F487100

General Info

Members Datasets Scaffolds Average Seq Length
970 413 1940 217

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0020265|Ga0495638_0020265_491_1285
Length 264
Sequence LRWAADRSAIVSYTESRQQQGTHFQCRRKRSPALRQRPLTITARRSNMAIRIGDEAPDFTAQTTEGTLNFHQWIGDGWAILFSHPKDFTPVCTTELGYLAKLKPEFDKRNTKILGLSIDPVSDHEKWVGDIEETQGNAVNYPLIGDENLVVAKLYDMIHPNASGGTRTAVDNATVRSVFLVGPDKKIKAMLIYPMSAGRNFDEVLRLLDSLQLNAKHTVATPVNWRPGEDVIIPTSVSDEDAKKKYPDGFKTLKPYLRTVAQPK

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
100 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
173 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
181 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
182 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
186 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
187 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
188 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
189 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
190 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
191 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
192 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
193 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
194 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
195 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
196 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
199 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
280 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
287 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
353 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
354 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
355 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
356 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
357 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
358 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
365 2511231004 Pseudomonas sp. GM102 Isolate Nodule
366 2511231006 Pseudomonas sp. GM17 Isolate Nodule
367 2511231007 Pseudomonas sp. GM18 Isolate Nodule
368 2511231008 Pseudomonas sp. GM21 Isolate Nodule
369 2511231012 Pseudomonas sp. GM33 Isolate Nodule
370 2511231014 Pseudomonas sp. GM48 Isolate Nodule
371 2511231015 Pseudomonas sp. GM49 Isolate Nodule
372 2511231016 Pseudomonas sp. GM50 Isolate Nodule
373 2511231017 Pseudomonas sp. GM55 Isolate Nodule
374 2511231020 Pseudomonas sp. GM74 Isolate Nodule
375 2511231021 Pseudomonas sp. GM78 Isolate Nodule
376 2511231022 Pseudomonas sp. GM79 Isolate Nodule
377 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
378 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
379 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
380 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
381 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
382 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
383 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
384 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
385 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
386 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
387 2643221584 Caulobacter sp. Root656 Isolate Unclassified
388 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
389 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
390 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
391 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
392 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
393 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
394 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
395 2773857670 Pseudomonas sp. 478 Isolate Unclassified
396 2784132072 Pseudomonas sp. 460 Isolate Unclassified
397 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
398 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
399 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
400 2818991435 Caulobacter henricii 536 Isolate Unclassified
401 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
402 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
403 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
404 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
405 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
406 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
407 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
408 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
409 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
410 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
411 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
412 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
413 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.2
Metatranscriptomes 1.75
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.22
Nodule 1.55
Rhizoplane 1.75
Rhizosphere 85.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0020265 3300046460 Bacteria 4393
2 MRS2a_Contig_16 2124908027 Bacteria 42770
3 MRS2a_Contig_7135 2124908027 Bacteria 4188
4 MRS2a_Contig_9103 2124908027 Bacteria 4155
5 SwRhRL2b_contig_1791376 2162886007 Bacteria 3602
6 SwRhRL2b_contig_275942 2162886007 Bacteria 816
7 JGI25162J39368_1000045 3300002737 Bacteria 170731
8 JGI25163J39215_1000297 3300002771 Bacteria 16793
9 JGI25164J39214_1000147 3300002772 Bacteria 67564
10 JGI25151J46595_10000065 3300003187 Bacteria 145136
11 JGI25151J46595_10056448 3300003187 Bacteria 1287
12 JGI25165J46597_1000086 3300003214 Bacteria 170731
13 Ga0006562J51391_1007874 3300003578 Bacteria 1416
14 Ga0055537_1000409 3300003773 Bacteria 28111
15 Ga0055524_1021663 3300003775 Bacteria 2122
16 Ga0055536_1000028 3300003781 Bacteria 162550
17 Ga0055534_1000189 3300003784 Bacteria 45268
18 Ga0055530_10000030 3300003791 Bacteria 125301
19 Ga0055530_10014884 3300003791 Bacteria 2568
20 Ga0055540_1000262 3300003792 Bacteria 47599
21 Ga0058863_10027487 3300004799 Bacteria 1250
22 Ga0065714_10000003 3300005288 Bacteria 32061
23 Ga0065714_10004301 3300005288 Bacteria 6888
24 Ga0065714_10004791 3300005288 Bacteria 4459
25 Ga0065714_10005115 3300005288 Bacteria 9819
26 Ga0065714_10005580 3300005288 Bacteria 12212
27 Ga0065714_10066220 3300005288 Bacteria 7333
28 Ga0065714_10084673 3300005288 Bacteria 2153
29 Ga0065714_10105443 3300005288 Bacteria 1566
30 Ga0065714_10120013 3300005288 Bacteria 1342
31 Ga0065704_10079095 3300005289 Bacteria 4258
32 Ga0065704_10112878 3300005289 Bacteria 1914
33 Ga0065704_10146359 3300005289 Bacteria 1468
34 Ga0065712_10002579 3300005290 Bacteria 5346
35 Ga0065715_10101780 3300005293 Bacteria 3102
36 Ga0065707_10128004 3300005295 Bacteria 1973
37 Ga0070666_10027722 3300005335 Bacteria 3712
38 Ga0070661_100127962 3300005344 Bacteria 1906
39 Ga0070661_100181536 3300005344 Bacteria 1601
40 Ga0070668_100117988 3300005347 Bacteria 2118
41 Ga0070675_100857004 3300005354 Bacteria 832
42 Ga0070674_100116330 3300005356 Bacteria 1973
43 Ga0070674_100476319 3300005356 Bacteria 1035
44 Ga0070674_100969041 3300005356 Bacteria 745
45 Ga0070673_100306202 3300005364 Bacteria 1400
46 Ga0070713_100419852 3300005436 Bacteria 1252
47 Ga0070705_100004662 3300005440 Bacteria 6675
48 Ga0070705_100493441 3300005440 Bacteria 928
49 Ga0070694_100014594 3300005444 Bacteria 4919
50 Ga0070708_100036681 3300005445 Bacteria 4277
51 Ga0070708_100499237 3300005445 Bacteria 1148
52 Ga0070678_100039595 3300005456 Bacteria 3327
53 Ga0070678_100796008 3300005456 Bacteria 858
54 Ga0070681_10084016 3300005458 Bacteria 3136
55 Ga0070681_10502913 3300005458 Bacteria 1125
56 Ga0070706_100009094 3300005467 Bacteria 9252
57 Ga0070706_100016861 3300005467 Bacteria 6746
58 Ga0070706_100083731 3300005467 Bacteria 2955
59 Ga0070707_100650196 3300005468 Bacteria 1017
60 Ga0070698_100001874 3300005471 Bacteria 23434
61 Ga0070698_100050404 3300005471 Bacteria 4245
62 Ga0070699_100000814 3300005518 Bacteria 28861
63 Ga0070699_100002404 3300005518 Bacteria 16798
64 Ga0070699_100059013 3300005518 Bacteria 3325
65 Ga0070699_100099564 3300005518 Bacteria 2547
66 Ga0070699_100103653 3300005518 Bacteria 2495
67 Ga0070679_100137439 3300005530 Bacteria 2425
68 Ga0070679_100329000 3300005530 Bacteria 1477
69 Ga0070679_100750491 3300005530 Bacteria 919
70 Ga0068853_100008756 3300005539 Bacteria 8139
71 Ga0068853_100050648 3300005539 Bacteria 3573
72 Ga0070672_100123927 3300005543 Bacteria 2118
73 Ga0070672_100249747 3300005543 Bacteria 1494
74 Ga0070695_100114785 3300005545 Bacteria 1834
75 Ga0070696_100001106 3300005546 Bacteria 17448
76 Ga0070696_100080896 3300005546 Bacteria 2301
77 Ga0070696_100206054 3300005546 Bacteria 1470
78 Ga0070665_100053117 3300005548 Bacteria 4064
79 Ga0070665_100644904 3300005548 Bacteria 1072
80 Ga0070704_100159504 3300005549 Bacteria 1782
81 Ga0068855_100067729 3300005563 Bacteria 4158
82 Ga0068855_100192437 3300005563 Bacteria 2300
83 Ga0068856_100004119 3300005614 Bacteria 14533
84 Ga0068852_100316995 3300005616 Bacteria 1513
85 Ga0068852_101030868 3300005616 Bacteria 842
86 Ga0068859_100159859 3300005617 Bacteria 2332
87 Ga0068860_100135331 3300005843 Bacteria 2366
88 Ga0068862_100666199 3300005844 Bacteria 1005
89 Ga0081455_10183998 3300005937 Bacteria 1579
90 Ga0081455_10197492 3300005937 Bacteria 1509
91 Ga0081455_10230493 3300005937 Bacteria 1367
92 Ga0075365_10191220 3300006038 Bacteria 1432
