F487110

General Info

Members Datasets Scaffolds Average Seq Length
970 731 1940 270

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|639633055|639649651
Length 313
Sequence SRSGTVLSRYSFLFLGWNNNIFFVQNASGRRCLLAADAKETGSMTVEWKDMMLDKVAIGPVSARIYQGADYGKGPPIVLYLHGGAFLDSDKNVDRPVAMSLAKAGAIVVAADYSSLSGNLFPQALEVSFSVFTYLANKRAGLGDRKSLLFVAGEEAGGNVAAGVALKARDQMPDALDGQVLISPLLDPFMGTSSIRKAEAIGMRQRWTEGWSHYLSGGGCHPYAAPCLCSRISGVAPALIFTAEDDPLHDETIGYGARLKQAGVGVRQHVLPAGTGWPSIYGGKSDGAPDWQENVSRHFGSFLRDVSVQPQLH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
51 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
63 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
64 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
65 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
66 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
67 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
68 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
108 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
118 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
122 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
125 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
126 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
127 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
128 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
129 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
130 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
227 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
228 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
229 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
230 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
231 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
237 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
243 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
244 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
245 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
249 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
250 2509276019 Ensifer aridi TW10 Isolate Nodule
251 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
252 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
253 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
254 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
255 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
256 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
257 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
258 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
259 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
260 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
261 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
262 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
263 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
264 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
265 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
266 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
267 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
268 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
269 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
270 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
271 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
272 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
273 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
274 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
275 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
276 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
277 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
278 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
279 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
280 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
281 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
282 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
283 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
284 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
285 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
286 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
287 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
288 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
289 2519899620 Rhizobium sp. Pop5 Isolate Nodule
290 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
291 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
292 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
293 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
294 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
295 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
296 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
297 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
298 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
299 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
300 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
301 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
302 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
303 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
304 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
305 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
306 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
307 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
308 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
309 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
310 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
311 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
312 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
313 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
314 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
315 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
316 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
317 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
318 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
319 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
320 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
321 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
322 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
323 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
324 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
325 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
326 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
327 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
328 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
329 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
330 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
331 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
332 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
333 2643221568 Rhizobium sp. Root564 Isolate Unclassified
334 2643221582 Rhizobium sp. Root651 Isolate Unclassified
335 2643221599 Rhizobium sp. Root708 Isolate Unclassified
336 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
337 2643221693 Rhizobium sp. Root491 Isolate Unclassified
338 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
339 2718217882 Rhizobium sp. N741 Isolate Nodule
340 2718217927 Rhizobium sp. N324 Isolate Nodule
341 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
342 2718218009 Rhizobium sp. N561 Isolate Nodule
343 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
344 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
345 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
346 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
347 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
348 2718218363 Rhizobium sp. N113 Isolate Nodule
349 2718218365 Rhizobium sp. N731 Isolate Nodule
350 2718218366 Rhizobium sp. N621 Isolate Nodule
351 2718218423 Rhizobium sp. N941 Isolate Nodule
352 2721755514 Rhizobium sp. N6212 Isolate Nodule
353 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
354 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
355 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
356 2721755809 Rhizobium sp. N541 Isolate Nodule
357 2721755810 Rhizobium sp. N871 Isolate Nodule
358 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
359 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
360 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
361 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
362 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
363 2728369365 Rhizobium sp. N1341 Isolate Nodule
364 2728369397 Rhizobium sp. N1314 Isolate Nodule
365 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
366 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
367 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
368 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
369 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
370 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
371 2791355256 Rhizobium sp. M10 Isolate Nodule
372 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
373 2791355260 Rhizobium sp. L9 Isolate Nodule
374 2791355261 Rhizobium sp. J15 Isolate Nodule
375 2791355262 Rhizobium sp. M1 Isolate Nodule
376 2791355263 Rhizobium chutanense C5 Isolate Nodule
377 2791355264 Rhizobium sp. S9 Isolate Nodule
378 2791355265 Rhizobium sp. H4 Isolate Nodule
379 2791355266 Rhizobium sp. L43 Isolate Nodule
380 2791355267 Rhizobium sp. L18 Isolate Nodule
381 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
382 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
383 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
384 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
385 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
386 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
387 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
388 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
389 2802429633 Rhizobium anhuiense J3 Isolate Nodule
390 2802429634 Rhizobium anhuiense S10 Isolate Nodule
391 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
392 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
393 2802429637 Rhizobium anhuiense C15 Isolate Nodule
394 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
395 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
396 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
397 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
398 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
399 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
400 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
401 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
402 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
403 2838048938 Rhizobium pisi 27/80 Isolate Nodule
404 2838061910 Rhizobium phaseoli L15 Isolate Nodule
405 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
406 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
407 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
408 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
409 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
410 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
411 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
412 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
413 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
414 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
415 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
416 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
417 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
418 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
419 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
420 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
421 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
