
| 446 | 3300006173 | Ga0070716_100005468 | Ga0070716_1000054682 | 172 |
| 447 | 3300006173 | Ga0070716_100148756 | Ga0070716_1001487562 | 172 |
| 448 | 3300006173 | Ga0070716_100340044 | Ga0070716_1003400442 | 172 |
| 449 | 3300006175 | Ga0070712_100007818 | Ga0070712_1000078183 | 172 |
| 450 | 3300006175 | Ga0070712_100201313 | Ga0070712_1002013132 | 172 |
| 451 | 3300006175 | Ga0070712_100204974 | Ga0070712_1002049742 | 172 |
| 452 | 3300006175 | Ga0070712_100409598 | Ga0070712_1004095982 | 172 |
| 453 | 3300006175 | Ga0070712_100841834 | Ga0070712_1008418342 | 172 |
| 454 | 3300006237 | Ga0097621_100194789 | Ga0097621_1001947892 | 172 |
| 455 | 3300006237 | Ga0097621_100808083 | Ga0097621_1008080832 | 172 |
| 456 | 3300006358 | Ga0068871_100935193 | Ga0068871_1009351932 | 172 |
| 457 | 3300006844 | Ga0075428_100326426 | Ga0075428_1003264262 | 172 |
| 458 | 3300006852 | Ga0075433_10006430 | Ga0075433_100064307 | 172 |
| 459 | 3300006852 | Ga0075433_10086522 | Ga0075433_100865222 | 172 |
| 460 | 3300006871 | Ga0075434_100010403 | Ga0075434_1000104034 | 172 |
| 461 | 3300006871 | Ga0075434_100181401 | Ga0075434_1001814012 | 172 |
| 462 | 3300006871 | Ga0075434_100185211 | Ga0075434_1001852112 | 172 |
| 463 | 3300006871 | Ga0075434_101111147 | Ga0075434_1011111472 | 172 |
| 464 | 3300006881 | Ga0068865_100158561 | Ga0068865_1001585612 | 172 |
| 465 | 3300006914 | Ga0075436_100059844 | Ga0075436_1000598442 | 172 |
| 466 | 3300006914 | Ga0075436_100087709 | Ga0075436_1000877093 | 172 |
| 467 | 3300006931 | Ga0097620_100048443 | Ga0097620_1000484434 | 172 |
| 468 | 3300007076 | Ga0075435_100015650 | Ga0075435_1000156504 | 172 |
| 469 | 3300007076 | Ga0075435_100062813 | Ga0075435_1000628132 | 172 |
| 470 | 3300007076 | Ga0075435_100147365 | Ga0075435_1001473652 | 172 |
| 471 | 3300009011 | Ga0105251_10017383 | Ga0105251_100173833 | 172 |
| 472 | 3300009093 | Ga0105240_10164587 | Ga0105240_101645871 | 172 |
| 473 | 3300009094 | Ga0111539_10088325 | Ga0111539_100883252 | 172 |
| 474 | 3300009098 | Ga0105245_10100888 | Ga0105245_101008882 | 172 |
| 475 | 3300009101 | Ga0105247_10037739 | Ga0105247_100377392 | 172 |
| 476 | 3300009101 | Ga0105247_10604507 | Ga0105247_106045072 | 172 |
| 477 | 3300009147 | Ga0114129_10007274 | Ga0114129_100072749 | 172 |
| 478 | 3300009147 | Ga0114129_11591694 | Ga0114129_115916942 | 172 |
| 479 | 3300009148 | Ga0105243_10045901 | Ga0105243_100459013 | 172 |
| 480 | 3300009174 | Ga0105241_10443340 | Ga0105241_104433401 | 172 |
| 481 | 3300009174 | Ga0105241_10690029 | Ga0105241_106900292 | 172 |
| 482 | 3300009176 | Ga0105242_10260774 | Ga0105242_102607742 | 172 |
| 483 | 3300009177 | Ga0105248_10090347 | Ga0105248_100903474 | 172 |
| 484 | 3300009545 | Ga0105237_10197260 | Ga0105237_101972602 | 172 |
| 485 | 3300009545 | Ga0105237_10481942 | Ga0105237_104819421 | 172 |
| 486 | 3300009545 | Ga0105237_10607368 | Ga0105237_106073681 | 172 |
| 487 | 3300009553 | Ga0105249_10019483 | Ga0105249_100194833 | 172 |
| 488 | 3300010159 | Ga0099796_10047442 | Ga0099796_100474422 | 172 |
| 489 | 3300010375 | Ga0105239_11205846 | Ga0105239_112058462 | 172 |
| 490 | 3300011119 | Ga0105246_10014986 | Ga0105246_100149861 | 172 |
| 491 | 3300012497 | Ga0157319_1009886 | Ga0157319_10098862 | 172 |
| 492 | 3300012507 | Ga0157342_1000357 | Ga0157342_10003572 | 172 |
| 493 | 3300012507 | Ga0157342_1017220 | Ga0157342_10172201 | 172 |
| 494 | 3300013100 | Ga0157373_10007594 | Ga0157373_100075945 | 172 |
| 495 | 3300013100 | Ga0157373_10606835 | Ga0157373_106068351 | 172 |
| 496 | 3300013102 | Ga0157371_10138477 | Ga0157371_101384772 | 172 |
| 497 | 3300013105 | Ga0157369_10853882 | Ga0157369_108538821 | 172 |
| 498 | 3300013105 | Ga0157369_10858699 | Ga0157369_108586992 | 172 |
| 499 | 3300013105 | Ga0157369_11419298 | Ga0157369_114192981 | 172 |
| 500 | 3300013296 | Ga0157374_10238950 | Ga0157374_102389502 | 172 |
| 501 | 3300013297 | Ga0157378_10149261 | Ga0157378_101492611 | 172 |
| 502 | 3300013297 | Ga0157378_10963931 | Ga0157378_109639311 | 172 |
| 503 | 3300013306 | Ga0163162_10242507 | Ga0163162_102425072 | 172 |
| 504 | 3300013307 | Ga0157372_10342228 | Ga0157372_103422281 | 172 |
| 505 | 3300013307 | Ga0157372_11395631 | Ga0157372_113956312 | 172 |
| 506 | 3300013307 | Ga0157372_11859312 | Ga0157372_118593121 | 172 |
| 507 | 3300013308 | Ga0157375_10257876 | Ga0157375_102578762 | 172 |
| 508 | 3300014325 | Ga0163163_10141014 | Ga0163163_101410142 | 172 |
| 509 | 3300014325 | Ga0163163_10546335 | Ga0163163_105463352 | 172 |
| 510 | 3300014326 | Ga0157380_10116313 | Ga0157380_101163133 | 172 |
| 511 | 3300014745 | Ga0157377_10018876 | Ga0157377_100188764 | 172 |
| 512 | 3300014968 | Ga0157379_10539556 | Ga0157379_105395562 | 172 |
| 513 | 3300014969 | Ga0157376_10076153 | Ga0157376_100761533 | 172 |
| 514 | 3300017792 | Ga0163161_10021461 | Ga0163161_100214614 | 172 |
| 515 | 3300020070 | Ga0206356_11554725 | Ga0206356_115547253 | 172 |
| 516 | 3300021388 | Ga0213875_10001833 | Ga0213875_100018333 | 172 |
| 517 | 3300021388 | Ga0213875_10020598 | Ga0213875_100205982 | 172 |