93 Ga0075368_10027474 3300006042 Bacteria 2196
94 Ga0075368_10047722 3300006042 Bacteria 1695
95 Ga0075363_100076711 3300006048 Bacteria 1823
96 Ga0075364_10010255 3300006051 Bacteria 5653
97 Ga0075364_10015174 3300006051 Bacteria 4771
98 Ga0075364_10026491 3300006051 Bacteria 3699
99 Ga0075364_10032030 3300006051 Bacteria 3377
100 Ga0075432_10003245 3300006058 Bacteria 5488
101 Ga0075432_10003498 3300006058 Bacteria 5318
102 Ga0075432_10177981 3300006058 Bacteria 831
103 Ga0075362_10176928 3300006177 Bacteria 1033
104 Ga0075367_10006727 3300006178 Bacteria 5834
105 Ga0075369_10056579 3300006186 Bacteria 1705
106 Ga0075369_10256479 3300006186 Bacteria 813
107 Ga0075370_10019361 3300006353 Bacteria 3707
108 Ga0075370_10057075 3300006353 Bacteria 2219
109 Ga0075370_10127917 3300006353 Bacteria 1481
110 Ga0068871_100259576 3300006358 Bacteria 1515
111 Ga0068871_100446309 3300006358 Bacteria 1159
112 Ga0075428_100047960 3300006844 Bacteria 4690
113 Ga0075428_100080257 3300006844 Bacteria 3560
114 Ga0075428_100261448 3300006844 Bacteria 1863
115 Ga0075430_100267414 3300006846 Bacteria 1416
116 Ga0075431_100004080 3300006847 Bacteria 14244
117 Ga0075431_100159825 3300006847 Bacteria 2317
118 Ga0075431_100368703 3300006847 Bacteria 1441
119 Ga0075433_10519587 3300006852 Bacteria 1047
120 Ga0075434_100006602 3300006871 Bacteria 10647
121 Ga0075429_100093930 3300006880 Bacteria 2616
122 Ga0075436_100008107 3300006914 Bacteria 7191
123 Ga0075436_100024079 3300006914 Bacteria 4185
124 Ga0075436_100028764 3300006914 Bacteria 3823
125 Ga0075436_100048957 3300006914 Bacteria 2916
126 Ga0075436_100077100 3300006914 Bacteria 2309
127 Ga0097620_100159866 3300006931 Bacteria 2332
128 Ga0097620_100892470 3300006931 Bacteria 974
129 Ga0079104_1000142 3300006946 Bacteria 101403
130 Ga0075435_100708387 3300007076 Bacteria 875
131 Ga0105251_10004626 3300009011 Bacteria 9277
132 Ga0105244_10002532 3300009036 Bacteria 13729
133 Ga0105244_10063319 3300009036 Bacteria 1857
134 Ga0105240_10258621 3300009093 Bacteria 2009
135 Ga0111539_10408583 3300009094 Bacteria 1581
136 Ga0111539_10831499 3300009094 Bacteria 1074
137 Ga0105245_10022120 3300009098 Bacteria 5583
138 Ga0114129_10009271 3300009147 Bacteria 14036
139 Ga0114129_10261499 3300009147 Bacteria 2319
140 Ga0105243_10069412 3300009148 Bacteria 2843
141 Ga0105237_10139362 3300009545 Bacteria 2420
142 Ga0105249_10142451 3300009553 Bacteria 2300
143 Ga0105239_10387528 3300010375 Bacteria 1580
144 Ga0105239_10877916 3300010375 Bacteria 1029
145 Ga0105246_10045067 3300011119 Bacteria 3001
146 Ga0157373_10002776 3300013100 Bacteria 13252
147 Ga0157373_10360227 3300013100 Bacteria 1038
148 Ga0157370_10004153 3300013104 Bacteria 16762
149 Ga0157370_10042606 3300013104 Bacteria 4373
150 Ga0157370_10154518 3300013104 Bacteria 2135
151 Ga0157370_10321525 3300013104 Bacteria 1427
152 Ga0157369_10047541 3300013105 Bacteria 4657
153 Ga0157369_10086985 3300013105 Bacteria 3337
154 Ga0157369_10120305 3300013105 Bacteria 2787
155 Ga0157374_10030634 3300013296 Bacteria 4887
156 Ga0157374_10127693 3300013296 Bacteria 2458
157 Ga0157374_10301093 3300013296 Bacteria 1586
158 Ga0163162_11130794 3300013306 Bacteria 888
159 Ga0157372_10029964 3300013307 Bacteria 5947
160 Ga0157372_10628220 3300013307 Bacteria 1251
161 Ga0157375_10826208 3300013308 Bacteria 1074
162 Ga0163163_10309828 3300014325 Bacteria 1631
163 Ga0163163_11162738 3300014325 Bacteria 834
164 Ga0157380_10327161 3300014326 Bacteria 1424
165 Ga0157380_10673742 3300014326 Bacteria 1035
166 Ga0157380_10750972 3300014326 Bacteria 987
167 Ga0182008_10005589 3300014497 Bacteria 7130
168 Ga0182008_10007190 3300014497 Bacteria 6161
169 Ga0182008_10011159 3300014497 Bacteria 4791
170 Ga0182008_10023599 3300014497 Bacteria 3140
171 Ga0182008_10036263 3300014497 Bacteria 2468
172 Ga0157376_10034639 3300014969 Bacteria 4079
173 Ga0157376_10258665 3300014969 Bacteria 1630
174 Ga0157376_10324382 3300014969 Bacteria 1465
175 Ga0182006_1000083 3300015261 Bacteria 118727
176 Ga0182005_1001254 3300015265 Bacteria 10436
177 Ga0182005_1006914 3300015265 Bacteria 3433
178 Ga0182005_1023824 3300015265 Bacteria 1672
179 Ga0182005_1067993 3300015265 Bacteria 977
180 Ga0163161_10002966 3300017792 Bacteria 12023
181 Ga0163161_10039468 3300017792 Bacteria 3389
182 Ga0163161_10098276 3300017792 Bacteria 2175
183 Ga0197907_10262403 3300020069 Bacteria 829
184 Ga0197907_10324341 3300020069 Bacteria 733
185 Ga0197907_10358230 3300020069 Bacteria 1235
186 Ga0206356_11534046 3300020070 Bacteria 666
187 Ga0206355_1011593 3300020076 Bacteria 899
188 Ga0206355_1314941 3300020076 Bacteria 769
189 Ga0206355_1571517 3300020076 Bacteria 1065
190 Ga0206351_10232290 3300020077 Bacteria 764
191 Ga0206351_10699157 3300020077 Bacteria 825
192 Ga0206354_10217960 3300020081 Bacteria 872
193 Ga0206353_11403311 3300020082 Bacteria 786
194 Ga0224712_10104057 3300022467 Bacteria 1208
195 Ga0224712_10272325 3300022467 Bacteria 786
196 Ga0209760_100019 3300025207 Bacteria 170806
197 Ga0207427_100011 3300025231 Bacteria 640076
198 Ga0209437_100044 3300025233 Bacteria 430619
199 Ga0209759_1001894 3300025256 Bacteria 10298
200 Ga0209233_1000057 3300025261 Bacteria 430619
201 Ga0209565_1000109 3300025263 Bacteria 120345
202 Ga0209673_1034456 3300025273 Bacteria 1529
203 Ga0209675_1000118 3300025291 Bacteria 110507
204 Ga0209676_1000062 3300025292 Bacteria 332319
205 Ga0209025_1000159 3300025294 Bacteria 167081
206 Ga0209025_1002020 3300025294 Bacteria 23152
207 Ga0209025_1048697 3300025294 Bacteria 1715
208 Ga0209758_1010371 3300025297 Bacteria 5588
209 Ga0209050_1000150 3300025298 Bacteria 162946
210 Ga0209050_1000684 3300025298 Bacteria 50962
211 Ga0209256_1001890 3300025299 Bacteria 19210
212 Ga0209256_1014655 3300025299 Bacteria 2800
213 Ga0209051_1000162 3300025303 Bacteria 125696
214 Ga0209051_1004106 3300025303 Bacteria 9141
215 Ga0209051_1029433 3300025303 Bacteria 2150
216 Ga0207696_1021703 3300025711 Bacteria 2053
217 Ga0207655_1000481 3300025728 Bacteria 51474
218 Ga0207655_1007663 3300025728 Bacteria 6968
219 Ga0207655_1049284 3300025728 Bacteria 1721
220 Ga0207655_1057603 3300025728 Bacteria 1525
221 Ga0207713_1005276 3300025735 Bacteria 8130
222 Ga0207713_1013027 3300025735 Bacteria 4411
223 Ga0207653_10010636 3300025885 Bacteria 2872
224 Ga0207684_10031488 3300025910 Bacteria 4512
225 Ga0207707_10002069 3300025912 Bacteria 18184
226 Ga0207663_10823405 3300025916 Bacteria 740
227 Ga0207660_10077534 3300025917 Bacteria 2433
228 Ga0207657_10167548 3300025919 Bacteria 1781
229 Ga0207652_10171900 3300025921 Bacteria 1945
230 Ga0207646_10467462 3300025922 Bacteria 1137
231 Ga0207650_10333309 3300025925 Bacteria 1245
232 Ga0207659_10315634 3300025926 Bacteria 1288
233 Ga0207669_10099785 3300025937 Bacteria 1916
234 Ga0207691_10222981 3300025940 Bacteria 1634
235 Ga0207691_10629764 3300025940 Bacteria 907
236 Ga0207689_10491043 3300025942 Bacteria 1028
237 Ga0207679_10026985 3300025945 Bacteria 3966
238 Ga0207667_10045365 3300025949 Bacteria 4656
239 Ga0207651_10289560 3300025960 Bacteria 1357
240 Ga0207712_10094815 3300025961 Bacteria 2205
241 Ga0207668_10097056 3300025972 Bacteria 2180
242 Ga0207639_10088761 3300026041 Bacteria 2468
243 Ga0207639_10632024 3300026041 Bacteria 989
244 Ga0207708_10641113 3300026075 Bacteria 903
245 Ga0207675_100692499 3300026118 Bacteria 1027
246 Ga0207683_10014559 3300026121 Bacteria 6699
247 Ga0207683_10448633 3300026121 Bacteria 1189
248 Ga0209281_1000262 3300027111 Bacteria 101417
249 Ga0209813_10034384 3300027866 Bacteria 1513
250 Ga0207428_10047709 3300027907 Bacteria 3438
251 Ga0207428_10085522 3300027907 Bacteria 2456
252 Ga0207428_10130436 3300027907 Bacteria 1924
253 Ga0207428_10141121 3300027907 Bacteria 1839
254 Ga0207428_10164918 3300027907 Bacteria 1681
255 Ga0207428_10275962 3300027907 Bacteria 1249
256 Ga0207428_10323448 3300027907 Bacteria 1139
257 Ga0268266_10183856 3300028379 Bacteria 1905
258 Ga0268266_10636712 3300028379 Bacteria 1026
259 Ga0268265_10219441 3300028380 Bacteria 1663
260 Ga0268265_10658413 3300028380 Bacteria 1007
261 Ga0265323_10125744 3300028653 Bacteria 833
262 Ga0265338_10076532 3300028800 Bacteria 2834
263 Ga0265338_10209017 3300028800 Bacteria 1466
264 Ga0265327_10091961 3300031251 Bacteria 1477
265 Ga0307408_100652223 3300031548 Bacteria 941
266 Ga0307405_10373914 3300031731 Bacteria 1107
267 Ga0307413_10056041 3300031824 Bacteria 2402
268 Ga0307413_10347394 3300031824 Bacteria 1143
269 Ga0307410_10014366 3300031852 Bacteria 4657
270 Ga0307410_10066547 3300031852 Bacteria 2483
271 Ga0307406_10014079 3300031901 Bacteria 4597
272 Ga0307407_10025967 3300031903 Bacteria 3096
273 Ga0307407_10045096 3300031903 Bacteria 2489
274 Ga0307407_10461172 3300031903 Bacteria 924
275 Ga0307407_10782680 3300031903 Bacteria 724
276 Ga0307412_10667877 3300031911 Bacteria 888
277 Ga0307409_100009144 3300031995 Bacteria 6071
278 Ga0307409_100235840 3300031995 Bacteria 1662
279 Ga0307409_100293291 3300031995 Bacteria 1509
280 Ga0307416_100101103 3300032002 Bacteria 2510
281 Ga0307416_100194992 3300032002 Bacteria 1915
282 Ga0307414_10257190 3300032004 Bacteria 1455
283 Ga0307411_10029681 3300032005 Bacteria 3343
284 Ga0307411_10276555 3300032005 Bacteria 1334
285 Ga0307411_10280097 3300032005 Bacteria 1327