422 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
423 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
424 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
425 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
426 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
427 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
428 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
429 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
430 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
431 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
432 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
433 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
434 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
435 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
436 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
437 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
438 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
439 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
440 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
441 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
442 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
443 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
444 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
445 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
446 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
447 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
448 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
449 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
450 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
451 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
452 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
453 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
454 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
455 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
456 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
457 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
458 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
459 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
460 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
461 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
462 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
463 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
464 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
465 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
466 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
467 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
468 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
469 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
470 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
471 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
472 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
473 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
474 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
475 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
476 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
477 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
478 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
479 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
480 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
481 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
482 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
483 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
484 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
485 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
486 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
487 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
488 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
489 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
490 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
491 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
492 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
493 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
494 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
495 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
496 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
497 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
498 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
499 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
500 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
501 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
502 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
503 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
504 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
505 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
506 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
507 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
508 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
509 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
510 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
511 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
512 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
513 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
514 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
515 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
516 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
517 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
518 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
519 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
520 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
521 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
522 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
523 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
524 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
525 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
526 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
527 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
528 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
529 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
530 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
531 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
532 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
533 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
534 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
535 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
536 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
537 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
538 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
539 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
540 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
541 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
542 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
543 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
544 2933599457 Rhizobium phaseoli M3 Isolate Nodule
545 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
546 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
547 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
548 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
549 2936381700 Rhizobium chutanense C16 Isolate Unclassified
550 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
551 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
552 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
553 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
554 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
555 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
556 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
557 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
558 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
559 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
560 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
561 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
562 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
563 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
564 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
565 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
566 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
567 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
568 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
569 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
570 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
571 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
572 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
573 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
574 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
575 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
576 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
577 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
578 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
579 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
580 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
581 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
582 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
583 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
584 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
585 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
586 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
587 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
588 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
589 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
590 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
591 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
592 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
593 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
594 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
595 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
596 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
597 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
598 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
599 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
600 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
601 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
602 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
603 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
604 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
605 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
606 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
607 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
608 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
609 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
610 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
611 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
612 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
613 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
614 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
615 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
616 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
617 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
618 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
619 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
620 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
621 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
622 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
623 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
624 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
625 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