| 518 | 3300022467 | Ga0224712_10017697 | Ga0224712_100176971 | 172 |
| 519 | 3300022467 | Ga0224712_10097660 | Ga0224712_100976602 | 172 |
| 520 | 3300024225 | Ga0224572_1000045 | Ga0224572_10000453 | 172 |
| 521 | 3300024227 | Ga0228598_1033823 | Ga0228598_10338231 | 172 |
| 522 | 3300025898 | Ga0207692_10027121 | Ga0207692_100271212 | 172 |
| 523 | 3300025898 | Ga0207692_10112100 | Ga0207692_101121001 | 172 |
| 524 | 3300025898 | Ga0207692_10284694 | Ga0207692_102846941 | 172 |
| 525 | 3300025899 | Ga0207642_10062716 | Ga0207642_100627162 | 172 |
| 526 | 3300025901 | Ga0207688_10004338 | Ga0207688_100043386 | 172 |
| 527 | 3300025904 | Ga0207647_10014384 | Ga0207647_100143845 | 172 |
| 528 | 3300025905 | Ga0207685_10014244 | Ga0207685_100142442 | 172 |
| 529 | 3300025905 | Ga0207685_10033747 | Ga0207685_100337472 | 172 |
| 530 | 3300025905 | Ga0207685_10066486 | Ga0207685_100664862 | 172 |
| 531 | 3300025905 | Ga0207685_10108183 | Ga0207685_101081832 | 172 |
| 532 | 3300025905 | Ga0207685_10162507 | Ga0207685_101625072 | 172 |
| 533 | 3300025906 | Ga0207699_10000902 | Ga0207699_1000090212 | 172 |
| 534 | 3300025906 | Ga0207699_10010790 | Ga0207699_100107902 | 172 |
| 535 | 3300025906 | Ga0207699_10013718 | Ga0207699_100137182 | 172 |
| 536 | 3300025906 | Ga0207699_10025050 | Ga0207699_100250503 | 172 |
| 537 | 3300025906 | Ga0207699_10322950 | Ga0207699_103229502 | 172 |
| 538 | 3300025907 | Ga0207645_10269087 | Ga0207645_102690872 | 172 |
| 539 | 3300025908 | Ga0207643_10034728 | Ga0207643_100347282 | 172 |
| 540 | 3300025909 | Ga0207705_10033404 | Ga0207705_100334044 | 172 |
| 541 | 3300025910 | Ga0207684_10001101 | Ga0207684_100011017 | 172 |
| 542 | 3300025910 | Ga0207684_10009747 | Ga0207684_100097472 | 172 |
| 543 | 3300025910 | Ga0207684_10047286 | Ga0207684_100472863 | 172 |
| 544 | 3300025910 | Ga0207684_10061734 | Ga0207684_100617341 | 172 |
| 545 | 3300025910 | Ga0207684_10236433 | Ga0207684_102364332 | 172 |
| 546 | 3300025910 | Ga0207684_10285314 | Ga0207684_102853141 | 172 |
| 547 | 3300025910 | Ga0207684_10726939 | Ga0207684_107269392 | 172 |
| 548 | 3300025912 | Ga0207707_10145737 | Ga0207707_101457372 | 172 |
| 549 | 3300025913 | Ga0207695_10419786 | Ga0207695_104197862 | 172 |
| 550 | 3300025914 | Ga0207671_10104756 | Ga0207671_101047563 | 172 |
| 551 | 3300025915 | Ga0207693_10004702 | Ga0207693_100047025 | 172 |
| 552 | 3300025915 | Ga0207693_10006820 | Ga0207693_100068205 | 172 |
| 553 | 3300025915 | Ga0207693_10029965 | Ga0207693_100299652 | 172 |
| 554 | 3300025915 | Ga0207693_10114809 | Ga0207693_101148092 | 172 |
| 555 | 3300025916 | Ga0207663_10001184 | Ga0207663_100011844 | 172 |
| 556 | 3300025916 | Ga0207663_10048742 | Ga0207663_100487423 | 172 |
| 557 | 3300025916 | Ga0207663_10063205 | Ga0207663_100632052 | 172 |
| 558 | 3300025916 | Ga0207663_10350583 | Ga0207663_103505832 | 172 |
| 559 | 3300025917 | Ga0207660_10187749 | Ga0207660_101877492 | 172 |
| 560 | 3300025918 | Ga0207662_10002153 | Ga0207662_100021538 | 172 |
| 561 | 3300025919 | Ga0207657_10006511 | Ga0207657_100065119 | 172 |
| 562 | 3300025920 | Ga0207649_10215709 | Ga0207649_102157092 | 172 |
| 563 | 3300025922 | Ga0207646_10005472 | Ga0207646_100054722 | 172 |
| 564 | 3300025922 | Ga0207646_10014190 | Ga0207646_100141906 | 172 |
| 565 | 3300025922 | Ga0207646_10103407 | Ga0207646_101034072 | 172 |
| 566 | 3300025922 | Ga0207646_10428883 | Ga0207646_104288831 | 172 |
| 567 | 3300025924 | Ga0207694_10238407 | Ga0207694_102384072 | 172 |
| 568 | 3300025925 | Ga0207650_10168691 | Ga0207650_101686912 | 172 |
| 569 | 3300025926 | Ga0207659_10116968 | Ga0207659_101169683 | 172 |
| 570 | 3300025926 | Ga0207659_10758132 | Ga0207659_107581322 | 172 |
| 571 | 3300025927 | Ga0207687_10183670 | Ga0207687_101836702 | 172 |
| 572 | 3300025928 | Ga0207700_10000414 | Ga0207700_1000041424 | 172 |
| 573 | 3300025928 | Ga0207700_10001073 | Ga0207700_1000107314 | 172 |
| 574 | 3300025928 | Ga0207700_10031567 | Ga0207700_100315672 | 172 |
| 575 | 3300025928 | Ga0207700_10052750 | Ga0207700_100527502 | 172 |
| 576 | 3300025928 | Ga0207700_10069517 | Ga0207700_100695171 | 172 |
| 577 | 3300025928 | Ga0207700_10304829 | Ga0207700_103048292 | 172 |
| 578 | 3300025928 | Ga0207700_11431221 | Ga0207700_114312211 | 172 |
| 579 | 3300025929 | Ga0207664_10000678 | Ga0207664_1000067812 | 172 |
| 580 | 3300025929 | Ga0207664_10004822 | Ga0207664_100048227 | 172 |
| 581 | 3300025929 | Ga0207664_10020088 | Ga0207664_100200886 | 172 |
| 582 | 3300025929 | Ga0207664_10025989 | Ga0207664_100259892 | 172 |
| 583 | 3300025929 | Ga0207664_10026465 | Ga0207664_100264652 | 172 |
| 584 | 3300025929 | Ga0207664_10053030 | Ga0207664_100530302 | 172 |
| 585 | 3300025929 | Ga0207664_10098918 | Ga0207664_100989182 | 172 |
| 586 | 3300025929 | Ga0207664_10107248 | Ga0207664_101072483 | 172 |
| 587 | 3300025929 | Ga0207664_10110634 | Ga0207664_101106343 | 172 |
| 588 | 3300025929 | Ga0207664_10263166 | Ga0207664_102631662 | 172 |
| 589 | 3300025929 | Ga0207664_10351648 | Ga0207664_103516482 | 172 |