286 Ga0373927_0283142 3300035695 Bacteria 1091
287 Ga0373947_0059733 3300035725 Bacteria 2312
288 Ga0373925_0118821 3300037068 Bacteria 2050
289 Ga0395899_0192124 3300037312 Bacteria 1428
290 Ga0395899_0309829 3300037312 Bacteria 1066
291 Ga0395900_0358145 3300037418 Bacteria 1431
292 Ga0395898_0565308 3300037466 Bacteria 1080
293 Ga0395905_0186624 3300037471 Bacteria 1946
294 Ga0436365_0924268 3300039437 Bacteria 3116
295 Ga0436360_0011970 3300039438 Bacteria 1059
296 Ga0439436_0000762 3300041404 Bacteria 8712
297 Ga0439438_000379 3300041405 Bacteria 19968
298 Ga0439438_001079 3300041405 Bacteria 12190
299 Ga0439438_001796 3300041405 Bacteria 9418
300 Ga0439438_004736 3300041405 Bacteria 5153
301 Ga0439438_011170 3300041405 Bacteria 2807
302 Ga0439447_000016 3300041407 Bacteria 61120
303 Ga0439447_000054 3300041407 Bacteria 39346
304 Ga0439447_000101 3300041407 Bacteria 29978
305 Ga0439447_000519 3300041407 Bacteria 14291
306 Ga0439447_001146 3300041407 Bacteria 9651
307 Ga0439447_005206 3300041407 Bacteria 4349
308 Ga0439461_0017956 3300041410 Bacteria 1380
309 Ga0439466_0000101 3300041411 Bacteria 33127
310 Ga0439466_0003430 3300041411 Bacteria 6152
311 Ga0439466_0008454 3300041411 Bacteria 3879
312 Ga0439466_0008895 3300041411 Bacteria 3775
313 Ga0439466_0013095 3300041411 Bacteria 3039
314 Ga0439466_0051597 3300041411 Bacteria 1346
315 Ga0439465_0044696 3300041413 Bacteria 1439
316 Ga0451845_0227851 3300041501 Bacteria 973
317 Ga0439433_0068448 3300041999 Bacteria 853
318 Ga0439432_000233 3300042006 Bacteria 20049
319 Ga0439432_008552 3300042006 Bacteria 3592
320 Ga0439432_016390 3300042006 Bacteria 2494
321 Ga0439451_000450 3300042009 Bacteria 8019
322 Ga0439451_006682 3300042009 Bacteria 2357
323 Ga0439451_006802 3300042009 Bacteria 2339
324 Ga0439452_000287 3300042010 Bacteria 32645
325 Ga0439452_000939 3300042010 Bacteria 13100
326 Ga0439452_001970 3300042010 Bacteria 7852
327 Ga0439452_004038 3300042010 Bacteria 4992
328 Ga0439452_006076 3300042010 Bacteria 3815
329 Ga0439456_000745 3300042013 Bacteria 6624
330 Ga0439456_001138 3300042013 Bacteria 5270
331 Ga0439456_001454 3300042013 Bacteria 4767
332 Ga0439456_008929 3300042013 Bacteria 2069
333 Ga0439456_026889 3300042013 Bacteria 1225
334 Ga0439456_058581 3300042013 Bacteria 845
335 Ga0439462_0012322 3300042015 Bacteria 2183
336 Ga0439463_000007 3300042016 Bacteria 44178
337 Ga0439463_004030 3300042016 Bacteria 3694
338 Ga0450911_000781 3300042115 Bacteria 8919
339 Ga0450911_001463 3300042115 Bacteria 5418
340 Ga0450911_002978 3300042115 Bacteria 3118
341 Ga0450919_014287 3300042121 Bacteria 897
342 Ga0450920_000220 3300042122 Bacteria 8536
343 Ga0450922_004730 3300042124 Bacteria 1254
344 Ga0450890_000293 3300042127 Bacteria 7283
345 Ga0450892_006597 3300042130 Bacteria 968
346 Ga0450903_000835 3300042138 Bacteria 6009
347 Ga0450903_002032 3300042138 Bacteria 3649
348 Ga0450903_004133 3300042138 Bacteria 2488
349 Ga0450903_004819 3300042138 Bacteria 2279
350 Ga0450904_000497 3300042139 Bacteria 7723
351 Ga0450905_009553 3300042142 Bacteria 1336
352 Ga0450906_000952 3300042145 Bacteria 6331
353 Ga0450906_001246 3300042145 Bacteria 5618
354 Ga0450907_000001 3300042146 Bacteria 236562
355 Ga0450907_001863 3300042146 Bacteria 4323
356 Ga0450907_007968 3300042146 Bacteria 1764
357 Ga0450910_000235 3300042147 Bacteria 6316
358 Ga0439446_0000210 3300042156 Bacteria 10703
359 Ga0439446_0000222 3300042156 Bacteria 10452
360 Ga0439446_0003553 3300042156 Bacteria 3882
361 Ga0439446_0041583 3300042156 Bacteria 1355
362 Ga0450908_001049 3300042184 Bacteria 5355
363 Ga0450909_000158 3300042185 Bacteria 7292
364 Ga0450909_000192 3300042185 Bacteria 6991
365 Ga0439434_0000057 3300042435 Bacteria 27366
366 Ga0439460_0001544 3300042461 Bacteria 5421
367 Ga0439460_0017057 3300042461 Bacteria 1941
368 Ga0450893_0014890 3300042532 Bacteria 1308
369 Ga0451577_0279906 3300042876 Bacteria 1511
370 Ga0439440_0000252 3300042993 Bacteria 8658
371 Ga0439440_0002205 3300042993 Bacteria 3650
372 Ga0439440_0012574 3300042993 Bacteria 1801
373 Ga0466969_0013651 3300044656 Bacteria 4275
374 Ga0453683_0503235 3300044673 Bacteria 786
375 Ga0466966_0012062 3300044684 Bacteria 5726
376 Ga0466961_0192849 3300044693 Bacteria 1262
377 Ga0466964_0174205 3300044706 Bacteria 1015
378 Ga0453684_0330988 3300044712 Bacteria 1722
379 Ga0466971_0286610 3300044719 Bacteria 789
380 Ga0466968_0013865 3300044735 Bacteria 3175
381 Ga0466970_0025318 3300044765 Bacteria 3106
382 Ga0466970_0187245 3300044765 Bacteria 1149
383 Ga0466957_0037733 3300044842 Bacteria 2909
384 Ga0466959_0015461 3300045049 Bacteria 5560
385 Ga0451576_0036741 3300045051 Bacteria 5190
386 Ga0466958_0018299 3300045836 Bacteria 4064
387 Ga0466958_0316142 3300045836 Bacteria 1003
388 Ga0495617_000204 3300046452 Bacteria 37490
389 Ga0495617_001096 3300046452 Bacteria 12306
390 Ga0495617_002458 3300046452 Bacteria 7362
391 Ga0495617_002836 3300046452 Bacteria 6678
392 Ga0495617_004958 3300046452 Bacteria 4786
393 Ga0495617_005427 3300046452 Bacteria 4519
394 Ga0495617_025087 3300046452 Bacteria 2010
395 Ga0495617_027628 3300046452 Bacteria 1908
396 Ga0495617_045668 3300046452 Bacteria 1460
397 Ga0495627_000124 3300046453 Bacteria 93651
398 Ga0495627_001657 3300046453 Bacteria 12330
399 Ga0495627_034261 3300046453 Bacteria 1587
400 Ga0495603_0002282 3300046455 Bacteria 11268
401 Ga0495603_0045148 3300046455 Bacteria 2628
402 Ga0495603_0129686 3300046455 Bacteria 1469
403 Ga0495590_0000114 3300046457 Bacteria 48407
404 Ga0495590_0000628 3300046457 Bacteria 16425
405 Ga0495590_0004576 3300046457 Bacteria 5567
406 Ga0495590_0012548 3300046457 Bacteria 3142
407 Ga0495590_0044981 3300046457 Bacteria 1539
408 Ga0495591_000021 3300046458 Bacteria 203554
409 Ga0495591_001154 3300046458 Bacteria 17320
410 Ga0495591_004409 3300046458 Bacteria 6907
411 Ga0495591_009642 3300046458 Bacteria 3816
412 Ga0495591_011532 3300046458 Bacteria 3343
413 Ga0495591_017906 3300046458 Bacteria 2417
414 Ga0495591_022356 3300046458 Bacteria 2045
415 Ga0495638_0000073 3300046460 Bacteria 164378
416 Ga0495638_0001071 3300046460 Bacteria 26689
417 Ga0495638_0001173 3300046460 Bacteria 25137
418 Ga0495638_0001643 3300046460 Bacteria 19841
419 Ga0495638_0001675 3300046460 Bacteria 19601
420 Ga0495638_0003795 3300046460 Bacteria 11742
421 Ga0495638_0006166 3300046460 Bacteria 8758
422 Ga0495638_0012543 3300046460 Bacteria 5802
423 Ga0495638_0036061 3300046460 Bacteria 3151
424 Ga0495638_0040995 3300046460 Bacteria 2931
425 Ga0495638_0126384 3300046460 Bacteria 1506
426 Ga0495638_0153048 3300046460 Bacteria 1336
427 Ga0495653_0101918 3300046463 Bacteria 2078
428 Ga0495650_0000822 3300046471 Bacteria 37641
429 Ga0495650_0001066 3300046471 Bacteria 30414
430 Ga0495650_0001224 3300046471 Bacteria 26826
431 Ga0495650_0001886 3300046471 Bacteria 18639
432 Ga0495650_0002534 3300046471 Bacteria 14579
433 Ga0495650_0008706 3300046471 Bacteria 5876
434 Ga0495605_0000391 3300046474 Bacteria 40370
435 Ga0495605_0000446 3300046474 Bacteria 37125
436 Ga0495605_0000751 3300046474 Bacteria 23782
437 Ga0495605_0003866 3300046474 Bacteria 8887
438 Ga0495605_0010911 3300046474 Bacteria 5076
439 Ga0495605_0043419 3300046474 Bacteria 2229
440 Ga0495605_0052934 3300046474 Bacteria 1971
441 Ga0495605_0103442 3300046474 Bacteria 1306
442 Ga0495639_0001776 3300046475 Bacteria 9555
443 Ga0495584_0000019 3300046491 Bacteria 140608
444 Ga0495584_0000176 3300046491 Bacteria 45031
445 Ga0495584_0000296 3300046491 Bacteria 35158
446 Ga0495584_0000568 3300046491 Bacteria 24896
447 Ga0495584_0004039 3300046491 Bacteria 7917
448 Ga0495584_0005778 3300046491 Bacteria 6525
449 Ga0495584_0015243 3300046491 Bacteria 3915
450 Ga0495584_0073558 3300046491 Bacteria 1717
451 Ga0495584_0251961 3300046491 Bacteria 897
452 Ga0495585_0000165 3300046492 Bacteria 71444
453 Ga0495585_0004259 3300046492 Bacteria 9320
454 Ga0495585_0016293 3300046492 Bacteria 4306
455 Ga0495585_0041395 3300046492 Bacteria 2583
456 Ga0495585_0071007 3300046492 Bacteria 1898
457 Ga0495585_0077305 3300046492 Bacteria 1807
458 Ga0495585_0085811 3300046492 Bacteria 1701
459 Ga0495585_0194445 3300046492 Bacteria 1036
460 Ga0495585_0239726 3300046492 Bacteria 908
461 Ga0495594_0000316 3300046499 Bacteria 23873
462 Ga0495594_0001211 3300046499 Bacteria 13483
463 Ga0495594_0042317 3300046499 Bacteria 2494
464 Ga0495596_0000209 3300046500 Bacteria 40288
465 Ga0495607_0000188 3300046501 Bacteria 66018
466 Ga0495607_0000709 3300046501 Bacteria 32137
467 Ga0495607_0006930 3300046501 Bacteria 7903
468 Ga0495607_0012463 3300046501 Bacteria 5612
469 Ga0495607_0049007 3300046501 Bacteria 2466
470 Ga0495607_0051036 3300046501 Bacteria 2404
471 Ga0495607_0059322 3300046501 Bacteria 2183
472 Ga0495607_0113049 3300046501 Bacteria 1436
473 Ga0495583_0001277 3300046506 Bacteria 26327
474 Ga0495583_0005600 3300046506 Bacteria 8465
475 Ga0495583_0010683 3300046506 Bacteria 5334
476 Ga0495583_0023101 3300046506 Bacteria 3152
477 Ga0495606_0000347 3300046507 Bacteria 79388
478 Ga0495606_0004664 3300046507 Bacteria 13547
479 Ga0495606_0029004 3300046507 Bacteria 3892
480 Ga0495606_0060018 3300046507 Bacteria 2437
481 Ga0495606_0283666 3300046507 Bacteria 904
482 Ga0495610_0004063 3300046512 Bacteria 10982
483 Ga0495610_0005350 3300046512 Bacteria 9158
