F487076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 969 | 411 | 1938 | 803 |
Family's Representative Sequence
| Representative Sequence | 3300046522|Ga0495643_0012233|Ga0495643_0012233_1098_3638 |
| Length | 846 |
| Sequence | LPRGWPKKWCSTVVVWLARTSAEVRVFRETLRALVSHWRQHPVQFFSVLTGLWLATSLLTGVQALNSQARESYARASQLIGGEPQASLSAPSGATFSQQVFVDLRRAGWPVSPVLQGRVTLKGHDDQRLQLMGIEPVSLPVGSAVAGQALAIEQVVEFFSPPGSTWTSPQTLQALGLQEGESPLTLSGQALPPLHAQPDMAPGVLLVDIGFAQQILGLPDQLSRLLLPKDFTATLPDQFKGQLQLKTSGEENNLSRLTESFHLNLDALGFLSFVVGLFIVHAAIGLALEQRRGLLRTLRACGVSARMLIACLAVELGGLALIGGLVGVASGYLLASVLLPDVAASLRGLYGAEVAGQLSLSPWWWLSGVGLSLLGALLAGSNSLLRAARLPLLALADPQAWHQAHARWLRRQGWVAVIAAVIAVLALIFGDSLSSGFVLMAALLIGXXXALPVXXNWXXNRVLHRSRSVLGQWFLADCRQQLPALSLALMALLLALAANIGAGSMTAGFRQTFSDWLEQRLTAELYVNPRNPAQARELQTWLKQQPGLTAVLPSWQVSIQLQGWPADVFGVIDHPTYRQHWPLLEALGDNPWDRLAKDDALMLSEQLARRLKVRLGDHLTIPTPNGAWSPRIVGIYADYGNPKGHILVNVNHLLRGWPQLTPSRFNLRIDPTLIPAFLTALQTRFTLEDSRIVDQARLKGWSTQVFERTFAATAALNSLTLCVAGVALFISLLTQSQSRLGQLAPLWALGVTRRQLMLLNLGQTWLLAVLTLVLALPLGIALAWCLDTVINVQAFGWRLPLRVFPLQLLQLMGLALLATLLASAWPLYSLYRTQPADLLRTFAHED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 23 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 24 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 32 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 40 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 41 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 42 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 45 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 57 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 77 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 78 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 79 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 80 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 81 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 82 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 83 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 85 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 86 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 87 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 88 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 89 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 90 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 91 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 92 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 93 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 94 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 95 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 96 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 97 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 98 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 99 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 100 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 101 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 102 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 103 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 104 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 181 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 182 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 183 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 184 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 185 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 186 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 187 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 188 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 189 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 190 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 191 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 192 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 195 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 198 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 199 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 200 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 201 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 202 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 203 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 204 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 205 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 206 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 207 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 208 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 209 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 210 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 211 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 212 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 213 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 214 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 215 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 216 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 217 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 218 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 219 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 220 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 221 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 222 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 223 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 224 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 225 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 226 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 227 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 228 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 229 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 230 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 231 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 232 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 233 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 234 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 235 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 236 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 237 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 238 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 239 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 240 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 241 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 242 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 243 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 244 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 245 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 246 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 247 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 248 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 249 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 250 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 251 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 252 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 253 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 254 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 255 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 256 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 257 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 258 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 259 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 260 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 261 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 262 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 263 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 264 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 265 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 266 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 267 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 268 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 269 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 270 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 271 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 272 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 273 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 274 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 275 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 276 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 277 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 278 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 279 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 280 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 281 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 282 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 283 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 284 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 285 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 286 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 287 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 288 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 289 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 290 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 291 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 292 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 293 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 294 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 295 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 296 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 297 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 298 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 299 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 300 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 301 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 302 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 303 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 304 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 305 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 306 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 307 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 308 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 309 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 310 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 311 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 312 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 313 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 314 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 315 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 316 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 317 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 318 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 319 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 320 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 321 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 322 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 323 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 324 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 325 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 326 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 327 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 328 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 329 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 330 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 331 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 332 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 333 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 334 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 335 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 336 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 337 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 338 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 339 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 340 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 341 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 342 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 343 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 344 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 345 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 346 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 347 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 348 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 349 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 350 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 351 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 352 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 353 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 354 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 355 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 356 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 357 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 358 