| 590 | 3300025932 | Ga0207690_10153596 | Ga0207690_101535962 | 172 |
| 591 | 3300025933 | Ga0207706_10210132 | Ga0207706_102101322 | 172 |
| 592 | 3300025934 | Ga0207686_10034626 | Ga0207686_100346262 | 172 |
| 593 | 3300025935 | Ga0207709_10029554 | Ga0207709_100295542 | 172 |
| 594 | 3300025936 | Ga0207670_10047244 | Ga0207670_100472442 | 172 |
| 595 | 3300025939 | Ga0207665_10001619 | Ga0207665_1000161911 | 172 |
| 596 | 3300025939 | Ga0207665_10001749 | Ga0207665_1000174910 | 172 |
| 597 | 3300025939 | Ga0207665_10001957 | Ga0207665_1000195714 | 172 |
| 598 | 3300025939 | Ga0207665_10008150 | Ga0207665_100081503 | 172 |
| 599 | 3300025939 | Ga0207665_10076791 | Ga0207665_100767912 | 172 |
| 600 | 3300025939 | Ga0207665_10091180 | Ga0207665_100911802 | 172 |
| 601 | 3300025941 | Ga0207711_10334743 | Ga0207711_103347432 | 172 |
| 602 | 3300025942 | Ga0207689_10001908 | Ga0207689_1000190817 | 172 |
| 603 | 3300025944 | Ga0207661_10094743 | Ga0207661_100947432 | 172 |
| 604 | 3300025944 | Ga0207661_10482381 | Ga0207661_104823812 | 172 |
| 605 | 3300025945 | Ga0207679_10065914 | Ga0207679_100659143 | 172 |
| 606 | 3300025945 | Ga0207679_10619395 | Ga0207679_106193952 | 172 |
| 607 | 3300025949 | Ga0207667_10110508 | Ga0207667_101105083 | 172 |
| 608 | 3300025960 | Ga0207651_10433555 | Ga0207651_104335552 | 172 |
| 609 | 3300025981 | Ga0207640_10296443 | Ga0207640_102964432 | 172 |
| 610 | 3300025986 | Ga0207658_10054810 | Ga0207658_100548102 | 172 |
| 611 | 3300026041 | Ga0207639_10166876 | Ga0207639_101668763 | 172 |
| 612 | 3300026067 | Ga0207678_10002509 | Ga0207678_1000250911 | 172 |
| 613 | 3300026075 | Ga0207708_10028936 | Ga0207708_100289364 | 172 |
| 614 | 3300026078 | Ga0207702_10018650 | Ga0207702_100186502 | 172 |
| 615 | 3300026088 | Ga0207641_10564040 | Ga0207641_105640402 | 172 |
| 616 | 3300026089 | Ga0207648_10066245 | Ga0207648_100662453 | 172 |
| 617 | 3300026095 | Ga0207676_10087847 | Ga0207676_100878473 | 172 |
| 618 | 3300026116 | Ga0207674_10003114 | Ga0207674_1000311418 | 172 |
| 619 | 3300026118 | Ga0207675_100003405 | Ga0207675_1000034053 | 172 |
| 620 | 3300026121 | Ga0207683_10001732 | Ga0207683_1000173212 | 172 |
| 621 | 3300026121 | Ga0207683_10049142 | Ga0207683_100491421 | 172 |
| 622 | 3300026142 | Ga0207698_10390234 | Ga0207698_103902342 | 172 |
| 623 | 3300027671 | Ga0209588_1213537 | Ga0209588_12135371 | 172 |
| 624 | 3300028380 | Ga0268265_10429920 | Ga0268265_104299202 | 172 |
| 625 | 3300028666 | Ga0265336_10014829 | Ga0265336_100148293 | 172 |
| 626 | 3300028800 | Ga0265338_10001840 | Ga0265338_100018407 | 172 |
| 627 | 3300034816 | Ga0373930_0022589 | Ga0373930_0022589_551_1069 | 172 |
| 628 | 3300034817 | Ga0373948_0012442 | Ga0373948_0012442_983_1501 | 172 |
| 629 | 3300034819 | Ga0373958_0010609 | Ga0373958_0010609_493_1011 | 172 |
| 630 | 3300034957 | Ga0373938_0014755 | Ga0373938_0014755_25_555 | 172 |
| 631 | 3300035083 | Ga0373926_0003143 | Ga0373926_0003143_3215_3733 | 172 |
| 632 | 3300035083 | Ga0373926_0067459 | Ga0373926_0067459_769_1287 | 172 |
| 633 | 3300035084 | Ga0373928_0012133 | Ga0373928_0012133_468_986 | 172 |
| 634 | 3300035085 | Ga0373929_0023731 | Ga0373929_0023731_646_1191 | 172 |
| 635 | 3300035085 | Ga0373929_0063218 | Ga0373929_0063218_201_719 | 172 |
| 636 | 3300035086 | Ga0373934_0008531 | Ga0373934_0008531_2661_3179 | 172 |
| 637 | 3300035086 | Ga0373934_0110315 | Ga0373934_0110315_390_908 | 172 |
| 638 | 3300035086 | Ga0373934_0143888 | Ga0373934_0143888_48_566 | 172 |
| 639 | 3300035088 | Ga0373940_0006439 | Ga0373940_0006439_808_1326 | 172 |
| 640 | 3300035088 | Ga0373940_0054979 | Ga0373940_0054979_557_1102 | 172 |
| 641 | 3300035089 | Ga0373944_0000424 | Ga0373944_0000424_3840_4358 | 172 |
| 642 | 3300035089 | Ga0373944_0010456 | Ga0373944_0010456_114_632 | 172 |
| 643 | 3300035091 | Ga0373951_0105280 | Ga0373951_0105280_114_632 | 172 |
| 644 | 3300035092 | Ga0373952_0003468 | Ga0373952_0003468_872_1402 | 172 |
| 645 | 3300035111 | Ga0373923_0004966 | Ga0373923_0004966_2290_2808 | 172 |
| 646 | 3300035111 | Ga0373923_0015962 | Ga0373923_0015962_352_870 | 172 |
| 647 | 3300035111 | Ga0373923_0028048 | Ga0373923_0028048_908_1426 | 172 |
| 648 | 3300035111 | Ga0373923_0075480 | Ga0373923_0075480_226_744 | 172 |
| 649 | 3300035111 | Ga0373923_0126538 | Ga0373923_0126538_65_583 | 172 |
| 650 | 3300035112 | Ga0373932_0009086 | Ga0373932_0009086_986_1504 | 172 |
| 651 | 3300035113 | Ga0373936_0000169 | Ga0373936_0000169_14929_15447 | 172 |
| 652 | 3300035113 | Ga0373936_0004876 | Ga0373936_0004876_3844_4362 | 172 |
| 653 | 3300035113 | Ga0373936_0079737 | Ga0373936_0079737_801_1319 | 172 |
| 654 | 3300035114 | Ga0373939_0030493 | Ga0373939_0030493_316_846 | 172 |
| 655 | 3300035115 | Ga0373941_0054135 | Ga0373941_0054135_362_880 | 172 |
| 656 | 3300035116 | Ga0373945_0000510 | Ga0373945_0000510_8710_9228 | 172 |
| 657 | 3300035116 | Ga0373945_0016220 | Ga0373945_0016220_1291_1809 | 172 |
| 658 | 3300035116 | Ga0373945_0031182 | Ga0373945_0031182_1135_1653 | 172 |