484 Ga0495610_0006965 3300046512 Bacteria 7654
485 Ga0495610_0009997 3300046512 Bacteria 5930
486 Ga0495610_0022448 3300046512 Bacteria 3452
487 Ga0495610_0030486 3300046512 Bacteria 2826
488 Ga0495610_0038437 3300046512 Bacteria 2429
489 Ga0495610_0044935 3300046512 Bacteria 2188
490 Ga0495610_0071691 3300046512 Bacteria 1614
491 Ga0495616_0001952 3300046513 Bacteria 13876
492 Ga0495616_0006371 3300046513 Bacteria 7149
493 Ga0495616_0017139 3300046513 Bacteria 3997
494 Ga0495616_0028257 3300046513 Bacteria 2969
495 Ga0495616_0034385 3300046513 Bacteria 2632
496 Ga0495616_0127435 3300046513 Bacteria 1169
497 Ga0495616_0190414 3300046513 Bacteria 907
498 Ga0495616_0214611 3300046513 Bacteria 840
499 Ga0495620_0000308 3300046515 Bacteria 34889
500 Ga0495620_0002940 3300046515 Bacteria 9796
501 Ga0495620_0035239 3300046515 Bacteria 2252
502 Ga0495620_0036621 3300046515 Bacteria 2193
503 Ga0495620_0103192 3300046515 Bacteria 1135
504 Ga0495630_0001104 3300046517 Bacteria 18552
505 Ga0495630_0195039 3300046517 Bacteria 1545
506 Ga0495630_0400453 3300046517 Bacteria 1051
507 Ga0495631_0000005 3300046518 Bacteria 159179
508 Ga0495631_0002159 3300046518 Bacteria 11362
509 Ga0495631_0029040 3300046518 Bacteria 2519
510 Ga0495631_0042894 3300046518 Bacteria 1997
511 Ga0495631_0102238 3300046518 Bacteria 1233
512 Ga0495632_0000270 3300046519 Bacteria 51498
513 Ga0495632_0000533 3300046519 Bacteria 35890
514 Ga0495632_0000693 3300046519 Bacteria 30620
515 Ga0495632_0001677 3300046519 Bacteria 18117
516 Ga0495632_0003778 3300046519 Bacteria 10579
517 Ga0495632_0005075 3300046519 Bacteria 8805
518 Ga0495632_0008319 3300046519 Bacteria 6386
519 Ga0495632_0015102 3300046519 Bacteria 4341
520 Ga0495632_0015668 3300046519 Bacteria 4239
521 Ga0495632_0016160 3300046519 Bacteria 4160
522 Ga0495632_0025415 3300046519 Bacteria 3132
523 Ga0495632_0066506 3300046519 Bacteria 1739
524 Ga0495632_0093900 3300046519 Bacteria 1419
525 Ga0495637_0000499 3300046520 Bacteria 28432
526 Ga0495637_0001804 3300046520 Bacteria 12251
527 Ga0495637_0003265 3300046520 Bacteria 8626
528 Ga0495637_0010990 3300046520 Bacteria 4361
529 Ga0495637_0012856 3300046520 Bacteria 3992
530 Ga0495637_0016974 3300046520 Bacteria 3399
531 Ga0495637_0037619 3300046520 Bacteria 2099
532 Ga0495637_0076372 3300046520 Bacteria 1342
533 Ga0495643_0005530 3300046522 Bacteria 8521
534 Ga0495643_0006979 3300046522 Bacteria 7340
535 Ga0495643_0007123 3300046522 Bacteria 7256
536 Ga0495643_0009829 3300046522 Bacteria 5916
537 Ga0495643_0014019 3300046522 Bacteria 4779
538 Ga0495643_0061386 3300046522 Bacteria 1994
539 Ga0495644_0000108 3300046523 Bacteria 39503
540 Ga0495644_0000143 3300046523 Bacteria 34300
541 Ga0495644_0007098 3300046523 Bacteria 4333
542 Ga0495648_0000049 3300046524 Bacteria 164366
543 Ga0495648_0000092 3300046524 Bacteria 111529
544 Ga0495648_0003675 3300046524 Bacteria 13411
545 Ga0495648_0004541 3300046524 Bacteria 11829
546 Ga0495648_0008097 3300046524 Bacteria 8310
547 Ga0495648_0008400 3300046524 Bacteria 8134
548 Ga0495648_0010547 3300046524 Bacteria 7027
549 Ga0495648_0011830 3300046524 Bacteria 6547
550 Ga0495648_0135431 3300046524 Bacteria 1303
551 Ga0495666_0000088 3300046526 Bacteria 37174
552 Ga0495666_0014084 3300046526 Bacteria 3987
553 Ga0495666_0067413 3300046526 Bacteria 1705
554 Ga0495642_0000003 3300046528 Bacteria 185425
555 Ga0495642_0000018 3300046528 Bacteria 108992
556 Ga0495642_0000599 3300046528 Bacteria 18124
557 Ga0495654_0000088 3300046530 Bacteria 104763
558 Ga0495654_0001088 3300046530 Bacteria 19751
559 Ga0495654_0001307 3300046530 Bacteria 17424
560 Ga0495654_0004804 3300046530 Bacteria 7947
561 Ga0495654_0007459 3300046530 Bacteria 6107
562 Ga0495654_0008806 3300046530 Bacteria 5553
563 Ga0495654_0016497 3300046530 Bacteria 3903
564 Ga0495654_0018347 3300046530 Bacteria 3668
565 Ga0495654_0025747 3300046530 Bacteria 3029
566 Ga0495654_0031557 3300046530 Bacteria 2689
567 Ga0495654_0084049 3300046530 Bacteria 1487
568 Ga0495654_0107052 3300046530 Bacteria 1279
569 Ga0495654_0111662 3300046530 Bacteria 1246
570 Ga0495609_0000409 3300046538 Bacteria 35874
571 Ga0495609_0002918 3300046538 Bacteria 10176
572 Ga0495609_0026937 3300046538 Bacteria 2628
573 Ga0495609_0125128 3300046538 Bacteria 1103
574 Ga0495597_0003792 3300046542 Bacteria 8600
575 Ga0495597_0005486 3300046542 Bacteria 6708
576 Ga0495597_0009049 3300046542 Bacteria 4946
577 Ga0495597_0011043 3300046542 Bacteria 4389
578 Ga0495597_0096501 3300046542 Bacteria 1250
579 Ga0495597_0115631 3300046542 Bacteria 1121
580 Ga0495622_0000193 3300046557 Bacteria 48480
581 Ga0495622_0000347 3300046557 Bacteria 33186
582 Ga0495622_0007820 3300046557 Bacteria 4964
583 Ga0495622_0042330 3300046557 Bacteria 2117
584 Ga0495633_0017843 3300046558 Bacteria 3615
585 Ga0495633_0096991 3300046558 Bacteria 1369
586 Ga0495656_0003888 3300046615 Bacteria 5079
587 Ga0495656_0007882 3300046615 Bacteria 3785
588 Ga0495656_0024651 3300046615 Bacteria 2378
589 Ga0495656_0058921 3300046615 Bacteria 1668
590 Ga0495656_0179777 3300046615 Bacteria 1039
591 Ga0495668_0000467 3300046616 Bacteria 51372
592 Ga0495668_0009442 3300046616 Bacteria 5992
593 Ga0495611_0007442 3300046648 Bacteria 4649
594 Ga0495625_0000397 3300046660 Bacteria 66539
595 Ga0495625_0001435 3300046660 Bacteria 29011
596 Ga0495625_0005691 3300046660 Bacteria 11288
597 Ga0495625_0007778 3300046660 Bacteria 9254
598 Ga0495625_0014487 3300046660 Bacteria 6288
599 Ga0495625_0015160 3300046660 Bacteria 6116
600 Ga0495625_0045240 3300046660 Bacteria 3183
601 Ga0495625_0089279 3300046660 Bacteria 2133
602 Ga0495659_0000002 3300046664 Bacteria 176698
603 Ga0495659_0000641 3300046664 Bacteria 12731
604 Ga0495659_0003771 3300046664 Bacteria 4815
605 Ga0495661_0013350 3300046665 Bacteria 5521
606 Ga0495661_0031938 3300046665 Bacteria 3333
607 Ga0495661_0082342 3300046665 Bacteria 1852
608 Ga0495588_0004596 3300046674 Bacteria 6098
609 Ga0495588_0019536 3300046674 Bacteria 3319
610 Ga0495588_0123428 3300046674 Bacteria 1365
611 Ga0495623_0001478 3300046679 Bacteria 15908
612 Ga0495623_0002571 3300046679 Bacteria 11991
613 Ga0495658_0155476 3300046683 Bacteria 1407
614 Ga0495669_0000279 3300046684 Bacteria 29265
615 Ga0495669_0001673 3300046684 Bacteria 9091
616 Ga0495669_0009985 3300046684 Bacteria 4014
617 Ga0495613_0045217 3300046689 Bacteria 3257
618 Ga0495624_0089391 3300046690 Bacteria 1901
619 Ga0495670_0000112 3300046691 Bacteria 36057
620 Ga0495670_0000620 3300046691 Bacteria 16990
621 Ga0495670_0001315 3300046691 Bacteria 12114
622 Ga0495670_0013560 3300046691 Bacteria 4008
623 Ga0495670_0017942 3300046691 Bacteria 3485
624 Ga0495670_0022028 3300046691 Bacteria 3146
625 Ga0495670_0032135 3300046691 Bacteria 2609
626 Ga0495670_0062329 3300046691 Bacteria 1876
627 Ga0495670_0089262 3300046691 Bacteria 1576
628 Ga0495670_0108992 3300046691 Bacteria 1431
629 Ga0495670_0189817 3300046691 Bacteria 1086
630 Ga0495671_0000066 3300046692 Bacteria 105167
631 Ga0495671_0000160 3300046692 Bacteria 59259
632 Ga0495671_0005604 3300046692 Bacteria 7327
633 Ga0495671_0019876 3300046692 Bacteria 3544
634 Ga0495671_0033611 3300046692 Bacteria 2611
635 Ga0495671_0094409 3300046692 Bacteria 1463
636 Ga0495671_0094867 3300046692 Bacteria 1459
637 Ga0495671_0121270 3300046692 Bacteria 1275
638 Ga0495671_0135752 3300046692 Bacteria 1199
639 Ga0495671_0252794 3300046692 Bacteria 850
640 Ga0495649_0000013 3300046694 Bacteria 316013
641 Ga0495649_0000814 3300046694 Bacteria 25112
642 Ga0495649_0001154 3300046694 Bacteria 20537
643 Ga0495649_0005808 3300046694 Bacteria 7771
644 Ga0495649_0006677 3300046694 Bacteria 7160
645 Ga0495649_0016472 3300046694 Bacteria 4188
646 Ga0495649_0043216 3300046694 Bacteria 2460
647 Ga0495649_0095279 3300046694 Bacteria 1584
648 Ga0495649_0164511 3300046694 Bacteria 1162
649 Ga0495589_0000123 3300046794 Bacteria 72582
650 Ga0495589_0001395 3300046794 Bacteria 14016
651 Ga0495589_0003200 3300046794 Bacteria 8940
652 Ga0495589_0005346 3300046794 Bacteria 6776
653 Ga0495589_0006827 3300046794 Bacteria 6002
654 Ga0495589_0033379 3300046794 Bacteria 2585
655 Ga0495589_0041175 3300046794 Bacteria 2305
656 Ga0495589_0054318 3300046794 Bacteria 1975
657 Ga0495589_0133423 3300046794 Bacteria 1191
658 Ga0495600_0025520 3300046809 Bacteria 3809
659 Ga0495660_0001517 3300046810 Bacteria 15674
660 Ga0495660_0001634 3300046810 Bacteria 15043
661 Ga0495660_0002240 3300046810 Bacteria 12445
662 Ga0495660_0013001 3300046810 Bacteria 4825
663 Ga0495660_0019231 3300046810 Bacteria 3921
664 Ga0495660_0020036 3300046810 Bacteria 3836
665 Ga0495660_0023755 3300046810 Bacteria 3496
666 Ga0495660_0030094 3300046810 Bacteria 3060
667 Ga0495660_0030283 3300046810 Bacteria 3049
668 Ga0495660_0042483 3300046810 Bacteria 2512
669 Ga0495660_0065169 3300046810 Bacteria 1945
670 Ga0495660_0081658 3300046810 Bacteria 1694
671 Ga0495660_0128573 3300046810 Bacteria 1273
672 Ga0495581_0088882 3300047315 Bacteria 1792
673 Ga0495604_0001925 3300047317 Bacteria 16807
674 Ga0495636_0007111 3300047318 Bacteria 4404
675 Ga0495636_0066107 3300047318 Bacteria 1536
676 Ga0495674_0005938 3300047319 Bacteria 11717
677 Ga0495672_0000442 3300047320 Bacteria 49513
678 Ga0495672_0000773 3300047320 Bacteria 34808