626 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
627 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
628 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
629 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
630 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
631 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
632 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
633 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
634 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
635 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
636 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
637 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
638 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
639 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
640 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
641 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
642 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
643 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
644 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
645 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
646 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
647 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
648 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
649 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
650 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
651 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
652 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
653 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
654 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
655 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
656 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
657 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
658 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
659 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
660 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
661 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
662 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
663 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
664 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
665 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
666 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
667 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
668 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
669 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
670 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
671 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
672 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
673 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
674 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
675 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
676 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
677 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
678 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
679 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
680 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
681 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
682 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
683 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
684 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
685 2996893221 Rhizobium sp. R635 Isolate Nodule
686 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
687 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
688 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
689 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
690 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
691 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
692 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
693 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
694 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
695 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
696 8005275841 Rhizobium sp. N4311 Isolate Nodule
697 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
698 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
699 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
700 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
701 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
702 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
703 8005382845 Rhizobium sp. R634 Isolate Nodule
704 8005395548 Rhizobium sp. R339 Isolate Nodule
705 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
706 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
707 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
708 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
709 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
710 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
711 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
712 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
713 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
714 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
715 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
716 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
717 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
718 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
719 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
720 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
721 8018176218 Rhizobium sp. N122 Isolate Nodule
722 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
723 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
724 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
725 8024501048 Rhizobium sp. H4 Isolate Nodule
726 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
727 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
728 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
729 8056382006 Rhizobium croatiense 13T Isolate Nodule
730 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
731 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.69
Metatranscriptomes 0.41
Isolates 49.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 22.89
Nodule 42.78
Rhizoplane 1.03
Rhizosphere 18.76
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000564 3300001979 Bacteria 15949
2 JGI25155J39150_1000065 3300002704 Bacteria 69464
3 JGI25155J39150_1000098 3300002704 Bacteria 48725
4 JGI25156J39149_1000144 3300002705 Bacteria 52681
5 JGI25156J39149_1000163 3300002705 Bacteria 48762
6 JGI25154J39366_1000035 3300002738 Bacteria 172224
7 JGI25154J39366_1000183 3300002738 Bacteria 48762
8 JGI25158J39367_1000927 3300002739 Bacteria 5464
9 JGI25157J39369_1000209 3300002741 Bacteria 48762
10 JGI25157J39369_1001004 3300002741 Bacteria 13118
11 JGI25152J39213_1003227 3300002773 Bacteria 5673
12 JGI25152J39213_1010470 3300002773 Bacteria 2117
13 JGI25159J45721_1001556 3300002987 Bacteria 9403
14 JGI25159J45721_1004685 3300002987 Bacteria 4465
15 JGI25151J46595_10002096 3300003187 Bacteria 12432
16 JGI25151J46595_10005186 3300003187 Bacteria 6758
17 JGI25151J46595_10007415 3300003187 Bacteria 5378
18 JGI25151J46595_10009835 3300003187 Bacteria 4495
19 JGI25151J46595_10026849 3300003187 Bacteria 2316
20 JGI25153J46596_10006886 3300003215 Bacteria 5676
21 JGI25153J46596_10007510 3300003215 Bacteria 5343
22 JGI25153J46596_10011704 3300003215 Bacteria 3854
23 rootH1_10057687 3300003316 Bacteria 1444
24 rootH1_10074966 3300003316 Bacteria 1695
25 rootH2_10008438 3300003320 Bacteria 4030
26 rootH2_10008440 3300003320 Bacteria 1808
27 rootH2_10045333 3300003320 Bacteria 1620
28 rootL2_10016820 3300003322 Bacteria 9950
29 rootL2_10320304 3300003322 Bacteria 1491
30 rootH1_10063714 3300003323 Bacteria 2561
31 rootH1_10117136 3300003323 Bacteria 1559
32 rootH1_10170367 3300003323 Bacteria 3776
33 JGI25160J50197_1000001 3300003354 Bacteria 782301
34 JGI25160J50197_1000212 3300003354 Bacteria 47984
35 JGI25160J50197_1000917 3300003354 Bacteria 15487
36 JGI25160J50197_1009247 3300003354 Bacteria 3674
37 JGI25161J50226_1000047 3300003374 Bacteria 113472
38 JGI25161J50226_1000151 3300003374 Bacteria 47984
39 JGI25161J50226_1000238 3300003374 Bacteria 33305
40 JGI25161J50226_1000331 3300003374 Bacteria 25691
41 JGI25161J50226_1001587 3300003374 Bacteria 6643
42 Ga0055526_1002806 3300003771 Bacteria 11539
43 Ga0055526_1004625 3300003771 Bacteria 8198
44 Ga0055526_1012519 3300003771 Bacteria 3691
45 Ga0055526_1017186 3300003771 Bacteria 2780
46 Ga0055537_1000709 3300003773 Bacteria 17283
47 Ga0055524_1000082 3300003775 Bacteria 119749
48 Ga0055524_1001237 3300003775 Bacteria 15052
49 Ga0055524_1004997 3300003775 Bacteria 6005
50 Ga0055524_1006292 3300003775 Bacteria 5166
51 Ga0055524_1021578 3300003775 Bacteria 2130
52 Ga0055536_1001960 3300003781 Bacteria 11848
53 Ga0055534_1003222 3300003784 Bacteria 5238
54 Ga0055534_1005336 3300003784 Bacteria 3465
55 Ga0055534_1013334 3300003784 Bacteria 1583
56 Ga0055528_1000525 3300003790 Bacteria 29704
57 Ga0055528_1001182 3300003790 Bacteria 16852
58 Ga0055528_1002394 3300003790 Bacteria 10090
59 Ga0055528_1003139 3300003790 Bacteria 8476
60 Ga0055528_1009964 3300003790 Bacteria 3915
61 Ga0055528_1019332 3300003790 Bacteria 2263
62 Ga0055528_1019744 3300003790 Bacteria 2216
63 Ga0055530_10000688 3300003791 Bacteria 28617
64 Ga0055530_10046368 3300003791 Bacteria 1032
65 Ga0055540_1000010 3300003792 Bacteria 290865
66 Ga0055540_1001376 3300003792 Bacteria 14517
67 Ga0055540_1003377 3300003792 Bacteria 7740
68 Ga0055531_10019143 3300003794 Bacteria 2786
69 Ga0058692_1001275 3300003856 Bacteria 9566
70 Ga0055543_1000007 3300004625 Bacteria 204042
71 Ga0055543_1000419 3300004625 Bacteria 26802
72 Ga0055543_1000526 3300004625 Bacteria 21681
73 Ga0055543_1000646 3300004625 Bacteria 18584
74 Ga0065165_1000357 3300005262 Bacteria 75030
75 Ga0065165_1015536 3300005262 Bacteria 2896
76 Ga0065165_1032167 3300005262 Bacteria 1647
77 Ga0065165_1042739 3300005262 Bacteria 1335
78 Ga0070670_100000560 3300005331 Bacteria 29495
79 Ga0070669_100286700 3300005353 Bacteria 1321
80 Ga0070664_100468505 3300005564 Bacteria 1158
81 Ga0068854_100017336 3300005578 Bacteria 4819
82 Ga0068856_100185206 3300005614 Bacteria 2096
83 Ga0068852_100127814 3300005616 Bacteria 2336
84 Ga0075365_10004644 3300006038 Bacteria 7313
85 Ga0075365_10006669 3300006038 Bacteria 6378
86 Ga0075368_10027051 3300006042 Bacteria 2210
87 Ga0075363_100026618 3300006048 Bacteria 2960
88 Ga0075364_10007185 3300006051 Bacteria 6593
89 Ga0075364_10012908 3300006051 Bacteria 5127
90 Ga0075362_10000300 3300006177 Bacteria 14031
91 Ga0075362_10001572 3300006177 Bacteria 7379
92 Ga0075362_10092379 3300006177 Bacteria 1406
93 Ga0075367_10004384 3300006178 Bacteria 6885
94 Ga0075367_10005561 3300006178 Bacteria 6278
95 Ga0075367_10021211 3300006178 Bacteria 3628
96 Ga0075369_10001899 3300006186 Bacteria 7324
97 Ga0075369_10001967 3300006186 Bacteria 7222
98 Ga0075369_10027942 3300006186 Bacteria 2361
99 Ga0075369_10031219 3300006186 Bacteria 2247
100 Ga0075369_10055396 3300006186 Bacteria 1723
101 Ga0075366_10009357 3300006195 Bacteria 5468
102 Ga0075366_10022758 3300006195 Bacteria 3648
103 Ga0075366_10048190 3300006195 Bacteria 2526
104 Ga0075370_10020155 3300006353 Bacteria 3641
105 Ga0075370_10027128 3300006353 Bacteria 3177
106 Ga0075370_10045619 3300006353 Bacteria 2479
107 Ga0075370_10062684 3300006353 Bacteria 2119
108 Ga0075370_10078416 3300006353 Bacteria 1897
109 Ga0079104_1004704 3300006946 Bacteria 5718
110 Ga0079104_1005831 3300006946 Bacteria 4814
111 Ga0099826_10002615 3300006948 Bacteria 11731
112 Ga0105240_10000014 3300009093 Bacteria 482033
113 Ga0105243_10131709 3300009148 Bacteria 2122
114 Ga0105237_10000770 3300009545 Bacteria 43805
115 Ga0105238_10659264 3300009551 Bacteria 1057
116 Ga0123341_1000011 3300009765 Bacteria 108023