| 659 | 3300035117 | Ga0373953_0038149 | Ga0373953_0038149_613_1131 | 172 |
| 660 | 3300035117 | Ga0373953_0063896 | Ga0373953_0063896_708_1226 | 172 |
| 661 | 3300035117 | Ga0373953_0101951 | Ga0373953_0101951_369_887 | 172 |
| 662 | 3300035118 | Ga0373954_0074046 | Ga0373954_0074046_106_624 | 172 |
| 663 | 3300035118 | Ga0373954_0099461 | Ga0373954_0099461_52_570 | 172 |
| 664 | 3300035119 | Ga0373956_0002560 | Ga0373956_0002560_6062_6580 | 172 |
| 665 | 3300035119 | Ga0373956_0031045 | Ga0373956_0031045_1351_1869 | 172 |
| 666 | 3300035120 | Ga0373957_0015871 | Ga0373957_0015871_698_1216 | 172 |
| 667 | 3300035120 | Ga0373957_0055526 | Ga0373957_0055526_707_1225 | 172 |
| 668 | 3300035121 | Ga0373960_0023596 | Ga0373960_0023596_430_960 | 172 |
| 669 | 3300035170 | Ga0373943_0001153 | Ga0373943_0001153_8875_9393 | 172 |
| 670 | 3300035170 | Ga0373943_0014124 | Ga0373943_0014124_2170_2688 | 172 |
| 671 | 3300035170 | Ga0373943_0117413 | Ga0373943_0117413_701_1219 | 172 |
| 672 | 3300035170 | Ga0373943_0239269 | Ga0373943_0239269_195_713 | 172 |
| 673 | 3300035170 | Ga0373943_0399531 | Ga0373943_0399531_206_724 | 172 |
| 674 | 3300035170 | Ga0373943_0521346 | Ga0373943_0521346_69_587 | 172 |
| 675 | 3300035171 | Ga0373946_0000662 | Ga0373946_0000662_4848_5366 | 172 |
| 676 | 3300035171 | Ga0373946_0012809 | Ga0373946_0012809_2438_2956 | 172 |
| 677 | 3300035171 | Ga0373946_0016314 | Ga0373946_0016314_356_874 | 172 |
| 678 | 3300035171 | Ga0373946_0049738 | Ga0373946_0049738_666_1184 | 172 |
| 679 | 3300035172 | Ga0373955_0008188 | Ga0373955_0008188_4007_4525 | 172 |
| 680 | 3300035172 | Ga0373955_0039673 | Ga0373955_0039673_710_1228 | 172 |
| 681 | 3300035207 | Ga0373942_0168645 | Ga0373942_0168645_90_608 | 172 |
| 682 | 3300035241 | Ga0373961_0046653 | Ga0373961_0046653_404_934 | 172 |
| 683 | 3300035241 | Ga0373961_0052308 | Ga0373961_0052308_164_682 | 172 |
| 684 | 3300035242 | Ga0373962_0006182 | Ga0373962_0006182_458_988 | 172 |
| 685 | 3300035242 | Ga0373962_0092929 | Ga0373962_0092929_14_532 | 172 |
| 686 | 3300035410 | Ga0373924_0004123 | Ga0373924_0004123_1500_2018 | 172 |
| 687 | 3300035410 | Ga0373924_0133753 | Ga0373924_0133753_307_825 | 172 |
| 688 | 3300035410 | Ga0373924_0220861 | Ga0373924_0220861_131_649 | 172 |
| 689 | 3300035691 | Ga0373931_0028101 | Ga0373931_0028101_781_1311 | 172 |
| 690 | 3300035691 | Ga0373931_0123127 | Ga0373931_0123127_712_1230 | 172 |
| 691 | 3300035692 | Ga0373935_0003437 | Ga0373935_0003437_2506_3024 | 172 |
| 692 | 3300035692 | Ga0373935_0003809 | Ga0373935_0003809_7568_8086 | 172 |
| 693 | 3300035692 | Ga0373935_0092064 | Ga0373935_0092064_1201_1719 | 172 |
| 694 | 3300035692 | Ga0373935_0159058 | Ga0373935_0159058_358_876 | 172 |
| 695 | 3300035692 | Ga0373935_0196307 | Ga0373935_0196307_255_773 | 172 |
| 696 | 3300035695 | Ga0373927_0007125 | Ga0373927_0007125_3821_4339 | 172 |
| 697 | 3300035695 | Ga0373927_0025699 | Ga0373927_0025699_1304_1822 | 172 |
| 698 | 3300035695 | Ga0373927_0120942 | Ga0373927_0120942_1099_1617 | 172 |
| 699 | 3300035695 | Ga0373927_0330436 | Ga0373927_0330436_67_585 | 172 |
| 700 | 3300035724 | Ga0373933_0019370 | Ga0373933_0019370_887_1405 | 172 |
| 701 | 3300035724 | Ga0373933_0040439 | Ga0373933_0040439_62_580 | 172 |
| 702 | 3300035724 | Ga0373933_0055188 | Ga0373933_0055188_1202_1720 | 172 |
| 703 | 3300035724 | Ga0373933_0103794 | Ga0373933_0103794_54_572 | 172 |
| 704 | 3300035725 | Ga0373947_0002831 | Ga0373947_0002831_3656_4174 | 172 |
| 705 | 3300035725 | Ga0373947_0013227 | Ga0373947_0013227_3525_4043 | 172 |
| 706 | 3300035725 | Ga0373947_0036935 | Ga0373947_0036935_359_877 | 172 |
| 707 | 3300035725 | Ga0373947_0355086 | Ga0373947_0355086_369_887 | 172 |
| 708 | 3300035725 | Ga0373947_0568094 | Ga0373947_0568094_103_621 | 172 |
| 709 | 3300036401 | Ga0373937_0009545 | Ga0373937_0009545_4977_5495 | 172 |
| 710 | 3300036401 | Ga0373937_0105354 | Ga0373937_0105354_1092_1610 | 172 |
| 711 | 3300036401 | Ga0373937_0185996 | Ga0373937_0185996_1380_1898 | 172 |
| 712 | 3300036401 | Ga0373937_0189466 | Ga0373937_0189466_645_1163 | 172 |
| 713 | 3300036401 | Ga0373937_1401962 | Ga0373937_1401962_52_570 | 172 |
| 714 | 3300037068 | Ga0373925_0003785 | Ga0373925_0003785_8103_8621 | 172 |
| 715 | 3300037068 | Ga0373925_0018494 | Ga0373925_0018494_1859_2377 | 172 |
| 716 | 3300037068 | Ga0373925_0019909 | Ga0373925_0019909_570_1088 | 172 |
| 717 | 3300037068 | Ga0373925_0026700 | Ga0373925_0026700_1794_2312 | 172 |
| 718 | 3300037068 | Ga0373925_0052371 | Ga0373925_0052371_431_949 | 172 |
| 719 | 3300037068 | Ga0373925_0101945 | Ga0373925_0101945_1201_1719 | 172 |
| 720 | 3300037068 | Ga0373925_0735375 | Ga0373925_0735375_101_619 | 172 |
| 721 | 3300037853 | Ga0436364_0604676 | Ga0436364_0604676_234_752 | 172 |
| 722 | 3300037853 | Ga0436364_0791858 | Ga0436364_0791858_573_1091 | 172 |
| 723 | 3300037853 | Ga0436364_0799387 | Ga0436364_0799387_372_911 | 172 |
| 724 | 3300037853 | Ga0436364_1045514 | Ga0436364_1045514_280_798 | 172 |
| 725 | 3300037853 | Ga0436364_1530016 | Ga0436364_1530016_15109_15627 | 172 |