679 Ga0495672_0000891 3300047320 Bacteria 31355
680 Ga0495672_0001663 3300047320 Bacteria 21577
681 Ga0495672_0001947 3300047320 Bacteria 19521
682 Ga0495672_0006676 3300047320 Bacteria 8864
683 Ga0495672_0010062 3300047320 Bacteria 6771
684 Ga0495672_0045791 3300047320 Bacteria 2614
685 Ga0495672_0101971 3300047320 Bacteria 1554
686 Ga0495676_0229954 3300047321 Bacteria 1274
687 Ga0495680_0053758 3300047322 Bacteria 3131
688 Ga0495680_0434782 3300047322 Bacteria 900
689 Ga0495683_0000010 3300047323 Bacteria 223494
690 Ga0495683_0000337 3300047323 Bacteria 38955
691 Ga0495683_0002492 3300047323 Bacteria 11095
692 Ga0495683_0006146 3300047323 Bacteria 6582
693 Ga0495683_0011122 3300047323 Bacteria 4743
694 Ga0495683_0011848 3300047323 Bacteria 4583
695 Ga0495683_0014403 3300047323 Bacteria 4119
696 Ga0495683_0018156 3300047323 Bacteria 3639
697 Ga0495683_0020399 3300047323 Bacteria 3418
698 Ga0495683_0038365 3300047323 Bacteria 2426
699 Ga0495687_003205 3300047443 Bacteria 12125
700 Ga0495687_004845 3300047443 Bacteria 8848
701 Ga0495687_007840 3300047443 Bacteria 6211
702 Ga0495687_020289 3300047443 Bacteria 3240
703 Ga0495677_0000471 3300047445 Bacteria 17236
704 Ga0495679_001961 3300047446 Bacteria 10972
705 Ga0495679_009228 3300047446 Bacteria 3962
706 Ga0495679_012799 3300047446 Bacteria 3176
707 Ga0495685_012690 3300047447 Bacteria 2854
708 Ga0495673_0000434 3300047469 Bacteria 46894
709 Ga0495673_0000553 3300047469 Bacteria 38181
710 Ga0495673_0001485 3300047469 Bacteria 18547
711 Ga0495673_0002017 3300047469 Bacteria 14933
712 Ga0495673_0002389 3300047469 Bacteria 13263
713 Ga0495673_0005784 3300047469 Bacteria 7405
714 Ga0495673_0046284 3300047469 Bacteria 1928
715 Ga0495681_0000010 3300047470 Bacteria 203548
716 Ga0495681_0000259 3300047470 Bacteria 43196
717 Ga0495681_0000262 3300047470 Bacteria 42740
718 Ga0495681_0000419 3300047470 Bacteria 32654
719 Ga0495681_0000703 3300047470 Bacteria 25565
720 Ga0495681_0009052 3300047470 Bacteria 6172
721 Ga0495681_0010676 3300047470 Bacteria 5540
722 Ga0495681_0024186 3300047470 Bacteria 3207
723 Ga0495681_0031963 3300047470 Bacteria 2654
724 Ga0495681_0039958 3300047470 Bacteria 2287
725 Ga0495681_0183092 3300047470 Bacteria 859
726 Ga0495684_0035906 3300047471 Bacteria 3800
727 Ga0495686_0008941 3300047472 Bacteria 7279
728 Ga0495686_0041603 3300047472 Bacteria 2925
729 Ga0495686_0138116 3300047472 Bacteria 1440
730 Ga0495686_0144097 3300047472 Bacteria 1404
731 Ga0495686_0150522 3300047472 Bacteria 1366
732 Ga0495593_0000018 3300047673 Bacteria 74926
733 Ga0495593_0000777 3300047673 Bacteria 18553
734 Ga0495615_0000105 3300048090 Bacteria 23071
735 Ga0495615_0048847 3300048090 Bacteria 1083
736 Ga0495626_0000031 3300048091 Bacteria 197930
737 Ga0495626_0000079 3300048091 Bacteria 129922
738 Ga0495626_0000242 3300048091 Bacteria 63298
739 Ga0495626_0000329 3300048091 Bacteria 50091
740 Ga0495626_0000759 3300048091 Bacteria 29787
741 Ga0495626_0001357 3300048091 Bacteria 19791
742 Ga0495626_0005157 3300048091 Bacteria 7746
743 Ga0495626_0013146 3300048091 Bacteria 4312
744 Ga0495626_0014268 3300048091 Bacteria 4103
745 Ga0496100_0590620 3300048903 Bacteria 862
746 Ga0496102_0235272 3300048905 Bacteria 1727
747 Ga0496102_0380623 3300048905 Bacteria 1328
748 Ga0496105_0049697 3300048908 Bacteria 3463
749 Ga0496106_0189660 3300048909 Bacteria 1634
750 Ga0496107_0177192 3300048910 Bacteria 1583
751 Ga0496110_0078555 3300048913 Bacteria 2938
752 Ga0496110_0099864 3300048913 Bacteria 2601
753 Ga0496110_0666980 3300048913 Bacteria 940
754 Ga0496111_0188066 3300048914 Bacteria 1535
755 Ga0496112_0014420 3300048915 Bacteria 7331
756 Ga0496112_0020807 3300048915 Bacteria 6227
757 Ga0496113_0062287 3300048916 Bacteria 2817
758 Ga0496113_0413008 3300048916 Bacteria 1084
759 Ga0496116_0001237 3300048919 Bacteria 29731
760 Ga0496116_0002307 3300048919 Bacteria 20229
761 Ga0496117_0129555 3300048920 Bacteria 1532
762 Ga0496118_0195987 3300048921 Bacteria 1202
763 Ga0496121_0095310 3300048924 Bacteria 2313
764 Ga0496122_0002525 3300048925 Bacteria 25773
765 Ga0496122_0002963 3300048925 Bacteria 23155
766 Ga0496123_0002451 3300048926 Bacteria 22992
767 Ga0496124_0002900 3300048927 Bacteria 21631
768 Ga0496124_0010024 3300048927 Bacteria 9668
769 Ga0496124_0043609 3300048927 Bacteria 3855
770 Ga0496124_0093915 3300048927 Bacteria 2441
771 Ga0496124_0123802 3300048927 Bacteria 2062
772 Ga0496125_0004944 3300048928 Bacteria 15081
773 Ga0496125_0018626 3300048928 Bacteria 6590
774 Ga0496126_0087602 3300048929 Bacteria 2744
775 Ga0495678_000701 3300049459 Bacteria 30500
776 Ga0495678_001245 3300049459 Bacteria 20717
777 Ga0495678_005843 3300049459 Bacteria 6667
778 Ga0495678_009163 3300049459 Bacteria 4925
779 Ga0495678_022535 3300049459 Bacteria 2751
780 Ga0495678_024222 3300049459 Bacteria 2624
781 Ga0495678_080520 3300049459 Bacteria 1170
782 Ga0495678_114602 3300049459 Bacteria 914
783 Ga0495682_0001309 3300049460 Bacteria 13842
784 Ga0495682_0003820 3300049460 Bacteria 6617
785 Ga0495682_0011988 3300049460 Bacteria 3331
786 Ga0501031_0030749 3300049568 Bacteria 3503
787 Ga0501031_0033103 3300049568 Bacteria 3370
788 Ga0501031_0167040 3300049568 Bacteria 1438
789 Ga0501031_0597796 3300049568 Bacteria 710
790 Ga0501033_0007048 3300049570 Bacteria 8777
791 Ga0501034_0100599 3300049571 Bacteria 2885
792 Ga0501036_0001193 3300049572 Bacteria 19803
793 Ga0501036_0024335 3300049572 Bacteria 5105
794 Ga0501036_0045902 3300049572 Bacteria 3700
795 Ga0501036_0097970 3300049572 Bacteria 2479
796 Ga0501038_0212540 3300049574 Bacteria 1547
797 Ga0501038_0432642 3300049574 Bacteria 1014
798 Ga0501039_0033563 3300049575 Bacteria 3957
799 Ga0501039_0044040 3300049575 Bacteria 3447
800 Ga0501039_0101858 3300049575 Bacteria 2241
801 Ga0501039_0279936 3300049575 Bacteria 1311
802 Ga0501040_0001724 3300049576 Bacteria 14028
803 Ga0501040_0065708 3300049576 Bacteria 2499
804 Ga0501040_0079561 3300049576 Bacteria 2269
805 Ga0501041_0011140 3300049577 Bacteria 5310
806 Ga0501041_0018736 3300049577 Bacteria 4123
807 Ga0501041_0059613 3300049577 Bacteria 2336
808 Ga0501041_0076801 3300049577 Bacteria 2055
809 Ga0501042_0005577 3300049578 Bacteria 8108
810 Ga0501042_0126712 3300049578 Bacteria 1839
811 Ga0501043_0092185 3300049579 Bacteria 2382
812 Ga0501043_0543683 3300049579 Bacteria 864
813 Ga0501046_0107619 3300049580 Bacteria 2133
814 Ga0501047_0186360 3300049581 Bacteria 1940
815 Ga0501047_0459801 3300049581 Bacteria 1102
816 Ga0501048_0050547 3300049582 Bacteria 2960
817 Ga0501068_0005672 3300049584 Bacteria 6837
818 Ga0501068_0141862 3300049584 Bacteria 1506
819 Ga0501069_0294780 3300049585 Bacteria 950
820 Ga0501070_0198410 3300049586 Bacteria 1648
821 Ga0501071_0007936 3300049587 Bacteria 7002
822 Ga0501071_0009804 3300049587 Bacteria 6393
823 Ga0501071_0135125 3300049587 Bacteria 1835
824 Ga0501072_0005608 3300049588 Bacteria 9551
825 Ga0501072_0011565 3300049588 Bacteria 6744
826 Ga0501072_0095836 3300049588 Bacteria 2358
827 Ga0501072_0253513 3300049588 Bacteria 1401
828 Ga0501072_0262375 3300049588 Bacteria 1375
829 Ga0501073_0042142 3300049589 Bacteria 3223
830 Ga0501073_0071178 3300049589 Bacteria 2424
831 Ga0501074_0062661 3300049590 Bacteria 2679
832 Ga0501074_0100816 3300049590 Bacteria 2067
833 Ga0501074_0109025 3300049590 Bacteria 1981
834 Ga0501074_0173184 3300049590 Bacteria 1540
835 Ga0501074_0220991 3300049590 Bacteria 1349
836 Ga0501074_0289274 3300049590 Bacteria 1165
837 Ga0501075_0011542 3300049591 Bacteria 6253
838 Ga0501075_0023427 3300049591 Bacteria 4521
839 Ga0501075_0025157 3300049591 Bacteria 4373
840 Ga0501075_0034455 3300049591 Bacteria 3770
841 Ga0501075_0116664 3300049591 Bacteria 2030
842 Ga0501076_0022693 3300049592 Bacteria 4825
843 Ga0501076_0023798 3300049592 Bacteria 4725
844 Ga0501076_0043988 3300049592 Bacteria 3521
845 Ga0501077_0031361 3300049593 Bacteria 3381
846 Ga0501077_0120177 3300049593 Bacteria 1665
847 Ga0501079_0038714 3300049741 Bacteria 3677
848 Ga0501079_0100709 3300049741 Bacteria 2240
849 Ga0501079_0139474 3300049741 Bacteria 1888
850 Ga0501079_0595572 3300049741 Bacteria 870
851 Ga0501080_0644458 3300049742 Bacteria 938
852 Ga0501081_0011107 3300049743 Bacteria 5890
853 Ga0501081_0064537 3300049743 Bacteria 2543
854 Ga0501081_0104547 3300049743 Bacteria 2005
855 Ga0501035_0026432 3300049822 Bacteria 5310
856 Ga0501035_0735758 3300049822 Bacteria 793
857 Ga0501044_0043020 3300049823 Bacteria 4694
858 Ga0501045_0012473 3300049824 Bacteria 5985
859 Ga0501045_0016327 3300049824 Bacteria 5272
860 Ga0501045_0025200 3300049824 Bacteria 4274
861 nmdc:mga00v17_209825_c1 3300050491 Bacteria 1260
862 nmdc:mga00v17_209969_c1 3300050491 Bacteria 1260
863 nmdc:mga00v17_26563_c1 3300050491 Bacteria 3375
864 nmdc:mga00v17_58430_c1 3300050491 Bacteria 1301
865 nmdc:mga00v17_88236_c1 3300050491 Bacteria 1945
866 nmdc:mga06z11_35824_c1 3300050494 Bacteria 2445
867 nmdc:mga04h51_13771_c1 3300050495 Bacteria 2297
868 nmdc:mga07m45_123412_c1 3300050496 Bacteria 1497
869 nmdc:mga07m45_8603_c1 3300050496 Bacteria 5256
870 nmdc:mga07m45_90954_c1 3300050496 Bacteria 1748
871 nmdc:mga05p37_20057_c1 3300050507 Bacteria 8089
872 nmdc:mga05p37_200676_c1 3300050507 Bacteria 2416
873 nmdc:mga05p37_610024_c1 3300050507 Bacteria 1230