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 359 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 360 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 361 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 362 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 363 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 364 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 365 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 366 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 367 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 368 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 369 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 370 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 371 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 372 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 373 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 374 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 375 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 376 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 377 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 378 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 379 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 380 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 381 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 382 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 383 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 384 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 385 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 386 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 387 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 388 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 389 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 390 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 391 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 392 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 393 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 394 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 395 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 396 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 397 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 398 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 399 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 400 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 401 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 402 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 403 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 404 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 405 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 406 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 407 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 408 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 409 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 410 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 411 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.92 |
| Metatranscriptomes | 0 |
| Isolates | 22.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.19 |
| Nodule | 2.27 |
| Rhizoplane | 7.02 |
| Rhizosphere | 72.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495643_0012233 | 3300046522 | Bacteria | 5182 |
| 2 | JGI25162J39368_1000050 | 3300002737 | Bacteria | 157157 |
| 3 | JGI25162J39368_1000060 | 3300002737 | Bacteria | 137745 |
| 4 | JGI25163J39215_1000017 | 3300002771 | Bacteria | 79704 |
| 5 | JGI25163J39215_1000102 | 3300002771 | Bacteria | 35489 |
| 6 | JGI25164J39214_1000025 | 3300002772 | Bacteria | 157157 |
| 7 | JGI25164J39214_1000037 | 3300002772 | Bacteria | 137530 |
| 8 | JGI25165J46597_1000114 | 3300003214 | Bacteria | 144350 |
| 9 | JGI25165J46597_1000118 | 3300003214 | Bacteria | 137530 |
| 10 | JGI25165J46597_1000176 | 3300003214 | Bacteria | 99160 |
| 11 | Ga0055538_1000066 | 3300003751 | Bacteria | 98557 |
| 12 | Ga0055539_1000102 | 3300003752 | Bacteria | 98557 |
| 13 | Ga0055533_1000110 | 3300003756 | Bacteria | 98557 |
| 14 | Ga0055532_1000326 | 3300003758 | Bacteria | 26665 |
| 15 | Ga0055525_1000187 | 3300003759 | Bacteria | 75518 |
| 16 | Ga0055536_1000028 | 3300003781 | Bacteria | 162550 |
| 17 | Ga0055536_1000046 | 3300003781 | Bacteria | 118284 |
| 18 | Ga0055536_1000119 | 3300003781 | Bacteria | 68235 |
| 19 | Ga0055530_10000030 | 3300003791 | Bacteria | 125301 |
| 20 | Ga0055530_10000094 | 3300003791 | Bacteria | 76102 |
| 21 | Ga0055530_10000653 | 3300003791 | Bacteria | 29713 |
| 22 | Ga0055540_1000070 | 3300003792 | Bacteria | 118483 |
| 23 | Ga0055540_1000130 | 3300003792 | Bacteria | 76102 |
| 24 | Ga0055540_1000262 | 3300003792 | Bacteria | 47599 |
| 25 | Ga0055531_10001382 | 3300003794 | Bacteria | 18006 |
| 26 | Ga0055541_1000068 | 3300003841 | Bacteria | 98557 |
| 27 | Ga0065714_10000079 | 3300005288 | Bacteria | 12131 |
| 28 | Ga0065714_10002746 | 3300005288 | Bacteria | 12938 |
| 29 | Ga0065714_10003089 | 3300005288 | Bacteria | 13598 |
| 30 | Ga0065704_10071193 | 3300005289 | Bacteria | 12583 |
| 31 | Ga0065704_10075106 | 3300005289 | Bacteria | 5786 |
| 32 | Ga0070670_100000242 | 3300005331 | Bacteria | 49330 |
| 33 | Ga0070670_100001182 | 3300005331 | Bacteria | 20700 |
| 34 | Ga0070661_100000151 | 3300005344 | Bacteria | 56885 |
| 35 | Ga0070662_100001621 | 3300005457 | Bacteria | 13873 |
| 36 | Ga0070664_100000095 | 3300005564 | Bacteria | 56885 |
| 37 | Ga0068851_10000119 | 3300005834 | Bacteria | 42402 |
| 38 | Ga0079104_1000325 | 3300006946 | Bacteria | 58566 |
| 39 | Ga0079104_1000469 | 3300006946 | Bacteria | 45007 |
| 40 | Ga0105251_10000088 | 3300009011 | Bacteria | 88504 |
| 41 | Ga0105251_10000252 | 3300009011 | Bacteria | 53844 |
| 42 | Ga0105251_10000806 | 3300009011 | Bacteria | 28377 |
| 43 | Ga0105251_10002980 | 3300009011 | Bacteria | 12671 |
| 44 | Ga0105251_10003228 | 3300009011 | Bacteria | 12013 |
| 45 | Ga0105244_10000568 | 3300009036 | Bacteria | 33066 |
| 46 | Ga0105244_10000991 | 3300009036 | Bacteria | 23858 |
| 47 | Ga0105244_10001433 | 3300009036 | Bacteria | 19301 |
| 48 | Ga0105244_10001729 | 3300009036 | Bacteria | 17190 |
| 49 | Ga0105244_10015684 | 3300009036 | Bacteria | 4338 |
| 50 | Ga0105244_10022491 | 3300009036 | Bacteria | 3469 |
| 51 | Ga0105250_10000304 | 3300009092 | Bacteria | 38571 |
| 52 | Ga0105250_10000849 | 3300009092 | Bacteria | 18118 |
| 53 | Ga0105250_10005489 | 3300009092 | Bacteria | 5679 |
| 54 | Ga0105250_10010093 | 3300009092 | Bacteria | 3943 |
| 55 | Ga0105243_10000142 | 3300009148 | Bacteria | 82230 |
| 56 | Ga0105243_10002427 | 3300009148 | Bacteria | 15588 |
| 57 | Ga0105243_10014765 | 3300009148 | Bacteria | 5908 |
| 58 | Ga0105242_10003458 | 3300009176 | Bacteria | 12283 |
| 59 | Ga0105237_10000009 | 3300009545 | Bacteria | 337615 |
| 60 | Ga0105246_10000021 | 3300011119 | Bacteria | 59651 |
| 61 | Ga0105246_10005271 | 3300011119 | Bacteria | 7865 |
| 62 | Ga0105246_10051915 | 3300011119 | Bacteria | 2817 |
| 63 | Ga0157345_1000107 | 3300012498 | Bacteria | 15943 |
| 64 | Ga0157373_10000084 | 3300013100 | Bacteria | 81436 |
| 65 | Ga0157373_10000144 | 3300013100 | Bacteria | 56939 |
| 66 | Ga0157373_10000722 | 3300013100 | Bacteria | 25841 |
| 67 | Ga0157373_10005893 | 3300013100 | Bacteria | 9168 |
| 68 | Ga0157373_10009331 | 3300013100 | Bacteria | 7250 |
| 69 | Ga0157373_10027270 | 3300013100 | Bacteria | 4121 |
| 70 | Ga0157373_10043599 | 3300013100 | Bacteria | 3204 |
| 71 | Ga0157371_10000627 | 3300013102 | Bacteria | 41942 |
| 72 | Ga0157371_10001356 | 3300013102 | Bacteria | 25744 |
| 73 | Ga0157371_10001502 | 3300013102 | Bacteria | 24121 |
| 74 | Ga0157371_10007809 | 3300013102 | Bacteria | 8594 |
| 75 | Ga0157370_10064179 | 3300013104 | Bacteria | 3477 |
| 76 | Ga0157369_10001116 | 3300013105 | Bacteria | 33559 |
| 77 | Ga0157369_10002793 | 3300013105 | Bacteria | 20845 |
| 78 | Ga0157369_10004854 | 3300013105 | Bacteria | 15777 |
| 79 | Ga0157369_10007474 | 3300013105 | Bacteria | 12578 |
| 80 | Ga0157369_10010872 | 3300013105 | Bacteria | 10366 |
| 81 | Ga0163162_10000160 | 3300013306 | Bacteria | 62335 |
| 82 | Ga0157372_10001586 | 3300013307 | Bacteria | 24736 |
| 83 | Ga0157375_10000930 | 3300013308 | Bacteria | 25364 |
| 84 | Ga0157375_10001137 | 3300013308 | Bacteria | 23049 |
| 85 | Ga0157375_10021607 | 3300013308 | Bacteria | 5905 |
| 86 | Ga0182008_10000153 | 3300014497 | Bacteria | 54130 |
| 87 | Ga0182008_10000544 | 3300014497 | Bacteria | 28036 |
| 88 | Ga0182008_10001477 | 3300014497 | Bacteria | 15716 |
| 89 | Ga0182008_10001506 | 3300014497 | Bacteria | 15547 |
| 90 | Ga0182008_10001888 | 3300014497 | Bacteria | 13612 |
| 91 | Ga0182006_1000196 | 3300015261 | Bacteria | 62428 |
| 92 | Ga0182006_1000204 | 3300015261 | Bacteria | 59798 |
| 93 | Ga0182006_1003686 | 3300015261 | Bacteria | 7766 |
| 94 | Ga0182006_1008555 | 3300015261 | Bacteria | 4637 |
| 95 | Ga0182006_1008801 | 3300015261 | Bacteria | 4564 |
| 96 | Ga0182007_10000625 | 3300015262 | Bacteria | 20562 |
| 97 | Ga0182005_1000114 | 3300015265 | Bacteria | 57889 |
| 98 | Ga0163161_10000879 | 3300017792 | Bacteria | 23382 |
| 99 | Ga0163161_10001080 | 3300017792 | Bacteria | 20638 |
| 100 | Ga0163161_10004821 | 3300017792 | Bacteria | 9398 |
| 101 | Ga0163161_10011502 | 3300017792 | Bacteria | 6141 |
| 102 | Ga0163161_10023179 | 3300017792 | Bacteria | 4377 |
| 103 | Ga0209435_100440 | 3300025206 | Bacteria | 8429 |
| 104 | Ga0209760_100023 | 3300025207 | Bacteria | 159144 |
| 105 | Ga0209760_100033 | 3300025207 | Bacteria | 136583 |
| 106 | Ga0209784_100057 | 3300025224 | Bacteria | 167476 |
| 107 | Ga0209566_100073 | 3300025225 | Bacteria | 167476 |
| 108 | Ga0209674_100095 | 3300025226 | Bacteria | 167476 |
| 109 | Ga0209147_100092 | 3300025229 | Bacteria | 167476 |
| 110 | Ga0209563_100093 | 3300025230 | Bacteria | 167476 |
| 111 | Ga0209563_100649 | 3300025230 | Bacteria | 11178 |
| 112 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 113 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 114 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 115 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 116 | Ga0209258_100300 | 3300025242 | Bacteria | 80484 |
| 117 | Ga0209646_1000413 | 3300025246 | Bacteria | 24436 |
| 118 | Ga0209677_100054 | 3300025253 | Bacteria | 167476 |
| 119 | Ga0209759_1001701 | 3300025256 | Bacteria | 11410 |
| 120 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 121 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 122 | Ga0209675_1001274 | 3300025291 | Bacteria | 15065 |
| 123 | Ga0209676_1000055 | 3300025292 | Bacteria | 361565 |
| 124 | Ga0209676_1000062 | 3300025292 | Bacteria | 332319 |
| 125 | Ga0209676_1000407 | 3300025292 | Bacteria | 77466 |
| 126 | Ga0209676_1001180 | 3300025292 | Bacteria | 28279 |
| 127 | Ga0209676_1001565 | 3300025292 | Bacteria | 20454 |
| 128 | Ga0209050_1000079 | 3300025298 | Bacteria | 277803 |
| 129 | Ga0209050_1000150 | 3300025298 | Bacteria | 162946 |
| 130 | Ga0209050_1000231 | 3300025298 | Bacteria | 122373 |
| 131 | Ga0209050_1000920 | 3300025298 | Bacteria | 38750 |
| 132 | Ga0209051_1000054 | 3300025303 | Bacteria | 280804 |
| 133 | Ga0209051_1000162 | 3300025303 | Bacteria | 125696 |
| 134 | Ga0209051_1000165 | 3300025303 | Bacteria | 122373 |
| 135 | Ga0209051_1006812 | 3300025303 | Bacteria | 6361 |
| 136 | Ga0209257_1000483 | 3300025304 | Bacteria | 72183 |
| 137 | Ga0207656_10002363 | 3300025321 | Bacteria | 6334 |
| 138 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 139 | Ga0207696_1000023 | 3300025711 | Bacteria | 422195 |
| 140 | Ga0207696_1000108 | 3300025711 | Bacteria | 157445 |
| 141 | Ga0207696_1000161 | 3300025711 | Bacteria | 109070 |
| 142 | Ga0207696_1000916 | 3300025711 | Bacteria | 18208 |
| 143 | Ga0207696_1003059 | 3300025711 | Bacteria | 7801 |
| 144 | Ga0207655_1000006 | 3300025728 | Bacteria | 861092 |
| 145 | Ga0207655_1000085 | 3300025728 | Bacteria | 206425 |
| 146 | Ga0207655_1000114 | 3300025728 | Bacteria | 164098 |
| 147 | Ga0207655_1002192 | 3300025728 | Bacteria | 16211 |
| 148 | Ga0207655_1004671 | 3300025728 | Bacteria | 9604 |
| 149 | Ga0207655_1014631 | 3300025728 | Bacteria | 4418 |
| 150 | Ga0207713_1000102 | 3300025735 | Bacteria | 139512 |
| 151 | Ga0207713_1000313 | 3300025735 | Bacteria | 55095 |
| 152 | Ga0207713_1000581 | 3300025735 | Bacteria | 36390 |
| 153 | Ga0207713_1001194 | 3300025735 | Bacteria | 21812 |
| 154 | Ga0207713_1001284 | 3300025735 | Bacteria | 20704 |
| 155 | Ga0207713_1002575 | 3300025735 | Bacteria | 13100 |
| 156 | Ga0207713_1009590 | 3300025735 | Bacteria | 5441 |
| 157 | Ga0207671_10000561 | 3300025914 | Bacteria | 49927 |
| 158 | Ga0207649_10000032 | 3300025920 | Bacteria | 143552 |
| 159 | Ga0207681_10000299 | 3300025923 | Bacteria | 36494 |
| 160 | Ga0207650_10000068 | 3300025925 | Bacteria | 139947 |
| 161 | Ga0207650_10000259 | 3300025925 | Bacteria | 56695 |
| 162 | Ga0207706_10004102 | 3300025933 | Bacteria | 13761 |
| 163 | Ga0207686_10010366 | 3300025934 | Bacteria | 5074 |
| 164 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 165 | Ga0207709_10001540 | 3300025935 | Bacteria | 15831 |