117 Ga0123342_1008752 3300009766 Bacteria 12535
118 Ga0123342_1018063 3300009766 Bacteria 5714
119 Ga0105239_10004243 3300010375 Bacteria 17211
120 Ga0105239_10316635 3300010375 Bacteria 1759
121 Ga0105246_10050655 3300011119 Bacteria 2849
122 Ga0157373_10049545 3300013100 Bacteria 2993
123 Ga0157373_10081630 3300013100 Bacteria 2279
124 Ga0157373_10106668 3300013100 Bacteria 1969
125 Ga0157371_10000966 3300013102 Bacteria 31904
126 Ga0157371_10002118 3300013102 Bacteria 19329
127 Ga0157370_10000015 3300013104 Bacteria 185771
128 Ga0157370_10000338 3300013104 Bacteria 59035
129 Ga0157369_10020309 3300013105 Bacteria 7424
130 Ga0157372_10239097 3300013307 Unclassified 2107
131 Ga0182008_10033845 3300014497 Bacteria 2563
132 Ga0182007_10002096 3300015262 Bacteria 10220
133 Ga0182005_1010891 3300015265 Bacteria 2606
134 Ga0206355_1174415 3300020076 Bacteria 1071
135 Ga0214544_1000105 3300021320 Bacteria 114109
136 Ga0214542_1000029 3300021321 Bacteria 174097
137 Ga0214543_1000027 3300021327 Bacteria 215065
138 Ga0214543_1000040 3300021327 Bacteria 174142
139 Ga0228711_1000013 3300022739 Bacteria 132585
140 Ga0228710_1000008 3300022740 Bacteria 174306
141 Ga0209435_100005 3300025206 Bacteria 573745
142 Ga0209435_100010 3300025206 Bacteria 475373
143 Ga0209436_100110 3300025208 Bacteria 41189
144 Ga0209436_107364 3300025208 Bacteria 2305
145 Ga0209672_103287 3300025228 Bacteria 3414
146 Ga0209437_100058 3300025233 Bacteria 357279
147 Ga0209437_100060 3300025233 Bacteria 355034
148 Ga0207425_1001956 3300025245 Bacteria 7737
149 Ga0207425_1001995 3300025245 Bacteria 7624
150 Ga0207425_1013334 3300025245 Bacteria 1902
151 Ga0209646_1000001 3300025246 Bacteria 3092932
152 Ga0209646_1000011 3300025246 Bacteria 573745
153 Ga0209026_1000001 3300025250 Bacteria 1228671
154 Ga0209026_1000008 3300025250 Bacteria 573745
155 Ga0209677_100781 3300025253 Bacteria 16045
156 Ga0209148_1004917 3300025254 Bacteria 3157
157 Ga0209759_1000001 3300025256 Bacteria 2799452
158 Ga0209759_1000004 3300025256 Bacteria 573745
159 Ga0209129_1000226 3300025258 Bacteria 63537
160 Ga0209129_1001492 3300025258 Bacteria 13007
161 Ga0209129_1002108 3300025258 Bacteria 10140
162 Ga0209129_1005143 3300025258 Bacteria 4773
163 Ga0209129_1005786 3300025258 Bacteria 4230
164 Ga0209129_1010068 3300025258 Bacteria 2405
165 Ga0209129_1013977 3300025258 Bacteria 1733
166 Ga0209233_1000137 3300025261 Bacteria 200314
167 Ga0209565_1000036 3300025263 Bacteria 293334
168 Ga0209565_1000226 3300025263 Bacteria 63161
169 Ga0209455_1012080 3300025272 Bacteria 2087
170 Ga0209673_1000239 3300025273 Bacteria 105502
171 Ga0209673_1000282 3300025273 Bacteria 95013
172 Ga0209673_1000478 3300025273 Bacteria 66832
173 Ga0209673_1001495 3300025273 Bacteria 21722
174 Ga0209673_1001737 3300025273 Bacteria 18320
175 Ga0209673_1002506 3300025273 Bacteria 12623
176 Ga0209673_1018821 3300025273 Bacteria 2497
177 Ga0209130_1000023 3300025284 Bacteria 359355
178 Ga0209130_1000042 3300025284 Bacteria 257581
179 Ga0209130_1000145 3300025284 Bacteria 113201
180 Ga0209130_1008226 3300025284 Bacteria 3102
181 Ga0209130_1014063 3300025284 Bacteria 2024
182 Ga0209130_1017324 3300025284 Bacteria 1719
183 Ga0209675_1000289 3300025291 Bacteria 47643
184 Ga0209675_1003625 3300025291 Bacteria 7246
185 Ga0209676_1000007 3300025292 Bacteria 1029371
186 Ga0209676_1018097 3300025292 Bacteria 2467
187 Ga0209025_1000288 3300025294 Bacteria 113626
188 Ga0209025_1000411 3300025294 Bacteria 86058
189 Ga0209025_1002347 3300025294 Bacteria 20391
190 Ga0209025_1006388 3300025294 Bacteria 9173
191 Ga0209025_1013965 3300025294 Bacteria 4996
192 Ga0209025_1037708 3300025294 Bacteria 2139
193 Ga0209025_1051255 3300025294 Bacteria 1642
194 Ga0209025_1081354 3300025294 Bacteria 1098
195 Ga0209564_1000259 3300025295 Bacteria 112570
196 Ga0209564_1000393 3300025295 Bacteria 78338
197 Ga0209564_1001326 3300025295 Bacteria 26471
198 Ga0209564_1007458 3300025295 Bacteria 5644
199 Ga0209564_1024341 3300025295 Bacteria 2072
200 Ga0209564_1025207 3300025295 Bacteria 2009
201 Ga0209564_1026301 3300025295 Bacteria 1927
202 Ga0209758_1000390 3300025297 Bacteria 75869
203 Ga0209758_1001594 3300025297 Bacteria 25947
204 Ga0209758_1004703 3300025297 Bacteria 11144
205 Ga0209758_1008994 3300025297 Bacteria 6315
206 Ga0209758_1078594 3300025297 Bacteria 1007
207 Ga0209050_1000003 3300025298 Bacteria 1609245
208 Ga0209050_1004120 3300025298 Bacteria 10120
209 Ga0209050_1007028 3300025298 Bacteria 6467
210 Ga0209050_1013661 3300025298 Bacteria 3582
211 Ga0209256_1000001 3300025299 Bacteria 2166974
212 Ga0209256_1000155 3300025299 Bacteria 144379
213 Ga0209256_1000619 3300025299 Bacteria 49078
214 Ga0209256_1001902 3300025299 Bacteria 19096
215 Ga0209256_1004144 3300025299 Bacteria 9364
216 Ga0209256_1007631 3300025299 Bacteria 5271
217 Ga0207426_1000011 3300025302 Bacteria 791203
218 Ga0207426_1000087 3300025302 Bacteria 288870
219 Ga0207426_1000097 3300025302 Bacteria 265930
220 Ga0207426_1000386 3300025302 Bacteria 75890
221 Ga0207426_1001878 3300025302 Bacteria 15369
222 Ga0209051_1000003 3300025303 Bacteria 1609245
223 Ga0209051_1000321 3300025303 Bacteria 72390
224 Ga0209051_1003739 3300025303 Bacteria 9784
225 Ga0209051_1004393 3300025303 Bacteria 8718
226 Ga0209051_1018086 3300025303 Bacteria 3130
227 Ga0209257_1000020 3300025304 Bacteria 773356
228 Ga0209257_1005878 3300025304 Bacteria 8282
229 Ga0209257_1010077 3300025304 Bacteria 4886
230 Ga0207695_10000037 3300025913 Bacteria 476303
231 Ga0207671_10000080 3300025914 Bacteria 148567
232 Ga0207681_10101055 3300025923 Bacteria 2080
233 Ga0207650_10007237 3300025925 Bacteria 7559
234 Ga0207709_10086633 3300025935 Bacteria 2034
235 Ga0207640_10018330 3300025981 Bacteria 4113
236 Ga0207702_10041321 3300026078 Bacteria 3867
237 Ga0209281_1000134 3300027111 Bacteria 185406
238 Ga0209281_1000783 3300027111 Bacteria 30223
239 Ga0209371_1000022 3300027312 Bacteria 536342
240 Ga0209371_1000370 3300027312 Bacteria 48496
241 Ga0209371_1001191 3300027312 Bacteria 18849
242 Ga0209282_1000029 3300027666 Bacteria 157883
243 Ga0209282_1001507 3300027666 Bacteria 12863
244 Ga0209813_10003505 3300027866 Bacteria 3679
245 Ga0268266_10112087 3300028379 Bacteria 2418
246 Ga0307515_10007465 3300028794 Bacteria 21615
247 Ga0307515_10209541 3300028794 Bacteria 1797
248 Ga0268256_1000019 3300030500 Bacteria 587949
249 Ga0268256_1002822 3300030500 Bacteria 8390
250 Ga0268256_1005648 3300030500 Bacteria 4853
251 Ga0316181_1086484 3300030744 Bacteria 2161
252 Ga0307513_10000011 3300031456 Bacteria 354929
253 Ga0307513_10015921 3300031456 Bacteria 9094
254 Ga0307513_10129858 3300031456 Bacteria 2468
255 Ga0307408_100004501 3300031548 Bacteria 9450
256 Ga0307408_100068413 3300031548 Bacteria 2615
257 Ga0307408_100344065 3300031548 Bacteria 1263
258 Ga0307405_10157461 3300031731 Bacteria 1605
259 Ga0307406_10027924 3300031901 Bacteria 3405
260 Ga0307412_10025014 3300031911 Bacteria 3693
261 Ga0307412_10218606 3300031911 Bacteria 1459
262 Ga0307412_10436561 3300031911 Bacteria 1075
263 Ga0315914_1000021 3300031967 Bacteria 119592
264 Ga0307409_100331407 3300031995 Bacteria 1428
265 Ga0307409_100381438 3300031995 Bacteria 1340
266 Ga0307414_10073553 3300032004 Bacteria 2473
267 Ga0315913_1000014 3300033430 Bacteria 120114
268 Ga0315915_1000003 3300033464 Bacteria 407996
269 Ga0395905_0012601 3300037471 Bacteria 8134
270 Ga0439465_0007062 3300041413 Bacteria 3568
271 Ga0439465_0018167 3300041413 Bacteria 2197
272 Ga0451787_279068 3300041441 Bacteria 3997
273 Ga0451798_0814015 3300041458 Bacteria 2521
274 Ga0451833_0644275 3300041491 Bacteria 4161
275 Ga0451840_11731 3300041497 Bacteria 1565
276 Ga0451841_0397021 3300041498 Bacteria 1357
277 Ga0451841_1005621 3300041498 Bacteria 923
278 Ga0451845_0927883 3300041501 Bacteria 1270
279 Ga0451845_0929104 3300041501 Bacteria 1300
280 Ga0451846_05577 3300041502 Bacteria 2773
281 Ga0451847_0008387 3300041503 Bacteria 3817
282 Ga0451847_0691945 3300041503 Bacteria 1303
283 Ga0451851_0548143 3300041507 Bacteria 1880
284 Ga0451855_0189021 3300041511 Bacteria 947
285 Ga0451853_1500900 3300041512 Bacteria 5314
286 Ga0451853_3538132 3300041512 Bacteria 2636
287 Ga0452268_38528 3300041907 Bacteria 1511
288 Ga0439432_013219 3300042006 Bacteria 2810
289 Ga0439449_0022025 3300042007 Bacteria 2385
290 Ga0439449_0086854 3300042007 Bacteria 1154
291 Ga0453684_0009469 3300044712 Bacteria 17035
292 Ga0495617_054991 3300046452 Bacteria 1321
293 Ga0495629_0019024 3300046459 Bacteria 4911
294 Ga0495638_0000300 3300046460 Bacteria 63643
295 Ga0495638_0014856 3300046460 Bacteria 5248
296 Ga0495638_0025826 3300046460 Bacteria 3814
297 Ga0495651_0066767 3300046462 Bacteria 2745
298 Ga0495605_0000998 3300046474 Bacteria 19122
299 Ga0495605_0036369 3300046474 Bacteria 2483
300 Ga0495662_0017093 3300046476 Bacteria 3511
301 Ga0495664_0058057 3300046477 Bacteria 2302
302 Ga0495585_0037288 3300046492 Bacteria 2738
303 Ga0495607_0073056 3300046501 Bacteria 1907
304 Ga0495583_0032155 3300046506 Bacteria 2535
305 Ga0495583_0044005 3300046506 Bacteria 2075
306 Ga0495606_0001142 3300046507 Bacteria 37680
307 Ga0495606_0048548 3300046507 Bacteria 2790
308 Ga0495608_0116000 3300046511 Bacteria 1719
309 Ga0495610_0022471 3300046512 Bacteria 3449
310 Ga0495616_0036507 3300046513 Bacteria 2535
311 Ga0495616_0080039 3300046513 Bacteria 1565
312 Ga0495620_0006745 3300046515 Bacteria 6279
313 Ga0495620_0022657 3300046515 Bacteria 3020
314 Ga0495631_0002311 3300046518 Bacteria 10861
315 Ga0495632_0008599 3300046519 Bacteria 6238
316 Ga0495632_0029795 3300046519 Bacteria 2838
317 Ga0495643_0018843 3300046522 Bacteria 3998
318 Ga0495643_0022292 3300046522 Bacteria 3616
319 Ga0495644_0047387 3300046523 Bacteria 1615
320 Ga0495652_0140687 3300046529 Bacteria 1898
321 Ga0495654_0005924 3300046530 Bacteria 7027
322 Ga0495587_0155622 3300046536 Bacteria 1302
323 Ga0495609_0014796 3300046538 Bacteria 3662
324 Ga0495609_0060177 3300046538 Bacteria 1679
325 Ga0495597_0025376 3300046542 Bacteria 2728
326 Ga0495633_0032451 3300046558 Bacteria 2523
327 Ga0495656_0053175 3300046615 Bacteria 1739
328 Ga0495668_0004998 3300046616 Bacteria 9163
329 Ga0495668_0028712 3300046616 Bacteria 3145
330 Ga0495611_0011812 3300046648 Bacteria 3706
331 Ga0495625_0008370 3300046660 Bacteria 8830
332 Ga0495625_0021355 3300046660 Bacteria 4986
333 Ga0495625_0023158 3300046660 Bacteria 4746
334 Ga0495635_0048244 3300046663 Bacteria 2936
335 Ga0495588_0019961 3300046674 Bacteria 3288
336 Ga0495657_0051262 3300046675 Bacteria 2771
337 Ga0495613_0131417 3300046689 Bacteria 1793
338 Ga0495624_0228488 3300046690 Bacteria 1127
339 Ga0495671_0041582 3300046692 Bacteria 2314
340 Ga0495649_0010942 3300046694 Bacteria 5344
341 Ga0495649_0030253 3300046694 Bacteria 2991
342 Ga0495600_0034660 3300046809 Bacteria 3277
343 Ga0495660_0015968 3300046810 Bacteria 4332
344 Ga0495604_0003714 3300047317 Bacteria 12160
345 Ga0495636_0006453 3300047318 Bacteria 4609
346 Ga0495672_0011865 3300047320 Bacteria 6118
347 Ga0495683_0069995 3300047323 Bacteria 1723
348 Ga0495687_116962 3300047443 Bacteria 969
349 Ga0495681_0000688 3300047470 Bacteria 25777
350 Ga0495681_0136781 3300047470 Bacteria 1038
351 Ga0495686_0000422 3300047472 Bacteria 66571
352 Ga0495686_0002120 3300047472 Bacteria 19433
353 Ga0495686_0027768 3300047472 Bacteria 3692
354 Ga0495686_0064325 3300047472 Bacteria 2271
355 Ga0495686_0143729 3300047472 Bacteria 1406
356 Ga0495602_0359792 3300048088 Bacteria 1048
357 Ga0495615_0008384 3300048090 Bacteria 1995
358 Ga0495626_0057492 3300048091 Bacteria 1779
359 Ga0496100_0358463 3300048903 Bacteria 1103
360 Ga0496104_0114639 3300048907 Bacteria 2585
361 Ga0496106_0000028 3300048909 Bacteria 143296
362 Ga0496113_0061214 3300048916 Bacteria 2840
363 Ga0496116_0000049 3300048919 Bacteria 314452