874 nmdc:mga05p37_682271_c1 3300050507 Bacteria 1145
875 nmdc:mga09592_20431_c1 3300050508 Bacteria 5444
876 nmdc:mga09592_266351_c1 3300050508 Bacteria 1486
877 nmdc:mga09592_459552_c1 3300050508 Bacteria 1098
878 nmdc:mga0qj67_121249_c1 3300050509 Bacteria 2115
879 nmdc:mga0qj67_447253_c1 3300050509 Bacteria 1041
880 nmdc:mga0qj67_98346_c1 3300050509 Bacteria 2357
881 nmdc:mga06r32_1070187_c1 3300050510 Bacteria 757
882 nmdc:mga06r32_148916_c1 3300050510 Bacteria 2318
883 nmdc:mga06r32_258614_c1 3300050510 Bacteria 1729
884 nmdc:mga08y16_320082_c1 3300050511 Bacteria 1597
885 nmdc:mga0n895_179639_c1 3300050512 Bacteria 2148
886 nmdc:mga0rr50_102939_c1 3300050513 Bacteria 2246
887 nmdc:mga0rr50_671860_c1 3300050513 Bacteria 884
888 nmdc:mga0rr50_6947_c1 3300050513 Bacteria 6940
889 nmdc:mga08x19_156712_c1 3300050514 Bacteria 1545
890 nmdc:mga08x19_247988_c1 3300050514 Bacteria 1229
891 nmdc:mga08x19_26165_c1 3300050514 Bacteria 3639
892 nmdc:mga08x19_36808_c1 3300050514 Bacteria 3101
893 nmdc:mga08x19_5919_c1 3300050514 Bacteria 7233
894 nmdc:mga0a205_14835_c1 3300050515 Bacteria 7272
895 nmdc:mga0sz30_16921_c2 3300050516 Bacteria 2130
896 nmdc:mga0sz30_75741_c1 3300050516 Bacteria 1452
897 Ga0495612_0231950 3300053078 Bacteria 819
898 Ga0500566_0000044 3300053094 Bacteria 61711
899 Ga0500641_0060647 3300053096 Bacteria 1574
900 Ga0500555_005902 3300053103 Bacteria 3474
901 Ga0500593_000006 3300053117 Bacteria 88644
902 Ga0500559_0004626 3300053136 Bacteria 6495
903 Ga0500568_0000005 3300053139 Bacteria 614296
904 Ga0500568_0022253 3300053139 Bacteria 2716
905 Ga0500577_0001370 3300053142 Bacteria 6224
906 Ga0500577_0092089 3300053142 Bacteria 1227
907 Ga0500616_0020681 3300053153 Bacteria 3696
908 Ga0501084_0045923 3300054114 Bacteria 3657
909 Ga0501084_0103954 3300054114 Bacteria 2386
910 Ga0587073_0098291 3300059492 Bacteria 756
911 Ga0587091_075971 3300059511 Bacteria 744
912 Ga0501082_0045823 3300060353 Bacteria 3770
913 Ga0501082_0099541 3300060353 Bacteria 2514
914 Ga0501082_0197956 3300060353 Bacteria 1748
915 Ga0501082_0224692 3300060353 Bacteria 1634
916 Ga0501082_0237481 3300060353 Bacteria 1586
917 Ga0530510_0012041 3300061734 Bacteria 6066
918 Ga0530510_0013473 3300061734 Bacteria 5748
919 Ga0530510_0014529 3300061734 Bacteria 5554
920 Ga0530510_0021620 3300061734 Bacteria 4577
921 Ga0530510_0079955 3300061734 Bacteria 2378
922 2511257125 2511231004 Bacteria 6669789
923 2511264323 2511231006 Bacteria 6794709
924 2511270396 2511231007 Bacteria 6306603
925 2511275481 2511231008 Bacteria 6624100
926 2511302077 2511231012 Bacteria 6738011
927 2511313773 2511231014 Bacteria 6462302
928 2511323157 2511231015 Bacteria 6598026
929 2511325567 2511231016 Bacteria 6704427
930 2511333339 2511231017 Bacteria 6503007
931 2511350151 2511231020 Bacteria 6115223
932 2511357440 2511231021 Bacteria 7302637
933 2511361151 2511231022 Bacteria 6719296
934 2512329181 2512047018 Bacteria 6663241
935 2513592536 2513237087 Bacteria 5817514
936 2583793317 2582580891 Bacteria 6800976
937 2585153353 2582581280 Bacteria 5994497
938 2585196714 2582581293 Bacteria 5907401
939 2597857289 2597489887 Bacteria 6666321
940 2599484776 2599185185 Bacteria 6652270
941 2599801960 2599185257 Bacteria 6492581
942 2643781844 2643221552 Bacteria 5708754
943 2643842236 2643221565 Bacteria 6216018
944 2643930433 2643221584 Bacteria 5511711
945 2643956692 2643221589 Bacteria 6250934
946 2644021915 2643221602 Bacteria 6249926
947 2644188269 2643221633 Bacteria 6733554
948 2671768908 2671180172 Bacteria 6495783
949 2739197784 2738543004 Bacteria 6381073
950 2739262237 2738543015 Bacteria 6750701
951 2743736712 2740892503 Bacteria 6855563
952 2774118805 2773857670 Bacteria 6407454
953 2784312443 2784132072 Bacteria 6596533
954 2808933193 2808606377 Bacteria 6646337
955 2808955300 2808606381 Bacteria 6646461
956 2809214685 2808606445 Bacteria 6057339
957 2819537829 2818991435 Bacteria 5433759
958 2819647607 2818991454 Bacteria 5563326
959 2828306528 2828305725 Bacteria 4916900
960 2858693607 2858688981 Bacteria 8184122
961 2904551848 2904550169 Bacteria 6221258
962 2919459136 2919456309 Bacteria 6586567
963 2923155730 2923153595 Bacteria 6870622
964 2939639985 2939636861 Bacteria 6297853
965 2939674401 2939669807 Bacteria 5028511
966 2984290295 2984286254 Bacteria 6702062
967 8015689982 8015687852 Bacteria 6613826
968 8055773085 8055770955 Bacteria 6827675
969 8056129470 8056125926 Bacteria 6228218
970 8056178640 8056177738 Bacteria 6748268
971 Ga0495638_0020265
972 MRS2a_Contig_16
973 MRS2a_Contig_7135
974 MRS2a_Contig_9103
975 SwRhRL2b_contig_1791376
976 SwRhRL2b_contig_275942
977 JGI25162J39368_1000045
978 JGI25163J39215_1000297
979 JGI25164J39214_1000147
980 JGI25151J46595_10000065
981 JGI25151J46595_10056448
982 JGI25165J46597_1000086
983 Ga0006562J51391_1007874
984 Ga0055537_1000409
985 Ga0055524_1021663
986 Ga0055536_1000028
987 Ga0055534_1000189
988 Ga0055530_10000030
989 Ga0055530_10014884
990 Ga0055540_1000262
991 Ga0058863_10027487
992 Ga0065714_10000003
993 Ga0065714_10004301
994 Ga0065714_10004791
995 Ga0065714_10005115
996 Ga0065714_10005580
997 Ga0065714_10066220
998 Ga0065714_10084673
999 Ga0065714_10105443
1000 Ga0065714_10120013
1001 Ga0065704_10079095
1002 Ga0065704_10112878
1003 Ga0065704_10146359
1004 Ga0065712_10002579
1005 Ga0065715_10101780
1006 Ga0065707_10128004
1007 Ga0070666_10027722
1008 Ga0070661_100127962
1009 Ga0070661_100181536
1010 Ga0070668_100117988
1011 Ga0070675_100857004
1012 Ga0070674_100116330
1013 Ga0070674_100476319
1014 Ga0070674_100969041
1015 Ga0070673_100306202
1016 Ga0070713_100419852
1017 Ga0070705_100004662
1018 Ga0070705_100493441
1019 Ga0070694_100014594
1020 Ga0070708_100036681
1021 Ga0070708_100499237
1022 Ga0070678_100039595
1023 Ga0070678_100796008
1024 Ga0070681_10084016
1025 Ga0070681_10502913
1026 Ga0070706_100009094
1027 Ga0070706_100016861
1028 Ga0070706_100083731
1029 Ga0070707_100650196
1030 Ga0070698_100001874
1031 Ga0070698_100050404
1032 Ga0070699_100000814
1033 Ga0070699_100002404
1034 Ga0070699_100059013
1035 Ga0070699_100099564
1036 Ga0070699_100103653
1037 Ga0070679_100137439
1038 Ga0070679_100329000
1039 Ga0070679_100750491
1040 Ga0068853_100008756
1041 Ga0068853_100050648
1042 Ga0070672_100123927
1043 Ga0070672_100249747
1044 Ga0070695_100114785
1045 Ga0070696_100001106
1046 Ga0070696_100080896
1047 Ga0070696_100206054
1048 Ga0070665_100053117
1049 Ga0070665_100644904
1050 Ga0070704_100159504
1051 Ga0068855_100067729
1052 Ga0068855_100192437
1053 Ga0068856_100004119
1054 Ga0068852_100316995
1055 Ga0068852_101030868
1056 Ga0068859_100159859
1057 Ga0068860_100135331
1058 Ga0068862_100666199
1059 Ga0081455_10183998
1060 Ga0081455_10197492
1061 Ga0081455_10230493
1062 Ga0075365_10191220
1063 Ga0075368_10027474
1064 Ga0075368_10047722
1065 Ga0075363_100076711
1066 Ga0075364_10010255
1067 Ga0075364_10015174
1068 Ga0075364_10026491
1069 Ga0075364_10032030
1070 Ga0075432_10003245
1071 Ga0075432_10003498
1072 Ga0075432_10177981
1073 Ga0075362_10176928
1074 Ga0075367_10006727
1075 Ga0075369_10056579
1076 Ga0075369_10256479
1077 Ga0075370_10019361
1078 Ga0075370_10057075
1079 Ga0075370_10127917
1080 Ga0068871_100259576
1081 Ga0068871_100446309
1082 Ga0075428_100047960
1083 Ga0075428_100080257
1084 Ga0075428_100261448
1085 Ga0075430_100267414
1086 Ga0075431_100004080
1087 Ga0075431_100159825
1088 Ga0075431_100368703
1089 Ga0075433_10519587
1090 Ga0075434_100006602
1091 Ga0075429_100093930
1092 Ga0075436_100008107
1093 Ga0075436_100024079
1094 Ga0075436_100028764
1095 Ga0075436_100048957
1096 Ga0075436_100077100
1097 Ga0097620_100159866
1098 Ga0097620_100892470
1099 Ga0079104_1000142
1100 Ga0075435_100708387
1101 Ga0105251_10004626
1102 Ga0105244_10002532
1103 Ga0105244_10063319
1104 Ga0105240_10258621
1105 Ga0111539_10408583
1106 Ga0111539_10831499
1107 Ga0105245_10022120
1108 Ga0114129_10009271
1109 Ga0114129_10261499
1110 Ga0105243_10069412
1111 Ga0105237_10139362
1112 Ga0105249_10142451
1113 Ga0105239_10387528
1114 Ga0105239_10877916
1115 Ga0105246_10045067
1116 Ga0157373_10002776
1117 Ga0157373_10360227
1118 Ga0157370_10004153
1119 Ga0157370_10042606
1120 Ga0157370_10154518
1121 Ga0157370_10321525
1122 Ga0157369_10047541
1123 Ga0157369_10086985
1124 Ga0157369_10120305
1125 Ga0157374_10030634
1126 Ga0157374_10127693
1127 Ga0157374_10301093
1128 Ga0163162_11130794
1129 Ga0157372_10029964
1130 Ga0157372_10628220
1131 Ga0157375_10826208
1132 Ga0163163_10309828
1133 Ga0163163_11162738
1134 Ga0157380_10327161
1135 Ga0157380_10673742
1136 Ga0157380_10750972
1137 Ga0182008_10005589
1138 Ga0182008_10007190
1139 Ga0182008_10011159
1140 Ga0182008_10023599
1141 Ga0182008_10036263
1142 Ga0157376_10034639
1143 Ga0157376_10258665
1144 Ga0157376_10324382
1145 Ga0182006_1000083
1146 Ga0182005_1001254
1147 Ga0182005_1006914
1148 Ga0182005_1023824
1149 Ga0182005_1067993
1150 Ga0163161_10002966
1151 Ga0163161_10039468
1152 Ga0163161_10098276
1153 Ga0197907_10262403
1154 Ga0197907_10324341
1155 Ga0197907_10358230
1156 Ga0206356_11534046
1157 Ga0206355_1011593
1158 Ga0206355_1314941
1159 Ga0206355_1571517
1160 Ga0206351_10232290
1161 Ga0206351_10699157
1162 Ga0206354_10217960
1163 Ga0206353_11403311
1164 Ga0224712_10104057
1165 Ga0224712_10272325
1166 Ga0209760_100019
1167 Ga0207427_100011
1168 Ga0209437_100044
1169 Ga0209759_1001894
1170 Ga0209233_1000057
1171 Ga0209565_1000109
1172 Ga0209673_1034456
1173 Ga0209675_1000118
1174 Ga0209676_1000062
1175 Ga0209025_1000159
1176 Ga0209025_1002020
1177 Ga0209025_1048697
1178 Ga0209758_1010371
1179 Ga0209050_1000150
1180 Ga0209050_1000684
1181 Ga0209256_1001890
1182 Ga0209256_1014655
1183 Ga0209051_1000162
1184 Ga0209051_1004106
1185 Ga0209051_1029433
1186 Ga0207696_1021703
1187 Ga0207655_1000481
1188 Ga0207655_1007663
1189 Ga0207655_1049284
1190 Ga0207655_1057603
1191 Ga0207713_1005276
1192 Ga0207713_1013027
1193 Ga0207653_10010636
1194 Ga0207684_10031488
1195 Ga0207707_10002069
1196 Ga0207663_10823405
1197 Ga0207660_10077534
1198 Ga0207657_10167548
1199 Ga0207652_10171900
1200 Ga0207646_10467462
1201 Ga0207650_10333309
1202 Ga0207659_10315634
1203 Ga0207669_10099785
1204 Ga0207691_10222981
1205 Ga0207691_10629764
1206 Ga0207689_10491043
1207 Ga0207679_10026985
1208 Ga0207667_10045365
1209 Ga0207651_10289560
1210 Ga0207712_10094815
1211 Ga0207668_10097056
1212 Ga0207639_10088761
1213 Ga0207639_10632024
1214 Ga0207708_10641113
1215 Ga0207675_100692499
1216 Ga0207683_10014559
1217 Ga0207683_10448633
1218 Ga0209281_1000262
1219 Ga0209813_10034384
1220 Ga0207428_10047709
1221 Ga0207428_10085522
1222 Ga0207428_10130436
1223 Ga0207428_10141121
1224 Ga0207428_10164918
1225 Ga0207428_10275962
1226 Ga0207428_10323448
1227 Ga0268266_10183856
1228 Ga0268266_10636712
1229 Ga0268265_10219441
1230 Ga0268265_10658413
1231 Ga0265323_10125744
1232 Ga0265338_10076532
1233 Ga0265338_10209017
1234 Ga0265327_10091961
1235 Ga0307408_100652223
1236 Ga0307405_10373914
1237 Ga0307413_10056041
1238 Ga0307413_10347394
1239 Ga0307410_10014366
1240 Ga0307410_10066547
1241 Ga0307406_10014079
1242 Ga0307407_10025967
1243 Ga0307407_10045096
1244 Ga0307407_10461172
1245 Ga0307407_10782680
1246 Ga0307412_10667877
1247 Ga0307409_100009144
1248 Ga0307409_100235840
1249 Ga0307409_100293291
1250 Ga0307416_100101103
1251 Ga0307416_100194992
1252 Ga0307414_10257190
1253 Ga0307411_10029681
1254 Ga0307411_10276555
1255 Ga0307411_10280097
1256 Ga0373927_0283142
1257 Ga0373947_0059733
1258 Ga0373925_0118821
1259 Ga0395899_0192124
1260 Ga0395899_0309829
1261 Ga0395900_0358145
1262 Ga0395898_0565308
1263 Ga0395905_0186624
1264 Ga0436365_0924268
1265 Ga0436360_0011970
1266 Ga0439436_0000762
1267 Ga0439438_000379
1268 Ga0439438_001079
1269 Ga0439438_001796
1270 Ga0439438_004736
1271 Ga0439438_011170
1272 Ga0439447_000016
1273 Ga0439447_000054
1274 Ga0439447_000101
1275 Ga0439447_000519
1276 Ga0439447_001146
1277 Ga0439447_005206
1278 Ga0439461_0017956
1279 Ga0439466_0000101
1280 Ga0439466_0003430
1281 Ga0439466_0008454
1282 Ga0439466_0008895
1283 Ga0439466_0013095
1284 Ga0439466_0051597
1285 Ga0439465_0044696
1286 Ga0451845_0227851
1287 Ga0439433_0068448
1288 Ga0439432_000233
1289 Ga0439432_008552
1290 Ga0439432_016390
1291 Ga0439451_000450
1292 Ga0439451_006682
1293 Ga0439451_006802
1294 Ga0439452_000287
1295 Ga0439452_000939
1296 Ga0439452_001970
1297 Ga0439452_004038
1298 Ga0439452_006076
1299 Ga0439456_000745
1300 Ga0439456_001138
1301 Ga0439456_001454
1302 Ga0439456_008929
1303 Ga0439456_026889
1304 Ga0439456_058581
1305 Ga0439462_0012322
1306 Ga0439463_000007
1307 Ga0439463_004030
1308 Ga0450911_000781
1309 Ga0450911_001463
1310 Ga0450911_002978
1311 Ga0450919_014287
1312 Ga0450920_000220
1313 Ga0450922_004730
1314 Ga0450890_000293
1315 Ga0450892_006597
1316 Ga0450903_000835
1317 Ga0450903_002032
1318 Ga0450903_004133
1319 Ga0450903_004819
1320 Ga0450904_000497
1321 Ga0450905_009553
1322 Ga0450906_000952
1323 Ga0450906_001246
1324 Ga0450907_000001
1325 Ga0450907_001863
1326 Ga0450907_007968
1327 Ga0450910_000235
1328 Ga0439446_0000210
1329 Ga0439446_0000222
1330 Ga0439446_0003553
1331 Ga0439446_0041583
1332 Ga0450908_001049
1333 Ga0450909_000158
1334 Ga0450909_000192
1335 Ga0439434_0000057
1336 Ga0439460_0001544
1337 Ga0439460_0017057
1338 Ga0450893_0014890
1339 Ga0451577_0279906
1340 Ga0439440_0000252
1341 Ga0439440_0002205
1342 Ga0439440_0012574
1343 Ga0466969_0013651
1344 Ga0453683_0503235
1345 Ga0466966_0012062
1346 Ga0466961_0192849
1347 Ga0466964_0174205
1348 Ga0453684_0330988
1349 Ga0466971_0286610
1350 Ga0466968_0013865
1351 Ga0466970_0025318
1352 Ga0466970_0187245
1353 Ga0466957_0037733
1354 Ga0466959_0015461
1355 Ga0451576_0036741
1356 Ga0466958_0018299
1357 Ga0466958_0316142
1358 Ga0495617_000204
1359 Ga0495617_001096
1360 Ga0495617_002458
1361 Ga0495617_002836
1362 Ga0495617_004958
1363 Ga0495617_005427
1364 Ga0495617_025087
1365 Ga0495617_027628
1366 Ga0495617_045668
1367 Ga0495627_000124
1368 Ga0495627_001657
1369 Ga0495627_034261
1370 Ga0495603_0002282
1371 Ga0495603_0045148
1372 Ga0495603_0129686
1373 Ga0495590_0000114
1374 Ga0495590_0000628
1375 Ga0495590_0004576
1376 Ga0495590_0012548
1377 Ga0495590_0044981
1378 Ga0495591_000021
1379 Ga0495591_001154
1380 Ga0495591_004409
1381 Ga0495591_009642
1382 Ga0495591_011532
1383 Ga0495591_017906
1384 Ga0495591_022356
1385 Ga0495638_0000073
1386 Ga0495638_0001071
1387 Ga0495638_0001173
1388 Ga0495638_0001643
1389 Ga0495638_0001675
1390 Ga0495638_0003795
1391 Ga0495638_0006166
1392 Ga0495638_0012543
1393 Ga0495638_0036061
1394 Ga0495638_0040995
1395 Ga0495638_0126384
1396 Ga0495638_0153048
1397 Ga0495653_0101918
1398 Ga0495650_0000822
1399 Ga0495650_0001066
1400 Ga0495650_0001224
1401 Ga0495650_0001886
1402 Ga0495650_0002534
1403 Ga0495650_0008706
1404 Ga0495605_0000391
1405 Ga0495605_0000446
1406 Ga0495605_0000751
1407 Ga0495605_0003866
1408 Ga0495605_0010911
1409 Ga0495605_0043419
1410 Ga0495605_0052934
1411 Ga0495605_0103442
1412 Ga0495639_0001776
1413 Ga0495584_0000019
1414 Ga0495584_0000176
1415 Ga0495584_0000296
1416 Ga0495584_0000568
1417 Ga0495584_0004039
1418 Ga0495584_0005778
1419 Ga0495584_0015243
1420 Ga0495584_0073558
1421 Ga0495584_0251961
1422 Ga0495585_0000165
1423 Ga0495585_0004259
1424 Ga0495585_0016293
1425 Ga0495585_0041395
1426 Ga0495585_0071007
1427 Ga0495585_0077305
1428 Ga0495585_0085811
1429 Ga0495585_0194445
1430 Ga0495585_0239726
1431 Ga0495594_0000316
1432 Ga0495594_0001211
1433 Ga0495594_0042317
1434 Ga0495596_0000209
1435 Ga0495607_0000188
1436 Ga0495607_0000709
1437 Ga0495607_0006930
1438 Ga0495607_0012463
1439 Ga0495607_0049007
1440 Ga0495607_0051036
1441 Ga0495607_0059322
1442 Ga0495607_0113049
1443 Ga0495583_0001277
1444 Ga0495583_0005600
1445 Ga0495583_0010683
1446 Ga0495583_0023101
1447 Ga0495606_0000347
1448 Ga0495606_0004664
1449 Ga0495606_0029004
1450 Ga0495606_0060018
1451 Ga0495606_0283666
1452 Ga0495610_0004063
1453 Ga0495610_0005350
1454 Ga0495610_0006965
1455 Ga0495610_0009997
1456 Ga0495610_0022448
1457 Ga0495610_0030486
1458 Ga0495610_0038437
1459 Ga0495610_0044935
1460 Ga0495610_0071691
1461 Ga0495616_0001952
1462 Ga0495616_0006371
1463 Ga0495616_0017139
1464 Ga0495616_0028257
1465 Ga0495616_0034385
1466 Ga0495616_0127435
1467 Ga0495616_0190414
1468 Ga0495616_0214611
1469 Ga0495620_0000308
1470 Ga0495620_0002940
1471 Ga0495620_0035239
1472 Ga0495620_0036621
1473 Ga0495620_0103192
1474 Ga0495630_0001104
1475 Ga0495630_0195039
1476 Ga0495630_0400453
1477 Ga0495631_0000005
1478 Ga0495631_0002159
1479 Ga0495631_0029040
1480 Ga0495631_0042894
1481 Ga0495631_0102238
1482 Ga0495632_0000270
1483 Ga0495632_0000533
1484 Ga0495632_0000693
1485 Ga0495632_0001677
1486 Ga0495632_0003778
1487 Ga0495632_0005075
1488 Ga0495632_0008319
1489 Ga0495632_0015102
1490 Ga0495632_0015668
1491 Ga0495632_0016160
1492 Ga0495632_0025415
1493 Ga0495632_0066506
1494 Ga0495632_0093900
1495 Ga0495637_0000499
1496 Ga0495637_0001804
1497 Ga0495637_0003265
1498 Ga0495637_0010990
1499 Ga0495637_0012856
1500 Ga0495637_0016974
1501 Ga0495637_0037619
1502 Ga0495637_0076372
1503 Ga0495643_0005530
1504 Ga0495643_0006979
1505 Ga0495643_0007123
1506 Ga0495643_0009829
1507 Ga0495643_0014019
1508 Ga0495643_0061386
1509 Ga0495644_0000108
1510 Ga0495644_0000143
1511 Ga0495644_0007098
1512 Ga0495648_0000049
1513 Ga0495648_0000092
1514 Ga0495648_0003675
1515 Ga0495648_0004541
1516 Ga0495648_0008097
1517 Ga0495648_0008400
1518 Ga0495648_0010547
1519 Ga0495648_0011830
1520 Ga0495648_0135431
1521 Ga0495666_0000088
1522 Ga0495666_0014084
1523 Ga0495666_0067413
1524 Ga0495642_0000003
1525 Ga0495642_0000018
1526 Ga0495642_0000599
1527 Ga0495654_0000088
1528 Ga0495654_0001088
1529 Ga0495654_0001307
1530 Ga0495654_0004804
1531 Ga0495654_0007459
1532 Ga0495654_0008806
1533 Ga0495654_0016497
1534 Ga0495654_0018347
1535 Ga0495654_0025747
1536 Ga0495654_0031557
1537 Ga0495654_0084049
1538 Ga0495654_0107052
1539 Ga0495654_0111662
1540 Ga0495609_0000409
1541 Ga0495609_0002918
1542 Ga0495609_0026937
1543 Ga0495609_0125128
1544 Ga0495597_0003792
1545 Ga0495597_0005486
1546 Ga0495597_0009049
1547 Ga0495597_0011043
1548 Ga0495597_0096501
1549 Ga0495597_0115631
1550 Ga0495622_0000193
1551 Ga0495622_0000347
1552 Ga0495622_0007820
1553 Ga0495622_0042330
1554 Ga0495633_0017843
1555 Ga0495633_0096991
1556 Ga0495656_0003888
1557 Ga0495656_0007882
1558 Ga0495656_0024651
1559 Ga0495656_0058921
1560 Ga0495656_0179777
1561 Ga0495668_0000467
1562 Ga0495668_0009442
1563 Ga0495611_0007442
1564 Ga0495625_0000397
1565 Ga0495625_0001435
1566 Ga0495625_0005691
1567 Ga0495625_0007778
1568 Ga0495625_0014487
1569 Ga0495625_0015160
1570 Ga0495625_0045240