| 726 | 3300039438 | Ga0436360_0613585 | Ga0436360_0613585_71_589 | 172 |
| 727 | 3300039447 | Ga0436361_0437895 | Ga0436361_0437895_13_531 | 172 |
| 728 | 3300039450 | Ga0436363_1006539 | Ga0436363_1006539_436_954 | 172 |
| 729 | 3300039453 | Ga0436362_1235364 | Ga0436362_1235364_28_546 | 172 |
| 730 | 3300044694 | Ga0466963_0104402 | Ga0466963_0104402_1412_1930 | 172 |
| 731 | 3300044735 | Ga0466968_0283705 | Ga0466968_0283705_213_731 | 172 |
| 732 | 3300045836 | Ga0466958_0527056 | Ga0466958_0527056_117_635 | 172 |
| 733 | 3300045976 | Ga0466967_0283710 | Ga0466967_0283710_842_1360 | 172 |
| 734 | 3300046454 | Ga0495592_0004732 | Ga0495592_0004732_1182_1700 | 172 |
| 735 | 3300046454 | Ga0495592_0015295 | Ga0495592_0015295_5173_5691 | 172 |
| 736 | 3300046454 | Ga0495592_0046539 | Ga0495592_0046539_2120_2638 | 172 |
| 737 | 3300046454 | Ga0495592_0076844 | Ga0495592_0076844_746_1264 | 172 |
| 738 | 3300046454 | Ga0495592_0407419 | Ga0495592_0407419_71_589 | 172 |
| 739 | 3300046455 | Ga0495603_0005012 | Ga0495603_0005012_4035_4553 | 172 |
| 740 | 3300046459 | Ga0495629_0002832 | Ga0495629_0002832_10920_11438 | 172 |
| 741 | 3300046459 | Ga0495629_0010491 | Ga0495629_0010491_24_542 | 172 |
| 742 | 3300046459 | Ga0495629_0044212 | Ga0495629_0044212_242_760 | 172 |
| 743 | 3300046459 | Ga0495629_0102201 | Ga0495629_0102201_951_1469 | 172 |
| 744 | 3300046461 | Ga0495641_0012845 | Ga0495641_0012845_419_937 | 172 |
| 745 | 3300046461 | Ga0495641_0018849 | Ga0495641_0018849_760_1278 | 172 |
| 746 | 3300046461 | Ga0495641_0051286 | Ga0495641_0051286_544_1062 | 172 |
| 747 | 3300046462 | Ga0495651_0116402 | Ga0495651_0116402_1182_1700 | 172 |
| 748 | 3300046462 | Ga0495651_0152028 | Ga0495651_0152028_149_667 | 172 |
| 749 | 3300046462 | Ga0495651_0217564 | Ga0495651_0217564_336_854 | 172 |
| 750 | 3300046462 | Ga0495651_0565824 | Ga0495651_0565824_67_585 | 172 |
| 751 | 3300046463 | Ga0495653_0002817 | Ga0495653_0002817_250_768 | 172 |
| 752 | 3300046463 | Ga0495653_0016804 | Ga0495653_0016804_2235_2753 | 172 |
| 753 | 3300046463 | Ga0495653_0070654 | Ga0495653_0070654_808_1326 | 172 |
| 754 | 3300046463 | Ga0495653_0154459 | Ga0495653_0154459_330_848 | 172 |
| 755 | 3300046463 | Ga0495653_0406284 | Ga0495653_0406284_227_745 | 172 |
| 756 | 3300046472 | Ga0495580_0010328 | Ga0495580_0010328_6069_6587 | 172 |
| 757 | 3300046472 | Ga0495580_0259587 | Ga0495580_0259587_407_925 | 172 |
| 758 | 3300046473 | Ga0495582_0012503 | Ga0495582_0012503_2814_3332 | 172 |
| 759 | 3300046473 | Ga0495582_0021981 | Ga0495582_0021981_1150_1668 | 172 |
| 760 | 3300046473 | Ga0495582_0039599 | Ga0495582_0039599_24_542 | 172 |
| 761 | 3300046473 | Ga0495582_0075559 | Ga0495582_0075559_929_1447 | 172 |
| 762 | 3300046475 | Ga0495639_0015642 | Ga0495639_0015642_2734_3252 | 172 |
| 763 | 3300046475 | Ga0495639_0017037 | Ga0495639_0017037_567_1085 | 172 |
| 764 | 3300046476 | Ga0495662_0004269 | Ga0495662_0004269_6265_6783 | 172 |
| 765 | 3300046476 | Ga0495662_0018100 | Ga0495662_0018100_429_947 | 172 |
| 766 | 3300046476 | Ga0495662_0018801 | Ga0495662_0018801_79_597 | 172 |
| 767 | 3300046476 | Ga0495662_0037551 | Ga0495662_0037551_280_798 | 172 |
| 768 | 3300046477 | Ga0495664_0001749 | Ga0495664_0001749_8652_9170 | 172 |
| 769 | 3300046477 | Ga0495664_0023680 | Ga0495664_0023680_323_841 | 172 |
| 770 | 3300046477 | Ga0495664_0029956 | Ga0495664_0029956_880_1398 | 172 |
| 771 | 3300046477 | Ga0495664_0062041 | Ga0495664_0062041_1532_2050 | 172 |
| 772 | 3300046477 | Ga0495664_0138606 | Ga0495664_0138606_739_1257 | 172 |
| 773 | 3300046477 | Ga0495664_0259613 | Ga0495664_0259613_447_965 | 172 |
| 774 | 3300046477 | Ga0495664_0379735 | Ga0495664_0379735_50_568 | 172 |
| 775 | 3300046499 | Ga0495594_0199205 | Ga0495594_0199205_55_573 | 172 |
| 776 | 3300046499 | Ga0495594_0212843 | Ga0495594_0212843_191_709 | 172 |
| 777 | 3300046511 | Ga0495608_0005687 | Ga0495608_0005687_7738_8256 | 172 |
| 778 | 3300046511 | Ga0495608_0018014 | Ga0495608_0018014_1042_1560 | 172 |
| 779 | 3300046511 | Ga0495608_0041204 | Ga0495608_0041204_2541_3059 | 172 |
| 780 | 3300046511 | Ga0495608_0080670 | Ga0495608_0080670_766_1284 | 172 |
| 781 | 3300046514 | Ga0495618_0040555 | Ga0495618_0040555_2028_2546 | 172 |
| 782 | 3300046514 | Ga0495618_0122905 | Ga0495618_0122905_502_1020 | 172 |
| 783 | 3300046514 | Ga0495618_0295127 | Ga0495618_0295127_468_986 | 172 |
| 784 | 3300046516 | Ga0495628_0024931 | Ga0495628_0024931_468_986 | 172 |
| 785 | 3300046516 | Ga0495628_0050817 | Ga0495628_0050817_2236_2754 | 172 |
| 786 | 3300046516 | Ga0495628_0090413 | Ga0495628_0090413_589_1107 | 172 |
| 787 | 3300046516 | Ga0495628_0128663 | Ga0495628_0128663_950_1468 | 172 |
| 788 | 3300046516 | Ga0495628_0264377 | Ga0495628_0264377_700_1218 | 172 |
| 789 | 3300046517 | Ga0495630_0037661 | Ga0495630_0037661_1129_1647 | 172 |
| 790 | 3300046517 | Ga0495630_0045136 | Ga0495630_0045136_2726_3244 | 172 |
| 791 | 3300046517 | Ga0495630_0061310 | Ga0495630_0061310_148_666 | 172 |
| 792 | 3300046517 | Ga0495630_0579897 | Ga0495630_0579897_211_741 | 172 |