364 Ga0496116_0020205 3300048919 Bacteria 5065
365 Ga0496116_0041823 3300048919 Bacteria 3140
366 Ga0496116_0101314 3300048919 Bacteria 1720
367 Ga0496117_0000002 3300048920 Bacteria 2483758
368 Ga0496117_0001124 3300048920 Bacteria 40302
369 Ga0496117_0036587 3300048920 Bacteria 3671
370 Ga0496117_0097498 3300048920 Bacteria 1872
371 Ga0496118_0000759 3300048921 Bacteria 52080
372 Ga0496118_0003513 3300048921 Bacteria 19652
373 Ga0496118_0011225 3300048921 Bacteria 8770
374 Ga0496118_0015019 3300048921 Bacteria 7199
375 Ga0496118_0046582 3300048921 Bacteria 3371
376 Ga0496118_0083291 3300048921 Bacteria 2237
377 Ga0496119_0003324 3300048922 Bacteria 16773
378 Ga0496119_0011799 3300048922 Bacteria 7179
379 Ga0496119_0026727 3300048922 Bacteria 3991
380 Ga0496120_0000093 3300048923 Bacteria 146905
381 Ga0496120_0004706 3300048923 Bacteria 11250
382 Ga0496120_0048286 3300048923 Bacteria 2450
383 Ga0496120_0077123 3300048923 Bacteria 1814
384 Ga0496121_0000005 3300048924 Bacteria 1034486
385 Ga0496121_0000570 3300048924 Bacteria 69574
386 Ga0496121_0033662 3300048924 Bacteria 4632
387 Ga0496121_0186523 3300048924 Bacteria 1491
388 Ga0496121_0196021 3300048924 Bacteria 1444
389 Ga0496122_0000004 3300048925 Bacteria 645283
390 Ga0496122_0016047 3300048925 Bacteria 7117
391 Ga0496122_0027961 3300048925 Bacteria 4802
392 Ga0496122_0030501 3300048925 Bacteria 4517
393 Ga0496122_0066691 3300048925 Bacteria 2597
394 Ga0496123_0000007 3300048926 Bacteria 645283
395 Ga0496123_0031684 3300048926 Bacteria 3842
396 Ga0496124_0000091 3300048927 Bacteria 189706
397 Ga0496124_0006058 3300048927 Bacteria 13308
398 Ga0496124_0028541 3300048927 Bacteria 4990
399 Ga0496124_0049468 3300048927 Bacteria 3586
400 Ga0496124_0118925 3300048927 Bacteria 2114
401 Ga0496124_0268973 3300048927 Bacteria 1249
402 Ga0496124_0371616 3300048927 Bacteria 1003
403 Ga0496125_0000159 3300048928 Bacteria 151205
404 Ga0496125_0004359 3300048928 Bacteria 16404
405 Ga0496125_0030598 3300048928 Bacteria 4812
406 Ga0496125_0128119 3300048928 Bacteria 1793
407 Ga0496126_0000081 3300048929 Bacteria 218818
408 Ga0496126_0012281 3300048929 Bacteria 8789
409 Ga0496126_0045555 3300048929 Bacteria 4030
410 Ga0496126_0283502 3300048929 Bacteria 1371
411 Ga0495682_0080327 3300049460 Bacteria 1173
412 Ga0501032_0146820 3300049569 Bacteria 1552
413 Ga0501033_0051370 3300049570 Bacteria 3056
414 Ga0501034_0161912 3300049571 Bacteria 2208
415 Ga0501036_0015259 3300049572 Bacteria 6414
416 Ga0501037_0085812 3300049573 Bacteria 2279
417 Ga0501038_0185118 3300049574 Bacteria 1678
418 Ga0501043_0044713 3300049579 Bacteria 3482
419 Ga0501043_0129810 3300049579 Bacteria 1975
420 Ga0501047_0059512 3300049581 Bacteria 3688
421 Ga0501047_0061221 3300049581 Bacteria 3632
422 Ga0501073_0461324 3300049589 Bacteria 878
423 Ga0501080_0047331 3300049742 Bacteria 4003
424 Ga0501083_0040392 3300049744 Bacteria 3167
425 Ga0501083_0086468 3300049744 Bacteria 2073
426 Ga0501044_0031639 3300049823 Bacteria 5568
427 nmdc:mga03683_34324_c1 3300050489 Bacteria 2053
428 nmdc:mga03683_51438_c1 3300050489 Bacteria 1720
429 nmdc:mga03n38_68598_c1 3300050490 Bacteria 1635
430 nmdc:mga03n38_84311_c1 3300050490 Bacteria 1500
431 nmdc:mga00v17_19670_c1 3300050491 Bacteria 3860
432 nmdc:mga0yw44_154925_c1 3300050492 Bacteria 1497
433 nmdc:mga0yw44_213678_c1 3300050492 Bacteria 1276
434 nmdc:mga0yw44_3224_c1 3300050492 Bacteria 7187
435 nmdc:mga0yw44_431_c1 3300050492 Bacteria 14728
436 nmdc:mga0k408_127220_c1 3300050493 Bacteria 1512
437 nmdc:mga0k408_3813_c1 3300050493 Bacteria 7991
438 nmdc:mga06z11_102447_c1 3300050494 Bacteria 1573
439 nmdc:mga06z11_10978_c1 3300050494 Bacteria 3884
440 nmdc:mga04h51_39557_c1 3300050495 Bacteria 1532
441 nmdc:mga07m45_134482_c1 3300050496 Bacteria 1431
442 nmdc:mga07m45_38680_c1 3300050496 Bacteria 2663
443 nmdc:mga0sz30_25294_c1 3300050516 Bacteria 1803
444 nmdc:mga0sz30_2699_c1 3300050516 Bacteria 3389
445 nmdc:mga0sz30_26_c1 3300050516 Bacteria 59011
446 Ga0495655_0003456 3300053083 Bacteria 2609
447 Ga0500578_0063248 3300053086 Bacteria 2360
448 Ga0500650_0025695 3300053098 Bacteria 2635
449 Ga0500557_000894 3300053105 Bacteria 4400
450 Ga0500562_031322 3300053108 Bacteria 1403
451 Ga0500569_000971 3300053109 Bacteria 5165
452 Ga0500569_011125 3300053109 Bacteria 2140
453 Ga0500572_001165 3300053111 Bacteria 7574
454 Ga0500593_003321 3300053117 Bacteria 6055
455 Ga0500594_0001842 3300053118 Bacteria 4594
456 Ga0500594_0010520 3300053118 Bacteria 2149
457 Ga0500608_012503 3300053122 Bacteria 3725
458 Ga0500628_006682 3300053129 Bacteria 1956
459 Ga0500658_0001192 3300053134 Bacteria 10585
460 Ga0500658_0037330 3300053134 Bacteria 1932
461 Ga0500559_0009290 3300053136 Bacteria 4264
462 Ga0500561_0005831 3300053137 Bacteria 2315
463 Ga0500568_0001664 3300053139 Bacteria 13928
464 Ga0500568_0002341 3300053139 Bacteria 11225
465 Ga0500577_0010406 3300053142 Bacteria 2737
466 Ga0500590_005672 3300053148 Bacteria 6023
467 Ga0500604_0011839 3300053151 Bacteria 2349
468 Ga0500616_0000400 3300053153 Bacteria 59475
469 Ga0500616_0001502 3300053153 Bacteria 22017
470 Ga0500616_0040719 3300053153 Bacteria 2497
471 Ga0500622_0000593 3300053156 Bacteria 32900
472 Ga0500622_0003374 3300053156 Bacteria 10748
473 Ga0500622_0138141 3300053156 Bacteria 1165
474 Ga0500624_000600 3300053157 Bacteria 9838
475 Ga0500627_0043016 3300053158 Bacteria 1946
476 Ga0500627_0079345 3300053158 Bacteria 1462
477 Ga0500627_0133104 3300053158 Bacteria 1123
478 Ga0500633_0000975 3300053160 Bacteria 5042
479 Ga0500636_0000001 3300053177 Bacteria 324086
480 Ga0500636_0021680 3300053177 Bacteria 3803
481 Ga0500611_029383 3300053727 Bacteria 1125
482 Ga0500645_001087 3300053730 Bacteria 14925
483 Ga0500645_010175 3300053730 Bacteria 3125
484 Ga0500645_041416 3300053730 Bacteria 1360
485 Ga0500645_044187 3300053730 Bacteria 1311
486 Ga0501082_0149894 3300060353 Bacteria 2025
487 639649651 639633055 Bacteria 7751309
488 2509108994 2508501122 Bacteria 6292184
489 2509375284 2509276019 Bacteria 6802256
490 2509390098 2509276021 Bacteria 7634384
491 2509447615 2509276033 Bacteria 7180565
492 2510134447 2510065019 Bacteria 6903379
493 2510307169 2510065057 Bacteria 6649661
494 2510838947 2510461069 Bacteria 5505000
495 2510895872 2510461076 Bacteria 8618824
496 2511137331 2510917022 Bacteria 6504556
497 2511182803 2510917028 Bacteria 6185411
498 2511194864 2510917030 Bacteria 7460662
499 2511499038 2511231052 Bacteria 6974333
500 2512531637 2512047086 Bacteria 6850303
501 2512973007 2512875026 Bacteria 6861065
502 2513567440 2513237084 Bacteria 7231967
503 2513577776 2513237085 Bacteria 7695351
504 2513582400 2513237086 Bacteria 7265287
505 2513604411 2513237089 Bacteria 6553624
506 2513616104 2513237091 Bacteria 6900273
507 2513632077 2513237093 Bacteria 7545552
508 2513712453 2513237103 Bacteria 7647401
509 2513869758 2513237138 Bacteria 7368160
510 2513884694 2513237140 Bacteria 7076289
511 2513905089 2513237143 Bacteria 6664116
512 2513910557 2513237144 Bacteria 7530820
513 2513927999 2513237146 Bacteria 7166346
514 2514007111 2513237160 Bacteria 6650282
515 2514017823 2513237162 Bacteria 7468464
516 2515113609 2515075009 Bacteria 7288508
517 2515607458 2515154107 Bacteria 6795637
518 2515635322 2515154113 Bacteria 7807172
519 2515646066 2515154114 Bacteria 7848616
520 2515654860 2515154116 Bacteria 7552979
521 2515739966 2515154134 Bacteria 7220242
522 2516891587 2516653046 Bacteria 6989037
523 2517037224 2516653077 Bacteria 7555578
524 2517077563 2516653085 Bacteria 7346596
525 2517096333 2517093000 Bacteria 7412387
526 2517408191 2517287029 Bacteria 6905599
527 2517568375 2517487022 Bacteria 7227575
528 2520378474 2519899620 Bacteria 6499161
529 2524450804 2524023207 Bacteria 6813453
530 2524459103 2524023209 Bacteria 6679728
531 2530646311 2529292951 Bacteria 6916614
532 2537875859 2537561587 Bacteria 5425293
533 2551679987 2551306084 Bacteria 8942552
534 2551683658 2551306085 Bacteria 7347181
535 2551691638 2551306086 Bacteria 6843938
536 2551702798 2551306087 Bacteria 7351905
537 2551708725 2551306089 Bacteria 7162724
538 2551718114 2551306090 Bacteria 7953713
539 2551730292 2551306091 Bacteria 7086830
540 2551733866 2551306092 Bacteria 6992595
541 2551741150 2551306093 Bacteria 7064773
542 2554248624 2554235003 Bacteria 5877155
543 2558866372 2558860100 Bacteria 8458965
544 2559295712 2558860242 Bacteria 5568029
545 2585225171 2582581298 Bacteria 7315509
546 2585230762 2582581299 Bacteria 6518058
547 2585259280 2582581304 Bacteria 5831370
548 2585274070 2582581307 Bacteria 6597605
549 2585279528 2582581308 Bacteria 7413247
550 2585322812 2582581315 Bacteria 7318924
551 2585330982 2582581316 Bacteria 7774528
552 2585402853 2582581867 Bacteria 7184437
553 2585524991 2585427526 Bacteria 7258840
554 2585530988 2585427527 Bacteria 7273426
555 2585542707 2585427528 Bacteria 6842387
556 2585547727 2585427529 Bacteria 7395659
557 2585553091 2585427530 Bacteria 7383882
558 2585560520 2585427531 Bacteria 6992870
559 2585823485 2585427590 Bacteria 6824633
560 2585841349 2585427593 Bacteria 7141551
561 2585898713 2585427608 Bacteria 6544331
562 2585903698 2585427609 Bacteria 6667127
563 2587981183 2585428125 Bacteria 6662905
564 2599421010 2599185170 Bacteria 7295545
565 2599602036 2599185210 Bacteria 5624189
566 2601609713 2600255279 Bacteria 5605316
567 2601746488 2600255308 Bacteria 5611129
568 2616296576 2615840624 Bacteria 6557588
569 2616307102 2615840626 Bacteria 7921970
570 2616554706 2615840698 Bacteria 7319877
571 2617383058 2617270742 Bacteria 6808054
572 2643854596 2643221568 Bacteria 5187270
573 2643919969 2643221582 Bacteria 5804683
574 2644003010 2643221599 Bacteria 6292121
575 2644196748 2643221634 Bacteria 6705461
576 2644523321 2643221693 Bacteria 5513853
577 2671111942 2667528174 Bacteria 6435400
578 2719182323 2718217882 Bacteria 6556348
579 2719386914 2718217927 Bacteria 6972593
580 2719666650 2718217997 Bacteria 6740740
581 2719733039 2718218009 Bacteria 6478651
582 2720493070 2718218199 Bacteria 6740745
583 2720614548 2718218232 Bacteria 6720332
584 2720621322 2718218233 Bacteria 6662049
585 2720632648 2718218235 Bacteria 6630699
586 2720776372 2718218269 Bacteria 6906114
587 2721148436 2718218363 Bacteria 6524337
588 2721159822 2718218365 Bacteria 6274507
589 2721165250 2718218366 Bacteria 6425255
590 2721400637 2718218423 Bacteria 6438183
591 2722841420 2721755514 Bacteria 6424414
592 2723027961 2721755556 Bacteria 6745503
593 2723561591 2721755684 Bacteria 6859907
594 2723568220 2721755685 Bacteria 6704835
595 2724039450 2721755809 Bacteria 6438790
596 2724045795 2721755810 Bacteria 6479005
597 2724090979 2721755819 Bacteria 6906405
598 2724105485 2721755822 Bacteria 6726041
599 2724111310 2721755823 Bacteria 6752556
600 2725949289 2724679232 Bacteria 7646494
601 2730108897 2728369352 Bacteria 6745171
602 2730165558 2728369365 Bacteria 6555560
603 2730299454 2728369397 Bacteria 6274511
604 2739033313 2738541333 Bacteria 7106503
605 2753462706 2751185821 Bacteria 6189929
606 2766066361 2765235942 Bacteria 7445910
607 2776910490 2775507049 Bacteria 6284736
608 2778175777 2775507266 Bacteria 7392367
609 2792637812 2791355094 Bacteria 7011481
610 2793293940 2791355256 Bacteria 6798008
611 2793314386 2791355259 Bacteria 7254731
612 2793323872 2791355260 Bacteria 6598818
613 2793330156 2791355261 Bacteria 6661293
614 2793335035 2791355262 Bacteria 6774204
615 2793342378 2791355263 Bacteria 6872478
616 2793349746 2791355264 Bacteria 6429314
617 2793355397 2791355265 Bacteria 6539969
618 2793362103 2791355266 Bacteria 7116587
619 2793369957 2791355267 Bacteria 7222458
620 2802718574 2802428858 Bacteria 6636079
621 2802724255 2802428859 Bacteria 6667919
622 2802730083 2802428860 Bacteria 6525526
623 2802737426 2802428861 Bacteria 6534206
624 2802742342 2802428862 Bacteria 6633353
625 2802749025 2802428863 Bacteria 6410669
626 2805929612 2802429605 Bacteria 6875453
627 2805937304 2802429606 Bacteria 6346811
628 2806047445 2802429633 Bacteria 7341974
629 2806055204 2802429634 Bacteria 7083200
630 2806062652 2802429635 Bacteria 7650140
631 2806069720 2802429636 Bacteria 7597525
632 2806075649 2802429637 Bacteria 7067217
633 2808987553 2808606387 Bacteria 5697198
634 2819559430 2818991439 Bacteria 6907412
635 2819609834 2818991448 Bacteria 6772224
636 2819639939 2818991453 Bacteria 7181617
637 2838019858 2838016132 Bacteria 6577831
638 2838023364 2838022645 Bacteria 6494267
639 2838034058 2838029111 Bacteria 6603031
640 2838041370 2838035591 Bacteria 7166484
641 2838045692 2838042994 Bacteria 6046894
642 2838052666 2838048938 Bacteria 6044578
643 2838064924 2838061910 Bacteria 6794874
644 2838069652 2838068647 Bacteria 6208656
645 2838075082 2838074704 Bacteria 6785777
646 2838665762 2838661181 Bacteria 7385261
647 2838671846 2838668709 Bacteria 6671819
648 2838675394 2838675328 Bacteria 4909118
649 2838682950 2838680041 Bacteria 6545511
650 2838686558 2838686498 Bacteria 7807632
651 2838698107 2838694306 Bacteria 6853137
652 2838704525 2838701080 Bacteria 6669771
653 2838711221 2838707686 Bacteria 6619912
654 2838714275 2838714209 Bacteria 5525906
655 2838721923 2838719591 Bacteria 5523910
656 2838725036 2838724970 Bacteria 4908691
657 2838734800 2838729681 Bacteria 7400765
658 2838747415 2838742623 Bacteria 7396178
659 2841848903 2841846520 Bacteria 5345850
660 2841854387 2841851746 Bacteria 7532261
661 2841862572 2841859092 Bacteria 5436171
662 2841867466 2841864319 Bacteria 6742987
663 2842079398 2842077413 Bacteria 6508645
664 2842115496 2842110456 Bacteria 7656360
665 2842118093 2842118031 Bacteria 7033875
666 2842125066 2842124991 Bacteria 5346824
667 2842130289 2842130223 Bacteria 4909145
668 2842149743 2842146304 Bacteria 5957337
669 2842154541 2842152218 Bacteria 4908957
670 2842158594 2842156927 Bacteria 6894975
671 2842168960 2842163707 Bacteria 6916235
672 2842170518 2842170452 Bacteria 5525737
673 2842178161 2842175837 Bacteria 4908771
674 2842182208 2842180545 Bacteria 6888678
675 2842187384 2842187318 Bacteria 5524014
676 2842195553 2842192696 Bacteria 6147454
677 2842198878 2842198810 Bacteria 6608673
678 2842210874 2842205361 Bacteria 6340321
679 2842211695 2842211629 Bacteria 5523832
680 2842218439 2842217011 Bacteria 7497767
681 2842226685 2842224351 Bacteria 5524473
682 2842229792 2842229732 Bacteria 7475766
683 2842240006 2842237096 Bacteria 6620661
684 2842243681 2842243621 Bacteria 7421798
685 2842254090 2842250916 Bacteria 6579627
686 2842258234 2842257432 Bacteria 7401195
687 2842268985 2842264693 Bacteria 6472963
688 2842271904 2842271015 Bacteria 7807131
689 2842284328 2842278818 Bacteria 6340002
690 2842285114 2842285085 Bacteria 6011953
691 2842293059 2842291075 Bacteria 7076806
692 2842298456 2842298080 Bacteria 6123127
693 2842305516 2842304105 Bacteria 7023636
694 2842314238 2842311132 Bacteria 6616990
695 2842320040 2842317721 Bacteria 6793725
696 2842347563 2842341865 Bacteria 7003929
697 2842360468 2842357229 Bacteria 6485165
698 2842368787 2842363717 Bacteria 6844742
699 2842373579 2842370503 Bacteria 7038661
700 2842379456 2842377471 Bacteria 7140707
701 2842384603 2842384541 Bacteria 7057858
702 2842400505 2842395702 Bacteria 6780583
703 2842402472 2842402390 Bacteria 6681310
704 2842410157 2842409023 Bacteria 6687331
705 2842416805 2842415677 Bacteria 6596907
706 2842423266 2842422224 Bacteria 6239196
707 2842433093 2842428310 Bacteria 6767288
708 2842439398 2842434925 Bacteria 6502746
709 2842446027 2842441272 Bacteria 6769273
710 2842449055 2842447887 Bacteria 6754142
711 2842467368 2842462802 Bacteria 6588055
712 2842474163 2842469257 Bacteria 6752936
713 2842480774 2842475841 Bacteria 6603183
714 2842483623 2842482326 Bacteria 7212537
715 2842493418 2842489311 Bacteria 6620893
716 2842497570 2842495871 Bacteria 6820686
717 2842507415 2842502639 Bacteria 6604161
718 2842510485 2842509118 Bacteria 6850950
719 2842519356 2842515876 Bacteria 5436280
720 2844457856 2844454524 Bacteria 7952546
721 2850079651 2850079185 Bacteria 6848280
722 2852390909 2852387548 Bacteria 8025568
723 2855827950 2855825444 Bacteria 6785811
724 2855839707 2855839649 Bacteria 7135830
725 2857516929 2857516855 Bacteria 7787325
726 2858803599 2858800743 Bacteria 6603254
727 2896384792 2896384573 Bacteria 7700774
728 2899795745 2899792073 Bacteria 4926588
729 2899848942 2899845264 Bacteria 5672268
730 2913298224 2913295892 Bacteria 6333755
731 2915986499 2915980308 Bacteria 6624279
732 2915987646 2915986958 Bacteria 6739310
733 2915997269 2915993759 Bacteria 7016183
734 2916004675 2916000859 Bacteria 6865702
735 2916012071 2916007675 Bacteria 6898660
736 2916019062 2916014648 Bacteria 6946486
737 2916027949 2916021584 Bacteria 6854472
738 2916031518 2916028427 Bacteria 6748433
739 2916039418 2916035215 Bacteria 6755766
740 2916048280 2916041962 Bacteria 6820487
741 2916051976 2916048683 Bacteria 6543552
742 2916057069 2916055098 Bacteria 6758838
743 2916068297 2916061851 Bacteria 6737736
744 2916076386 2916068649 Bacteria 6943657
745 2916077872 2916076590 Bacteria 6596108
746 2919105677 2919100787 Bacteria 7710546
747 2919114306 2919114240 Bacteria 5700270
748 2919168933 2919166419 Bacteria 4952238
749 2919410445 2919408235 Bacteria 6149349
750 2920763660 2920760137 Bacteria 7427611
751 2921203736 2921201388 Bacteria 6926299
752 2921212355 2921208531 Bacteria 6745326
753 2921242759 2921237296 Bacteria 6876710
754 2921248993 2921244191 Bacteria 6568419
755 2921252653 2921250672 Bacteria 6677771
756 2921262732 2921257292 Bacteria 6808382
757 2921268815 2921263974 Bacteria 6864552
758 2921287005 2921282425 Bacteria 6826397
759 2921289799 2921289301 Bacteria 7316391
760 2921298629 2921296804 Bacteria 7176999
761 2923562018 2923556063 Bacteria 6793593
762 2924148879 2924144063 Bacteria 6883928
763 2924154326 2924150972 Bacteria 7169444
764 2924164644 2924158325 Bacteria 7188855
765 2924170794 2924165586 Bacteria 7260590
766 2924179248 2924172951 Bacteria 6749356
767 2924181134 2924179722 Bacteria 6843264
768 2924189436 2924186466 Bacteria 6876637
769 2924200187 2924193448 Bacteria 6955718
770 2924204656 2924200457 Bacteria 6757188
771 2924211733 2924207177 Bacteria 6917007
772 2924214650 2924214083 Bacteria 7080103
773 2924226405 2924221636 Bacteria 7113495
774 2924230038 2924228884 Bacteria 6633132
775 2926755326 2926754445 Bacteria 5964435
776 2926762436 2926760298 Bacteria 5505990
777 2929142905 2929138655 Bacteria 5810547
778 2933009186 2933006813 Bacteria 4912075
779 2933014473 2933011516 Bacteria 5439334
780 2933571323 2933570622 Bacteria 7023390
781 2933591911 2933586486 Bacteria 7667493
782 2933596223 2933594066 Bacteria 5594265
783 2933600458 2933599457 Bacteria 5858799
784 2935896510 2935894831 Bacteria 6620579
785 2935901402 2935901341 Bacteria 7341747
786 2936371548 2936367885 Bacteria 7324495
787 2936376919 2936375103 Bacteria 6652732
788 2936383491 2936381700 Bacteria 7006523
789 2936998556 2936996657 Bacteria 6298727
790 2937007462 2937002841 Bacteria 6934057
791 2937015578 2937009748 Bacteria 6746052
792 2937021365 2937016420 Bacteria 6782579
793 2937023473 2937023124 Bacteria 6815156
794 2937031592 2937029754 Bacteria 6424026
795 2937037724 2937036028 Bacteria 6846469
796 2937047393 2937042894 Bacteria 6741576
797 2937053248 2937049772 Bacteria 6757901
798 2937060786 2937056579 Bacteria 7107896
799 2937066776 2937063883 Bacteria 7199456
800 2937072807 2937071275 Bacteria 6984483
801 2937081719 2937078374 Bacteria 6610289
802 2937089411 2937084907 Bacteria 6618516
803 2937097062 2937091812 Bacteria 6979387
804 2937102801 2937098957 Bacteria 7249374
805 2937106515 2937106411 Bacteria 6947143
806 2937119374 2937113482 Bacteria 6505872
807 2937124296 2937119839 Bacteria 6597547
808 2937130876 2937126314 Bacteria 6771275
809 2957377805 2957375807 Bacteria 6425588
810 2957386461 2957382221 Bacteria 6737050
811 2957393280 2957388812 Bacteria 6778072
812 2957397590 2957395598 Bacteria 6822399
813 2957403400 2957402308 Bacteria 6741770
814 2957413421 2957408893 Bacteria 6558585
815 2957420851 2957415311 Bacteria 6991633
816 2957423585 2957422303 Bacteria 7172205
817 2957435918 2957430029 Bacteria 7022557
818 2957443279 2957437181 Bacteria 6568994
819 2957449250 2957443900 Bacteria 6869977
820 2957455647 2957450854 Bacteria 6765715
821 2957461867 2957457609 Bacteria 6967680
822 2957469420 2957464669 Bacteria 6568877
823 2957473226 2957471148 Bacteria 6797643
824 2957481880 2957478035 Bacteria 6756658
825 2957490984 2957484790 Bacteria 6703082
826 2957494030 2957491536 Bacteria 6695180
827 2957500767 2957498199 Bacteria 7126688
828 2957505907 2957505466 Bacteria 7253085
829 2960590436 2960584000 Bacteria 6864594
830 2960593362 2960591022 Bacteria 6622873
831 2960601247 2960597568 Bacteria 6550735
832 2960604350 2960603979 Bacteria 6898737
833 2960613303 2960610863 Bacteria 6691244
834 2960620127 2960617483 Bacteria 6727748
835 2960626230 2960624210 Bacteria 6875384
836 2960637148 2960631154 Bacteria 6732508
837 2960644144 2960637947 Bacteria 7296468
838 2960650390 2960645483 Bacteria 7211087
839 2960658890 2960652885 Bacteria 7083688
840 2960660681 2960660292 Bacteria 7041660
841 2960673047 2960667422 Bacteria 6763020
842 2960677720 2960674078 Bacteria 6609048
843 2960684607 2960680706 Bacteria 6624464
844 2960687401 2960687367 Bacteria 6535474
845 2960697473 2960693952 Bacteria 6749742
846 2964614786 2964607997 Bacteria 7101408
847 2964618328 2964615318 Bacteria 6809089
848 2964626601 2964621998 Bacteria 6834995
849 2964633376 2964628898 Bacteria 7083044
850 2964642263 2964636051 Bacteria 7091832
851 2964649811 2964643177 Bacteria 6820887
852 2964650046 2964649959 Bacteria 6675118
853 2964661674 2964656573 Bacteria 7100150
854 2964670247 2964663802 Bacteria 7019362
855 2964675752 2964670856 Bacteria 6851364
856 2964683601 2964678106 Bacteria 6792020
857 2964689840 2964685014 Bacteria 6839111
858 2964696179 2964691889 Bacteria 6802758
859 2964702854 2964698721 Bacteria 6765331
860 2964710731 2964705432 Bacteria 7114648
861 2964712988 2964712639 Bacteria 6695970
862 2964724399 2964719344 Bacteria 7286602
863 2967667512 2967664464 Bacteria 6948836
864 2967676838 2967671571 Bacteria 7021409
865 2967682593 2967678726 Bacteria 7264382
866 2967688123 2967686174 Bacteria 6678622
867 2967694801 2967693043 Bacteria 6804451
868 2967706914 2967699805 Bacteria 6854538
869 2967711502 2967706974 Bacteria 7186053
870 2967714395 2967714385 Bacteria 7000047
871 2967723719 2967721400 Bacteria 7073753
872 2967731133 2967728569 Bacteria 6641507
873 2967739145 2967735183 Bacteria 6827012
874 2967745732 2967742019 Bacteria 6794534
875 2967754559 2967748971 Bacteria 6733771
876 2967757246 2967755722 Bacteria 6814706
877 2967768775 2967762386 Bacteria 6923502
878 2967773767 2967769361 Bacteria 6587838
879 2967780048 2967775926 Bacteria 6738189
880 2970021234 2970019648 Bacteria 7072033
881 2970027325 2970026789 Bacteria 6785236
882 2970037480 2970033650 Bacteria 7118744
883 2970040995 2970040964 Bacteria 6731123
884 2970048159 2970047711 Bacteria 7088379
885 2970056952 2970054988 Bacteria 6611507
886 2970068339 2970061556 Bacteria 7099761
887 2970069186 2970068827 Bacteria 7123112
888 2970080466 2970076120 Bacteria 6697332
889 2970088086 2970082768 Bacteria 6183754
890 2970093737 2970088815 Bacteria 6933825
891 2970100803 2970095765 Bacteria 6936963
892 2970106085 2970102677 Bacteria 6812532
893 2970111543 2970109326 Bacteria 6863976
894 2970121378 2970116247 Bacteria 6501857
895 2970126138 2970122695 Bacteria 6625855
896 2970131299 2970129317 Bacteria 6806560
897 2970140811 2970136068 Bacteria 7207982
898 2970146322 2970143518 Bacteria 6446480
899 2970151880 2970149975 Bacteria 6779706
900 2970162607 2970156795 Bacteria 7168044
901 2970169574 2970164137 Bacteria 6861252
902 2970175699 2970170962 Bacteria 6876229
903 2970179388 2970177841 Bacteria 6768001
904 2970185657 2970184632 Bacteria 7054431
905 2970196576 2970191845 Bacteria 7032787
906 2977518296 2977516862 Bacteria 6940108
907 2977528444 2977523885 Bacteria 6960446
908 2977531094 2977530762 Bacteria 6951399
909 2977538514 2977537788 Bacteria 6929320
910 2977545836 2977544691 Bacteria 6875412
911 2977554718 2977551784 Bacteria 7125765
912 2977563350 2977558990 Bacteria 6863948
913 2977570072 2977565890 Bacteria 6901543
914 2977575584 2977572785 Bacteria 6763888
915 2977584319 2977579622 Bacteria 6772100
916 2978971630 2978969890 Bacteria 5400756
917 2979092293 2979089926 Bacteria 5670289
918 2979100318 2979095461 Bacteria 5669583
919 2979104281 2979100975 Bacteria 5423623
920 2984511139 2984509177 Bacteria 5274802
921 2984522499 2984518228 Bacteria 5277463
922 2984588772 2984587000 Bacteria 5263363
923 2984604158 2984601300 Bacteria 5455244
924 2996898131 2996893221 Bacteria 5823108
925 3005409314 3005409236 Bacteria 7188837
926 3005418722 3005416602 Bacteria 7064308
927 3005448916 3005445848 Bacteria 6906074
928 3005455146 3005452660 Bacteria 5889319
929 643824273 643692032 Bacteria 6891900
930 648736775 648276728 Bacteria 6968865
931 650740924 650716007 Bacteria 5573770
932 8003571997 8003570095 Bacteria 5747666
933 8003992178 8003992118 Bacteria 7266902
934 8003999457 8003999396 Bacteria 7063185
935 8005281728 8005275841 Bacteria 6929066
936 8005284316 8005282627 Bacteria 6675747
937 8005289568 8005289223 Bacteria 6634003
938 8005303635 8005301065 Bacteria 6614431
939 8005314152 8005307578 Bacteria 7395396
940 8005318386 8005314921 Bacteria 7072929
941 8005382608 8005376324 Bacteria 6590079
942 8005384570 8005382845 Bacteria 6732062
943 8005395598 8005395548 Bacteria 6806915
944 8005434446 8005430974 Bacteria 6689030
945 8005464295 8005460587 Bacteria 7157962
946 8005488730 8005484373 Bacteria 6297373
947 8005501398 8005497431 Bacteria 6477605
948 8005561709 8005556819 Bacteria 6908598
949 8005568488 8005563573 Bacteria 7153261
950 8005572976 8005570704 Bacteria 6957481
951 8005622761 8005619151 Bacteria 7030230
952 8005630275 8005626139 Bacteria 6534237
953 8005645888 8005645114 Bacteria 6950293
954 8005672818 8005668836 Bacteria 6953162
955 8005682433 8005682033 Bacteria 6726518
956 8005691585 8005688590 Bacteria 6610080
957 8005696719 8005695170 Bacteria 6912330
958 8018130653 8018127388 Bacteria 7351159
959 8018163270 8018163183 Bacteria 7277977
960 8018179031 8018176218 Bacteria 6896178
961 8023682678 8023680758 Bacteria 7729763
962 8024486035 8024479707 Bacteria 6954785
963 8024488527 8024486573 Bacteria 6540512
964 8024501114 8024501048 Bacteria 6427847
965 8046772544 8046767195 Bacteria 7547379
966 8054464715 8054460903 Bacteria 4872905
967 8056377093 8056375014 Bacteria 7006639
968 8056387415 8056382006 Bacteria 6408074
969 8057576998 8057575449 Bacteria 7367519
970 8057881848 8057874678 Bacteria 7494653
971 JGI24740J21852_10000564
972 JGI25155J39150_1000065
973 JGI25155J39150_1000098
974 JGI25156J39149_1000144
975 JGI25156J39149_1000163
976 JGI25154J39366_1000035
977 JGI25154J39366_1000183
978 JGI25158J39367_1000927
979 JGI25157J39369_1000209
980 JGI25157J39369_1001004
981 JGI25152J39213_1003227
982 JGI25152J39213_1010470
983 JGI25159J45721_1001556
984 JGI25159J45721_1004685
985 JGI25151J46595_10002096
986 JGI25151J46595_10005186
987 JGI25151J46595_10007415
988 JGI25151J46595_10009835
989 JGI25151J46595_10026849
990 JGI25153J46596_10006886
991 JGI25153J46596_10007510
992 JGI25153J46596_10011704
993 rootH1_10057687
994 rootH1_10074966
995 rootH2_10008438
996 rootH2_10008440
997 rootH2_10045333
998 rootL2_10016820
999 rootL2_10320304
1000 rootH1_10063714
1001 rootH1_10117136
1002 rootH1_10170367
1003 JGI25160J50197_1000001
1004 JGI25160J50197_1000212
1005 JGI25160J50197_1000917
1006 JGI25160J50197_1009247
1007 JGI25161J50226_1000047
1008 JGI25161J50226_1000151
1009 JGI25161J50226_1000238
1010 JGI25161J50226_1000331
1011 JGI25161J50226_1001587
1012 Ga0055526_1002806
1013 Ga0055526_1004625
1014 Ga0055526_1012519
1015 Ga0055526_1017186
1016 Ga0055537_1000709
1017 Ga0055524_1000082
1018 Ga0055524_1001237
1019 Ga0055524_1004997
1020 Ga0055524_1006292
1021 Ga0055524_1021578
1022 Ga0055536_1001960
1023 Ga0055534_1003222
1024 Ga0055534_1005336
1025 Ga0055534_1013334
1026 Ga0055528_1000525
1027 Ga0055528_1001182
1028 Ga0055528_1002394
1029 Ga0055528_1003139
1030 Ga0055528_1009964
1031 Ga0055528_1019332
1032 Ga0055528_1019744
1033 Ga0055530_10000688
1034 Ga0055530_10046368
1035 Ga0055540_1000010
1036 Ga0055540_1001376
1037 Ga0055540_1003377
1038 Ga0055531_10019143
1039 Ga0058692_1001275
1040 Ga0055543_1000007
1041 Ga0055543_1000419
1042 Ga0055543_1000526
1043 Ga0055543_1000646
1044 Ga0065165_1000357
1045 Ga0065165_1015536
1046 Ga0065165_1032167
1047 Ga0065165_1042739
1048 Ga0070670_100000560
1049 Ga0070669_100286700
1050 Ga0070664_100468505
1051 Ga0068854_100017336
1052 Ga0068856_100185206
1053 Ga0068852_100127814
1054 Ga0075365_10004644
1055 Ga0075365_10006669
1056 Ga0075368_10027051
1057 Ga0075363_100026618
1058 Ga0075364_10007185
1059 Ga0075364_10012908
1060 Ga0075362_10000300
1061 Ga0075362_10001572
1062 Ga0075362_10092379
1063 Ga0075367_10004384
1064 Ga0075367_10005561
1065 Ga0075367_10021211
1066 Ga0075369_10001899
1067 Ga0075369_10001967
1068 Ga0075369_10027942
1069 Ga0075369_10031219
1070 Ga0075369_10055396
1071 Ga0075366_10009357
1072 Ga0075366_10022758
1073 Ga0075366_10048190
1074 Ga0075370_10020155
1075 Ga0075370_10027128
1076 Ga0075370_10045619
1077 Ga0075370_10062684
1078 Ga0075370_10078416
1079 Ga0079104_1004704
1080 Ga0079104_1005831
1081 Ga0099826_10002615
1082 Ga0105240_10000014
1083 Ga0105243_10131709
1084 Ga0105237_10000770
1085 Ga0105238_10659264
1086 Ga0123341_1000011
1087 Ga0123342_1008752
1088 Ga0123342_1018063
1089 Ga0105239_10004243
1090 Ga0105239_10316635
1091 Ga0105246_10050655
1092 Ga0157373_10049545
1093 Ga0157373_10081630
1094 Ga0157373_10106668
1095 Ga0157371_10000966
1096 Ga0157371_10002118
1097 Ga0157370_10000015
1098 Ga0157370_10000338
1099 Ga0157369_10020309
1100 Ga0157372_10239097
1101 Ga0182008_10033845
1102 Ga0182007_10002096
1103 Ga0182005_1010891
1104 Ga0206355_1174415
1105 Ga0214544_1000105
1106 Ga0214542_1000029
1107 Ga0214543_1000027
1108 Ga0214543_1000040
1109 Ga0228711_1000013
1110 Ga0228710_1000008
1111 Ga0209435_100005
1112 Ga0209435_100010
1113 Ga0209436_100110
1114 Ga0209436_107364
1115 Ga0209672_103287
1116 Ga0209437_100058
1117 Ga0209437_100060
1118 Ga0207425_1001956
1119 Ga0207425_1001995
1120 Ga0207425_1013334
1121 Ga0209646_1000001
1122 Ga0209646_1000011
1123 Ga0209026_1000001
1124 Ga0209026_1000008
1125 Ga0209677_100781
1126 Ga0209148_1004917
1127 Ga0209759_1000001
1128 Ga0209759_1000004
1129 Ga0209129_1000226
1130 Ga0209129_1001492
1131 Ga0209129_1002108
1132 Ga0209129_1005143
1133 Ga0209129_1005786
1134 Ga0209129_1010068
1135 Ga0209129_1013977
1136 Ga0209233_1000137
1137 Ga0209565_1000036
1138 Ga0209565_1000226
1139 Ga0209455_1012080
1140 Ga0209673_1000239
1141 Ga0209673_1000282
1142 Ga0209673_1000478
1143 Ga0209673_1001495
1144 Ga0209673_1001737
1145 Ga0209673_1002506
1146 Ga0209673_1018821
1147 Ga0209130_1000023
1148 Ga0209130_1000042
1149 Ga0209130_1000145
1150 Ga0209130_1008226
1151 Ga0209130_1014063
1152 Ga0209130_1017324
1153 Ga0209675_1000289
1154 Ga0209675_1003625
1155 Ga0209676_1000007
1156 Ga0209676_1018097
1157 Ga0209025_1000288
1158 Ga0209025_1000411
1159 Ga0209025_1002347
1160 Ga0209025_1006388
1161 Ga0209025_1013965
1162 Ga0209025_1037708
1163 Ga0209025_1051255
1164 Ga0209025_1081354
1165 Ga0209564_1000259
1166 Ga0209564_1000393
1167 Ga0209564_1001326
1168 Ga0209564_1007458
1169 Ga0209564_1024341
1170 Ga0209564_1025207
1171 Ga0209564_1026301
1172 Ga0209758_1000390
1173 Ga0209758_1001594
1174 Ga0209758_1004703
1175 Ga0209758_1008994
1176 Ga0209758_1078594
1177 Ga0209050_1000003
1178 Ga0209050_1004120
1179 Ga0209050_1007028
1180 Ga0209050_1013661
1181 Ga0209256_1000001
1182 Ga0209256_1000155
1183 Ga0209256_1000619
1184 Ga0209256_1001902
1185 Ga0209256_1004144
1186 Ga0209256_1007631
1187 Ga0207426_1000011
1188 Ga0207426_1000087
1189 Ga0207426_1000097
1190 Ga0207426_1000386
1191 Ga0207426_1001878
1192 Ga0209051_1000003
1193 Ga0209051_1000321
1194 Ga0209051_1003739
1195 Ga0209051_1004393
1196 Ga0209051_1018086
1197 Ga0209257_1000020
1198 Ga0209257_1005878
1199 Ga0209257_1010077
1200 Ga0207695_10000037
1201 Ga0207671_10000080
1202 Ga0207681_10101055
1203 Ga0207650_10007237
1204 Ga0207709_10086633
1205 Ga0207640_10018330
1206 Ga0207702_10041321
1207 Ga0209281_1000134
1208 Ga0209281_1000783
1209 Ga0209371_1000022
1210 Ga0209371_1000370
1211 Ga0209371_1001191
1212 Ga0209282_1000029
1213 Ga0209282_1001507
1214 Ga0209813_10003505
1215 Ga0268266_10112087
1216 Ga0307515_10007465
1217 Ga0307515_10209541
1218 Ga0268256_1000019
1219 Ga0268256_1002822
1220 Ga0268256_1005648
1221 Ga0316181_1086484
1222 Ga0307513_10000011
1223 Ga0307513_10015921
1224 Ga0307513_10129858
1225 Ga0307408_100004501
1226 Ga0307408_100068413
1227 Ga0307408_100344065
1228 Ga0307405_10157461
1229 Ga0307406_10027924
1230 Ga0307412_10025014
1231 Ga0307412_10218606
1232 Ga0307412_10436561
1233 Ga0315914_1000021
1234 Ga0307409_100331407
1235 Ga0307409_100381438
1236 Ga0307414_10073553
1237 Ga0315913_1000014
1238 Ga0315915_1000003
1239 Ga0395905_0012601
1240 Ga0439465_0007062
1241 Ga0439465_0018167
1242 Ga0451787_279068
1243 Ga0451798_0814015
1244 Ga0451833_0644275
1245 Ga0451840_11731
1246 Ga0451841_0397021
1247 Ga0451841_1005621
1248 Ga0451845_0927883
1249 Ga0451845_0929104
1250 Ga0451846_05577
1251 Ga0451847_0008387
1252 Ga0451847_0691945
1253 Ga0451851_0548143
1254 Ga0451855_0189021
1255 Ga0451853_1500900
1256 Ga0451853_3538132
1257 Ga0452268_38528
1258 Ga0439432_013219
1259 Ga0439449_0022025
1260 Ga0439449_0086854
1261 Ga0453684_0009469
1262 Ga0495617_054991
1263 Ga0495629_0019024
1264 Ga0495638_0000300
1265 Ga0495638_0014856
1266 Ga0495638_0025826
1267 Ga0495651_0066767
1268 Ga0495605_0000998
1269 Ga0495605_0036369
1270 Ga0495662_0017093
1271 Ga0495664_0058057
1272 Ga0495585_0037288
1273 Ga0495607_0073056
1274 Ga0495583_0032155
1275 Ga0495583_0044005
1276 Ga0495606_0001142
1277 Ga0495606_0048548
1278 Ga0495608_0116000
1279 Ga0495610_0022471
1280 Ga0495616_0036507
1281 Ga0495616_0080039
1282 Ga0495620_0006745
1283 Ga0495620_0022657
1284 Ga0495631_0002311
1285 Ga0495632_0008599
1286 Ga0495632_0029795
1287 Ga0495643_0018843
1288 Ga0495643_0022292
1289 Ga0495644_0047387
1290 Ga0495652_0140687
1291 Ga0495654_0005924
1292 Ga0495587_0155622
1293 Ga0495609_0014796
1294 Ga0495609_0060177
1295 Ga0495597_0025376
1296 Ga0495633_0032451
1297 Ga0495656_0053175
1298 Ga0495668_0004998
1299 Ga0495668_0028712
1300 Ga0495611_0011812
1301 Ga0495625_0008370
1302 Ga0495625_0021355
1303 Ga0495625_0023158
1304 Ga0495635_0048244
1305 Ga0495588_0019961
1306 Ga0495657_0051262
1307 Ga0495613_0131417
1308 Ga0495624_0228488
1309 Ga0495671_0041582
1310 Ga0495649_0010942
1311 Ga0495649_0030253
1312 Ga0495600_0034660
1313 Ga0495660_0015968
1314 Ga0495604_0003714
1315 Ga0495636_0006453
1316 Ga0495672_0011865
1317 Ga0495683_0069995
1318 Ga0495687_116962
1319 Ga0495681_0000688
1320 Ga0495681_0136781
1321 Ga0495686_0000422
1322 Ga0495686_0002120
1323 Ga0495686_0027768
1324 Ga0495686_0064325
1325 Ga0495686_0143729
1326 Ga0495602_0359792
1327 Ga0495615_0008384
1328 Ga0495626_0057492
1329 Ga0496100_0358463
1330 Ga0496104_0114639
1331 Ga0496106_0000028
1332 Ga0496113_0061214
1333 Ga0496116_0000049
1334 Ga0496116_0020205
1335 Ga0496116_0041823
1336 Ga0496116_0101314
1337 Ga0496117_0000002
1338 Ga0496117_0001124
1339 Ga0496117_0036587
1340 Ga0496117_0097498
1341 Ga0496118_0000759
1342 Ga0496118_0003513
1343 Ga0496118_0011225
1344 Ga0496118_0015019
1345 Ga0496118_0046582
1346 Ga0496118_0083291
1347 Ga0496119_0003324
1348 Ga0496119_0011799
1349 Ga0496119_0026727
1350 Ga0496120_0000093
1351 Ga0496120_0004706
1352 Ga0496120_0048286
1353 Ga0496120_0077123
1354 Ga0496121_0000005
1355 Ga0496121_0000570
1356 Ga0496121_0033662
1357 Ga0496121_0186523
1358 Ga0496121_0196021
1359 Ga0496122_0000004
1360 Ga0496122_0016047
1361 Ga0496122_0027961
1362 Ga0496122_0030501
1363 Ga0496122_0066691
1364 Ga0496123_0000007
1365 Ga0496123_0031684
1366 Ga0496124_0000091
1367 Ga0496124_0006058
1368 Ga0496124_0028541
1369 Ga0496124_0049468
1370 Ga0496124_0118925
1371 Ga0496124_0268973
1372 Ga0496124_0371616
1373 Ga0496125_0000159
1374 Ga0496125_0004359
1375 Ga0496125_0030598
1376 Ga0496125_0128119
1377 Ga0496126_0000081
1378 Ga0496126_0012281
1379 Ga0496126_0045555
1380 Ga0496126_0283502
1381 Ga0495682_0080327
1382 Ga0501032_0146820
1383 Ga0501033_0051370
1384 Ga0501034_0161912
1385 Ga0501036_0015259
1386 Ga0501037_0085812
1387 Ga0501038_0185118
1388 Ga0501043_0044713
1389 Ga0501043_0129810
1390 Ga0501047_0059512
1391 Ga0501047_0061221
1392 Ga0501073_0461324
1393 Ga0501080_0047331
1394 Ga0501083_0040392
1395 Ga0501083_0086468
1396 Ga0501044_0031639
1397 nmdc:mga03683_34324_c1
1398 nmdc:mga03683_51438_c1
1399 nmdc:mga03n38_68598_c1
1400 nmdc:mga03n38_84311_c1
1401 nmdc:mga00v17_19670_c1
1402 nmdc:mga0yw44_154925_c1
1403 nmdc:mga0yw44_213678_c1
1404 nmdc:mga0yw44_3224_c1
1405 nmdc:mga0yw44_431_c1
1406 nmdc:mga0k408_127220_c1
1407 nmdc:mga0k408_3813_c1
1408 nmdc:mga06z11_102447_c1
1409 nmdc:mga06z11_10978_c1
1410 nmdc:mga04h51_39557_c1
1411 nmdc:mga07m45_134482_c1
1412 nmdc:mga07m45_38680_c1
1413 nmdc:mga0sz30_25294_c1
1414 nmdc:mga0sz30_2699_c1
1415 nmdc:mga0sz30_26_c1
1416 Ga0495655_0003456
1417 Ga0500578_0063248
1418 Ga0500650_0025695
1419 Ga0500557_000894
1420 Ga0500562_031322
1421 Ga0500569_000971
1422 Ga0500569_011125
1423 Ga0500572_001165
1424 Ga0500593_003321
1425 Ga0500594_0001842
1426 Ga0500594_0010520
1427 Ga0500608_012503
1428 Ga0500628_006682
1429 Ga0500658_0001192
1430 Ga0500658_0037330
1431 Ga0500559_0009290
1432 Ga0500561_0005831
1433 Ga0500568_0001664
1434 Ga0500568_0002341
1435 Ga0500577_0010406
1436 Ga0500590_005672
1437 Ga0500604_0011839
1438 Ga0500616_0000400
1439 Ga0500616_0001502
1440 Ga0500616_0040719
1441 Ga0500622_0000593
1442 Ga0500622_0003374
1443 Ga0500622_0138141
1444 Ga0500624_000600
1445 Ga0500627_0043016
1446 Ga0500627_0079345
1447 Ga0500627_0133104
1448 Ga0500633_0000975
1449 Ga0500636_0000001
1450 Ga0500636_0021680
1451 Ga0500611_029383
1452 Ga0500645_001087
1453 Ga0500645_010175
1454 Ga0500645_041416
1455 Ga0500645_044187
1456 Ga0501082_0149894
1457 639649651
1458 2509108994
1459 2509375284
1460 2509390098
1461 2509447615
1462 2510134447
1463 2510307169
1464 2510838947
1465 2510895872
1466 2511137331
1467 2511182803
1468 2511194864
1469 2511499038
1470 2512531637
1471 2512973007
1472 2513567440
1473 2513577776
1474 2513582400
1475 2513604411
1476 2513616104
1477 2513632077
1478 2513712453
1479 2513869758
1480 2513884694
1481 2513905089
1482 2513910557
1483 2513927999
1484 2514007111
1485 2514017823
1486 2515113609
1487 2515607458
1488 2515635322
1489 2515646066
1490 2515654860
1491 2515739966
1492 2516891587
1493 2517037224
1494 2517077563
1495 2517096333
1496 2517408191
1497 2517568375
1498 2520378474
1499 2524450804
1500 2524459103
1501 2530646311
1502 2537875859
1503 2551679987
1504 2551683658
1505 2551691638
1506 2551702798
1507 2551708725
1508 2551718114
1509 2551730292
1510 2551733866
1511 2551741150
1512 2554248624
1513 2558866372
1514 2559295712
1515 2585225171
1516 2585230762
1517 2585259280
1518 2585274070
1519 2585279528
1520 2585322812
1521 2585330982
1522 2585402853
1523 2585524991
1524 2585530988
1525 2585542707
1526 2585547727
1527 2585553091
1528 2585560520
1529 2585823485
1530 2585841349
1531 2585898713
1532 2585903698
1533 2587981183
1534 2599421010
1535 2599602036
1536 2601609713
1537 2601746488
1538 2616296576
1539 2616307102
1540 2616554706
1541 2617383058
1542 2643854596
1543 2643919969
1544 2644003010
1545 2644196748
1546 2644523321
1547 2671111942
1548 2719182323
1549 2719386914
1550 2719666650
1551 2719733039
1552 2720493070
1553 2720614548
1554 2720621322
1555 2720632648
1556 2720776372
1557 2721148436
1558 2721159822
1559 2721165250
1560 2721400637
1561 2722841420
1562 2723027961
1563 2723561591
1564 2723568220
1565 2724039450
1566 2724045795
1567 2724090979
1568 2724105485
1569 2724111310
1570 2725949289
1571 2730108897
1572 2730165558
1573 2730299454
1574 2739033313
1575 2753462706
1576 2766066361
1577 2776910490
1578 2778175777
1579 2792637812
1580 2793293940
1581 2793314386
1582 2793323872
1583 2793330156
1584 2793335035
1585 2793342378
1586 2793349746
1587 2793355397
1588 2793362103
1589 2793369957
1590 2802718574
1591 2802724255
1592 2802730083
1593 2802737426
1594 2802742342
1595 2802749025
1596 2805929612
1597 2805937304
1598 2806047445
1599 2806055204
1600 2806062652
1601 2806069720
1602 2806075649
1603 2808987553
1604 2819559430
1605 2819609834
1606 2819639939
1607 2838019858
1608 2838023364
1609 2838034058
1610 2838041370
1611 2838045692
1612 2838052666
1613 2838064924
1614 2838069652
1615 2838075082
1616 2838665762
1617 2838671846
1618 2838675394
1619 2838682950
1620 2838686558
1621 2838698107
1622 2838704525
1623 2838711221
1624 2838714275
1625 2838721923
1626 2838725036
1627 2838734800
1628 2838747415
1629 2841848903
1630 2841854387
1631 2841862572
1632 2841867466
1633 2842079398
1634 2842115496
1635 2842118093
1636 2842125066
1637 2842130289
1638 2842149743
1639 2842154541
1640 2842158594
1641 2842168960
1642 2842170518
1643 2842178161
1644 2842182208
1645 2842187384
1646 2842195553
1647 2842198878
1648 2842210874
1649 2842211695
1650 2842218439
1651 2842226685
1652 2842229792
1653 2842240006
1654 2842243681
1655 2842254090
1656 2842258234
1657 2842268985
1658 2842271904
1659 2842284328
1660 2842285114
1661 2842293059
1662 2842298456
1663 2842305516
1664 2842314238
1665 2842320040
1666 2842347563
1667 2842360468
1668 2842368787
1669 2842373579
1670 2842379456
1671 2842384603
1672 2842400505
1673 2842402472
1674 2842410157
1675 2842416805
1676 2842423266
1677 2842433093
1678 2842439398
1679 2842446027
1680 2842449055
1681 2842467368
1682 2842474163
1683 2842480774
1684 2842483623
1685 2842493418
1686 2842497570
1687 2842507415
1688 2842510485
1689 2842519356
1690 2844457856
1691 2850079651
1692 2852390909
1693 2855827950
1694 2855839707
1695 2857516929
1696 2858803599
1697 2896384792
1698 2899795745
1699 2899848942
1700 2913298224
1701 2915986499
1702 2915987646
1703 2915997269
1704 2916004675
1705 2916012071
1706 2916019062
1707 2916027949
1708 2916031518
1709 2916039418
1710 2916048280
1711 2916051976
1712 2916057069
1713 2916068297
1714 2916076386
1715 2916077872
1716 2919105677
1717 2919114306
1718 2919168933
1719 2919410445
1720 2920763660
1721 2921203736
1722 2921212355
1723 2921242759
1724 2921248993
1725 2921252653
1726 2921262732
1727 2921268815
1728 2921287005
1729 2921289799
1730 2921298629
1731 2923562018
1732 2924148879
1733 2924154326
1734 2924164644
1735 2924170794
1736 2924179248
1737 2924181134
1738 2924189436
1739 2924200187
1740 2924204656
1741 2924211733
1742 2924214650
1743 2924226405
1744 2924230038
1745 2926755326
1746 2926762436
1747 2929142905
1748 2933009186
1749 2933014473
1750 2933571323
1751 2933591911
1752 2933596223
1753 2933600458
1754 2935896510
1755 2935901402
1756 2936371548
1757 2936376919
1758 2936383491
1759 2936998556
1760 2937007462
1761 2937015578
1762 2937021365
1763 2937023473
1764 2937031592
1765 2937037724
1766 2937047393
1767 2937053248
1768 2937060786
1769 2937066776
1770 2937072807
1771 2937081719
1772 2937089411
1773 2937097062
1774 2937102801
1775 2937106515
1776 2937119374
1777 2937124296
1778 2937130876
1779 2957377805
1780 2957386461
1781 2957393280
1782 2957397590
1783 2957403400
1784 2957413421
1785 2957420851
1786 2957423585
1787 2957435918
1788 2957443279
1789 2957449250
1790 2957455647
1791 2957461867
1792 2957469420
1793 2957473226
1794 2957481880
1795 2957490984
1796 2957494030
1797 2957500767
1798 2957505907
1799 2960590436
1800 2960593362
1801 2960601247
1802 2960604350
1803 2960613303
1804 2960620127
1805 2960626230
1806 2960637148
1807 2960644144
1808 2960650390
1809 2960658890
1810 2960660681
1811 2960673047
1812 2960677720
1813 2960684607
1814 2960687401
1815 2960697473
1816 2964614786
1817 2964618328
1818 2964626601
1819 2964633376
1820 2964642263
1821 2964649811
1822 2964650046
1823 2964661674
1824 2964670247
1825 2964675752
1826 2964683601
1827 2964689840
1828 2964696179
1829 2964702854
1830 2964710731
1831 2964712988
1832 2964724399
1833 2967667512
1834 2967676838
1835 2967682593
1836 2967688123
1837 2967694801
1838 2967706914
1839 2967711502
1840 2967714395
1841 2967723719
1842 2967731133
1843 2967739145
1844 2967745732
1845 2967754559
1846 2967757246
1847 2967768775
1848 2967773767
1849 2967780048
1850 2970021234
1851 2970027325
1852 2970037480
1853 2970040995
1854 2970048159
1855 2970056952
1856 2970068339
1857 2970069186
1858 2970080466
1859 2970088086
1860 2970093737
1861 2970100803
1862 2970106085
1863 2970111543
1864 2970121378
1865 2970126138
1866 2970131299
1867 2970140811
1868 2970146322
1869 2970151880
1870 2970162607
1871 2970169574
1872 2970175699
1873 2970179388
1874 2970185657
1875 2970196576
1876 2977518296
1877 2977528444
1878 2977531094
1879 2977538514
1880 2977545836
1881 2977554718
1882 2977563350
1883 2977570072
1884 2977575584
1885 2977584319
1886 2978971630
1887 2979092293
1888 2979100318
1889 2979104281
1890 2984511139
1891 2984522499
1892 2984588772
1893 2984604158
1894 2996898131
1895 3005409314
1896 3005418722
1897 3005448916
1898 3005455146
1899 643824273
1900 648736775
1901 650740924
1902 8003571997
1903 8003992178
1904 8003999457
1905 8005281728
1906 8005284316
1907 8005289568
1908 8005303635
1909 8005314152
1910 8005318386
1911 8005382608
1912 8005384570
1913 8005395598
1914 8005434446
1915 8005464295
1916 8005488730
1917 8005501398
1918 8005561709
1919 8005568488
1920 8005572976
1921 8005622761
1922 8005630275
1923 8005645888
1924 8005672818
1925 8005682433
1926 8005691585
1927 8005696719
1928 8018130653
1929 8018163270
1930 8018179031
1931 8023682678
1932 8024486035
1933 8024488527
1934 8024501114
1935 8046772544
1936 8054464715
1937 8056377093
1938 8056387415
1939 8057576998
1940 8057881848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

78

275

0.91

PF20434

BD-FAE

BD-FAE

64

186

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aim-assembly1.cif.gz_A r267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii 0.8674 4 268
3aik-assembly1.cif.gz_A crystal structure of a hsl-like carboxylesterase from sulfolobus tokodaii 0.8458 4 268
4ob7-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant w187h 0.8444 2 270
4ob8-assembly1.cif.gz_A-2 crystal structure of a novel thermostable esterase from pseudomonas putida ecu1011 0.8444 2 270
4ou5-assembly1.cif.gz_A crystal structure of esterase rppe mutant s159a/w187h 0.8433 2 270
ID Description Score Start End Superfamily
3aikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8458 4 268 3.40.50.1820
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8444 2 270 3.40.50.1820
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8386 2 270 3.40.50.1820
5jd4D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8371 1 266 3.40.50.1820
3wj2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8332 1 268 3.40.50.1820
ID Description Score Start End GO Terms
AF-F7U5Z8-F1-model_v4 deleted 0.9518 35 270
AF-F7U5Z8-F1-model_v4 deleted 0.9438 35 270
AF-A0A4Q3YDS7-F1-model_v4 Alpha/beta hydrolase 0.9334 180 269 GO:0016787
AF-A0A7G6RUS5-F1-model_v4 deleted 0.9311 51 270
AF-A0A1M3ANF6-F1-model_v4 deleted 0.9262 1 269

Map