| 166 | Ga0207679_10000059 | 3300025945 | Bacteria | 101268 |
| 167 | Ga0207639_10022337 | 3300026041 | Bacteria | 4557 |
| 168 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 169 | Ga0209281_1000320 | 3300027111 | Bacteria | 84410 |
| 170 | Ga0207428_10008371 | 3300027907 | Bacteria | 9344 |
| 171 | Ga0316178_1045217 | 3300030735 | Bacteria | 8711 |
| 172 | Ga0307408_100000643 | 3300031548 | Bacteria | 29323 |
| 173 | Ga0307408_100014161 | 3300031548 | Bacteria | 5298 |
| 174 | Ga0307405_10000118 | 3300031731 | Bacteria | 31782 |
| 175 | Ga0307405_10002752 | 3300031731 | Bacteria | 7876 |
| 176 | Ga0307405_10005455 | 3300031731 | Bacteria | 6134 |
| 177 | Ga0307413_10004849 | 3300031824 | Bacteria | 5911 |
| 178 | Ga0307406_10036598 | 3300031901 | Bacteria | 3025 |
| 179 | Ga0307412_10000870 | 3300031911 | Bacteria | 17357 |
| 180 | Ga0307412_10001362 | 3300031911 | Bacteria | 13586 |
| 181 | Ga0307412_10004723 | 3300031911 | Bacteria | 7600 |
| 182 | Ga0307412_10010330 | 3300031911 | Bacteria | 5376 |
| 183 | Ga0307409_100054103 | 3300031995 | Bacteria | 3089 |
| 184 | Ga0307411_10014170 | 3300032005 | Bacteria | 4427 |
| 185 | Ga0307510_10000942 | 3300033180 | Bacteria | 30746 |
| 186 | Ga0439438_000293 | 3300041405 | Bacteria | 22448 |
| 187 | Ga0439438_000301 | 3300041405 | Bacteria | 22145 |
| 188 | Ga0439438_000361 | 3300041405 | Bacteria | 20332 |
| 189 | Ga0439438_000422 | 3300041405 | Bacteria | 19123 |
| 190 | Ga0439438_000485 | 3300041405 | Bacteria | 17984 |
| 191 | Ga0439438_000542 | 3300041405 | Bacteria | 17184 |
| 192 | Ga0439438_000684 | 3300041405 | Bacteria | 15198 |
| 193 | Ga0439438_001715 | 3300041405 | Bacteria | 9651 |
| 194 | Ga0439447_000030 | 3300041407 | Bacteria | 49948 |
| 195 | Ga0439447_000150 | 3300041407 | Bacteria | 24059 |
| 196 | Ga0439447_000314 | 3300041407 | Bacteria | 17399 |
| 197 | Ga0439447_000344 | 3300041407 | Bacteria | 16773 |
| 198 | Ga0439466_0000044 | 3300041411 | Bacteria | 49151 |
| 199 | Ga0439466_0000221 | 3300041411 | Bacteria | 22462 |
| 200 | Ga0439466_0000454 | 3300041411 | Bacteria | 15620 |
| 201 | Ga0439466_0001484 | 3300041411 | Bacteria | 9159 |
| 202 | Ga0439466_0004613 | 3300041411 | Bacteria | 5294 |
| 203 | Ga0439432_000084 | 3300042006 | Bacteria | 29253 |
| 204 | Ga0439432_003335 | 3300042006 | Bacteria | 5965 |
| 205 | Ga0439452_000098 | 3300042010 | Bacteria | 73779 |
| 206 | Ga0439452_000221 | 3300042010 | Bacteria | 40244 |
| 207 | Ga0439452_000411 | 3300042010 | Bacteria | 25146 |
| 208 | Ga0439452_000417 | 3300042010 | Bacteria | 24852 |
| 209 | Ga0439452_001041 | 3300042010 | Bacteria | 12262 |
| 210 | Ga0439452_003099 | 3300042010 | Bacteria | 5894 |
| 211 | Ga0439452_006573 | 3300042010 | Bacteria | 3633 |
| 212 | Ga0439456_000067 | 3300042013 | Bacteria | 37007 |
| 213 | Ga0439456_001379 | 3300042013 | Bacteria | 4863 |
| 214 | Ga0439463_000007 | 3300042016 | Bacteria | 44178 |
| 215 | Ga0439463_000123 | 3300042016 | Bacteria | 19502 |
| 216 | Ga0450911_000491 | 3300042115 | Bacteria | 12581 |
| 217 | Ga0450911_000528 | 3300042115 | Bacteria | 12058 |
| 218 | Ga0450911_001293 | 3300042115 | Bacteria | 5945 |
| 219 | Ga0450920_002980 | 3300042122 | Bacteria | 2915 |
| 220 | Ga0450890_000184 | 3300042127 | Bacteria | 9474 |
| 221 | Ga0450903_000914 | 3300042138 | Bacteria | 5662 |
| 222 | Ga0450903_001189 | 3300042138 | Bacteria | 4904 |
| 223 | Ga0450907_000051 | 3300042146 | Bacteria | 49159 |
| 224 | Ga0450907_004285 | 3300042146 | Bacteria | 2465 |
| 225 | Ga0439446_0001954 | 3300042156 | Bacteria | 4858 |
| 226 | Ga0450908_001635 | 3300042184 | Bacteria | 4359 |
| 227 | Ga0439434_0000099 | 3300042435 | Bacteria | 22061 |
| 228 | Ga0450901_000277 | 3300042533 | Bacteria | 6248 |
| 229 | Ga0439440_0002565 | 3300042993 | Bacteria | 3440 |
| 230 | Ga0495617_000680 | 3300046452 | Bacteria | 17010 |
| 231 | Ga0495617_000753 | 3300046452 | Bacteria | 15874 |
| 232 | Ga0495617_003142 | 3300046452 | Bacteria | 6286 |
| 233 | Ga0495617_004223 | 3300046452 | Bacteria | 5251 |
| 234 | Ga0495617_006186 | 3300046452 | Bacteria | 4212 |
| 235 | Ga0495627_000040 | 3300046453 | Bacteria | 195248 |
| 236 | Ga0495627_000137 | 3300046453 | Bacteria | 87495 |
| 237 | Ga0495627_000717 | 3300046453 | Bacteria | 25223 |
| 238 | Ga0495627_000779 | 3300046453 | Bacteria | 23541 |
| 239 | Ga0495627_001112 | 3300046453 | Bacteria | 17471 |
| 240 | Ga0495627_008328 | 3300046453 | Bacteria | 3899 |
| 241 | Ga0495627_010140 | 3300046453 | Bacteria | 3439 |
| 242 | Ga0495592_0002034 | 3300046454 | Bacteria | 14238 |
| 243 | Ga0495603_0005081 | 3300046455 | Bacteria | 7860 |
| 244 | Ga0495603_0007162 | 3300046455 | Bacteria | 6698 |
| 245 | Ga0495603_0011746 | 3300046455 | Bacteria | 5299 |
| 246 | Ga0495590_0000617 | 3300046457 | Bacteria | 16575 |
| 247 | Ga0495590_0000828 | 3300046457 | Bacteria | 14007 |
| 248 | Ga0495590_0011298 | 3300046457 | Bacteria | 3341 |
| 249 | Ga0495591_000023 | 3300046458 | Bacteria | 191598 |
| 250 | Ga0495591_000121 | 3300046458 | Bacteria | 84919 |
| 251 | Ga0495591_000374 | 3300046458 | Bacteria | 37971 |
| 252 | Ga0495591_000602 | 3300046458 | Bacteria | 27259 |
| 253 | Ga0495591_000680 | 3300046458 | Bacteria | 24850 |
| 254 | Ga0495591_000883 | 3300046458 | Bacteria | 21048 |
| 255 | Ga0495591_001537 | 3300046458 | Bacteria | 14147 |
| 256 | Ga0495591_001611 | 3300046458 | Bacteria | 13651 |
| 257 | Ga0495591_001776 | 3300046458 | Bacteria | 12780 |
| 258 | Ga0495591_002577 | 3300046458 | Bacteria | 9968 |
| 259 | Ga0495591_003036 | 3300046458 | Bacteria | 8933 |
| 260 | Ga0495591_004449 | 3300046458 | Bacteria | 6869 |
| 261 | Ga0495591_009603 | 3300046458 | Bacteria | 3827 |
| 262 | Ga0495591_012387 | 3300046458 | Bacteria | 3179 |
| 263 | Ga0495638_0000863 | 3300046460 | Bacteria | 31475 |
| 264 | Ga0495638_0000866 | 3300046460 | Bacteria | 31458 |
| 265 | Ga0495638_0001203 | 3300046460 | Bacteria | 24737 |
| 266 | Ga0495638_0002533 | 3300046460 | Bacteria | 14858 |
| 267 | Ga0495638_0006333 | 3300046460 | Bacteria | 8625 |
| 268 | Ga0495638_0016361 | 3300046460 | Bacteria | 4969 |
| 269 | Ga0495638_0019834 | 3300046460 | Bacteria | 4445 |
| 270 | Ga0495638_0042032 | 3300046460 | Bacteria | 2889 |
| 271 | Ga0495653_0001725 | 3300046463 | Bacteria | 17228 |
| 272 | Ga0495653_0004101 | 3300046463 | Bacteria | 11780 |
| 273 | Ga0495653_0004352 | 3300046463 | Bacteria | 11455 |
| 274 | Ga0495653_0038108 | 3300046463 | Bacteria | 3773 |
| 275 | Ga0495653_0088730 | 3300046463 | Bacteria | 2267 |
| 276 | Ga0495650_0001031 | 3300046471 | Bacteria | 31301 |
| 277 | Ga0495650_0001290 | 3300046471 | Bacteria | 25556 |
| 278 | Ga0495650_0003268 | 3300046471 | Bacteria | 12012 |
| 279 | Ga0495650_0003921 | 3300046471 | Bacteria | 10490 |
| 280 | Ga0495650_0011448 | 3300046471 | Bacteria | 4857 |
| 281 | Ga0495650_0021035 | 3300046471 | Bacteria | 3163 |
| 282 | Ga0495650_0021550 | 3300046471 | Bacteria | 3110 |
| 283 | Ga0495605_0000048 | 3300046474 | Bacteria | 170182 |
| 284 | Ga0495605_0000094 | 3300046474 | Bacteria | 112717 |
| 285 | Ga0495605_0000245 | 3300046474 | Bacteria | 64374 |
| 286 | Ga0495605_0000291 | 3300046474 | Bacteria | 55348 |
| 287 | Ga0495605_0000540 | 3300046474 | Bacteria | 31251 |
| 288 | Ga0495605_0000819 | 3300046474 | Bacteria | 22153 |
| 289 | Ga0495605_0001092 | 3300046474 | Bacteria | 18070 |
| 290 | Ga0495605_0002324 | 3300046474 | Bacteria | 11849 |
| 291 | Ga0495605_0003619 | 3300046474 | Bacteria | 9169 |
| 292 | Ga0495605_0007563 | 3300046474 | Bacteria | 6161 |
| 293 | Ga0495605_0008610 | 3300046474 | Bacteria | 5763 |
| 294 | Ga0495605_0010265 | 3300046474 | Bacteria | 5244 |
| 295 | Ga0495605_0021314 | 3300046474 | Bacteria | 3434 |
| 296 | Ga0495605_0022598 | 3300046474 | Bacteria | 3319 |
| 297 | Ga0495584_0000399 | 3300046491 | Bacteria | 29968 |
| 298 | Ga0495584_0000404 | 3300046491 | Bacteria | 29798 |
| 299 | Ga0495584_0000586 | 3300046491 | Bacteria | 24569 |
| 300 | Ga0495584_0001339 | 3300046491 | Bacteria | 14915 |
| 301 | Ga0495584_0002533 | 3300046491 | Bacteria | 10335 |
| 302 | Ga0495584_0003400 | 3300046491 | Bacteria | 8777 |
| 303 | Ga0495584_0006532 | 3300046491 | Bacteria | 6095 |
| 304 | Ga0495584_0014937 | 3300046491 | Bacteria | 3956 |
| 305 | Ga0495584_0020350 | 3300046491 | Bacteria | 3372 |
| 306 | Ga0495585_0000016 | 3300046492 | Bacteria | 175433 |
| 307 | Ga0495585_0000573 | 3300046492 | Bacteria | 34626 |
| 308 | Ga0495585_0000728 | 3300046492 | Bacteria | 29361 |
| 309 | Ga0495585_0001186 | 3300046492 | Bacteria | 21163 |
| 310 | Ga0495585_0001801 | 3300046492 | Bacteria | 16286 |
| 311 | Ga0495585_0002780 | 3300046492 | Bacteria | 12198 |
| 312 | Ga0495585_0005166 | 3300046492 | Bacteria | 8289 |
| 313 | Ga0495585_0005839 | 3300046492 | Bacteria | 7717 |
| 314 | Ga0495585_0006587 | 3300046492 | Bacteria | 7180 |
| 315 | Ga0495585_0006653 | 3300046492 | Bacteria | 7141 |
| 316 | Ga0495585_0011754 | 3300046492 | Bacteria | 5174 |
| 317 | Ga0495585_0019894 | 3300046492 | Bacteria | 3864 |
| 318 | Ga0495594_0001163 | 3300046499 | Bacteria | 13760 |
| 319 | Ga0495594_0002271 | 3300046499 | Bacteria | 10017 |
| 320 | Ga0495594_0003085 | 3300046499 | Bacteria | 8624 |
| 321 | Ga0495596_0000056 | 3300046500 | Bacteria | 81755 |
| 322 | Ga0495607_0000185 | 3300046501 | Bacteria | 66759 |
| 323 | Ga0495607_0000234 | 3300046501 | Bacteria | 59488 |
| 324 | Ga0495607_0000384 | 3300046501 | Bacteria | 45360 |
| 325 | Ga0495607_0000476 | 3300046501 | Bacteria | 40088 |
| 326 | Ga0495607_0000986 | 3300046501 | Bacteria | 26290 |
| 327 | Ga0495607_0001382 | 3300046501 | Bacteria | 21588 |
| 328 | Ga0495607_0001919 | 3300046501 | Bacteria | 17576 |
| 329 | Ga0495607_0002375 | 3300046501 | Bacteria | 15369 |
| 330 | Ga0495607_0002946 | 3300046501 | Bacteria | 13373 |
| 331 | Ga0495607_0003070 | 3300046501 | Bacteria | 12982 |
| 332 | Ga0495607_0003722 | 3300046501 | Bacteria | 11553 |
| 333 | Ga0495607_0006942 | 3300046501 | Bacteria | 7894 |
| 334 | Ga0495607_0007472 | 3300046501 | Bacteria | 7559 |
| 335 | Ga0495607_0007717 | 3300046501 | Bacteria | 7408 |
| 336 | Ga0495607_0015411 | 3300046501 | Bacteria | 4955 |
| 337 | Ga0495607_0019575 | 3300046501 | Bacteria | 4297 |
| 338 | Ga0495607_0021166 | 3300046501 | Bacteria | 4095 |
| 339 | Ga0495583_0000096 | 3300046506 | Bacteria | 151090 |
| 340 | Ga0495583_0000387 | 3300046506 | Bacteria | 67820 |
| 341 | Ga0495583_0000540 | 3300046506 | Bacteria | 53188 |
| 342 | Ga0495583_0001059 | 3300046506 | Bacteria | 30793 |
| 343 | Ga0495583_0002874 | 3300046506 | Bacteria | 13969 |
| 344 | Ga0495583_0002888 | 3300046506 | Bacteria | 13904 |
| 345 | Ga0495583_0004286 | 3300046506 | Bacteria | 10327 |
| 346 | Ga0495583_0007621 | 3300046506 | Bacteria | 6757 |
| 347 | Ga0495583_0009297 | 3300046506 | Bacteria | 5887 |
| 348 | Ga0495583_0012328 | 3300046506 | Bacteria | 4846 |
| 349 | Ga0495606_0000167 | 3300046507 | Bacteria | 115739 |
| 350 | Ga0495606_0001446 | 3300046507 | Bacteria | 31847 |
| 351 | Ga0495606_0001484 | 3300046507 | Bacteria | 31212 |
| 352 | Ga0495606_0002351 | 3300046507 | Bacteria | 22217 |
| 353 | Ga0495606_0002412 | 3300046507 | Bacteria | 21830 |
| 354 | Ga0495606_0002769 | 3300046507 | Bacteria | 19628 |
| 355 | Ga0495606_0002977 | 3300046507 | Bacteria | 18626 |
| 356 | Ga0495606_0004429 | 3300046507 | Bacteria | 14042 |
| 357 | Ga0495606_0007966 | 3300046507 | Bacteria | 9325 |
| 358 | Ga0495606_0008379 | 3300046507 | Bacteria | 8997 |
| 359 | Ga0495606_0010712 | 3300046507 | Bacteria | 7564 |
| 360 | Ga0495610_0000653 | 3300046512 | Bacteria | 33834 |
| 361 | Ga0495610_0000661 | 3300046512 | Bacteria | 33537 |
| 362 | Ga0495610_0002742 | 3300046512 | Bacteria | 14481 |
| 363 | Ga0495610_0003790 | 3300046512 | Bacteria | 11531 |
| 364 | Ga0495610_0003827 | 3300046512 | Bacteria | 11464 |
| 365 | Ga0495610_0011390 | 3300046512 | Bacteria | 5441 |
| 366 | Ga0495610_0012866 | 3300046512 | Bacteria | 5004 |
| 367 | Ga0495610_0013096 | 3300046512 | Bacteria | 4945 |
| 368 | Ga0495610_0018470 | 3300046512 | Bacteria | 3936 |
| 369 | Ga0495610_0019340 | 3300046512 | Bacteria | 3815 |
| 370 | Ga0495610_0024372 | 3300046512 | Bacteria | 3266 |
| 371 | Ga0495616_0000608 | 3300046513 | Bacteria | 26998 |
| 372 | Ga0495616_0000766 | 3300046513 | Bacteria | 23496 |
| 373 | Ga0495616_0000828 | 3300046513 | Bacteria | 22582 |
| 374 | Ga0495616_0001062 | 3300046513 | Bacteria | 19627 |
| 375 | Ga0495616_0001072 | 3300046513 | Bacteria | 19416 |
| 376 | Ga0495616_0001572 | 3300046513 | Bacteria | 15709 |
| 377 | Ga0495620_0000001 | 3300046515 | Bacteria | 386508 |
| 378 | Ga0495620_0000346 | 3300046515 | Bacteria | 32234 |
| 379 | Ga0495620_0000578 | 3300046515 | Bacteria | 23002 |
| 380 | Ga0495620_0000622 | 3300046515 | Bacteria | 22053 |
| 381 | Ga0495620_0001067 | 3300046515 | Bacteria | 16797 |
| 382 | Ga0495620_0001186 | 3300046515 | Bacteria | 15953 |
| 383 | Ga0495620_0001539 | 3300046515 | Bacteria | 13713 |
| 384 | Ga0495620_0002478 | 3300046515 | Bacteria | 10699 |
| 385 | Ga0495620_0003199 | 3300046515 | Bacteria | 9400 |
| 386 | Ga0495620_0003624 | 3300046515 | Bacteria | 8813 |
| 387 | Ga0495620_0007173 | 3300046515 | Bacteria | 6073 |
| 388 | Ga0495620_0010605 | 3300046515 | Bacteria | 4853 |
| 389 | Ga0495620_0015139 | 3300046515 | Bacteria | 3901 |
| 390 | Ga0495620_0017045 | 3300046515 | Bacteria | 3631 |
| 391 | Ga0495628_0012033 | 3300046516 | Bacteria | 7297 |
| 392 | Ga0495630_0010976 | 3300046517 | Bacteria | 6549 |
| 393 | Ga0495631_0000412 | 3300046518 | Bacteria | 29545 |
| 394 | Ga0495631_0001024 | 3300046518 | Bacteria | 17367 |
| 395 | Ga0495631_0001633 | 3300046518 | Bacteria | 13379 |
| 396 | Ga0495631_0003157 | 3300046518 | Bacteria | 9065 |
| 397 | Ga0495631_0008356 | 3300046518 | Bacteria | 5217 |
| 398 | Ga0495631_0028509 | 3300046518 | Bacteria | 2546 |
| 399 | Ga0495632_0000676 | 3300046519 | Bacteria | 31107 |
| 400 | Ga0495632_0000933 | 3300046519 | Bacteria | 25639 |
| 401 | Ga0495632_0001632 | 3300046519 | Bacteria | 18392 |
| 402 | Ga0495632_0002645 | 3300046519 | Bacteria | 13462 |
| 403 | Ga0495632_0003477 | 3300046519 | Bacteria | 11140 |
| 404 | Ga0495632_0003748 | 3300046519 | Bacteria | 10633 |
| 405 | Ga0495632_0004501 | 3300046519 | Bacteria | 9447 |
| 406 | Ga0495632_0005142 | 3300046519 | Bacteria | 8732 |
| 407 | Ga0495632_0006133 | 3300046519 | Bacteria | 7790 |
| 408 | Ga0495632_0008892 | 3300046519 | Bacteria | 6103 |
| 409 | Ga0495632_0008950 | 3300046519 | Bacteria | 6074 |
| 410 | Ga0495632_0009751 | 3300046519 | Bacteria | 5757 |
| 411 | Ga0495632_0018218 | 3300046519 | Bacteria | 3858 |
| 412 | Ga0495632_0019041 | 3300046519 | Bacteria | 3748 |
| 413 | Ga0495632_0021350 | 3300046519 | Bacteria | 3490 |
| 414 | Ga0495637_0000115 | 3300046520 | Bacteria | 58484 |
| 415 | Ga0495637_0000134 | 3300046520 | Bacteria | 55462 |
| 416 | Ga0495637_0000437 | 3300046520 | Bacteria | 30389 |
| 417 | Ga0495637_0000671 | 3300046520 | Bacteria | 23799 |
| 418 | Ga0495637_0000957 | 3300046520 | Bacteria | 18433 |
| 419 | Ga0495637_0001931 | 3300046520 | Bacteria | 11762 |
| 420 | Ga0495637_0002379 | 3300046520 | Bacteria | 10426 |
| 421 | Ga0495637_0004345 | 3300046520 | Bacteria | 7354 |
| 422 | Ga0495637_0004730 | 3300046520 | Bacteria | 7026 |
| 423 | Ga0495637_0006284 | 3300046520 | Bacteria | 5977 |
| 424 | Ga0495637_0006313 | 3300046520 | Bacteria | 5963 |
| 425 | Ga0495637_0018177 | 3300046520 | Bacteria | 3265 |
| 426 | Ga0495643_0001468 | 3300046522 | Bacteria | 21558 |
| 427 | Ga0495643_0002308 | 3300046522 | Bacteria | 15389 |
| 428 | Ga0495643_0004573 | 3300046522 | Bacteria | 9631 |
| 429 | Ga0495643_0009900 | 3300046522 | Bacteria | 5894 |
| 430 | Ga0495644_0000240 | 3300046523 | Bacteria | 25809 |
| 431 | Ga0495644_0000254 | 3300046523 | Bacteria | 24599 |
| 432 | Ga0495644_0011678 | 3300046523 | Bacteria | 3381 |
| 433 | Ga0495648_0000585 | 3300046524 | Bacteria | 39042 |
| 434 | Ga0495648_0001289 | 3300046524 | Bacteria | 24984 |
| 435 | Ga0495648_0001791 | 3300046524 | Bacteria | 20663 |
| 436 | Ga0495648_0001832 | 3300046524 | Bacteria | 20450 |
| 437 | Ga0495648_0002294 | 3300046524 | Bacteria | 17847 |
| 438 | Ga0495648_0002558 | 3300046524 | Bacteria | 16666 |
| 439 | Ga0495648_0005559 | 3300046524 | Bacteria | 10454 |
| 440 | Ga0495648_0007982 | 3300046524 | Bacteria | 8397 |
| 441 | Ga0495648_0010168 | 3300046524 | Bacteria | 7195 |
| 442 | Ga0495648_0015825 | 3300046524 | Bacteria | 5452 |
| 443 | Ga0495648_0025846 | 3300046524 | Bacteria | 3965 |
| 444 | Ga0495648_0030467 | 3300046524 | Bacteria | 3566 |
| 445 | Ga0495666_0000146 | 3300046526 | Bacteria | 29741 |
| 446 | Ga0495642_0000030 | 3300046528 | Bacteria | 89032 |
| 447 | Ga0495642_0000419 | 3300046528 | Bacteria | 22623 |
| 448 | Ga0495642_0001771 | 3300046528 | Bacteria | 9310 |
| 449 | Ga0495652_0071822 | 3300046529 | Bacteria | 2887 |
| 450 | Ga0495654_0000166 | 3300046530 | Bacteria | 64935 |
| 451 | Ga0495654_0000545 | 3300046530 | Bacteria | 30346 |
| 452 | Ga0495654_0001158 | 3300046530 | Bacteria | 18860 |
| 453 | Ga0495654_0001616 | 3300046530 | Bacteria | 15253 |
| 454 | Ga0495654_0002063 | 3300046530 | Bacteria | 13187 |
| 455 | Ga0495654_0002136 | 3300046530 | Bacteria | 12904 |
| 456 | Ga0495654_0003356 | 3300046530 | Bacteria | 9863 |
| 457 | Ga0495654_0004479 | 3300046530 | Bacteria | 8279 |
| 458 | Ga0495654_0011954 | 3300046530 | Bacteria | 4679 |
| 459 | Ga0495654_0016664 | 3300046530 | Bacteria | 3875 |
| 460 | Ga0495587_0001087 | 3300046536 | Bacteria | 17851 |
| 461 | Ga0495587_0009839 | 3300046536 | Bacteria | 6107 |
| 462 | Ga0495609_0000012 | 3300046538 | Bacteria | 333994 |
| 463 | Ga0495609_0000167 | 3300046538 | Bacteria | 68911 |
| 464 | Ga0495609_0000259 | 3300046538 | Bacteria | 49945 |
| 465 | Ga0495609_0000516 | 3300046538 | Bacteria | 31142 |
| 466 | Ga0495609_0001015 | 3300046538 | Bacteria | 19951 |
| 467 | Ga0495609_0002648 | 3300046538 | Bacteria | 10853 |
| 468 | Ga0495609_0016766 | 3300046538 | Bacteria | 3411 |
| 469 | Ga0495597_0000016 | 3300046542 | Bacteria | 167456 |
| 470 | Ga0495597_0000935 | 3300046542 | Bacteria | 22608 |
| 471 | Ga0495597_0001278 | 3300046542 | Bacteria | 18547 |
| 472 | Ga0495597_0001752 | 3300046542 | Bacteria | 14937 |
| 473 | Ga0495645_0011624 | 3300046543 | Bacteria | 6201 |
| 474 | Ga0495622_0000442 | 3300046557 | Bacteria | 26797 |
| 475 | Ga0495622_0001398 | 3300046557 | Bacteria | 12252 |
| 476 | Ga0495622_0001451 | 3300046557 | Bacteria | 11939 |
| 477 | Ga0495622_0004053 | 3300046557 | Bacteria | 6837 |
| 478 | Ga0495622_0006931 | 3300046557 | Bacteria | 5261 |
| 479 | Ga0495633_0000034 | 3300046558 | Bacteria | 185552 |
| 480 | Ga0495633_0001148 | 3300046558 | Bacteria | 21253 |
| 481 | Ga0495633_0001544 | 3300046558 | Bacteria | 17674 |
| 482 | Ga0495656_0005899 | 3300046615 | Bacteria | 4260 |
| 483 | Ga0495668_0001309 | 3300046616 | Bacteria | 24541 |
| 484 | Ga0495668_0001799 | 3300046616 | Bacteria | 19553 |
| 485 | Ga0495668_0004994 | 3300046616 | Bacteria | 9166 |
| 486 | Ga0495668_0008942 | 3300046616 | Bacteria | 6190 |
| 487 | Ga0495668_0010523 | 3300046616 | Bacteria | 5594 |
| 488 | Ga0495634_0000895 | 3300046642 | Bacteria | 28607 |
| 489 | Ga0495611_0000520 | 3300046648 | Bacteria | 22902 |
| 490 | Ga0495611_0000948 | 3300046648 | Bacteria | 15535 |
| 491 | Ga0495611_0001788 | 3300046648 | Bacteria | 10349 |
| 492 | Ga0495611_0004324 | 3300046648 | Bacteria | 6164 |
| 493 | Ga0495611_0004820 | 3300046648 | Bacteria | 5799 |
| 494 | Ga0495625_0000134 | 3300046660 | Bacteria | 115073 |
| 495 | Ga0495625_0001917 | 3300046660 | Bacteria | 23514 |
| 496 | Ga0495625_0002078 | 3300046660 | Bacteria | 22425 |
| 497 | Ga0495625_0002135 | 3300046660 | Bacteria | 22023 |
| 498 | Ga0495625_0018969 | 3300046660 | Bacteria | 5352 |
| 499 | Ga0495625_0021557 | 3300046660 | Bacteria | 4958 |
| 500 | Ga0495625_0038111 | 3300046660 | Bacteria | 3520 |
| 501 | Ga0495625_0044933 | 3300046660 | Bacteria | 3196 |
| 502 | Ga0495635_0001544 | 3300046663 | Bacteria | 15435 |
| 503 | Ga0495635_0001565 | 3300046663 | Bacteria | 15358 |
| 504 | Ga0495659_0000081 | 3300046664 | Bacteria | 41113 |
| 505 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 506 | Ga0495661_0000030 | 3300046665 | Bacteria | 171980 |
| 507 | Ga0495661_0000088 | 3300046665 | Bacteria | 111782 |
| 508 | Ga0495661_0000692 | 3300046665 | Bacteria | 33517 |
| 509 | Ga0495661_0000896 | 3300046665 | Bacteria | 27460 |
| 510 | Ga0495661_0001895 | 3300046665 | Bacteria | 16690 |
| 511 | Ga0495661_0003936 | 3300046665 | Bacteria | 10849 |
| 512 | Ga0495661_0005454 | 3300046665 | Bacteria | 9025 |
| 513 | Ga0495661_0011952 | 3300046665 | Bacteria | 5876 |
| 514 | Ga0495661_0013930 | 3300046665 | Bacteria | 5392 |
| 515 | Ga0495661_0014090 | 3300046665 | Bacteria | 5357 |
| 516 | Ga0495588_0002797 | 3300046674 | Bacteria | 7498 |
| 517 | Ga0495623_0001124 | 3300046679 | Bacteria | 18068 |
| 518 | Ga0495623_0002784 | 3300046679 | Bacteria | 11539 |
| 519 | Ga0495646_0003001 | 3300046680 | Bacteria | 10468 |
| 520 | Ga0495646_0005182 | 3300046680 | Bacteria | 8221 |
| 521 | Ga0495646_0006595 | 3300046680 | Bacteria | 7364 |
| 522 | Ga0495669_0000311 | 3300046684 | Bacteria | 26905 |
| 523 | Ga0495624_0000246 | 3300046690 | Bacteria | 42607 |
| 524 | Ga0495670_0000240 | 3300046691 | Bacteria | 25262 |
| 525 | Ga0495670_0000578 | 3300046691 | Bacteria | 17520 |
| 526 | Ga0495670_0001618 | 3300046691 | Bacteria | 11037 |
| 527 | Ga0495670_0004434 | 3300046691 | Bacteria | 6885 |
| 528 | Ga0495670_0004494 | 3300046691 | Bacteria | 6835 |
| 529 | Ga0495670_0005903 | 3300046691 | Bacteria | 5994 |
| 530 | Ga0495670_0009221 | 3300046691 | Bacteria | 4853 |
| 531 | Ga0495670_0009626 | 3300046691 | Bacteria | 4747 |
| 532 | Ga0495670_0013493 | 3300046691 | Bacteria | 4019 |
| 533 | Ga0495670_0017620 | 3300046691 | Bacteria | 3517 |
| 534 | Ga0495671_0000289 | 3300046692 | Bacteria | 42005 |
| 535 | Ga0495671_0000399 | 3300046692 | Bacteria | 35329 |
| 536 | Ga0495671_0000852 | 3300046692 | Bacteria | 21808 |
| 537 | Ga0495671_0000981 | 3300046692 | Bacteria | 19921 |
| 538 | Ga0495671_0003292 | 3300046692 | Bacteria | 9992 |
| 539 | Ga0495671_0007768 | 3300046692 | Bacteria | 6077 |
| 540 | Ga0495671_0008182 | 3300046692 | Bacteria | 5901 |
| 541 | Ga0495671_0008861 | 3300046692 | Bacteria | 5650 |
| 542 | Ga0495671_0012279 | 3300046692 | Bacteria | 4681 |
| 543 | Ga0495671_0015271 | 3300046692 | Bacteria | 4119 |
| 544 | Ga0495671_0017467 | 3300046692 | Bacteria | 3819 |
| 545 | Ga0495671_0017702 | 3300046692 | Bacteria | 3790 |
| 546 | Ga0495671_0036457 | 3300046692 | Bacteria | 2490 |
| 547 | Ga0495671_0037045 | 3300046692 | Bacteria | 2468 |
| 548 | Ga0495649_0000719 | 3300046694 | Bacteria | 26925 |
| 549 | Ga0495649_0000852 | 3300046694 | Bacteria | 24527 |
| 550 | Ga0495649_0000876 | 3300046694 | Bacteria | 24155 |
| 551 | Ga0495649_0001220 | 3300046694 | Bacteria | 19804 |
| 552 | Ga0495649_0004127 | 3300046694 | Bacteria | 9538 |
| 553 | Ga0495649_0012248 | 3300046694 | Bacteria | 4999 |
| 554 | Ga0495649_0012561 | 3300046694 | Bacteria | 4919 |
| 555 | Ga0495649_0014236 | 3300046694 | Bacteria | 4566 |
| 556 | Ga0495649_0016899 | 3300046694 | Bacteria | 4129 |
| 557 | Ga0495649_0018590 | 3300046694 | Bacteria | 3908 |
| 558 | Ga0495649_0031319 | 3300046694 | Bacteria | 2933 |
| 559 | Ga0495589_0000482 | 3300046794 | Bacteria | 28591 |
| 560 | Ga0495589_0001445 | 3300046794 | Bacteria | 13698 |
| 561 | Ga0495589_0001685 | 3300046794 | Bacteria | 12641 |
| 562 | Ga0495589_0002256 | 3300046794 | Bacteria | 10833 |
| 563 | Ga0495589_0002303 | 3300046794 | Bacteria | 10737 |
| 564 | Ga0495589_0004256 | 3300046794 | Bacteria | 7657 |
| 565 | Ga0495589_0009061 | 3300046794 | Bacteria | 5173 |
| 566 | Ga0495589_0012465 | 3300046794 | Bacteria | 4401 |
| 567 | Ga0495600_0034312 | 3300046809 | Bacteria | 3293 |
| 568 | Ga0495660_0000807 | 3300046810 | Bacteria | 23454 |
| 569 | Ga0495660_0000814 | 3300046810 | Bacteria | 23293 |
| 570 | Ga0495660_0000815 | 3300046810 | Bacteria | 23286 |
| 571 | Ga0495660_0001803 | 3300046810 | Bacteria | 14101 |
| 572 | Ga0495660_0002903 | 3300046810 | Bacteria | 10748 |
| 573 | Ga0495660_0004211 | 3300046810 | Bacteria | 8739 |
| 574 | Ga0495660_0005098 | 3300046810 | Bacteria | 7892 |
| 575 | Ga0495660_0008917 | 3300046810 | Bacteria | 5860 |
| 576 | Ga0495660_0014479 | 3300046810 | Bacteria | 4561 |
| 577 | Ga0495660_0017891 | 3300046810 | Bacteria | 4076 |
| 578 | Ga0495660_0027758 | 3300046810 | Bacteria | 3200 |
| 579 | Ga0495660_0029467 | 3300046810 | Bacteria | 3096 |
| 580 | Ga0495660_0039506 | 3300046810 | Bacteria | 2620 |
| 581 | Ga0495581_0001429 | 3300047315 | Bacteria | 13252 |
| 582 | Ga0495604_0002090 | 3300047317 | Bacteria | 16070 |
| 583 | Ga0495604_0002459 | 3300047317 | Bacteria | 14813 |
| 584 | Ga0495674_0006644 | 3300047319 | Bacteria | 11081 |
| 585 | Ga0495672_0000548 | 3300047320 | Bacteria | 42693 |
| 586 | Ga0495672_0000946 | 3300047320 | Bacteria | 30288 |
| 587 | Ga0495672_0001020 | 3300047320 | Bacteria | 28796 |
| 588 | Ga0495672_0001030 | 3300047320 | Bacteria | 28638 |
| 589 | Ga0495672_0002300 | 3300047320 | Bacteria | 17724 |
| 590 | Ga0495672_0003248 | 3300047320 | Bacteria | 14107 |
| 591 | Ga0495672_0004110 | 3300047320 | Bacteria | 12116 |
| 592 | Ga0495672_0004808 | 3300047320 | Bacteria | 10895 |
| 593 | Ga0495672_0008632 | 3300047320 | Bacteria | 7495 |
| 594 | Ga0495672_0008637 | 3300047320 | Bacteria | 7492 |
| 595 | Ga0495672_0011641 | 3300047320 | Bacteria | 6194 |
| 596 | Ga0495672_0016270 | 3300047320 | Bacteria | 5019 |
| 597 | Ga0495672_0021768 | 3300047320 | Bacteria | 4176 |
| 598 | Ga0495672_0032895 | 3300047320 | Bacteria | 3218 |
| 599 | Ga0495676_0000018 | 3300047321 | Bacteria | 178380 |
| 600 | Ga0495676_0002166 | 3300047321 | Bacteria | 17389 |
| 601 | Ga0495676_0003503 | 3300047321 | Bacteria | 14212 |
| 602 | Ga0495680_0001365 | 3300047322 | Bacteria | 26492 |
| 603 | Ga0495680_0002276 | 3300047322 | Bacteria | 19767 |
| 604 | Ga0495680_0022614 | 3300047322 | Bacteria | 5237 |
| 605 | Ga0495680_0041726 | 3300047322 | Bacteria | 3646 |
| 606 | Ga0495683_0000018 | 3300047323 | Bacteria | 185871 |
| 607 | Ga0495683_0000034 | 3300047323 | Bacteria | 148959 |
| 608 | Ga0495683_0000118 | 3300047323 | Bacteria | 79578 |
| 609 | Ga0495683_0000640 | 3300047323 | Bacteria | 26040 |
| 610 | Ga0495683_0001726 | 3300047323 | Bacteria | 13845 |
| 611 | Ga0495683_0002143 | 3300047323 | Bacteria | 12161 |
| 612 | Ga0495683_0004680 | 3300047323 | Bacteria | 7708 |
| 613 | Ga0495683_0005370 | 3300047323 | Bacteria | 7114 |
| 614 | Ga0495683_0005758 | 3300047323 | Bacteria | 6827 |
| 615 | Ga0495683_0007386 | 3300047323 | Bacteria | 5952 |
| 616 | Ga0495687_002214 | 3300047443 | Bacteria | 16072 |
| 617 | Ga0495687_005600 | 3300047443 | Bacteria | 7951 |
| 618 | Ga0495687_013475 | 3300047443 | Bacteria | 4264 |
| 619 | Ga0495687_015096 | 3300047443 | Bacteria | 3941 |
| 620 | Ga0495675_0001178 | 3300047444 | Bacteria | 15848 |
| 621 | Ga0495677_0000389 | 3300047445 | Bacteria | 18832 |
| 622 | Ga0495679_000039 | 3300047446 | Bacteria | 149640 |
| 623 | Ga0495679_000497 | 3300047446 | Bacteria | 27852 |
| 624 | Ga0495679_000571 | 3300047446 | Bacteria | 25561 |
| 625 | Ga0495679_000659 | 3300047446 | Bacteria | 22925 |
| 626 | Ga0495679_000717 | 3300047446 | Bacteria | 21400 |
| 627 | Ga0495679_000811 | 3300047446 | Bacteria | 19848 |
| 628 | Ga0495679_001183 | 3300047446 | Bacteria | 15508 |
| 629 | Ga0495679_004918 | 3300047446 | Bacteria | 6028 |
| 630 | Ga0495673_0000254 | 3300047469 | Bacteria | 74340 |
| 631 | Ga0495673_0001002 | 3300047469 | Bacteria | 24995 |
| 632 | Ga0495673_0001352 | 3300047469 | Bacteria | 19875 |
| 633 | Ga0495673_0002013 | 3300047469 | Bacteria | 14940 |
| 634 | Ga0495673_0002769 | 3300047469 | Bacteria | 11992 |
| 635 | Ga0495673_0002900 | 3300047469 | Bacteria | 11635 |
| 636 | Ga0495673_0003509 | 3300047469 | Bacteria | 10317 |
| 637 | Ga0495673_0004057 | 3300047469 | Bacteria | 9327 |
| 638 | Ga0495673_0004412 | 3300047469 | Bacteria | 8806 |
| 639 | Ga0495673_0004990 | 3300047469 | Bacteria | 8155 |
| 640 | Ga0495673_0008006 | 3300047469 | Bacteria | 5988 |
| 641 | Ga0495673_0009119 | 3300047469 | Bacteria | 5508 |
| 642 | Ga0495673_0011409 | 3300047469 | Bacteria | 4777 |
| 643 | Ga0495673_0012398 | 3300047469 | Bacteria | 4524 |
| 644 | Ga0495673_0013641 | 3300047469 | Bacteria | 4255 |
| 645 | Ga0495673_0015327 | 3300047469 | Bacteria | 3952 |
| 646 | Ga0495681_0000475 | 3300047470 | Bacteria | 30752 |
| 647 | Ga0495681_0000576 | 3300047470 | Bacteria | 28018 |
| 648 | Ga0495681_0000811 | 3300047470 | Bacteria | 24117 |
| 649 | Ga0495681_0000916 | 3300047470 | Bacteria | 22785 |
| 650 | Ga0495681_0000987 | 3300047470 | Bacteria | 21798 |
| 651 | Ga0495681_0001530 | 3300047470 | Bacteria | 17258 |
| 652 | Ga0495681_0001839 | 3300047470 | Bacteria | 15591 |
| 653 | Ga0495681_0002615 | 3300047470 | Bacteria | 12791 |
| 654 | Ga0495681_0003442 | 3300047470 | Bacteria | 11011 |
| 655 | Ga0495681_0003855 | 3300047470 | Bacteria | 10369 |
| 656 | Ga0495681_0004360 | 3300047470 | Bacteria | 9674 |
| 657 | Ga0495681_0004725 | 3300047470 | Bacteria | 9231 |
| 658 | Ga0495681_0004899 | 3300047470 | Bacteria | 9047 |
| 659 | Ga0495681_0005432 | 3300047470 | Bacteria | 8532 |
| 660 | Ga0495681_0009722 | 3300047470 | Bacteria | 5894 |
| 661 | Ga0495681_0009773 | 3300047470 | Bacteria | 5872 |
| 662 | Ga0495681_0015872 | 3300047470 | Bacteria | 4250 |
| 663 | Ga0495681_0021303 | 3300047470 | Bacteria | 3496 |
| 664 | Ga0495684_0021727 | 3300047471 | Bacteria | 4941 |
| 665 | Ga0495686_0000919 | 3300047472 | Bacteria | 36947 |
| 666 | Ga0495686_0004717 | 3300047472 | Bacteria | 11039 |
| 667 | Ga0495686_0007273 | 3300047472 | Bacteria | 8326 |
| 668 | Ga0495593_0000675 | 3300047673 | Bacteria | 19661 |
| 669 | Ga0495593_0025237 | 3300047673 | Bacteria | 3290 |
| 670 | Ga0495602_0001096 | 3300048088 | Bacteria | 26568 |
| 671 | Ga0495626_0000216 | 3300048091 | Bacteria | 68946 |
| 672 | Ga0495626_0000236 | 3300048091 | Bacteria | 64189 |
| 673 | Ga0495626_0000467 | 3300048091 | Bacteria | 41237 |
| 674 | Ga0495626_0000491 | 3300048091 | Bacteria | 39819 |
| 675 | Ga0495626_0000606 | 3300048091 | Bacteria | 35033 |
| 676 | Ga0495626_0001472 | 3300048091 | Bacteria | 18594 |
| 677 | Ga0495626_0002336 | 3300048091 | Bacteria | 13375 |
| 678 | Ga0495626_0004812 | 3300048091 | Bacteria | 8141 |
| 679 | Ga0495626_0012142 | 3300048091 | Bacteria | 4528 |
| 680 | Ga0496102_0000496 | 3300048905 | Bacteria | 43468 |
| 681 | Ga0496103_0002367 | 3300048906 | Bacteria | 11887 |
| 682 | Ga0496110_0056473 | 3300048913 | Bacteria | 3455 |
| 683 | Ga0496116_0000046 | 3300048919 | Bacteria | 323643 |
| 684 | Ga0496116_0000650 | 3300048919 | Bacteria | 45445 |
| 685 | Ga0496116_0001028 | 3300048919 | Bacteria | 34090 |
| 686 | Ga0496116_0002222 | 3300048919 | Bacteria | 20652 |
| 687 | Ga0496116_0002592 | 3300048919 | Bacteria | 18820 |
| 688 | Ga0496117_0000621 | 3300048920 | Bacteria | 57424 |
| 689 | Ga0496117_0001466 | 3300048920 | Bacteria | 33965 |
| 690 | Ga0496117_0002827 | 3300048920 | Bacteria | 21120 |
| 691 | Ga0496117_0004579 | 3300048920 | Bacteria | 15125 |
| 692 | Ga0496117_0006300 | 3300048920 | Bacteria | 12070 |
| 693 | Ga0496118_0003256 | 3300048921 | Bacteria | 20695 |
| 694 | Ga0496118_0025087 | 3300048921 | Bacteria | 5124 |
| 695 | Ga0496118_0039289 | 3300048921 | Bacteria | 3778 |
| 696 | Ga0496118_0042119 | 3300048921 | Bacteria | 3606 |
| 697 | Ga0496118_0045106 | 3300048921 | Bacteria | 3445 |
| 698 | Ga0496119_0005391 | 3300048922 | Bacteria | 12283 |
| 699 | Ga0496119_0012038 | 3300048922 | Bacteria | 7073 |
| 700 | Ga0496120_0002592 | 3300048923 | Bacteria | 17976 |
| 701 | Ga0496120_0003163 | 3300048923 | Bacteria | 15352 |
| 702 | Ga0496121_0000284 | 3300048924 | Bacteria | 105597 |
| 703 | Ga0496121_0005555 | 3300048924 | Bacteria | 16105 |
| 704 | Ga0496121_0006810 | 3300048924 | Bacteria | 13997 |
| 705 | Ga0496121_0008407 | 3300048924 | Bacteria | 12156 |
| 706 | Ga0496121_0019936 | 3300048924 | Bacteria | 6673 |
| 707 | Ga0496122_0001312 | 3300048925 | Bacteria | 40795 |
| 708 | Ga0496122_0004810 | 3300048925 | Bacteria | 16495 |
| 709 | Ga0496122_0005852 | 3300048925 | Bacteria | 14422 |
| 710 | Ga0496122_0006687 | 3300048925 | Bacteria | 13128 |
| 711 | Ga0496122_0022983 | 3300048925 | Bacteria | 5518 |
| 712 | Ga0496122_0061700 | 3300048925 | Bacteria | 2749 |
| 713 | Ga0496123_0002229 | 3300048926 | Bacteria | 24578 |
| 714 | Ga0496123_0002638 | 3300048926 | Bacteria | 21727 |
| 715 | Ga0496123_0004572 | 3300048926 | Bacteria | 14424 |
| 716 | Ga0496123_0005771 | 3300048926 | Bacteria | 12304 |
| 717 | Ga0496123_0034060 | 3300048926 | Bacteria | 3655 |
| 718 | Ga0496123_0057804 | 3300048926 | Bacteria | 2521 |
| 719 | Ga0496124_0000718 | 3300048927 | Bacteria | 54253 |
| 720 | Ga0496124_0001537 | 3300048927 | Bacteria | 33519 |
| 721 | Ga0496124_0003911 | 3300048927 | Bacteria | 17803 |
| 722 | Ga0496124_0004132 | 3300048927 | Bacteria | 17149 |
| 723 | Ga0496124_0004687 | 3300048927 | Bacteria | 15804 |
| 724 | Ga0496124_0006277 | 3300048927 | Bacteria | 12997 |
| 725 | Ga0496124_0016348 | 3300048927 | Bacteria | 7059 |
| 726 | Ga0496124_0018426 | 3300048927 | Bacteria | 6538 |
| 727 | Ga0496124_0034700 | 3300048927 | Bacteria | 4422 |
| 728 | Ga0496124_0066746 | 3300048927 | Bacteria | 2995 |
| 729 | Ga0496125_0000511 | 3300048928 | Bacteria | 67384 |
| 730 | Ga0496125_0000842 | 3300048928 | Bacteria | 49253 |
| 731 | Ga0496125_0002577 | 3300048928 | Bacteria | 23320 |
| 732 | Ga0496125_0014620 | 3300048928 | Bacteria | 7632 |
| 733 | Ga0496125_0019465 | 3300048928 | Bacteria | 6401 |
| 734 | Ga0496125_0026940 | 3300048928 | Bacteria | 5220 |
| 735 | Ga0496125_0051526 | 3300048928 | Bacteria | 3394 |
| 736 | Ga0496126_0001228 | 3300048929 | Bacteria | 41648 |
| 737 | Ga0496126_0012627 | 3300048929 | Bacteria | 8642 |
| 738 | Ga0495678_000049 | 3300049459 | Bacteria | 163929 |
| 739 | Ga0495678_000686 | 3300049459 | Bacteria | 31100 |
| 740 | Ga0495678_001210 | 3300049459 | Bacteria | 21165 |
| 741 | Ga0495678_001756 | 3300049459 | Bacteria | 16080 |
| 742 | Ga0495678_002099 | 3300049459 | Bacteria | 14132 |
| 743 | Ga0495678_004483 | 3300049459 | Bacteria | 8067 |
| 744 | Ga0495678_004580 | 3300049459 | Bacteria | 7955 |
| 745 | Ga0495678_005460 | 3300049459 | Bacteria | 7010 |
| 746 | Ga0495678_011772 | 3300049459 | Bacteria | 4173 |
| 747 | Ga0495678_028461 | 3300049459 | Bacteria | 2358 |
| 748 | Ga0495682_0000050 | 3300049460 | Bacteria | 110280 |
| 749 | Ga0495682_0001153 | 3300049460 | Bacteria | 15197 |
| 750 | Ga0495682_0003306 | 3300049460 | Bacteria | 7206 |
| 751 | Ga0501222_000227 | 3300049662 | Bacteria | 9738 |
| 752 | Ga0500572_000228 | 3300053111 | Bacteria | 19876 |
| 753 | Ga0500618_002134 | 3300053125 | Bacteria | 7803 |
| 754 | Ga0500634_0000141 | 3300053161 | Bacteria | 26079 |
| 755 | Ga0500634_0004166 | 3300053161 | Bacteria | 6623 |
| 756 | 2511255363 | 2511231004 | Bacteria | 6669789 |
| 757 | 2511264325 | 2511231006 | Bacteria | 6794709 |
| 758 | 2511271239 | 2511231007 | Bacteria | 6306603 |
| 759 | 2511279941 | 2511231008 | Bacteria | 6624100 |
| 760 | 2511290861 | 2511231010 | Bacteria | 6373152 |
| 761 | 2511293622 | 2511231011 | Bacteria | 6149768 |
| 762 | 2511304956 | 2511231012 | Bacteria | 6738011 |
| 763 | 2511316416 | 2511231014 | Bacteria | 6462302 |
| 764 | 2511328363 | 2511231016 | Bacteria | 6704427 |
| 765 | 2511332893 | 2511231017 | Bacteria | 6503007 |
| 766 | 2511340964 | 2511231018 | Bacteria | 6436256 |
| 767 | 2511346777 | 2511231019 | Bacteria | 6520662 |
| 768 | 2511351733 | 2511231020 | Bacteria | 6115223 |
| 769 | 2511358187 | 2511231021 | Bacteria | 7302637 |
| 770 | 2511364152 | 2511231022 | Bacteria | 6719296 |
| 771 | 2511370571 | 2511231023 | Bacteria | 6808468 |
| 772 | 2511416063 | 2511231031 | Bacteria | 6558529 |
| 773 | 2511823964 | 2511231156 | Bacteria | 6845832 |
| 774 | 2512329191 | 2512047018 | Bacteria | 6663241 |
| 775 | 2555669233 | 2554235341 | Bacteria | 6867980 |
| 776 | 2583793320 | 2582580891 | Bacteria | 6800976 |
| 777 | 2597857291 | 2597489887 | Bacteria | 6666321 |
| 778 | 2597864740 | 2597489888 | Bacteria | 6179543 |
| 779 | 2597870593 | 2597489889 | Bacteria | 6297495 |
| 780 | 2599330308 | 2599185155 | Bacteria | 5827168 |
| 781 | 2599357870 | 2599185160 | Bacteria | 6844013 |
| 782 | 2599361623 | 2599185161 | Bacteria | 6960462 |
| 783 | 2599367945 | 2599185162 | Bacteria | 6957254 |
| 784 | 2599374734 | 2599185163 | Bacteria | 6995158 |
| 785 | 2599383035 | 2599185164 | Bacteria | 6841688 |
| 786 | 2599389582 | 2599185165 | Bacteria | 6843250 |
| 787 | 2599393592 | 2599185166 | Bacteria | 6959206 |
| 788 | 2599397922 | 2599185167 | Bacteria | 6353609 |
| 789 | 2599405359 | 2599185168 | Bacteria | 6997636 |
| 790 | 2599452368 | 2599185179 | Bacteria | 6611171 |
| 791 | 2599464686 | 2599185181 | Bacteria | 6844519 |
| 792 | 2599468236 | 2599185182 | Bacteria | 6883168 |
| 793 | 2599484774 | 2599185185 | Bacteria | 6652270 |
| 794 | 2599493709 | 2599185186 | Bacteria | 6831633 |
| 795 | 2599503214 | 2599185188 | Bacteria | 6164180 |
| 796 | 2599506932 | 2599185189 | Bacteria | 5862825 |
| 797 | 2599513253 | 2599185190 | Bacteria | 6285678 |
| 798 | 2599518247 | 2599185191 | Bacteria | 6297582 |
| 799 | 2599612270 | 2599185212 | Bacteria | 6765997 |
| 800 | 2599769775 | 2599185248 | Bacteria | 6696816 |
| 801 | 2599801962 | 2599185257 | Bacteria | 6492581 |
| 802 | 2599878041 | 2599185288 | Bacteria | 6666191 |
| 803 | 2599887097 | 2599185289 | Bacteria | 6778765 |
| 804 | 2599891929 | 2599185290 | Bacteria | 6289611 |
| 805 | 2599898738 | 2599185291 | Bacteria | 6775623 |
| 806 | 2599933727 | 2599185300 | Bacteria | 6062622 |
| 807 | 2599942780 | 2599185302 | Bacteria | 5954930 |
| 808 | 2599947253 | 2599185303 | Bacteria | 6512725 |
| 809 | 2599953529 | 2599185304 | Bacteria | 5951361 |
| 810 | 2599959196 | 2599185305 | Bacteria | 6748700 |
| 811 | 2599964465 | 2599185306 | Bacteria | 6637356 |
| 812 | 2599975317 | 2599185307 | Bacteria | 6194719 |
| 813 | 2599975662 | 2599185308 | Bacteria | 6621546 |
| 814 | 2599982210 | 2599185309 | Bacteria | 5969593 |
| 815 | 2599989014 | 2599185310 | Bacteria | 6014457 |
| 816 | 2599993167 | 2599185311 | Bacteria | 6354990 |
| 817 | 2599999522 | 2599185312 | Bacteria | 5912071 |
| 818 | 2600007768 | 2599185313 | Bacteria | 6658188 |
| 819 | 2600009701 | 2599185314 | Bacteria | 6621749 |
| 820 | 2600016959 | 2599185315 | Bacteria | 6771107 |
| 821 | 2600022827 | 2599185316 | Bacteria | 6320029 |
| 822 | 2600030259 | 2599185317 | Bacteria | 6435722 |
| 823 | 2600036660 | 2599185318 | Bacteria | 6961590 |
| 824 | 2600039479 | 2599185319 | Bacteria | 6637840 |
| 825 | 2600046968 | 2599185320 | Bacteria | 5963263 |
| 826 | 2600051782 | 2599185321 | Bacteria | 6764560 |
| 827 | 2600057920 | 2599185322 | Bacteria | 6763055 |
| 828 | 2600068675 | 2599185323 | Bacteria | 6688755 |
| 829 | 2600070014 | 2599185324 | Bacteria | 6590677 |
| 830 | 2600076195 | 2599185325 | Bacteria | 6324919 |
| 831 | 2600217407 | 2599185356 | Bacteria | 6843884 |
| 832 | 2600359836 | 2600254930 | Bacteria | 6431253 |
| 833 | 2600367501 | 2600254931 | Bacteria | 6734225 |
| 834 | 2601626620 | 2600255283 | Bacteria | 6061572 |
| 835 | 2601689976 | 2600255296 | Bacteria | 5784754 |
| 836 | 2601777577 | 2600255313 | Bacteria | 6842543 |
| 837 | 2601795958 | 2600255318 | Bacteria | 6383414 |
| 838 | 2606075194 | 2603880185 | Bacteria | 6379190 |
| 839 | 2606128057 | 2603880199 | Bacteria | 6377649 |
| 840 | 2621298737 | 2619619299 | Bacteria | 6649820 |
| 841 | 2624480003 | 2623620443 | Bacteria | 6427864 |
| 842 | 2624492970 | 2623620446 | Bacteria | 6500345 |
| 843 | 2643843542 | 2643221565 | Bacteria | 6216018 |
| 844 | 2643871438 | 2643221571 | Bacteria | 6228673 |
| 845 | 2643953718 | 2643221589 | Bacteria | 6250934 |
| 846 | 2644021651 | 2643221602 | Bacteria | 6249926 |
| 847 | 2644190293 | 2643221633 | Bacteria | 6733554 |
| 848 | 2644282229 | 2643221650 | Bacteria | 7029547 |
| 849 | 2644622435 | 2643221713 | Bacteria | 6554480 |
| 850 | 2652545395 | 2651869719 | Bacteria | 6047974 |
| 851 | 2671091230 | 2667528170 | Bacteria | 6786960 |
| 852 | 2671098265 | 2667528171 | Bacteria | 6900659 |
| 853 | 2671128459 | 2667528176 | Bacteria | 6724917 |
| 854 | 2671768910 | 2671180172 | Bacteria | 6495783 |
| 855 | 2677900774 | 2675903420 | Bacteria | 6247433 |
| 856 | 2678262956 | 2675903515 | Bacteria | 6580491 |
| 857 | 2715753100 | 2713897148 | Bacteria | 5883533 |
| 858 | 2715756190 | 2713897149 | Bacteria | 6506249 |
| 859 | 2723249515 | 2721755607 | Bacteria | 5841722 |
| 860 | 2738671986 | 2738541265 | Bacteria | 6594665 |
| 861 | 2738691344 | 2738541271 | Bacteria | 5657310 |
| 862 | 2738750380 | 2738541282 | Bacteria | 6593925 |
| 863 | 2738809976 | 2738541294 | Bacteria | 6925949 |
| 864 | 2738859420 | 2738541303 | Bacteria | 6591772 |
| 865 | 2738897336 | 2738541309 | Bacteria | 6926455 |
| 866 | 2739201990 | 2738543004 | Bacteria | 6381073 |
| 867 | 2739260054 | 2738543015 | Bacteria | 6750701 |
| 868 | 2739267119 | 2738543016 | Bacteria | 5657564 |
| 869 | 2739316761 | 2738543025 | Bacteria | 6600348 |
| 870 | 2743736715 | 2740892503 | Bacteria | 6855563 |
| 871 | 2745009293 | 2744054620 | Bacteria | 6551379 |
| 872 | 2774123060 | 2773857670 | Bacteria | 6407454 |
| 873 | 2774137448 | 2773857673 | Bacteria | 6513460 |
| 874 | 2784263770 | 2784132063 | Bacteria | 6262788 |
| 875 | 2784315534 | 2784132072 | Bacteria | 6596533 |
| 876 | 2794596708 | 2791355520 | Bacteria | 5948615 |
| 877 | 2808857548 | 2808606361 | Bacteria | 6136259 |
| 878 | 2808925252 | 2808606376 | Bacteria | 6248667 |
| 879 | 2808930072 | 2808606377 | Bacteria | 6646337 |
| 880 | 2808937718 | 2808606378 | Bacteria | 6177535 |
| 881 | 2808947400 | 2808606380 | Bacteria | 6248705 |
| 882 | 2808952363 | 2808606381 | Bacteria | 6646461 |
| 883 | 2808960543 | 2808606382 | Bacteria | 6841132 |
| 884 | 2808966032 | 2808606383 | Bacteria | 6138645 |
| 885 | 2808977057 | 2808606385 | Bacteria | 6711065 |
| 886 | 2808992212 | 2808606388 | Bacteria | 6706662 |
| 887 | 2809000924 | 2808606389 | Bacteria | 6138126 |
| 888 | 2809214208 | 2808606445 | Bacteria | 6057339 |
| 889 | 2817492106 | 2816332298 | Bacteria | 6852809 |
| 890 | 2819656563 | 2818991456 | Bacteria | 6123676 |
| 891 | 2819703336 | 2818991464 | Bacteria | 6907494 |
| 892 | 2825656881 | 2825651385 | Bacteria | 6715909 |
| 893 | 2826584532 | 2826581358 | Bacteria | 5963467 |
| 894 | 2834032924 | 2834028612 | Bacteria | 6354979 |
| 895 | 2842818087 | 2842815866 | Bacteria | 5947510 |
| 896 | 2842828135 | 2842826826 | Bacteria | 5974129 |
| 897 | 2842835384 | 2842832357 | Bacteria | 5959113 |
| 898 | 2842842801 | 2842837860 | Bacteria | 6066181 |
| 899 | 2842847157 | 2842843487 | Bacteria | 6004777 |
| 900 | 2842849278 | 2842849001 | Bacteria | 5924277 |
| 901 | 2842854930 | 2842854478 | Bacteria | 6143501 |
| 902 | 2844669667 | 2844665904 | Bacteria | 6817974 |
| 903 | 2852613608 | 2852612431 | Bacteria | 6885235 |
| 904 | 2852658138 | 2852657418 | Bacteria | 6472974 |
| 905 | 2852668656 | 2852667396 | Bacteria | 6885555 |
| 906 | 2860342058 | 2860339153 | Bacteria | 6846989 |
| 907 | 2860871222 | 2860867994 | Bacteria | 5645326 |
| 908 | 2878031911 | 2878029506 | Bacteria | 6418441 |
| 909 | 2880234173 | 2880230671 | Bacteria | 6140320 |
| 910 | 2904522675 | 2904518522 | Bacteria | 6068986 |
| 911 | 2904551966 | 2904550169 | Bacteria | 6221258 |
| 912 | 2908450576 | 2908446538 | Bacteria | 6829095 |
| 913 | 2913040671 | 2913036834 | Bacteria | 6704877 |
| 914 | 2917073035 | 2917070673 | Bacteria | 6868303 |
| 915 | 2919068389 | 2919063839 | Bacteria | 6302690 |
| 916 | 2919386851 | 2919385768 | Bacteria | 5897293 |
| 917 | 2919456484 | 2919456309 | Bacteria | 6586567 |
| 918 | 2919482220 | 2919481497 | Bacteria | 6907839 |
| 919 | 2919492368 | 2919487758 | Bacteria | 5929766 |
| 920 | 2919699754 | 2919697872 | Bacteria | 6553725 |
| 921 | 2923155733 | 2923153595 | Bacteria | 6870622 |
| 922 | 2923587791 | 2923586266 | Bacteria | 6565975 |
| 923 | 2929148021 | 2929144301 | Bacteria | 6622272 |
| 924 | 2929193282 | 2929189879 | Bacteria | 5930554 |
| 925 | 2931374418 | 2931369376 | Bacteria | 6847892 |
| 926 | 2931394598 | 2931390751 | Bacteria | 6273349 |
| 927 | 2931400970 | 2931396565 | Bacteria | 7251677 |
| 928 | 2935359451 | 2935353572 | Unclassified | 6955622 |
| 929 | 2939640116 | 2939636861 | Bacteria | 6297853 |
| 930 | 2945932724 | 2945928738 | Bacteria | 6053221 |
| 931 | 2945962711 | 2945961074 | Bacteria | 7342064 |
| 932 | 2946008930 | 2946006987 | Bacteria | 6705746 |
| 933 | 2946031578 | 2946027586 | Bacteria | 6049274 |
| 934 | 2947238550 | 2947233263 | Bacteria | 6439278 |
| 935 | 2969306718 | 2969304461 | Bacteria | 6601805 |
| 936 | 2974291649 | 2974289157 | Bacteria | 6080362 |
| 937 | 2984290293 | 2984286254 | Bacteria | 6702062 |
| 938 | 2988729806 | 2988728565 | Bacteria | 6124362 |
| 939 | 2998142132 | 2998139840 | Bacteria | 6073514 |
| 940 | 3007401291 | 3007395558 | Bacteria | 6755444 |
| 941 | 3007422579 | 3007419365 | Bacteria | 7026924 |
| 942 | 3007513595 | 3007511990 | Bacteria | 6481491 |
| 943 | 3007618259 | 3007614139 | Bacteria | 6053559 |
| 944 | 3007620015 | 3007619802 | Bacteria | 6411688 |
| 945 | 3007723987 | 3007718800 | Bacteria | 5971527 |
| 946 | 3007860566 | 3007855910 | Bacteria | 5637581 |
| 947 | 3007862656 | 3007861166 | Bacteria | 6045338 |
| 948 | 3007868382 | 3007866637 | Bacteria | 5899198 |
| 949 | 637319568 | 637000220 | Bacteria | 7074893 |
| 950 | 8015689984 | 8015687852 | Bacteria | 6613826 |
| 951 | 8019775975 | 8019775933 | Bacteria | 6858656 |
| 952 | 8029998559 | 8029995093 | Bacteria | 5990776 |
| 953 | 8054285357 | 8054285046 | Bacteria | 6919322 |
| 954 | 8054348570 | 8054347763 | Bacteria | 5901107 |
| 955 | 8054507101 | 8054503363 | Bacteria | 6101651 |
| 956 | 8055773088 | 8055770955 | Bacteria | 6827675 |
| 957 | 8055822051 | 8055817908 | Bacteria | 6609162 |
| 958 | 8055883294 | 8055878733 | Bacteria | 5907058 |
| 959 | 8056128158 | 8056125926 | Bacteria | 6228218 |
| 960 | 8056135543 | 8056131705 | Bacteria | 6107031 |
| 961 | 8056147055 | 8056143049 | Bacteria | 6307666 |
| 962 | 8056151994 | 8056148874 | Bacteria | 6479865 |
| 963 | 8056157060 | 8056155041 | Bacteria | 6486948 |
| 964 | 8056161707 | 8056161164 | Bacteria | 6106669 |
| 965 | 8056168942 | 8056166840 | Bacteria | 5820959 |
| 966 | 8056175009 | 8056172158 | Bacteria | 6133900 |
| 967 | 8056178935 | 8056177738 | Bacteria | 6748268 |
| 968 | 8056572896 | 8056569372 | Bacteria | 5997322 |
| 969 | 8057799670 | 8057798959 | Bacteria | 6713499 |
| 970 | Ga0495643_0012233 | |||
| 971 | JGI25162J39368_1000050 | |||
| 972 | JGI25162J39368_1000060 | |||
| 973 | JGI25163J39215_1000017 | |||
| 974 | JGI25163J39215_1000102 | |||
| 975 | JGI25164J39214_1000025 | |||
| 976 | JGI25164J39214_1000037 | |||
| 977 | JGI25165J46597_1000114 | |||
| 978 | JGI25165J46597_1000118 | |||
| 979 | JGI25165J46597_1000176 | |||
| 980 | Ga0055538_1000066 | |||
| 981 | Ga0055539_1000102 | |||
| 982 | Ga0055533_1000110 | |||
| 983 | Ga0055532_1000326 | |||
| 984 | Ga0055525_1000187 | |||
| 985 | Ga0055536_1000028 | |||
| 986 | Ga0055536_1000046 | |||
| 987 | Ga0055536_1000119 | |||
| 988 | Ga0055530_10000030 | |||
| 989 | Ga0055530_10000094 | |||
| 990 | Ga0055530_10000653 | |||
| 991 | Ga0055540_1000070 | |||
| 992 | Ga0055540_1000130 | |||
| 993 | Ga0055540_1000262 | |||
| 994 | Ga0055531_10001382 | |||
| 995 | Ga0055541_1000068 | |||
| 996 | Ga0065714_10000079 | |||
| 997 | Ga0065714_10002746 | |||
| 998 | Ga0065714_10003089 | |||
| 999 | Ga0065704_10071193 | |||
| 1000 | Ga0065704_10075106 | |||
| 1001 | Ga0070670_100000242 | |||
| 1002 | Ga0070670_100001182 | |||
| 1003 | Ga0070661_100000151 | |||
| 1004 | Ga0070662_100001621 | |||
| 1005 | Ga0070664_100000095 | |||
| 1006 | Ga0068851_10000119 | |||
| 1007 | Ga0079104_1000325 | |||
| 1008 | Ga0079104_1000469 | |||
| 1009 | Ga0105251_10000088 | |||
| 1010 | Ga0105251_10000252 | |||
| 1011 | Ga0105251_10000806 | |||
| 1012 | Ga0105251_10002980 | |||
| 1013 | Ga0105251_10003228 | |||
| 1014 | Ga0105244_10000568 | |||
| 1015 | Ga0105244_10000991 | |||
| 1016 | Ga0105244_10001433 | |||
| 1017 | Ga0105244_10001729 | |||
| 1018 | Ga0105244_10015684 | |||
| 1019 | Ga0105244_10022491 | |||
| 1020 | Ga0105250_10000304 | |||
| 1021 | Ga0105250_10000849 | |||
| 1022 | Ga0105250_10005489 | |||
| 1023 | Ga0105250_10010093 | |||
| 1024 | Ga0105243_10000142 | |||
| 1025 | Ga0105243_10002427 | |||
| 1026 | Ga0105243_10014765 | |||
| 1027 | Ga0105242_10003458 | |||
| 1028 | Ga0105237_10000009 | |||
| 1029 | Ga0105246_10000021 | |||
| 1030 | Ga0105246_10005271 | |||
| 1031 | Ga0105246_10051915 | |||
| 1032 | Ga0157345_1000107 | |||
| 1033 | Ga0157373_10000084 | |||
| 1034 | Ga0157373_10000144 | |||
| 1035 | Ga0157373_10000722 | |||
| 1036 | Ga0157373_10005893 | |||
| 1037 | Ga0157373_10009331 | |||
| 1038 | Ga0157373_10027270 | |||
| 1039 | Ga0157373_10043599 | |||
| 1040 | Ga0157371_10000627 | |||
| 1041 | Ga0157371_10001356 | |||
| 1042 | Ga0157371_10001502 | |||
| 1043 | Ga0157371_10007809 | |||
| 1044 | Ga0157370_10064179 | |||
| 1045 | Ga0157369_10001116 | |||
| 1046 | Ga0157369_10002793 | |||
| 1047 | Ga0157369_10004854 | |||
| 1048 | Ga0157369_10007474 | |||
| 1049 | Ga0157369_10010872 | |||
| 1050 | Ga0163162_10000160 | |||
| 1051 | Ga0157372_10001586 | |||
| 1052 | Ga0157375_10000930 | |||
| 1053 | Ga0157375_10001137 | |||
| 1054 | Ga0157375_10021607 | |||
| 1055 | Ga0182008_10000153 | |||
| 1056 | Ga0182008_10000544 | |||
| 1057 | Ga0182008_10001477 | |||
| 1058 | Ga0182008_10001506 | |||
| 1059 | Ga0182008_10001888 | |||
| 1060 | Ga0182006_1000196 | |||
| 1061 | Ga0182006_1000204 | |||
| 1062 | Ga0182006_1003686 | |||
| 1063 | Ga0182006_1008555 | |||
| 1064 | Ga0182006_1008801 | |||
| 1065 | Ga0182007_10000625 | |||
| 1066 | Ga0182005_1000114 | |||
| 1067 | Ga0163161_10000879 | |||
| 1068 | Ga0163161_10001080 | |||
| 1069 | Ga0163161_10004821 | |||
| 1070 | Ga0163161_10011502 | |||
| 1071 | Ga0163161_10023179 | |||
| 1072 | Ga0209435_100440 | |||
| 1073 | Ga0209760_100023 | |||
| 1074 | Ga0209760_100033 | |||
| 1075 | Ga0209784_100057 | |||
| 1076 | Ga0209566_100073 | |||
| 1077 | Ga0209674_100095 | |||
| 1078 | Ga0209147_100092 | |||
| 1079 | Ga0209563_100093 | |||
| 1080 | Ga0209563_100649 | |||
| 1081 | Ga0207427_100003 | |||
| 1082 | Ga0207427_100018 | |||
| 1083 | Ga0209437_100002 | |||
| 1084 | Ga0209437_100031 | |||
| 1085 | Ga0209258_100300 | |||
| 1086 | Ga0209646_1000413 | |||
| 1087 | Ga0209677_100054 | |||
| 1088 | Ga0209759_1001701 | |||
| 1089 | Ga0209233_1000004 | |||
| 1090 | Ga0209233_1000012 | |||
| 1091 | Ga0209675_1001274 | |||
| 1092 | Ga0209676_1000055 | |||
| 1093 | Ga0209676_1000062 | |||
| 1094 | Ga0209676_1000407 | |||
| 1095 | Ga0209676_1001180 | |||
| 1096 | Ga0209676_1001565 | |||
| 1097 | Ga0209050_1000079 | |||
| 1098 | Ga0209050_1000150 | |||
| 1099 | Ga0209050_1000231 | |||
| 1100 | Ga0209050_1000920 | |||
| 1101 | Ga0209051_1000054 | |||
| 1102 | Ga0209051_1000162 | |||
| 1103 | Ga0209051_1000165 | |||
| 1104 | Ga0209051_1006812 | |||
| 1105 | Ga0209257_1000483 | |||
| 1106 | Ga0207656_10002363 | |||
| 1107 | Ga0207696_1000002 | |||
| 1108 | Ga0207696_1000023 | |||
| 1109 | Ga0207696_1000108 | |||
| 1110 | Ga0207696_1000161 | |||
| 1111 | Ga0207696_1000916 | |||
| 1112 | Ga0207696_1003059 | |||
| 1113 | Ga0207655_1000006 | |||
| 1114 | Ga0207655_1000085 | |||
| 1115 | Ga0207655_1000114 | |||
| 1116 | Ga0207655_1002192 | |||
| 1117 | Ga0207655_1004671 | |||
| 1118 | Ga0207655_1014631 | |||
| 1119 | Ga0207713_1000102 | |||
| 1120 | Ga0207713_1000313 | |||
| 1121 | Ga0207713_1000581 | |||
| 1122 | Ga0207713_1001194 | |||
| 1123 | Ga0207713_1001284 | |||
| 1124 | Ga0207713_1002575 | |||
| 1125 | Ga0207713_1009590 | |||
| 1126 | Ga0207671_10000561 | |||
| 1127 | Ga0207649_10000032 | |||
| 1128 | Ga0207681_10000299 | |||
| 1129 | Ga0207650_10000068 | |||
| 1130 | Ga0207650_10000259 | |||
| 1131 | Ga0207706_10004102 | |||
| 1132 | Ga0207686_10010366 | |||
| 1133 | Ga0207709_10000011 | |||
| 1134 | Ga0207709_10001540 | |||
| 1135 | Ga0207679_10000059 | |||
| 1136 | Ga0207639_10022337 | |||
| 1137 | Ga0209281_1000018 | |||
| 1138 | Ga0209281_1000320 | |||
| 1139 | Ga0207428_10008371 | |||
| 1140 | Ga0316178_1045217 | |||
| 1141 | Ga0307408_100000643 | |||
| 1142 | Ga0307408_100014161 | |||
| 1143 | Ga0307405_10000118 | |||
| 1144 | Ga0307405_10002752 | |||
| 1145 | Ga0307405_10005455 | |||
| 1146 | Ga0307413_10004849 | |||
| 1147 | Ga0307406_10036598 | |||
| 1148 | Ga0307412_10000870 | |||
| 1149 | Ga0307412_10001362 | |||
| 1150 | Ga0307412_10004723 | |||
| 1151 | Ga0307412_10010330 | |||
| 1152 | Ga0307409_100054103 | |||
| 1153 | Ga0307411_10014170 | |||
| 1154 | Ga0307510_10000942 | |||
| 1155 | Ga0439438_000293 | |||
| 1156 | Ga0439438_000301 | |||
| 1157 | Ga0439438_000361 | |||
| 1158 | Ga0439438_000422 | |||
| 1159 | Ga0439438_000485 | |||
| 1160 | Ga0439438_000542 | |||
| 1161 | Ga0439438_000684 | |||
| 1162 | Ga0439438_001715 | |||
| 1163 | Ga0439447_000030 | |||
| 1164 | Ga0439447_000150 | |||
| 1165 | Ga0439447_000314 | |||
| 1166 | Ga0439447_000344 | |||
| 1167 | Ga0439466_0000044 | |||
| 1168 | Ga0439466_0000221 | |||
| 1169 | Ga0439466_0000454 | |||
| 1170 | Ga0439466_0001484 | |||
| 1171 | Ga0439466_0004613 | |||
| 1172 | Ga0439432_000084 | |||
| 1173 | Ga0439432_003335 | |||
| 1174 | Ga0439452_000098 | |||
| 1175 | Ga0439452_000221 | |||
| 1176 | Ga0439452_000411 | |||
| 1177 | Ga0439452_000417 | |||
| 1178 | Ga0439452_001041 | |||
| 1179 | Ga0439452_003099 | |||
| 1180 | Ga0439452_006573 | |||
| 1181 | Ga0439456_000067 | |||
| 1182 | Ga0439456_001379 | |||
| 1183 | Ga0439463_000007 | |||
| 1184 | Ga0439463_000123 | |||
| 1185 | Ga0450911_000491 | |||
| 1186 | Ga0450911_000528 | |||
| 1187 | Ga0450911_001293 | |||
| 1188 | Ga0450920_002980 | |||
| 1189 | Ga0450890_000184 | |||
| 1190 | Ga0450903_000914 | |||
| 1191 | Ga0450903_001189 | |||
| 1192 | Ga0450907_000051 | |||
| 1193 | Ga0450907_004285 | |||
| 1194 | Ga0439446_0001954 | |||
| 1195 | Ga0450908_001635 | |||
| 1196 | Ga0439434_0000099 | |||
| 1197 | Ga0450901_000277 | |||
| 1198 | Ga0439440_0002565 | |||
| 1199 | Ga0495617_000680 | |||
| 1200 | Ga0495617_000753 | |||
| 1201 | Ga0495617_003142 | |||
| 1202 | Ga0495617_004223 | |||
| 1203 | Ga0495617_006186 | |||
| 1204 | Ga0495627_000040 | |||
| 1205 | Ga0495627_000137 | |||
| 1206 | Ga0495627_000717 | |||
| 1207 | Ga0495627_000779 | |||
| 1208 | Ga0495627_001112 | |||
| 1209 | Ga0495627_008328 | |||
| 1210 | Ga0495627_010140 | |||
| 1211 | Ga0495592_0002034 | |||
| 1212 | Ga0495603_0005081 | |||
| 1213 | Ga0495603_0007162 | |||
| 1214 | Ga0495603_0011746 | |||
| 1215 | Ga0495590_0000617 | |||
| 1216 | Ga0495590_0000828 | |||
| 1217 | Ga0495590_0011298 | |||
| 1218 | Ga0495591_000023 | |||
| 1219 | Ga0495591_000121 | |||
| 1220 | Ga0495591_000374 | |||
| 1221 | Ga0495591_000602 | |||
| 1222 | Ga0495591_000680 | |||
| 1223 | Ga0495591_000883 | |||
| 1224 | Ga0495591_001537 | |||
| 1225 | Ga0495591_001611 | |||
| 1226 | Ga0495591_001776 | |||
| 1227 | Ga0495591_002577 | |||
| 1228 | Ga0495591_003036 | |||
| 1229 | Ga0495591_004449 | |||
| 1230 | Ga0495591_009603 | |||
| 1231 | Ga0495591_012387 | |||
| 1232 | Ga0495638_0000863 | |||
| 1233 | Ga0495638_0000866 | |||
| 1234 | Ga0495638_0001203 | |||
| 1235 | Ga0495638_0002533 | |||
| 1236 | Ga0495638_0006333 | |||
| 1237 | Ga0495638_0016361 | |||
| 1238 | Ga0495638_0019834 | |||
| 1239 | Ga0495638_0042032 | |||
| 1240 | Ga0495653_0001725 | |||
| 1241 | Ga0495653_0004101 | |||
| 1242 | Ga0495653_0004352 | |||
| 1243 | Ga0495653_0038108 | |||
| 1244 | Ga0495653_0088730 | |||
| 1245 | Ga0495650_0001031 | |||
| 1246 | Ga0495650_0001290 | |||
| 1247 | Ga0495650_0003268 | |||
| 1248 | Ga0495650_0003921 | |||
| 1249 | Ga0495650_0011448 | |||
| 1250 | Ga0495650_0021035 | |||
| 1251 | Ga0495650_0021550 | |||
| 1252 | Ga0495605_0000048 | |||
| 1253 | Ga0495605_0000094 | |||
| 1254 | Ga0495605_0000245 | |||
| 1255 | Ga0495605_0000291 | |||
| 1256 | Ga0495605_0000540 | |||
| 1257 | Ga0495605_0000819 | |||
| 1258 | Ga0495605_0001092 | |||
| 1259 | Ga0495605_0002324 | |||
| 1260 | Ga0495605_0003619 | |||
| 1261 | Ga0495605_0007563 | |||
| 1262 | Ga0495605_0008610 | |||
| 1263 | Ga0495605_0010265 | |||
| 1264 | Ga0495605_0021314 | |||
| 1265 | Ga0495605_0022598 | |||
| 1266 | Ga0495584_0000399 | |||
| 1267 | Ga0495584_0000404 | |||
| 1268 | Ga0495584_0000586 | |||
| 1269 | Ga0495584_0001339 | |||
| 1270 | Ga0495584_0002533 | |||
| 1271 | Ga0495584_0003400 | |||
| 1272 | Ga0495584_0006532 | |||
| 1273 | Ga0495584_0014937 | |||
| 1274 | Ga0495584_0020350 | |||
| 1275 | Ga0495585_0000016 | |||
| 1276 | Ga0495585_0000573 | |||
| 1277 | Ga0495585_0000728 | |||
| 1278 | Ga0495585_0001186 | |||
| 1279 | Ga0495585_0001801 | |||
| 1280 | Ga0495585_0002780 | |||
| 1281 | Ga0495585_0005166 | |||
| 1282 | Ga0495585_0005839 | |||
| 1283 | Ga0495585_0006587 | |||
| 1284 | Ga0495585_0006653 | |||
| 1285 | Ga0495585_0011754 | |||
| 1286 | Ga0495585_0019894 | |||
| 1287 | Ga0495594_0001163 | |||
| 1288 | Ga0495594_0002271 | |||
| 1289 | Ga0495594_0003085 | |||
| 1290 | Ga0495596_0000056 | |||
| 1291 | Ga0495607_0000185 | |||
| 1292 | Ga0495607_0000234 | |||
| 1293 | Ga0495607_0000384 | |||
| 1294 | Ga0495607_0000476 | |||
| 1295 | Ga0495607_0000986 | |||
| 1296 | Ga0495607_0001382 | |||
| 1297 | Ga0495607_0001919 | |||
| 1298 | Ga0495607_0002375 | |||
| 1299 | Ga0495607_0002946 | |||
| 1300 | Ga0495607_0003070 | |||
| 1301 | Ga0495607_0003722 | |||
| 1302 | Ga0495607_0006942 | |||
| 1303 | Ga0495607_0007472 | |||
| 1304 | Ga0495607_0007717 | |||
| 1305 | Ga0495607_0015411 | |||
| 1306 | Ga0495607_0019575 | |||
| 1307 | Ga0495607_0021166 | |||
| 1308 | Ga0495583_0000096 | |||
| 1309 | Ga0495583_0000387 | |||
| 1310 | Ga0495583_0000540 | |||
| 1311 | Ga0495583_0001059 | |||
| 1312 | Ga0495583_0002874 | |||
| 1313 | Ga0495583_0002888 | |||
| 1314 | Ga0495583_0004286 | |||
| 1315 | Ga0495583_0007621 | |||
| 1316 | Ga0495583_0009297 | |||
| 1317 | Ga0495583_0012328 | |||
| 1318 | Ga0495606_0000167 | |||
| 1319 | Ga0495606_0001446 | |||
| 1320 | Ga0495606_0001484 | |||
| 1321 | Ga0495606_0002351 | |||
| 1322 | Ga0495606_0002412 | |||
| 1323 | Ga0495606_0002769 | |||
| 1324 | Ga0495606_0002977 | |||
| 1325 | Ga0495606_0004429 | |||
| 1326 | Ga0495606_0007966 | |||
| 1327 | Ga0495606_0008379 | |||
| 1328 | Ga0495606_0010712 | |||
| 1329 | Ga0495610_0000653 | |||
| 1330 | Ga0495610_0000661 | |||
| 1331 | Ga0495610_0002742 | |||
| 1332 | Ga0495610_0003790 | |||
| 1333 | Ga0495610_0003827 | |||
| 1334 | Ga0495610_0011390 | |||
| 1335 | Ga0495610_0012866 | |||
| 1336 | Ga0495610_0013096 | |||
| 1337 | Ga0495610_0018470 | |||
| 1338 | Ga0495610_0019340 | |||
| 1339 | Ga0495610_0024372 | |||
| 1340 | Ga0495616_0000608 | |||
| 1341 | Ga0495616_0000766 | |||
| 1342 | Ga0495616_0000828 | |||
| 1343 | Ga0495616_0001062 | |||
| 1344 | Ga0495616_0001072 | |||
| 1345 | Ga0495616_0001572 | |||
| 1346 | Ga0495620_0000001 | |||
| 1347 | Ga0495620_0000346 | |||
| 1348 | Ga0495620_0000578 | |||
| 1349 | Ga0495620_0000622 | |||
| 1350 | Ga0495620_0001067 | |||
| 1351 | Ga0495620_0001186 | |||
| 1352 | Ga0495620_0001539 | |||
| 1353 | Ga0495620_0002478 | |||
| 1354 | Ga0495620_0003199 | |||
| 1355 | Ga0495620_0003624 | |||
| 1356 | Ga0495620_0007173 | |||
| 1357 | Ga0495620_0010605 | |||
| 1358 | Ga0495620_0015139 | |||
| 1359 | Ga0495620_0017045 | |||
| 1360 | Ga0495628_0012033 | |||
| 1361 | Ga0495630_0010976 | |||
| 1362 | Ga0495631_0000412 | |||
| 1363 | Ga0495631_0001024 | |||
| 1364 | Ga0495631_0001633 | |||
| 1365 | Ga0495631_0003157 | |||
| 1366 | Ga0495631_0008356 | |||
| 1367 | Ga0495631_0028509 | |||
| 1368 | Ga0495632_0000676 | |||
| 1369 | Ga0495632_0000933 | |||
| 1370 | Ga0495632_0001632 | |||
| 1371 | Ga0495632_0002645 | |||
| 1372 | Ga0495632_0003477 | |||
| 1373 | Ga0495632_0003748 | |||
| 1374 | Ga0495632_0004501 | |||
| 1375 | Ga0495632_0005142 | |||
| 1376 | Ga0495632_0006133 | |||
| 1377 | Ga0495632_0008892 | |||
| 1378 | Ga0495632_0008950 | |||
| 1379 | Ga0495632_0009751 | |||
| 1380 | Ga0495632_0018218 | |||
| 1381 | Ga0495632_0019041 | |||
| 1382 | Ga0495632_0021350 | |||
| 1383 | Ga0495637_0000115 | |||
| 1384 | Ga0495637_0000134 | |||
| 1385 | Ga0495637_0000437 | |||
| 1386 | Ga0495637_0000671 | |||
| 1387 | Ga0495637_0000957 | |||
| 1388 | Ga0495637_0001931 | |||
| 1389 | Ga0495637_0002379 | |||
| 1390 | Ga0495637_0004345 | |||
| 1391 | Ga0495637_0004730 | |||
| 1392 | Ga0495637_0006284 | |||
| 1393 | Ga0495637_0006313 | |||
| 1394 | Ga0495637_0018177 | |||
| 1395 | Ga0495643_0001468 | |||
| 1396 | Ga0495643_0002308 | |||
| 1397 | Ga0495643_0004573 | |||
| 1398 | Ga0495643_0009900 | |||
| 1399 | Ga0495644_0000240 | |||
| 1400 | Ga0495644_0000254 | |||
| 1401 | Ga0495644_0011678 | |||
| 1402 | Ga0495648_0000585 | |||
| 1403 | Ga0495648_0001289 | |||
| 1404 | Ga0495648_0001791 | |||
| 1405 | Ga0495648_0001832 | |||
| 1406 | Ga0495648_0002294 | |||
| 1407 | Ga0495648_0002558 | |||
| 1408 | Ga0495648_0005559 | |||
| 1409 | Ga0495648_0007982 | |||
| 1410 | Ga0495648_0010168 | |||
| 1411 | Ga0495648_0015825 | |||
| 1412 | Ga0495648_0025846 | |||
| 1413 | Ga0495648_0030467 | |||
| 1414 | Ga0495666_0000146 | |||
| 1415 | Ga0495642_0000030 | |||
| 1416 | Ga0495642_0000419 | |||
| 1417 | Ga0495642_0001771 | |||
| 1418 | Ga0495652_0071822 | |||
| 1419 | Ga0495654_0000166 | |||
| 1420 | Ga0495654_0000545 | |||
| 1421 | Ga0495654_0001158 | |||
| 1422 | Ga0495654_0001616 | |||
| 1423 | Ga0495654_0002063 | |||
| 1424 | Ga0495654_0002136 | |||
| 1425 | Ga0495654_0003356 | |||
| 1426 | Ga0495654_0004479 | |||
| 1427 | Ga0495654_0011954 | |||
| 1428 | Ga0495654_0016664 | |||
| 1429 | Ga0495587_0001087 | |||
| 1430 | Ga0495587_0009839 | |||
| 1431 | Ga0495609_0000012 | |||
| 1432 | Ga0495609_0000167 | |||
| 1433 | Ga0495609_0000259 | |||
| 1434 | Ga0495609_0000516 | |||
| 1435 | Ga0495609_0001015 | |||
| 1436 | Ga0495609_0002648 | |||
| 1437 | Ga0495609_0016766 | |||
| 1438 | Ga0495597_0000016 | |||
| 1439 | Ga0495597_0000935 | |||
| 1440 | Ga0495597_0001278 | |||
| 1441 | Ga0495597_0001752 | |||
| 1442 | Ga0495645_0011624 | |||
| 1443 | Ga0495622_0000442 | |||
| 1444 | Ga0495622_0001398 | |||
| 1445 | Ga0495622_0001451 | |||
| 1446 | Ga0495622_0004053 | |||
| 1447 | Ga0495622_0006931 | |||
| 1448 | Ga0495633_0000034 | |||
| 1449 | Ga0495633_0001148 | |||
| 1450 | Ga0495633_0001544 | |||
| 1451 | Ga0495656_0005899 | |||
| 1452 | Ga0495668_0001309 | |||
| 1453 | Ga0495668_0001799 | |||
| 1454 | Ga0495668_0004994 | |||
| 1455 | Ga0495668_0008942 | |||
| 1456 | Ga0495668_0010523 | |||
| 1457 | Ga0495634_0000895 | |||
| 1458 | Ga0495611_0000520 | |||
| 1459 | Ga0495611_0000948 | |||
| 1460 | Ga0495611_0001788 | |||
| 1461 | Ga0495611_0004324 | |||
| 1462 | Ga0495611_0004820 | |||
| 1463 | Ga0495625_0000134 | |||
| 1464 | Ga0495625_0001917 | |||
| 1465 | Ga0495625_0002078 | |||
| 1466 | Ga0495625_0002135 | |||
| 1467 | Ga0495625_0018969 | |||
| 1468 | Ga0495625_0021557 | |||
| 1469 | Ga0495625_0038111 | |||
| 1470 | Ga0495625_0044933 | |||
| 1471 | Ga0495635_0001544 | |||
| 1472 | Ga0495635_0001565 | |||
| 1473 | Ga0495659_0000081 | |||
| 1474 | Ga0495661_0000004 | |||
| 1475 | Ga0495661_0000030 | |||
| 1476 | Ga0495661_0000088 | |||
| 1477 | Ga0495661_0000692 | |||
| 1478 | Ga0495661_0000896 | |||
| 1479 | Ga0495661_0001895 | |||
| 1480 | Ga0495661_0003936 | |||
| 1481 | Ga0495661_0005454 | |||
| 1482 | Ga0495661_0011952 | |||
| 1483 | Ga0495661_0013930 | |||
| 1484 | Ga0495661_0014090 | |||
| 1485 | Ga0495588_0002797 | |||
| 1486 | Ga0495623_0001124 | |||
| 1487 | Ga0495623_0002784 | |||
| 1488 | Ga0495646_0003001 | |||
| 1489 | Ga0495646_0005182 | |||
| 1490 | Ga0495646_0006595 | |||
| 1491 | Ga0495669_0000311 | |||
| 1492 | Ga0495624_0000246 | |||
| 1493 | Ga0495670_0000240 | |||
| 1494 | Ga0495670_0000578 | |||
| 1495 | Ga0495670_0001618 | |||
| 1496 | Ga0495670_0004434 | |||
| 1497 | Ga0495670_0004494 | |||
| 1498 | Ga0495670_0005903 | |||
| 1499 | Ga0495670_0009221 | |||
| 1500 | Ga0495670_0009626 | |||
| 1501 | Ga0495670_0013493 | |||
| 1502 | Ga0495670_0017620 | |||
| 1503 | Ga0495671_0000289 | |||
| 1504 | Ga0495671_0000399 | |||
| 1505 | Ga0495671_0000852 | |||
| 1506 | Ga0495671_0000981 | |||
| 1507 | Ga0495671_0003292 | |||
| 1508 | Ga0495671_0007768 | |||
| 1509 | Ga0495671_0008182 | |||
| 1510 | Ga0495671_0008861 | |||
| 1511 | Ga0495671_0012279 | |||
| 1512 | Ga0495671_0015271 | |||
| 1513 | Ga0495671_0017467 | |||
| 1514 | Ga0495671_0017702 | |||
| 1515 | Ga0495671_0036457 | |||
| 1516 | Ga0495671_0037045 | |||
| 1517 | Ga0495649_0000719 | |||
| 1518 | Ga0495649_0000852 | |||
| 1519 | Ga0495649_0000876 | |||
| 1520 | Ga0495649_0001220 | |||
| 1521 | Ga0495649_0004127 | |||
| 1522 | Ga0495649_0012248 | |||
| 1523 | Ga0495649_0012561 | |||
| 1524 | Ga0495649_0014236 | |||
| 1525 | Ga0495649_0016899 | |||
| 1526 | Ga0495649_0018590 | |||
| 1527 | Ga0495649_0031319 | |||
| 1528 | Ga0495589_0000482 | |||
| 1529 | Ga0495589_0001445 | |||
| 1530 | Ga0495589_0001685 | |||
| 1531 | Ga0495589_0002256 | |||
| 1532 | Ga0495589_0002303 | |||
| 1533 | Ga0495589_0004256 | |||
| 1534 | Ga0495589_0009061 | |||
| 1535 | Ga0495589_0012465 | |||
| 1536 | Ga0495600_0034312 | |||
| 1537 | Ga0495660_0000807 | |||
| 1538 | Ga0495660_0000814 | |||
| 1539 | Ga0495660_0000815 | |||
| 1540 | Ga0495660_0001803 | |||
| 1541 | Ga0495660_0002903 | |||
| 1542 | Ga0495660_0004211 | |||
| 1543 | Ga0495660_0005098 | |||
| 1544 | Ga0495660_0008917 | |||