| 793 | 3300046526 | Ga0495666_0012325 | Ga0495666_0012325_1751_2269 | 172 |
| 794 | 3300046529 | Ga0495652_0004139 | Ga0495652_0004139_11415_11933 | 172 |
| 795 | 3300046529 | Ga0495652_0076114 | Ga0495652_0076114_1952_2470 | 172 |
| 796 | 3300046529 | Ga0495652_0172292 | Ga0495652_0172292_22_540 | 172 |
| 797 | 3300046529 | Ga0495652_0290739 | Ga0495652_0290739_222_740 | 172 |
| 798 | 3300046529 | Ga0495652_0319814 | Ga0495652_0319814_126_644 | 172 |
| 799 | 3300046531 | Ga0495665_0003325 | Ga0495665_0003325_1234_1752 | 172 |
| 800 | 3300046531 | Ga0495665_0004279 | Ga0495665_0004279_2893_3411 | 172 |
| 801 | 3300046531 | Ga0495665_0186939 | Ga0495665_0186939_343_861 | 172 |
| 802 | 3300046533 | Ga0495640_0015063 | Ga0495640_0015063_4691_5209 | 172 |
| 803 | 3300046533 | Ga0495640_0021658 | Ga0495640_0021658_583_1101 | 172 |
| 804 | 3300046533 | Ga0495640_0069518 | Ga0495640_0069518_1355_1873 | 172 |
| 805 | 3300046533 | Ga0495640_0073053 | Ga0495640_0073053_1731_2249 | 172 |
| 806 | 3300046533 | Ga0495640_0109030 | Ga0495640_0109030_385_903 | 172 |
| 807 | 3300046533 | Ga0495640_0204268 | Ga0495640_0204268_579_1097 | 172 |
| 808 | 3300046533 | Ga0495640_0621329 | Ga0495640_0621329_24_542 | 172 |
| 809 | 3300046535 | Ga0495586_0032980 | Ga0495586_0032980_1726_2244 | 172 |
| 810 | 3300046535 | Ga0495586_0038569 | Ga0495586_0038569_404_922 | 172 |
| 811 | 3300046536 | Ga0495587_0053075 | Ga0495587_0053075_986_1504 | 172 |
| 812 | 3300046536 | Ga0495587_0099410 | Ga0495587_0099410_818_1336 | 172 |
| 813 | 3300046536 | Ga0495587_0120169 | Ga0495587_0120169_184_702 | 172 |
| 814 | 3300046543 | Ga0495645_0018464 | Ga0495645_0018464_3312_3830 | 172 |
| 815 | 3300046543 | Ga0495645_0027452 | Ga0495645_0027452_1050_1568 | 172 |
| 816 | 3300046543 | Ga0495645_0042705 | Ga0495645_0042705_1357_1875 | 172 |
| 817 | 3300046543 | Ga0495645_0053793 | Ga0495645_0053793_2303_2821 | 172 |
| 818 | 3300046543 | Ga0495645_0072780 | Ga0495645_0072780_946_1464 | 172 |
| 819 | 3300046543 | Ga0495645_0077148 | Ga0495645_0077148_1008_1526 | 172 |
| 820 | 3300046543 | Ga0495645_0157521 | Ga0495645_0157521_748_1266 | 172 |
| 821 | 3300046543 | Ga0495645_0459726 | Ga0495645_0459726_123_641 | 172 |
| 822 | 3300046557 | Ga0495622_0259848 | Ga0495622_0259848_16_534 | 172 |
| 823 | 3300046559 | Ga0495667_0010521 | Ga0495667_0010521_2241_2759 | 172 |
| 824 | 3300046559 | Ga0495667_0026991 | Ga0495667_0026991_2298_2816 | 172 |
| 825 | 3300046559 | Ga0495667_0030425 | Ga0495667_0030425_2791_3309 | 172 |
| 826 | 3300046559 | Ga0495667_0045697 | Ga0495667_0045697_1999_2517 | 172 |
| 827 | 3300046559 | Ga0495667_0053431 | Ga0495667_0053431_90_608 | 172 |
| 828 | 3300046559 | Ga0495667_0146617 | Ga0495667_0146617_373_891 | 172 |
| 829 | 3300046642 | Ga0495634_0019496 | Ga0495634_0019496_1588_2106 | 172 |
| 830 | 3300046642 | Ga0495634_0060263 | Ga0495634_0060263_1287_1805 | 172 |
| 831 | 3300046642 | Ga0495634_0077617 | Ga0495634_0077617_149_667 | 172 |
| 832 | 3300046663 | Ga0495635_0000698 | Ga0495635_0000698_6180_6698 | 172 |
| 833 | 3300046663 | Ga0495635_0013834 | Ga0495635_0013834_4314_4832 | 172 |
| 834 | 3300046663 | Ga0495635_0612478 | Ga0495635_0612478_14_532 | 172 |
| 835 | 3300046674 | Ga0495588_0018741 | Ga0495588_0018741_460_978 | 172 |
| 836 | 3300046675 | Ga0495657_0014491 | Ga0495657_0014491_4393_4911 | 172 |
| 837 | 3300046675 | Ga0495657_0041672 | Ga0495657_0041672_325_843 | 172 |
| 838 | 3300046675 | Ga0495657_0073922 | Ga0495657_0073922_215_733 | 172 |
| 839 | 3300046675 | Ga0495657_0094247 | Ga0495657_0094247_90_608 | 172 |
| 840 | 3300046675 | Ga0495657_0147544 | Ga0495657_0147544_258_776 | 172 |
| 841 | 3300046675 | Ga0495657_0468455 | Ga0495657_0468455_119_637 | 172 |
| 842 | 3300046678 | Ga0495599_0014531 | Ga0495599_0014531_1954_2472 | 172 |
| 843 | 3300046678 | Ga0495599_0018542 | Ga0495599_0018542_2677_3195 | 172 |
| 844 | 3300046678 | Ga0495599_0021944 | Ga0495599_0021944_90_608 | 172 |
| 845 | 3300046678 | Ga0495599_0096896 | Ga0495599_0096896_196_714 | 172 |
| 846 | 3300046678 | Ga0495599_0146454 | Ga0495599_0146454_14_532 | 172 |
| 847 | 3300046679 | Ga0495623_0023619 | Ga0495623_0023619_637_1155 | 172 |
| 848 | 3300046679 | Ga0495623_0041927 | Ga0495623_0041927_2383_2901 | 172 |
| 849 | 3300046679 | Ga0495623_0268593 | Ga0495623_0268593_20_538 | 172 |
| 850 | 3300046679 | Ga0495623_0396265 | Ga0495623_0396265_105_623 | 172 |
| 851 | 3300046680 | Ga0495646_0003516 | Ga0495646_0003516_5554_6072 | 172 |
| 852 | 3300046680 | Ga0495646_0023360 | Ga0495646_0023360_1040_1558 | 172 |
| 853 | 3300046680 | Ga0495646_0034742 | Ga0495646_0034742_712_1230 | 172 |
| 854 | 3300046680 | Ga0495646_0051383 | Ga0495646_0051383_248_766 | 172 |
| 855 | 3300046680 | Ga0495646_0056228 | Ga0495646_0056228_342_860 | 172 |
| 856 | 3300046680 | Ga0495646_0194680 | Ga0495646_0194680_286_804 | 172 |
| 857 | 3300046681 | Ga0495647_0008177 | Ga0495647_0008177_2792_3310 | 172 |
| 858 | 3300046681 | Ga0495647_0011994 | Ga0495647_0011994_30_548 | 172 |
| 859 | 3300046683 | Ga0495658_0003636 | Ga0495658_0003636_942_1460 | 172 |