1571 Ga0495625_0089279
1572 Ga0495659_0000002
1573 Ga0495659_0000641
1574 Ga0495659_0003771
1575 Ga0495661_0013350
1576 Ga0495661_0031938
1577 Ga0495661_0082342
1578 Ga0495588_0004596
1579 Ga0495588_0019536
1580 Ga0495588_0123428
1581 Ga0495623_0001478
1582 Ga0495623_0002571
1583 Ga0495658_0155476
1584 Ga0495669_0000279
1585 Ga0495669_0001673
1586 Ga0495669_0009985
1587 Ga0495613_0045217
1588 Ga0495624_0089391
1589 Ga0495670_0000112
1590 Ga0495670_0000620
1591 Ga0495670_0001315
1592 Ga0495670_0013560
1593 Ga0495670_0017942
1594 Ga0495670_0022028
1595 Ga0495670_0032135
1596 Ga0495670_0062329
1597 Ga0495670_0089262
1598 Ga0495670_0108992
1599 Ga0495670_0189817
1600 Ga0495671_0000066
1601 Ga0495671_0000160
1602 Ga0495671_0005604
1603 Ga0495671_0019876
1604 Ga0495671_0033611
1605 Ga0495671_0094409
1606 Ga0495671_0094867
1607 Ga0495671_0121270
1608 Ga0495671_0135752
1609 Ga0495671_0252794
1610 Ga0495649_0000013
1611 Ga0495649_0000814
1612 Ga0495649_0001154
1613 Ga0495649_0005808
1614 Ga0495649_0006677
1615 Ga0495649_0016472
1616 Ga0495649_0043216
1617 Ga0495649_0095279
1618 Ga0495649_0164511
1619 Ga0495589_0000123
1620 Ga0495589_0001395
1621 Ga0495589_0003200
1622 Ga0495589_0005346
1623 Ga0495589_0006827
1624 Ga0495589_0033379
1625 Ga0495589_0041175
1626 Ga0495589_0054318
1627 Ga0495589_0133423
1628 Ga0495600_0025520
1629 Ga0495660_0001517
1630 Ga0495660_0001634
1631 Ga0495660_0002240
1632 Ga0495660_0013001
1633 Ga0495660_0019231
1634 Ga0495660_0020036
1635 Ga0495660_0023755
1636 Ga0495660_0030094
1637 Ga0495660_0030283
1638 Ga0495660_0042483
1639 Ga0495660_0065169
1640 Ga0495660_0081658
1641 Ga0495660_0128573
1642 Ga0495581_0088882
1643 Ga0495604_0001925
1644 Ga0495636_0007111
1645 Ga0495636_0066107
1646 Ga0495674_0005938
1647 Ga0495672_0000442
1648 Ga0495672_0000773
1649 Ga0495672_0000891
1650 Ga0495672_0001663
1651 Ga0495672_0001947
1652 Ga0495672_0006676
1653 Ga0495672_0010062
1654 Ga0495672_0045791
1655 Ga0495672_0101971
1656 Ga0495676_0229954
1657 Ga0495680_0053758
1658 Ga0495680_0434782
1659 Ga0495683_0000010
1660 Ga0495683_0000337
1661 Ga0495683_0002492
1662 Ga0495683_0006146
1663 Ga0495683_0011122
1664 Ga0495683_0011848
1665 Ga0495683_0014403
1666 Ga0495683_0018156
1667 Ga0495683_0020399
1668 Ga0495683_0038365
1669 Ga0495687_003205
1670 Ga0495687_004845
1671 Ga0495687_007840
1672 Ga0495687_020289
1673 Ga0495677_0000471
1674 Ga0495679_001961
1675 Ga0495679_009228
1676 Ga0495679_012799
1677 Ga0495685_012690
1678 Ga0495673_0000434
1679 Ga0495673_0000553
1680 Ga0495673_0001485
1681 Ga0495673_0002017
1682 Ga0495673_0002389
1683 Ga0495673_0005784
1684 Ga0495673_0046284
1685 Ga0495681_0000010
1686 Ga0495681_0000259
1687 Ga0495681_0000262
1688 Ga0495681_0000419
1689 Ga0495681_0000703
1690 Ga0495681_0009052
1691 Ga0495681_0010676
1692 Ga0495681_0024186
1693 Ga0495681_0031963
1694 Ga0495681_0039958
1695 Ga0495681_0183092
1696 Ga0495684_0035906
1697 Ga0495686_0008941
1698 Ga0495686_0041603
1699 Ga0495686_0138116
1700 Ga0495686_0144097
1701 Ga0495686_0150522
1702 Ga0495593_0000018
1703 Ga0495593_0000777
1704 Ga0495615_0000105
1705 Ga0495615_0048847
1706 Ga0495626_0000031
1707 Ga0495626_0000079
1708 Ga0495626_0000242
1709 Ga0495626_0000329
1710 Ga0495626_0000759
1711 Ga0495626_0001357
1712 Ga0495626_0005157
1713 Ga0495626_0013146
1714 Ga0495626_0014268
1715 Ga0496100_0590620
1716 Ga0496102_0235272
1717 Ga0496102_0380623
1718 Ga0496105_0049697
1719 Ga0496106_0189660
1720 Ga0496107_0177192
1721 Ga0496110_0078555
1722 Ga0496110_0099864
1723 Ga0496110_0666980
1724 Ga0496111_0188066
1725 Ga0496112_0014420
1726 Ga0496112_0020807
1727 Ga0496113_0062287
1728 Ga0496113_0413008
1729 Ga0496116_0001237
1730 Ga0496116_0002307
1731 Ga0496117_0129555
1732 Ga0496118_0195987
1733 Ga0496121_0095310
1734 Ga0496122_0002525
1735 Ga0496122_0002963
1736 Ga0496123_0002451
1737 Ga0496124_0002900
1738 Ga0496124_0010024
1739 Ga0496124_0043609
1740 Ga0496124_0093915
1741 Ga0496124_0123802
1742 Ga0496125_0004944
1743 Ga0496125_0018626
1744 Ga0496126_0087602
1745 Ga0495678_000701
1746 Ga0495678_001245
1747 Ga0495678_005843
1748 Ga0495678_009163
1749 Ga0495678_022535
1750 Ga0495678_024222
1751 Ga0495678_080520
1752 Ga0495678_114602
1753 Ga0495682_0001309
1754 Ga0495682_0003820
1755 Ga0495682_0011988
1756 Ga0501031_0030749
1757 Ga0501031_0033103
1758 Ga0501031_0167040
1759 Ga0501031_0597796
1760 Ga0501033_0007048
1761 Ga0501034_0100599
1762 Ga0501036_0001193
1763 Ga0501036_0024335
1764 Ga0501036_0045902
1765 Ga0501036_0097970
1766 Ga0501038_0212540
1767 Ga0501038_0432642
1768 Ga0501039_0033563
1769 Ga0501039_0044040
1770 Ga0501039_0101858
1771 Ga0501039_0279936
1772 Ga0501040_0001724
1773 Ga0501040_0065708
1774 Ga0501040_0079561
1775 Ga0501041_0011140
1776 Ga0501041_0018736
1777 Ga0501041_0059613
1778 Ga0501041_0076801
1779 Ga0501042_0005577
1780 Ga0501042_0126712
1781 Ga0501043_0092185
1782 Ga0501043_0543683
1783 Ga0501046_0107619
1784 Ga0501047_0186360
1785 Ga0501047_0459801
1786 Ga0501048_0050547
1787 Ga0501068_0005672
1788 Ga0501068_0141862
1789 Ga0501069_0294780
1790 Ga0501070_0198410
1791 Ga0501071_0007936
1792 Ga0501071_0009804
1793 Ga0501071_0135125
1794 Ga0501072_0005608
1795 Ga0501072_0011565
1796 Ga0501072_0095836
1797 Ga0501072_0253513
1798 Ga0501072_0262375
1799 Ga0501073_0042142
1800 Ga0501073_0071178
1801 Ga0501074_0062661
1802 Ga0501074_0100816
1803 Ga0501074_0109025
1804 Ga0501074_0173184
1805 Ga0501074_0220991
1806 Ga0501074_0289274
1807 Ga0501075_0011542
1808 Ga0501075_0023427
1809 Ga0501075_0025157
1810 Ga0501075_0034455
1811 Ga0501075_0116664
1812 Ga0501076_0022693
1813 Ga0501076_0023798
1814 Ga0501076_0043988
1815 Ga0501077_0031361
1816 Ga0501077_0120177
1817 Ga0501079_0038714
1818 Ga0501079_0100709
1819 Ga0501079_0139474
1820 Ga0501079_0595572
1821 Ga0501080_0644458
1822 Ga0501081_0011107
1823 Ga0501081_0064537
1824 Ga0501081_0104547
1825 Ga0501035_0026432
1826 Ga0501035_0735758
1827 Ga0501044_0043020
1828 Ga0501045_0012473
1829 Ga0501045_0016327
1830 Ga0501045_0025200
1831 nmdc:mga00v17_209825_c1
1832 nmdc:mga00v17_209969_c1
1833 nmdc:mga00v17_26563_c1
1834 nmdc:mga00v17_58430_c1
1835 nmdc:mga00v17_88236_c1
1836 nmdc:mga06z11_35824_c1
1837 nmdc:mga04h51_13771_c1
1838 nmdc:mga07m45_123412_c1
1839 nmdc:mga07m45_8603_c1
1840 nmdc:mga07m45_90954_c1
1841 nmdc:mga05p37_20057_c1
1842 nmdc:mga05p37_200676_c1
1843 nmdc:mga05p37_610024_c1
1844 nmdc:mga05p37_682271_c1
1845 nmdc:mga09592_20431_c1
1846 nmdc:mga09592_266351_c1
1847 nmdc:mga09592_459552_c1
1848 nmdc:mga0qj67_121249_c1
1849 nmdc:mga0qj67_447253_c1
1850 nmdc:mga0qj67_98346_c1
1851 nmdc:mga06r32_1070187_c1
1852 nmdc:mga06r32_148916_c1
1853 nmdc:mga06r32_258614_c1
1854 nmdc:mga08y16_320082_c1
1855 nmdc:mga0n895_179639_c1
1856 nmdc:mga0rr50_102939_c1
1857 nmdc:mga0rr50_671860_c1
1858 nmdc:mga0rr50_6947_c1
1859 nmdc:mga08x19_156712_c1
1860 nmdc:mga08x19_247988_c1
1861 nmdc:mga08x19_26165_c1
1862 nmdc:mga08x19_36808_c1
1863 nmdc:mga08x19_5919_c1
1864 nmdc:mga0a205_14835_c1
1865 nmdc:mga0sz30_16921_c2
1866 nmdc:mga0sz30_75741_c1
1867 Ga0495612_0231950
1868 Ga0500566_0000044
1869 Ga0500641_0060647
1870 Ga0500555_005902
1871 Ga0500593_000006
1872 Ga0500559_0004626
1873 Ga0500568_0000005
1874 Ga0500568_0022253
1875 Ga0500577_0001370
1876 Ga0500577_0092089
1877 Ga0500616_0020681
1878 Ga0501084_0045923
1879 Ga0501084_0103954
1880 Ga0587073_0098291
1881 Ga0587091_075971
1882 Ga0501082_0045823
1883 Ga0501082_0099541
1884 Ga0501082_0197956
1885 Ga0501082_0224692
1886 Ga0501082_0237481
1887 Ga0530510_0012041
1888 Ga0530510_0013473
1889 Ga0530510_0014529
1890 Ga0530510_0021620
1891 Ga0530510_0079955
1892 2511257125
1893 2511264323
1894 2511270396
1895 2511275481
1896 2511302077
1897 2511313773
1898 2511323157
1899 2511325567
1900 2511333339
1901 2511350151
1902 2511357440
1903 2511361151
1904 2512329181
1905 2513592536
1906 2583793317
1907 2585153353
1908 2585196714
1909 2597857289
1910 2599484776
1911 2599801960
1912 2643781844
1913 2643842236
1914 2643930433
1915 2643956692
1916 2644021915
1917 2644188269
1918 2671768908
1919 2739197784
1920 2739262237
1921 2743736712
1922 2774118805
1923 2784312443
1924 2808933193
1925 2808955300
1926 2809214685
1927 2819537829
1928 2819647607
1929 2828306528
1930 2858693607
1931 2904551848
1932 2919459136
1933 2923155730
1934 2939639985
1935 2939674401
1936 2984290295
1937 8015689982
1938 8055773085
1939 8056129470
1940 8056178640

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

52

190

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

210

249

0.96

PF08534

Redoxin

Redoxin

51

208

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9534 3 217
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9519 2 217
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9488 3 217
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9473 2 217
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9384 2 214
ID Description Score Start End Superfamily
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9833 153 214 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9687 153 216 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9628 5 106 3.40.30.10
af_O08709_156_224_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9606 153 216 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9543 153 216 3.30.1020.10

Map