| 1545 | Ga0495660_0014479 | |||
| 1546 | Ga0495660_0017891 | |||
| 1547 | Ga0495660_0027758 | |||
| 1548 | Ga0495660_0029467 | |||
| 1549 | Ga0495660_0039506 | |||
| 1550 | Ga0495581_0001429 | |||
| 1551 | Ga0495604_0002090 | |||
| 1552 | Ga0495604_0002459 | |||
| 1553 | Ga0495674_0006644 | |||
| 1554 | Ga0495672_0000548 | |||
| 1555 | Ga0495672_0000946 | |||
| 1556 | Ga0495672_0001020 | |||
| 1557 | Ga0495672_0001030 | |||
| 1558 | Ga0495672_0002300 | |||
| 1559 | Ga0495672_0003248 | |||
| 1560 | Ga0495672_0004110 | |||
| 1561 | Ga0495672_0004808 | |||
| 1562 | Ga0495672_0008632 | |||
| 1563 | Ga0495672_0008637 | |||
| 1564 | Ga0495672_0011641 | |||
| 1565 | Ga0495672_0016270 | |||
| 1566 | Ga0495672_0021768 | |||
| 1567 | Ga0495672_0032895 | |||
| 1568 | Ga0495676_0000018 | |||
| 1569 | Ga0495676_0002166 | |||
| 1570 | Ga0495676_0003503 | |||
| 1571 | Ga0495680_0001365 | |||
| 1572 | Ga0495680_0002276 | |||
| 1573 | Ga0495680_0022614 | |||
| 1574 | Ga0495680_0041726 | |||
| 1575 | Ga0495683_0000018 | |||
| 1576 | Ga0495683_0000034 | |||
| 1577 | Ga0495683_0000118 | |||
| 1578 | Ga0495683_0000640 | |||
| 1579 | Ga0495683_0001726 | |||
| 1580 | Ga0495683_0002143 | |||
| 1581 | Ga0495683_0004680 | |||
| 1582 | Ga0495683_0005370 | |||
| 1583 | Ga0495683_0005758 | |||
| 1584 | Ga0495683_0007386 | |||
| 1585 | Ga0495687_002214 | |||
| 1586 | Ga0495687_005600 | |||
| 1587 | Ga0495687_013475 | |||
| 1588 | Ga0495687_015096 | |||
| 1589 | Ga0495675_0001178 | |||
| 1590 | Ga0495677_0000389 | |||
| 1591 | Ga0495679_000039 | |||
| 1592 | Ga0495679_000497 | |||
| 1593 | Ga0495679_000571 | |||
| 1594 | Ga0495679_000659 | |||
| 1595 | Ga0495679_000717 | |||
| 1596 | Ga0495679_000811 | |||
| 1597 | Ga0495679_001183 | |||
| 1598 | Ga0495679_004918 | |||
| 1599 | Ga0495673_0000254 | |||
| 1600 | Ga0495673_0001002 | |||
| 1601 | Ga0495673_0001352 | |||
| 1602 | Ga0495673_0002013 | |||
| 1603 | Ga0495673_0002769 | |||
| 1604 | Ga0495673_0002900 | |||
| 1605 | Ga0495673_0003509 | |||
| 1606 | Ga0495673_0004057 | |||
| 1607 | Ga0495673_0004412 | |||
| 1608 | Ga0495673_0004990 | |||
| 1609 | Ga0495673_0008006 | |||
| 1610 | Ga0495673_0009119 | |||
| 1611 | Ga0495673_0011409 | |||
| 1612 | Ga0495673_0012398 | |||
| 1613 | Ga0495673_0013641 | |||
| 1614 | Ga0495673_0015327 | |||
| 1615 | Ga0495681_0000475 | |||
| 1616 | Ga0495681_0000576 | |||
| 1617 | Ga0495681_0000811 | |||
| 1618 | Ga0495681_0000916 | |||
| 1619 | Ga0495681_0000987 | |||
| 1620 | Ga0495681_0001530 | |||
| 1621 | Ga0495681_0001839 | |||
| 1622 | Ga0495681_0002615 | |||
| 1623 | Ga0495681_0003442 | |||
| 1624 | Ga0495681_0003855 | |||
| 1625 | Ga0495681_0004360 | |||
| 1626 | Ga0495681_0004725 | |||
| 1627 | Ga0495681_0004899 | |||
| 1628 | Ga0495681_0005432 | |||
| 1629 | Ga0495681_0009722 | |||
| 1630 | Ga0495681_0009773 | |||
| 1631 | Ga0495681_0015872 | |||
| 1632 | Ga0495681_0021303 | |||
| 1633 | Ga0495684_0021727 | |||
| 1634 | Ga0495686_0000919 | |||
| 1635 | Ga0495686_0004717 | |||
| 1636 | Ga0495686_0007273 | |||
| 1637 | Ga0495593_0000675 | |||
| 1638 | Ga0495593_0025237 | |||
| 1639 | Ga0495602_0001096 | |||
| 1640 | Ga0495626_0000216 | |||
| 1641 | Ga0495626_0000236 | |||
| 1642 | Ga0495626_0000467 | |||
| 1643 | Ga0495626_0000491 | |||
| 1644 | Ga0495626_0000606 | |||
| 1645 | Ga0495626_0001472 | |||
| 1646 | Ga0495626_0002336 | |||
| 1647 | Ga0495626_0004812 | |||
| 1648 | Ga0495626_0012142 | |||
| 1649 | Ga0496102_0000496 | |||
| 1650 | Ga0496103_0002367 | |||
| 1651 | Ga0496110_0056473 | |||
| 1652 | Ga0496116_0000046 | |||
| 1653 | Ga0496116_0000650 | |||
| 1654 | Ga0496116_0001028 | |||
| 1655 | Ga0496116_0002222 | |||
| 1656 | Ga0496116_0002592 | |||
| 1657 | Ga0496117_0000621 | |||
| 1658 | Ga0496117_0001466 | |||
| 1659 | Ga0496117_0002827 | |||
| 1660 | Ga0496117_0004579 | |||
| 1661 | Ga0496117_0006300 | |||
| 1662 | Ga0496118_0003256 | |||
| 1663 | Ga0496118_0025087 | |||
| 1664 | Ga0496118_0039289 | |||
| 1665 | Ga0496118_0042119 | |||
| 1666 | Ga0496118_0045106 | |||
| 1667 | Ga0496119_0005391 | |||
| 1668 | Ga0496119_0012038 | |||
| 1669 | Ga0496120_0002592 | |||
| 1670 | Ga0496120_0003163 | |||
| 1671 | Ga0496121_0000284 | |||
| 1672 | Ga0496121_0005555 | |||
| 1673 | Ga0496121_0006810 | |||
| 1674 | Ga0496121_0008407 | |||
| 1675 | Ga0496121_0019936 | |||
| 1676 | Ga0496122_0001312 | |||
| 1677 | Ga0496122_0004810 | |||
| 1678 | Ga0496122_0005852 | |||
| 1679 | Ga0496122_0006687 | |||
| 1680 | Ga0496122_0022983 | |||
| 1681 | Ga0496122_0061700 | |||
| 1682 | Ga0496123_0002229 | |||
| 1683 | Ga0496123_0002638 | |||
| 1684 | Ga0496123_0004572 | |||
| 1685 | Ga0496123_0005771 | |||
| 1686 | Ga0496123_0034060 | |||
| 1687 | Ga0496123_0057804 | |||
| 1688 | Ga0496124_0000718 | |||
| 1689 | Ga0496124_0001537 | |||
| 1690 | Ga0496124_0003911 | |||
| 1691 | Ga0496124_0004132 | |||
| 1692 | Ga0496124_0004687 | |||
| 1693 | Ga0496124_0006277 | |||
| 1694 | Ga0496124_0016348 | |||
| 1695 | Ga0496124_0018426 | |||
| 1696 | Ga0496124_0034700 | |||
| 1697 | Ga0496124_0066746 | |||
| 1698 | Ga0496125_0000511 | |||
| 1699 | Ga0496125_0000842 | |||
| 1700 | Ga0496125_0002577 | |||
| 1701 | Ga0496125_0014620 | |||
| 1702 | Ga0496125_0019465 | |||
| 1703 | Ga0496125_0026940 | |||
| 1704 | Ga0496125_0051526 | |||
| 1705 | Ga0496126_0001228 | |||
| 1706 | Ga0496126_0012627 | |||
| 1707 | Ga0495678_000049 | |||
| 1708 | Ga0495678_000686 | |||
| 1709 | Ga0495678_001210 | |||
| 1710 | Ga0495678_001756 | |||
| 1711 | Ga0495678_002099 | |||
| 1712 | Ga0495678_004483 | |||
| 1713 | Ga0495678_004580 | |||
| 1714 | Ga0495678_005460 | |||
| 1715 | Ga0495678_011772 | |||
| 1716 | Ga0495678_028461 | |||
| 1717 | Ga0495682_0000050 | |||
| 1718 | Ga0495682_0001153 | |||
| 1719 | Ga0495682_0003306 | |||
| 1720 | Ga0501222_000227 | |||
| 1721 | Ga0500572_000228 | |||
| 1722 | Ga0500618_002134 | |||
| 1723 | Ga0500634_0000141 | |||
| 1724 | Ga0500634_0004166 | |||
| 1725 | 2511255363 | |||
| 1726 | 2511264325 | |||
| 1727 | 2511271239 | |||
| 1728 | 2511279941 | |||
| 1729 | 2511290861 | |||
| 1730 | 2511293622 | |||
| 1731 | 2511304956 | |||
| 1732 | 2511316416 | |||
| 1733 | 2511328363 | |||
| 1734 | 2511332893 | |||
| 1735 | 2511340964 | |||
| 1736 | 2511346777 | |||
| 1737 | 2511351733 | |||
| 1738 | 2511358187 | |||
| 1739 | 2511364152 | |||
| 1740 | 2511370571 | |||
| 1741 | 2511416063 | |||
| 1742 | 2511823964 | |||
| 1743 | 2512329191 | |||
| 1744 | 2555669233 | |||
| 1745 | 2583793320 | |||
| 1746 | 2597857291 | |||
| 1747 | 2597864740 | |||
| 1748 | 2597870593 | |||
| 1749 | 2599330308 | |||
| 1750 | 2599357870 | |||
| 1751 | 2599361623 | |||
| 1752 | 2599367945 | |||
| 1753 | 2599374734 | |||
| 1754 | 2599383035 | |||
| 1755 | 2599389582 | |||
| 1756 | 2599393592 | |||
| 1757 | 2599397922 | |||
| 1758 | 2599405359 | |||
| 1759 | 2599452368 | |||
| 1760 | 2599464686 | |||
| 1761 | 2599468236 | |||
| 1762 | 2599484774 | |||
| 1763 | 2599493709 | |||
| 1764 | 2599503214 | |||
| 1765 | 2599506932 | |||
| 1766 | 2599513253 | |||
| 1767 | 2599518247 | |||
| 1768 | 2599612270 | |||
| 1769 | 2599769775 | |||
| 1770 | 2599801962 | |||
| 1771 | 2599878041 | |||
| 1772 | 2599887097 | |||
| 1773 | 2599891929 | |||
| 1774 | 2599898738 | |||
| 1775 | 2599933727 | |||
| 1776 | 2599942780 | |||
| 1777 | 2599947253 | |||
| 1778 | 2599953529 | |||
| 1779 | 2599959196 | |||
| 1780 | 2599964465 | |||
| 1781 | 2599975317 | |||
| 1782 | 2599975662 | |||
| 1783 | 2599982210 | |||
| 1784 | 2599989014 | |||
| 1785 | 2599993167 | |||
| 1786 | 2599999522 | |||
| 1787 | 2600007768 | |||
| 1788 | 2600009701 | |||
| 1789 | 2600016959 | |||
| 1790 | 2600022827 | |||
| 1791 | 2600030259 | |||
| 1792 | 2600036660 | |||
| 1793 | 2600039479 | |||
| 1794 | 2600046968 | |||
| 1795 | 2600051782 | |||
| 1796 | 2600057920 | |||
| 1797 | 2600068675 | |||
| 1798 | 2600070014 | |||
| 1799 | 2600076195 | |||
| 1800 | 2600217407 | |||
| 1801 | 2600359836 | |||
| 1802 | 2600367501 | |||
| 1803 | 2601626620 | |||
| 1804 | 2601689976 | |||
| 1805 | 2601777577 | |||
| 1806 | 2601795958 | |||
| 1807 | 2606075194 | |||
| 1808 | 2606128057 | |||
| 1809 | 2621298737 | |||
| 1810 | 2624480003 | |||
| 1811 | 2624492970 | |||
| 1812 | 2643843542 | |||
| 1813 | 2643871438 | |||
| 1814 | 2643953718 | |||
| 1815 | 2644021651 | |||
| 1816 | 2644190293 | |||
| 1817 | 2644282229 | |||
| 1818 | 2644622435 | |||
| 1819 | 2652545395 | |||
| 1820 | 2671091230 | |||
| 1821 | 2671098265 | |||
| 1822 | 2671128459 | |||
| 1823 | 2671768910 | |||
| 1824 | 2677900774 | |||
| 1825 | 2678262956 | |||
| 1826 | 2715753100 | |||
| 1827 | 2715756190 | |||
| 1828 | 2723249515 | |||
| 1829 | 2738671986 | |||
| 1830 | 2738691344 | |||
| 1831 | 2738750380 | |||
| 1832 | 2738809976 | |||
| 1833 | 2738859420 | |||
| 1834 | 2738897336 | |||
| 1835 | 2739201990 | |||
| 1836 | 2739260054 | |||
| 1837 | 2739267119 | |||
| 1838 | 2739316761 | |||
| 1839 | 2743736715 | |||
| 1840 | 2745009293 | |||
| 1841 | 2774123060 | |||
| 1842 | 2774137448 | |||
| 1843 | 2784263770 | |||
| 1844 | 2784315534 | |||
| 1845 | 2794596708 | |||
| 1846 | 2808857548 | |||
| 1847 | 2808925252 | |||
| 1848 | 2808930072 | |||
| 1849 | 2808937718 | |||
| 1850 | 2808947400 | |||
| 1851 | 2808952363 | |||
| 1852 | 2808960543 | |||
| 1853 | 2808966032 | |||
| 1854 | 2808977057 | |||
| 1855 | 2808992212 | |||
| 1856 | 2809000924 | |||
| 1857 | 2809214208 | |||
| 1858 | 2817492106 | |||
| 1859 | 2819656563 | |||
| 1860 | 2819703336 | |||
| 1861 | 2825656881 | |||
| 1862 | 2826584532 | |||
| 1863 | 2834032924 | |||
| 1864 | 2842818087 | |||
| 1865 | 2842828135 | |||
| 1866 | 2842835384 | |||
| 1867 | 2842842801 | |||
| 1868 | 2842847157 | |||
| 1869 | 2842849278 | |||
| 1870 | 2842854930 | |||
| 1871 | 2844669667 | |||
| 1872 | 2852613608 | |||
| 1873 | 2852658138 | |||
| 1874 | 2852668656 | |||
| 1875 | 2860342058 | |||
| 1876 | 2860871222 | |||
| 1877 | 2878031911 | |||
| 1878 | 2880234173 | |||
| 1879 | 2904522675 | |||
| 1880 | 2904551966 | |||
| 1881 | 2908450576 | |||
| 1882 | 2913040671 | |||
| 1883 | 2917073035 | |||
| 1884 | 2919068389 | |||
| 1885 | 2919386851 | |||
| 1886 | 2919456484 | |||
| 1887 | 2919482220 | |||
| 1888 | 2919492368 | |||
| 1889 | 2919699754 | |||
| 1890 | 2923155733 | |||
| 1891 | 2923587791 | |||
| 1892 | 2929148021 | |||
| 1893 | 2929193282 | |||
| 1894 | 2931374418 | |||
| 1895 | 2931394598 | |||
| 1896 | 2931400970 | |||
| 1897 | 2935359451 | |||
| 1898 | 2939640116 | |||
| 1899 | 2945932724 | |||
| 1900 | 2945962711 | |||
| 1901 | 2946008930 | |||
| 1902 | 2946031578 | |||
| 1903 | 2947238550 | |||
| 1904 | 2969306718 | |||
| 1905 | 2974291649 | |||
| 1906 | 2984290293 | |||
| 1907 | 2988729806 | |||
| 1908 | 2998142132 | |||
| 1909 | 3007401291 | |||
| 1910 | 3007422579 | |||
| 1911 | 3007513595 | |||
| 1912 | 3007618259 | |||
| 1913 | 3007620015 | |||
| 1914 | 3007723987 | |||
| 1915 | 3007860566 | |||
| 1916 | 3007862656 | |||
| 1917 | 3007868382 | |||
| 1918 | 637319568 | |||
| 1919 | 8015689984 | |||
| 1920 | 8019775975 | |||
| 1921 | 8029998559 | |||
| 1922 | 8054285357 | |||
| 1923 | 8054348570 | |||
| 1924 | 8054507101 | |||
| 1925 | 8055773088 | |||
| 1926 | 8055822051 | |||
| 1927 | 8055883294 | |||
| 1928 | 8056128158 | |||
| 1929 | 8056135543 | |||
| 1930 | 8056147055 | |||
| 1931 | 8056151994 | |||
| 1932 | 8056157060 | |||
| 1933 | 8056161707 | |||
| 1934 | 8056168942 | |||
| 1935 | 8056175009 | |||
| 1936 | 8056178935 | |||
| 1937 | 8056572896 | |||
| 1938 | 8057799670 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ir5-assembly1.cif.gz_A | crystal structure of narghi mutant narg-h49c | 0.7541 | 141 | 185 |
| 8tzj-assembly1.cif.gz_D | cryo-em structure of vibrio cholerae ftse/ftsx complex | 0.6637 | 230 | 366 |
| 5f9q-assembly1.cif.gz_A | crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria | 0.662 | 497 | 668 |
| 3ftj-assembly1.cif.gz_A | crystal structure of the periplasmic region of macb from actinobacillus actinomycetemcomitans | 0.6447 | 496 | 674 |
| 5udf-assembly1.cif.gz_B | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.6321 | 489 | 668 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5BL07_3_99_2.40.40.20 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.5626 | 555 | 645 | 2.40.40.20 |
| 2iv2X04 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.5489 | 129 | 205 | 2.40.40.20 |
| 1kqgA04 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.5233 | 534 | 623 | 2.40.40.20 |
| af_P33602_811_906_2.40.40.20 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.5223 | 121 | 205 | 2.40.40.20 |
| af_Q5BL07_3_99_2.40.40.20 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.4996 | 555 | 645 | 2.40.40.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R2TH66-F1-model_v4 | Uncharacterized protein | 0.8171 | 350 | 820 |
GO:0005886
|
| AF-A0A0R2TH66-F1-model_v4 | Uncharacterized protein | 0.814 | 350 | 820 |
GO:0005886
|
| AF-A0A1V3A126-F1-model_v4 | ABC transporter permease | 0.8096 | 9 | 815 |
GO:0005886
|
| AF-A0A1S9CVS1-F1-model_v4 | Macrolide export ATP-binding/permease protein MacB | 0.8087 | 4 | 819 |
GO:0005886
|
| AF-A0A1S9CVS1-F1-model_v4 | Macrolide export ATP-binding/permease protein MacB | 0.8045 | 4 | 819 |
GO:0005886
|