| 860 | 3300046683 | Ga0495658_0010930 | Ga0495658_0010930_2679_3197 | 172 |
| 861 | 3300046689 | Ga0495613_0037126 | Ga0495613_0037126_755_1273 | 172 |
| 862 | 3300046689 | Ga0495613_0089011 | Ga0495613_0089011_239_757 | 172 |
| 863 | 3300046690 | Ga0495624_0046194 | Ga0495624_0046194_2035_2553 | 172 |
| 864 | 3300046690 | Ga0495624_0055880 | Ga0495624_0055880_1855_2373 | 172 |
| 865 | 3300046690 | Ga0495624_0102059 | Ga0495624_0102059_966_1484 | 172 |
| 866 | 3300046690 | Ga0495624_0149783 | Ga0495624_0149783_131_649 | 172 |
| 867 | 3300046690 | Ga0495624_0371633 | Ga0495624_0371633_274_804 | 172 |
| 868 | 3300046690 | Ga0495624_0503305 | Ga0495624_0503305_172_690 | 172 |
| 869 | 3300046809 | Ga0495600_0008867 | Ga0495600_0008867_4261_4779 | 172 |
| 870 | 3300046809 | Ga0495600_0047247 | Ga0495600_0047247_583_1101 | 172 |
| 871 | 3300046809 | Ga0495600_0048758 | Ga0495600_0048758_2028_2546 | 172 |
| 872 | 3300046809 | Ga0495600_0104981 | Ga0495600_0104981_758_1276 | 172 |
| 873 | 3300047315 | Ga0495581_0005385 | Ga0495581_0005385_863_1381 | 172 |
| 874 | 3300047315 | Ga0495581_0008932 | Ga0495581_0008932_2459_2977 | 172 |
| 875 | 3300047315 | Ga0495581_0030686 | Ga0495581_0030686_696_1214 | 172 |
| 876 | 3300047315 | Ga0495581_0048480 | Ga0495581_0048480_297_815 | 172 |
| 877 | 3300047317 | Ga0495604_0012952 | Ga0495604_0012952_5339_5857 | 172 |
| 878 | 3300047317 | Ga0495604_0015781 | Ga0495604_0015781_741_1259 | 172 |
| 879 | 3300047317 | Ga0495604_0819330 | Ga0495604_0819330_13_531 | 172 |
| 880 | 3300047319 | Ga0495674_0002024 | Ga0495674_0002024_3528_4046 | 172 |
| 881 | 3300047319 | Ga0495674_0008562 | Ga0495674_0008562_4882_5400 | 172 |
| 882 | 3300047319 | Ga0495674_0022932 | Ga0495674_0022932_555_1073 | 172 |
| 883 | 3300047319 | Ga0495674_0048649 | Ga0495674_0048649_3124_3642 | 172 |
| 884 | 3300047319 | Ga0495674_0065338 | Ga0495674_0065338_16_534 | 172 |
| 885 | 3300047319 | Ga0495674_0083049 | Ga0495674_0083049_1287_1805 | 172 |
| 886 | 3300047319 | Ga0495674_0190378 | Ga0495674_0190378_1121_1639 | 172 |
| 887 | 3300047319 | Ga0495674_0426765 | Ga0495674_0426765_208_726 | 172 |
| 888 | 3300047321 | Ga0495676_0064787 | Ga0495676_0064787_770_1288 | 172 |
| 889 | 3300047321 | Ga0495676_0119630 | Ga0495676_0119630_1035_1553 | 172 |
| 890 | 3300047321 | Ga0495676_0175035 | Ga0495676_0175035_430_948 | 172 |
| 891 | 3300047322 | Ga0495680_0013934 | Ga0495680_0013934_1501_2019 | 172 |
| 892 | 3300047322 | Ga0495680_0031216 | Ga0495680_0031216_1045_1563 | 172 |
| 893 | 3300047322 | Ga0495680_0057905 | Ga0495680_0057905_1692_2210 | 172 |
| 894 | 3300047322 | Ga0495680_0070658 | Ga0495680_0070658_2053_2571 | 172 |
| 895 | 3300047322 | Ga0495680_0076994 | Ga0495680_0076994_964_1482 | 172 |
| 896 | 3300047444 | Ga0495675_0005970 | Ga0495675_0005970_4068_4586 | 172 |
| 897 | 3300047444 | Ga0495675_0030343 | Ga0495675_0030343_2542_3060 | 172 |
| 898 | 3300047471 | Ga0495684_0001943 | Ga0495684_0001943_7269_7787 | 172 |
| 899 | 3300047471 | Ga0495684_0008935 | Ga0495684_0008935_4263_4781 | 172 |
| 900 | 3300047471 | Ga0495684_0010765 | Ga0495684_0010765_2818_3336 | 172 |
| 901 | 3300047471 | Ga0495684_0058922 | Ga0495684_0058922_2028_2546 | 172 |
| 902 | 3300047471 | Ga0495684_0070817 | Ga0495684_0070817_1213_1731 | 172 |
| 903 | 3300047471 | Ga0495684_0312173 | Ga0495684_0312173_312_830 | 172 |
| 904 | 3300047673 | Ga0495593_0021069 | Ga0495593_0021069_1460_1978 | 172 |
| 905 | 3300047673 | Ga0495593_0035403 | Ga0495593_0035403_13_531 | 172 |
| 906 | 3300047673 | Ga0495593_0072795 | Ga0495593_0072795_507_1025 | 172 |
| 907 | 3300048088 | Ga0495602_0059659 | Ga0495602_0059659_132_650 | 172 |
| 908 | 3300048088 | Ga0495602_0130272 | Ga0495602_0130272_1417_1935 | 172 |
| 909 | 3300048088 | Ga0495602_0267754 | Ga0495602_0267754_566_1084 | 172 |
| 910 | 3300048089 | Ga0495614_0020687 | Ga0495614_0020687_1921_2439 | 172 |
| 911 | 3300048089 | Ga0495614_0036387 | Ga0495614_0036387_1076_1594 | 172 |
| 912 | 3300048089 | Ga0495614_0181299 | Ga0495614_0181299_393_911 | 172 |
| 913 | 3300048904 | Ga0496101_0080830 | Ga0496101_0080830_385_903 | 172 |
| 914 | 3300048904 | Ga0496101_0085737 | Ga0496101_0085737_1400_1918 | 172 |
| 915 | 3300048905 | Ga0496102_0250511 | Ga0496102_0250511_485_1003 | 172 |
| 916 | 3300048905 | Ga0496102_0698364 | Ga0496102_0698364_235_765 | 172 |
| 917 | 3300048906 | Ga0496103_0027389 | Ga0496103_0027389_2026_2544 | 172 |
| 918 | 3300048906 | Ga0496103_0102809 | Ga0496103_0102809_246_776 | 172 |
| 919 | 3300048907 | Ga0496104_0001194 | Ga0496104_0001194_7126_7644 | 172 |
| 920 | 3300048907 | Ga0496104_0070595 | Ga0496104_0070595_315_833 | 172 |
| 921 | 3300048908 | Ga0496105_0002102 | Ga0496105_0002102_7559_8077 | 172 |
| 922 | 3300048908 | Ga0496105_0017097 | Ga0496105_0017097_3173_3691 | 172 |
| 923 | 3300048908 | Ga0496105_0036418 | Ga0496105_0036418_2316_2846 | 172 |
| 924 | 3300048908 | Ga0496105_0526975 | Ga0496105_0526975_337_855 | 172 |
| 925 | 3300048909 | Ga0496106_0077453 | Ga0496106_0077453_1572_2090 | 172 |
| 926 | 3300048909 | Ga0496106_0106910 | Ga0496106_0106910_853_1383 | 172 |
| 927 | 3300048910 | Ga0496107_0014906 | Ga0496107_0014906_1010_1528 | 172 |
| 928 | 3300048910 | Ga0496107_0059599 | Ga0496107_0059599_352_897 | 172 |
| 929 | 3300048910 | Ga0496107_0551692 | Ga0496107_0551692_141_659 | 172 |
| 930 | 3300048911 | Ga0496108_0012378 | Ga0496108_0012378_2414_2932 | 172 |
| 931 | 3300048912 | Ga0496109_0052702 | Ga0496109_0052702_3140_3658 | 172 |
| 932 | 3300048912 | Ga0496109_0057856 | Ga0496109_0057856_1448_1978 | 172 |
| 933 | 3300048912 | Ga0496109_0077274 | Ga0496109_0077274_316_834 | 172 |
| 934 | 3300048914 | Ga0496111_0040374 | Ga0496111_0040374_1230_1748 | 172 |
| 935 | 3300048914 | Ga0496111_0366943 | Ga0496111_0366943_50_595 | 172 |
| 936 | 3300048914 | Ga0496111_0598530 | Ga0496111_0598530_107_625 | 172 |
| 937 | 3300048915 | Ga0496112_0000183 | Ga0496112_0000183_10077_10595 | 172 |
| 938 | 3300048915 | Ga0496112_0267886 | Ga0496112_0267886_499_1017 | 172 |
| 939 | 3300048916 | Ga0496113_0006788 | Ga0496113_0006788_5114_5632 | 172 |
| 940 | 3300048916 | Ga0496113_0062251 | Ga0496113_0062251_1652_2170 | 172 |
| 941 | 3300048916 | Ga0496113_0257040 | Ga0496113_0257040_816_1334 | 172 |
| 942 | 3300048916 | Ga0496113_0550442 | Ga0496113_0550442_195_740 | 172 |
| 943 | 3300048917 | Ga0496114_0102641 | Ga0496114_0102641_424_942 | 172 |
| 944 | 3300048917 | Ga0496114_0123518 | Ga0496114_0123518_201_719 | 172 |
| 945 | 3300048918 | Ga0496115_0033108 | Ga0496115_0033108_1074_1592 | 172 |
| 946 | 3300048918 | Ga0496115_0039179 | Ga0496115_0039179_2848_3378 | 172 |
| 947 | 3300048929 | Ga0496126_0103220 | Ga0496126_0103220_730_1248 | 172 |
| 948 | 3300050507 | nmdc:mga05p37_38778_c1 | nmdc:mga05p37_38778_c1_617_1135 | 172 |
| 949 | 3300050511 | nmdc:mga08y16_132685_c1 | nmdc:mga08y16_132685_c1_19_537 | 172 |
| 950 | 3300050512 | nmdc:mga0n895_1244633_c1 | nmdc:mga0n895_1244633_c1_23_541 | 172 |
| 951 | 3300050512 | nmdc:mga0n895_26838_c1 | nmdc:mga0n895_26838_c1_3104_3622 | 172 |
| 952 | 3300050512 | nmdc:mga0n895_40493_c1 | nmdc:mga0n895_40493_c1_2908_3438 | 172 |
| 953 | 3300050512 | nmdc:mga0n895_68643_c1 | nmdc:mga0n895_68643_c1_1220_1738 | 172 |
| 954 | 3300050513 | nmdc:mga0rr50_157268_c1 | nmdc:mga0rr50_157268_c1_468_986 | 172 |
| 955 | 3300050513 | nmdc:mga0rr50_9469_c1 | nmdc:mga0rr50_9469_c1_3188_3718 | 172 |
| 956 | 3300050514 | nmdc:mga08x19_200024_c1 | nmdc:mga08x19_200024_c1_36_566 | 172 |
| 957 | 3300050514 | nmdc:mga08x19_41570_c1 | nmdc:mga08x19_41570_c1_1763_2281 | 172 |
| 958 | 3300050515 | nmdc:mga0a205_12658_c1 | nmdc:mga0a205_12658_c1_2912_3430 | 172 |
| 959 | 3300053077 | Ga0495601_0009875 | Ga0495601_0009875_814_1332 | 172 |
| 960 | 3300053077 | Ga0495601_0067835 | Ga0495601_0067835_568_1086 | 172 |
| 961 | 3300053077 | Ga0495601_0102629 | Ga0495601_0102629_1135_1653 | 172 |
| 962 | 3300053077 | Ga0495601_0295806 | Ga0495601_0295806_317_835 | 172 |
| 963 | 3300053077 | Ga0495601_0395566 | Ga0495601_0395566_228_746 | 172 |
| 964 | 3300053084 | Ga0495595_0015601 | Ga0495595_0015601_1932_2450 | 172 |
| 965 | 3300053084 | Ga0495595_0033595 | Ga0495595_0033595_1604_2122 | 172 |
| 966 | 3300053085 | Ga0495619_0004020 | Ga0495619_0004020_4932_5450 | 172 |
| 967 | 3300053085 | Ga0495619_0016223 | Ga0495619_0016223_2869_3387 | 172 |
| 968 | 3300053085 | Ga0495619_0112723 | Ga0495619_0112723_1159_1677 | 172 |
| 969 | 3300060344 | Ga0587071_096023 | Ga0587071_096023_117_635 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gm5-assembly1.cif.gz_A-2 | crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution | 0.8528 | 13 | 160 |
| 3gm5-assembly1.cif.gz_A-2 | crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution | 0.8214 | 13 | 160 |
| 3oa4-assembly1.cif.gz_A-2 | crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 | 0.7378 | 14 | 160 |
| 6qh4-assembly1.cif.gz_C | crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant | 0.7208 | 14 | 159 |
| 6qh4-assembly2.cif.gz_B | crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant | 0.7115 | 17 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gm5A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8528 | 13 | 160 | 3.10.180.10 |
| 3gm5A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8214 | 13 | 160 | 3.10.180.10 |
| 3oa4A01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7378 | 14 | 160 | 3.10.180.10 |
| 3oa4A01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.733 | 14 | 160 | 3.10.180.10 |
| 2r5vB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7153 | 14 | 166 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3WZF3-F1-model_v4 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (VOC family protein) | 0.9811 | 16 | 171 |
GO:0051213
|
| AF-A0A7X1J1A0-F1-model_v4 | VOC family protein | 0.966 | 13 | 171 |
|
| AF-A0A7J3FLD5-F1-model_v4 | VOC family protein | 0.9573 | 14 | 171 |
|
| AF-A0A2D9NV91-F1-model_v4 | deleted | 0.9488 | 13 | 170 |
|
| AF-A0A7J3FLD5-F1-model_v4 | VOC family protein | 0.9455 | 14 | 171 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar