F487113

General Info

Members Datasets Scaffolds Average Seq Length
971 554 1943 291

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100096892|Ga0070659_1000968921
Length 322
Sequence MVSRLRGNDTLDKDDCMATSLNLGFIGLGIMGAPMAGHLIKAGHKLFVHTHGELPAEIASTSATPCASGREVAQRADIVFLMVPDTPDVESVLFAENGVAAGLTKGKTVVDMSSISPLATKAFAKRIEALGCDYLDAPVSGGEVGAKAGSLTIMVGGPQAAFDKVRPLFELMGKNITLVGGVGDGQTCKVANQIIVALNIAAVGEALVFASKAGADPAKVRQALMGGFASSRILEVHGERMIKRTFEPGFRIRLHQKDLALALAGARELGVALPNTANAAQLMQTCAANGLADLDHSALVRALEIMADHEVQAPSPAGKGRG

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
247 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
248 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
249 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
250 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
251 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
252 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
253 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
254 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
255 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
258 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
259 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
317 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
318 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
340 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
341 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
342 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
345 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
350 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
361 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
362 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
383 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
384 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
385 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
386 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
387 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
395 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
396 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
397 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
398 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
399 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
400 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
401 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
402 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
403 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
404 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
405 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
406 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
407 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
408 2643221660 Methylibium sp. Root1272 Isolate Unclassified
409 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
410 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
411 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
412 2738543013 Variovorax sp. BT01 Isolate Unclassified
413 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
414 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
415 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
416 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
417 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
418 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
419 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
420 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
421 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
422 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
423 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
424 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
425 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
426 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
427 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
428 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
429 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
430 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
431 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
432 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
433 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
434 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
435 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
436 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
437 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
438 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
439 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
440 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
441 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
442 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
443 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
444 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
445 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
446 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
447 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
448 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
449 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
450 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
451 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
452 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
453 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
454 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
455 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
456 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
457 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
458 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
459 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
460 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
461 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
462 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
463 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
464 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
465 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
466 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
467 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
468 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
469 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
470 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
471 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
472 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
473 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
474 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
475 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
476 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
477 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
478 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
479 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
480 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
481 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
482 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
483 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
484 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
485 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
486 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
487 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
488 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
489 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
490 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
491 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
492 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
493 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
494 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
495 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
496 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
497 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
498 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
499 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
500 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
501 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
502 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
503 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
504 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
505 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
506 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
507 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
508 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
509 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
510 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
511 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
512 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
513 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
514 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
515 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
516 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
517 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
518 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
519 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
520 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
521 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
522 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
523 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
524 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
525 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
526 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
527 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
528 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
529 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
530 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
531 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
532 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
533 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
534 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
535 3004167301 Mesorhizobium loti 582 Isolate Unclassified
536 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
537 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
538 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
539 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
540 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
541 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
542 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
543 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
544 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
545 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
546 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
547 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
548 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
549 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
550 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
551 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
552 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
553 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
554 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.8
Metatranscriptomes 0.72
Isolates 16.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 14.83
Rhizoplane 2.99
Rhizosphere 69.52
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100096892 3300005366 Bacteria 2370
2 JGI25152J39213_1003114 3300002773 Bacteria 5794
3 JGI25159J45721_1000313 3300002987 Bacteria 22625
4 JGI25165J46597_1000076 3300003214 Bacteria 179537
5 rootH1_10006788 3300003316 Bacteria 3516
6 rootH1_10006788 3300003323 Bacteria 14904
7 rootH2_10062461 3300003320 Bacteria 10467
8 rootH1_10001121 3300003323 Bacteria 9905
9 JGI25160J50197_1000226 3300003354 Bacteria 44500
10 JGI25160J50197_1023160 3300003354 Bacteria 1801
11 JGI25161J50226_1000037 3300003374 Bacteria 133331
12 JGI26138J51218_100778 3300003504 Bacteria 1199
13 Ga0055524_1005357 3300003775 Bacteria 5746
14 Ga0055528_1001938 3300003790 Bacteria 11738
15 Ga0055543_1000708 3300004625 Bacteria 16941
16 Ga0055543_1010893 3300004625 Bacteria 1886
17 Ga0065165_1000248 3300005262 Bacteria 93216
18 Ga0065165_1000608 3300005262 Bacteria 52133
19 Ga0065165_1009335 3300005262 Bacteria 4413
20 Ga0065165_1009879 3300005262 Bacteria 4208
21 Ga0065712_10068036 3300005290 Bacteria 16427
22 Ga0065712_10087842 3300005290 Unclassified 2552
23 Ga0065707_10002804 3300005295 Bacteria 6819
24 Ga0070658_10055449 3300005327 Bacteria 3220
25 Ga0070658_10063877 3300005327 Bacteria 3002
26 Ga0070676_10003450 3300005328 Bacteria 8243
27 Ga0070676_10019078 3300005328 Bacteria 3811
28 Ga0070676_10028370 3300005328 Bacteria 3179
29 Ga0070676_10033704 3300005328 Bacteria 2938
30 Ga0070676_10039991 3300005328 Bacteria 2714
31 Ga0070683_100093887 3300005329 Bacteria 2819
32 Ga0070683_100282736 3300005329 Bacteria 1578
33 Ga0070683_100473792 3300005329 Bacteria 1195
34 Ga0070690_100010864 3300005330 Bacteria 5311
35 Ga0070690_100178382 3300005330 Bacteria 1466
36 Ga0070670_100005073 3300005331 Bacteria 11074
37 Ga0070670_100149299 3300005331 Bacteria 2023
38 Ga0070677_10042156 3300005333 Bacteria 1806
39 Ga0070677_10061429 3300005333 Bacteria 1551
40 Ga0068869_100007131 3300005334 Bacteria 7121
41 Ga0068869_100019096 3300005334 Bacteria 4677
42 Ga0068869_100022810 3300005334 Bacteria 4317
43 Ga0068869_100073064 3300005334 Bacteria 2543
44 Ga0070666_10261657 3300005335 Bacteria 1227
45 Ga0068868_100001782 3300005338 Bacteria 14769
46 Ga0068868_100003524 3300005338 Bacteria 10904
47 Ga0068868_100080240 3300005338 Bacteria 2614
48 Ga0068868_100085365 3300005338 Bacteria 2537
49 Ga0068868_100132224 3300005338 Bacteria 2042
50 Ga0068868_100220568 3300005338 Bacteria 1587
51 Ga0070689_100011360 3300005340 Bacteria 6377
52 Ga0070687_100039628 3300005343 Bacteria 2369
53 Ga0070687_100043617 3300005343 Bacteria 2280
54 Ga0070661_100000421 3300005344 Bacteria 32488
55 Ga0070661_100035098 3300005344 Bacteria 3640
56 Ga0070661_100380526 3300005344 Bacteria 1112
57 Ga0070668_100110947 3300005347 Bacteria 2183
58 Ga0070669_100030633 3300005353 Bacteria 3883
59 Ga0070675_100000866 3300005354 Bacteria 21542
60 Ga0070675_100014161 3300005354 Bacteria 6286
61 Ga0070675_100035964 3300005354 Bacteria 4027
62 Ga0070675_100057719 3300005354 Bacteria 3201
63 Ga0070675_100115405 3300005354 Bacteria 2276
64 Ga0070675_100118730 3300005354 Bacteria 2245
65 Ga0070675_100230740 3300005354 Bacteria 1615
66 Ga0070671_100004656 3300005355 Bacteria 10880
67 Ga0070671_100021651 3300005355 Bacteria 5251
68 Ga0070671_100035031 3300005355 Bacteria 4158
69 Ga0070671_100202982 3300005355 Bacteria 1681
70 Ga0070671_100207754 3300005355 Bacteria 1660
71 Ga0070671_100313214 3300005355 Bacteria 1337
72 Ga0070674_100050214 3300005356 Bacteria 2871
73 Ga0070674_100064160 3300005356 Bacteria 2573
74 Ga0070674_100228301 3300005356 Bacteria 1451
75 Ga0070673_100008291 3300005364 Bacteria 6904
76 Ga0070673_100079739 3300005364 Bacteria 2651
77 Ga0070673_100083110 3300005364 Bacteria 2601
78 Ga0070673_100128333 3300005364 Bacteria 2124
79 Ga0070673_100175005 3300005364 Unclassified 1834
80 Ga0070673_100408404 3300005364 Bacteria 1215
81 Ga0070688_100182474 3300005365 Bacteria 1457
82 Ga0070659_100001131 3300005366 Bacteria 19448
83 Ga0070659_100153310 3300005366 Bacteria 1881
84 Ga0070667_100002208 3300005367 Bacteria 17125
85 Ga0070667_100049104 3300005367 Bacteria 3553
86 Ga0070667_100152617 3300005367 Bacteria 2030
87 Ga0070709_10016715 3300005434 Unclassified 4195
88 Ga0070714_100000239 3300005435 Bacteria 42937
89 Ga0070714_100010965 3300005435 Bacteria 7179
90 Ga0070714_100171347 3300005435 Bacteria 1970
91 Ga0070713_100189149 3300005436 Bacteria 1854
92 Ga0070710_10005098 3300005437 Bacteria 6215
93 Ga0070710_10033872 3300005437 Bacteria 2776
94 Ga0070710_10155154 3300005437 Bacteria 1415
95 Ga0070711_100104617 3300005439 Bacteria 2065
96 Ga0070711_100285285 3300005439 Bacteria 1308
97 Ga0070711_100331649 3300005439 Unclassified 1218
98 Ga0070694_100046946 3300005444 Bacteria 2901
99 Ga0070708_100136925 3300005445 Bacteria 2269
100 Ga0070663_100097108 3300005455 Bacteria 2193
101 Ga0070663_100205385 3300005455 Bacteria 1540
102 Ga0070663_100388252 3300005455 Bacteria 1138
103 Ga0070678_100001312 3300005456 Bacteria 13199
104 Ga0070678_100015658 3300005456 Bacteria 4827
105 Ga0070678_100063793 3300005456 Bacteria 2728
106 Ga0070678_100160161 3300005456 Bacteria 1822
107 Ga0070678_100204366 3300005456 Bacteria 1632
108 Ga0070678_100324138 3300005456 Bacteria 1316
109 Ga0070662_100003497 3300005457 Bacteria 9797
110 Ga0068867_100021425 3300005459 Bacteria 4612
111 Ga0068867_100031464 3300005459 Bacteria 3831
112 Ga0068867_100059695 3300005459 Bacteria 2827
113 Ga0068867_100089619 3300005459 Bacteria 2333
114 Ga0068867_100116787 3300005459 Bacteria 2057
115 Ga0070699_100447116 3300005518 Bacteria 1171
116 Ga0070684_100138009 3300005535 Bacteria 2203
117 Ga0070697_100076610 3300005536 Bacteria 2750
118 Ga0070672_100002150 3300005543 Bacteria 12437
119 Ga0070672_100008361 3300005543 Bacteria 7075
120 Ga0070672_100013213 3300005543 Bacteria 5824
121 Ga0070672_100084137 3300005543 Bacteria 2554
122 Ga0070672_100164979 3300005543 Bacteria 1840
123 Ga0070672_100181641 3300005543 Bacteria 1753
124 Ga0070672_100282199 3300005543 Bacteria 1404
125 Ga0070686_100453656 3300005544 Bacteria 986
126 Ga0070665_100048226 3300005548 Bacteria 4276
127 Ga0068855_100017631 3300005563 Bacteria 8586
128 Ga0070664_100001426 3300005564 Bacteria 19072
129 Ga0070664_100106351 3300005564 Bacteria 2444
130 Ga0070664_100192032 3300005564 Bacteria 1820
131 Ga0070664_100490371 3300005564 Bacteria 1131
132 Ga0068857_100062734 3300005577 Bacteria 3304
133 Ga0068857_100094213 3300005577 Bacteria 2681
134 Ga0068854_100085085 3300005578 Bacteria 2341
135 Ga0068856_100292701 3300005614 Bacteria 1645
136 Ga0068856_100339202 3300005614 Bacteria 1521
137 Ga0068852_100070622 3300005616 Bacteria 3064
138 Ga0068852_100093258 3300005616 Bacteria 2698
139 Ga0068852_100119591 3300005616 Bacteria 2409
140 Ga0068852_100145428 3300005616 Bacteria 2198
141 Ga0068859_100003928 3300005617 Bacteria 15180
142 Ga0068859_100123572 3300005617 Bacteria 2656
143 Ga0068859_100395883 3300005617 Bacteria 1477
144 Ga0068864_100002466 3300005618 Bacteria 15271
145 Ga0068864_100021034 3300005618 Bacteria 5463
146 Ga0068864_100038973 3300005618 Bacteria 4060
147 Ga0068864_100059686 3300005618 Bacteria 3300
148 Ga0068864_100095122 3300005618 Bacteria 2634
149 Ga0068864_100320878 3300005618 Bacteria 1455
150 Ga0068861_100006231 3300005719 Bacteria 8115
151 Ga0068861_100044512 3300005719 Bacteria 3338
152 Ga0068851_10032364 3300005834 Bacteria 2602
153 Ga0068851_10046404 3300005834 Bacteria 2197
154 Ga0068863_100002188 3300005841 Bacteria 19393
155 Ga0068863_100047716 3300005841 Bacteria 4062
156 Ga0068863_100258187 3300005841 Bacteria 1684
157 Ga0068863_100261003 3300005841 Bacteria 1675
158 Ga0068863_100460737 3300005841 Bacteria 1248
159 Ga0068858_100013210 3300005842 Bacteria 7779
160 Ga0068858_100014936 3300005842 Bacteria 7306
161 Ga0068858_100024392 3300005842 Bacteria 5635
162 Ga0068860_100063283 3300005843 Bacteria 3514
163 Ga0068860_100084462 3300005843 Bacteria 3020
164 Ga0068862_100052915 3300005844 Bacteria 3475
165 Ga0068862_100081613 3300005844 Bacteria 2805
166 Ga0081455_10009631 3300005937 Bacteria 9920
167 Ga0081538_10044446 3300005981 Bacteria 2770
168 Ga0081539_10036751 3300005985 Bacteria 2926
169 Ga0070717_10047833 3300006028 Unclassified 3506
170 Ga0070717_10328904 3300006028 Bacteria 1363
171 Ga0070715_10039192 3300006163 Bacteria 1972
172 Ga0070712_100037571 3300006175 Bacteria 3302
173 Ga0070712_100120911 3300006175 Unclassified 1970
174 Ga0070712_100203204 3300006175 Bacteria 1558
175 Ga0075362_10015121 3300006177 Bacteria 3133
176 Ga0075367_10033175 3300006178 Bacteria 2975
177 Ga0075367_10193444 3300006178 Bacteria 1269
178 Ga0075366_10000654 3300006195 Bacteria 16309
179 Ga0075366_10000689 3300006195 Bacteria 15998
180 Ga0075366_10041951 3300006195 Bacteria 2709
181 Ga0075366_10054506 3300006195 Bacteria 2375
182 Ga0075366_10153331 3300006195 Bacteria 1395
183 Ga0097621_100048992 3300006237 Bacteria 3430
184 Ga0097621_100051212 3300006237 Bacteria 3359
185 Ga0097621_100149573 3300006237 Bacteria 2002
186 Ga0097621_100566377 3300006237 Bacteria 1035
187 Ga0068871_100036324 3300006358 Bacteria 3922
188 Ga0068871_100084672 3300006358 Bacteria 2631
189 Ga0068871_100090227 3300006358 Bacteria 2552
190 Ga0068871_100133339 3300006358 Bacteria 2108
191 Ga0068871_100231330 3300006358 Bacteria 1604
192 Ga0068871_100296293 3300006358 Bacteria 1418
193 Ga0075431_100195429 3300006847 Bacteria 2071
194 Ga0075433_10016698 3300006852 Bacteria 6060
195 Ga0075429_100001716 3300006880 Bacteria 18124
196 Ga0075429_100122924 3300006880 Bacteria 2269
197 Ga0068865_100029455 3300006881 Bacteria 3643
198 Ga0097620_100003928 3300006931 Bacteria 15180
199 Ga0097620_100123572 3300006931 Bacteria 2656
200 Ga0097620_100395902 3300006931 Bacteria 1477
201 Ga0075435_100283287 3300007076 Bacteria 1415
202 Ga0105251_10014736 3300009011 Bacteria 4305
203 Ga0105240_10215261 3300009093 Bacteria 2242
204 Ga0105240_10220319 3300009093 Bacteria 2211
205 Ga0111539_10262996 3300009094 Bacteria 2008
206 Ga0105245_10007672 3300009098 Bacteria 9449
207 Ga0105245_10377354 3300009098 Bacteria 1411
208 Ga0114129_10017649 3300009147 Bacteria 10160
209 Ga0114129_10106146 3300009147 Unclassified 3880
210 Ga0105241_10457472 3300009174 Bacteria 1130
211 Ga0105242_10160194 3300009176 Bacteria 1969
212 Ga0105242_10162634 3300009176 Bacteria 1955
213 Ga0105242_10394126 3300009176 Bacteria 1290
214 Ga0105248_10028618 3300009177 Bacteria 6210
215 Ga0105248_10033661 3300009177 Bacteria 5725
216 Ga0105248_10056309 3300009177 Bacteria 4412
217 Ga0105248_10163982 3300009177 Bacteria 2506
218 Ga0105248_10545850 3300009177 Bacteria 1307
219 Ga0105238_10015654 3300009551 Bacteria 7677
220 Ga0105238_10016359 3300009551 Bacteria 7507
221 Ga0105238_10204579 3300009551 Bacteria 1950
222 Ga0105249_10003228 3300009553 Bacteria 14114
223 Ga0105239_10244807 3300010375 Bacteria 2013
224 Ga0105239_10453749 3300010375 Bacteria 1454
225 Ga0157373_10072260 3300013100 Bacteria 2435
226 Ga0157373_10190739 3300013100 Bacteria 1444
227 Ga0157374_10009479 3300013296 Bacteria 8360
228 Ga0157374_10159195 3300013296 Bacteria 2199
229 Ga0157374_10312527 3300013296 Bacteria 1556
230 Ga0157378_10103371 3300013297 Unclassified 2603
231 Ga0157378_10151275 3300013297 Bacteria 2163
232 Ga0157378_10387407 3300013297 Bacteria 1374
233 Ga0163162_10001899 3300013306 Bacteria 19688
234 Ga0163162_10019285 3300013306 Bacteria 6686
235 Ga0163162_10718387 3300013306 Bacteria 1120
236 Ga0157372_10020476 3300013307 Bacteria 7137
237 Ga0157372_10497643 3300013307 Bacteria 1421
238 Ga0157372_10647920 3300013307 Bacteria 1230
239 Ga0157375_10088200 3300013308 Bacteria 3156
240 Ga0157375_10117747 3300013308 Bacteria 2762
241 Ga0157375_10194495 3300013308 Bacteria 2183
242 Ga0157375_10319915 3300013308 Bacteria 1716
243 Ga0157375_10517876 3300013308 Unclassified 1356
244 Ga0163163_10035272 3300014325 Bacteria 4852
245 Ga0163163_10035817 3300014325 Bacteria 4818
246 Ga0163163_10049468 3300014325 Bacteria 4138
247 Ga0163163_10065293 3300014325 Bacteria 3612
248 Ga0163163_10191021 3300014325 Bacteria 2096
249 Ga0163163_10329238 3300014325 Bacteria 1582
250 Ga0163163_10395514 3300014325 Bacteria 1440
251 Ga0157380_10009869 3300014326 Bacteria 6854
252 Ga0157380_10022924 3300014326 Bacteria 4708
253 Ga0157380_10048983 3300014326 Bacteria 3331
254 Ga0157377_10007122 3300014745 Bacteria 5380
255 Ga0157379_10015133 3300014968 Bacteria 6766
256 Ga0157379_10019725 3300014968 Bacteria 5958
257 Ga0157379_10240918 3300014968 Bacteria 1641
258 Ga0157376_10027735 3300014969 Bacteria 4493
259 Ga0157376_10030193 3300014969 Bacteria 4325
260 Ga0157376_10083603 3300014969 Bacteria 2746
261 Ga0157376_10181121 3300014969 Bacteria 1926
262 Ga0157376_10245004 3300014969 Bacteria 1671
263 Ga0163161_10028396 3300017792 Bacteria 3973
264 Ga0163161_10034948 3300017792 Bacteria 3596
265 Ga0197907_10207346 3300020069 Bacteria 1150
266 Ga0206354_11358317 3300020081 Bacteria 957
267 Ga0213872_10005750 3300021361 Bacteria 6307
268 Ga0213876_10003296 3300021384 Bacteria 9265
269 Ga0213876_10013809 3300021384 Bacteria 4280
270 Ga0213876_10059143 3300021384 Bacteria 2023
271 Ga0209759_1011554 3300025256 Bacteria 2502
272 Ga0209129_1008008 3300025258 Bacteria 3013
273 Ga0209233_1000010 3300025261 Bacteria 1194329
274 Ga0209673_1007596 3300025273 Bacteria 4960
275 Ga0209673_1042247 3300025273 Bacteria 1284
276 Ga0209130_1000202 3300025284 Bacteria 80333
277 Ga0209130_1000344 3300025284 Bacteria 53564
278 Ga0209130_1021652 3300025284 Bacteria 1447
279 Ga0209025_1017085 3300025294 Bacteria 4221
280 Ga0209564_1016680 3300025295 Bacteria 2904
281 Ga0209564_1039870 3300025295 Bacteria 1284
282 Ga0209758_1004351 3300025297 Bacteria 11863
283 Ga0209050_1003769 3300025298 Bacteria 10850
284 Ga0209256_1028596 3300025299 Bacteria 1569
285 Ga0207426_1000145 3300025302 Bacteria 191065
286 Ga0207426_1008184 3300025302 Bacteria 4258
287 Ga0207426_1015934 3300025302 Bacteria 2714
288 Ga0207697_10016381 3300025315 Bacteria 3053
289 Ga0207656_10008856 3300025321 Bacteria 3723
290 Ga0207656_10017385 3300025321 Bacteria 2816
291 Ga0207656_10033266 3300025321 Bacteria 2147
292 Ga0207656_10037843 3300025321 Bacteria 2032
293 Ga0207682_10028938 3300025893 Bacteria 2213
294 Ga0207682_10030865 3300025893 Bacteria 2148
295 Ga0207688_10009539 3300025901 Bacteria 5283
296 Ga0207688_10061777 3300025901 Bacteria 2112
297 Ga0207688_10126173 3300025901 Bacteria 1497
298 Ga0207699_10005822 3300025906 Bacteria 5931
299 Ga0207699_10010300 3300025906 Bacteria 4687
300 Ga0207645_10012581 3300025907 Bacteria 5738
301 Ga0207645_10016392 3300025907 Bacteria 4905
302 Ga0207645_10099989 3300025907 Bacteria 1871
303 Ga0207645_10123012 3300025907 Bacteria 1685
304 Ga0207645_10168377 3300025907 Bacteria 1435
305 Ga0207705_10185083 3300025909 Bacteria 1573
306 Ga0207684_10254469 3300025910 Bacteria 1515
307 Ga0207654_10123660 3300025911 Bacteria 1628
308 Ga0207695_10310867 3300025913 Bacteria 1466
309 Ga0207671_10005913 3300025914 Bacteria 11096
310 Ga0207693_10003396 3300025915 Bacteria 13605
311 Ga0207693_10055649 3300025915 Unclassified 3103
312 Ga0207663_10289885 3300025916 Bacteria 1219
313 Ga0207663_10308156 3300025916 Bacteria 1186
314 Ga0207662_10040025 3300025918 Bacteria 2753
315 Ga0207662_10052495 3300025918 Bacteria 2426
316 Ga0207657_10166302 3300025919 Bacteria 1789
317 Ga0207649_10000751 3300025920 Bacteria 21186
318 Ga0207649_10045266 3300025920 Bacteria 2697
319 Ga0207681_10009677 3300025923 Bacteria 5897
320 Ga0207681_10013024 3300025923 Bacteria 5141
321 Ga0207681_10059515 3300025923 Bacteria 2619
322 Ga0207694_10015611 3300025924 Bacteria 5728
323 Ga0207694_10023668 3300025924 Bacteria 4663
324 Ga0207694_10135269 3300025924 Bacteria 1979
325 Ga0207650_10001092 3300025925 Bacteria 20048
326 Ga0207650_10009480 3300025925 Bacteria 6651
327 Ga0207650_10042019 3300025925 Bacteria 3353
328 Ga0207650_10089125 3300025925 Bacteria 2354
329 Ga0207650_10114489 3300025925 Bacteria 2092
330 Ga0207650_10137681 3300025925 Bacteria 1917
331 Ga0207659_10000204 3300025926 Bacteria 35509
332 Ga0207659_10045135 3300025926 Bacteria 3105
333 Ga0207659_10061369 3300025926 Bacteria 2710
334 Ga0207659_10131469 3300025926 Bacteria 1933
335 Ga0207659_10155041 3300025926 Bacteria 1792
336 Ga0207659_10315351 3300025926 Bacteria 1288
337 Ga0207687_10024023 3300025927 Bacteria 4067
338 Ga0207700_10008110 3300025928 Bacteria 6483
339 Ga0207644_10000730 3300025931 Bacteria 20840
340 Ga0207644_10015474 3300025931 Bacteria 5121
341 Ga0207644_10064517 3300025931 Bacteria 2661
342 Ga0207644_10126989 3300025931 Bacteria 1948
343 Ga0207644_10135159 3300025931 Bacteria 1892
344 Ga0207644_10347363 3300025931 Bacteria 1204
345 Ga0207644_10435603 3300025931 Bacteria 1075
346 Ga0207690_10000481 3300025932 Bacteria 25729
347 Ga0207690_10010542 3300025932 Bacteria 5498
348 Ga0207690_10109637 3300025932 Bacteria 1986
349 Ga0207690_10286101 3300025932 Bacteria 1285
350 Ga0207706_10006354 3300025933 Bacteria 10978
351 Ga0207706_10075957 3300025933 Bacteria 2955
352 Ga0207706_10209873 3300025933 Bacteria 1707
353 Ga0207686_10041235 3300025934 Bacteria 2813
354 Ga0207686_10121334 3300025934 Bacteria 1780
355 Ga0207686_10126034 3300025934 Bacteria 1750
356 Ga0207709_10062584 3300025935 Bacteria 2330
357 Ga0207670_10005270 3300025936 Bacteria 7079
358 Ga0207670_10249899 3300025936 Bacteria 1370
359 Ga0207669_10012497 3300025937 Bacteria 4178
360 Ga0207704_10065386 3300025938 Bacteria 2277
361 Ga0207704_10137669 3300025938 Bacteria 1702
362 Ga0207665_10197116 3300025939 Bacteria 1466
363 Ga0207665_10293172 3300025939 Bacteria 1214
364 Ga0207691_10007781 3300025940 Bacteria 10320
365 Ga0207691_10009406 3300025940 Bacteria 9386
366 Ga0207691_10015487 3300025940 Bacteria 7249
367 Ga0207691_10050878 3300025940 Bacteria 3791
368 Ga0207691_10116997 3300025940 Bacteria 2365
369 Ga0207691_10122319 3300025940 Bacteria 2305
370 Ga0207691_10204119 3300025940 Bacteria 1719
371 Ga0207691_10359215 3300025940 Bacteria 1245
372 Ga0207711_10008092 3300025941 Bacteria 8801
373 Ga0207711_10035617 3300025941 Bacteria 4220
374 Ga0207711_10164068 3300025941 Bacteria 2013
375 Ga0207711_10206310 3300025941 Bacteria 1794
376 Ga0207711_10299807 3300025941 Bacteria 1482
377 Ga0207689_10000415 3300025942 Bacteria 39864
378 Ga0207689_10023985 3300025942 Bacteria 5118
379 Ga0207661_10286116 3300025944 Bacteria 1474
380 Ga0207679_10000501 3300025945 Bacteria 26940
381 Ga0207679_10034938 3300025945 Bacteria 3552
382 Ga0207679_10186810 3300025945 Bacteria 1719
383 Ga0207679_10340667 3300025945 Bacteria 1304
384 Ga0207667_10017829 3300025949 Bacteria 7982
385 Ga0207651_10006911 3300025960 Bacteria 5996
386 Ga0207651_10128496 3300025960 Bacteria 1935
387 Ga0207651_10184217 3300025960 Bacteria 1659
388 Ga0207712_10014838 3300025961 Bacteria 5016
389 Ga0207668_10021512 3300025972 Bacteria 4114
390 Ga0207668_10077602 3300025972 Bacteria 2395
391 Ga0207668_10163249 3300025972 Bacteria 1738
392 Ga0207640_10017859 3300025981 Bacteria 4157
393 Ga0207658_10001441 3300025986 Bacteria 18547
394 Ga0207658_10022795 3300025986 Bacteria 4361
395 Ga0207658_10023334 3300025986 Bacteria 4318
396 Ga0207658_10054469 3300025986 Bacteria 2960
397 Ga0207658_10280405 3300025986 Bacteria 1428
398 Ga0207658_10378592 3300025986 Bacteria 1239
399 Ga0207677_10002347 3300026023 Bacteria 9926
400 Ga0207677_10003745 3300026023 Bacteria 8068
401 Ga0207677_10057286 3300026023 Bacteria 2675
402 Ga0207677_10167615 3300026023 Bacteria 1714
403 Ga0207703_10001940 3300026035 Bacteria 18305
404 Ga0207703_10017353 3300026035 Bacteria 5619
405 Ga0207703_10033131 3300026035 Bacteria 4093
406 Ga0207639_10038632 3300026041 Bacteria 3552
407 Ga0207639_10093006 3300026041 Bacteria 2417
408 Ga0207639_10470858 3300026041 Bacteria 1144
409 Ga0207678_10031828 3300026067 Bacteria 4600
410 Ga0207678_10144423 3300026067 Bacteria 2031
411 Ga0207702_10022577 3300026078 Bacteria 5217
412 Ga0207702_10030478 3300026078 Bacteria 4496
413 Ga0207702_10102192 3300026078 Bacteria 2533
414 Ga0207702_10466356 3300026078 Bacteria 1227
415 Ga0207641_10006015 3300026088 Bacteria 10286
416 Ga0207641_10024016 3300026088 Bacteria 5024
417 Ga0207641_10082413 3300026088 Bacteria 2795
418 Ga0207641_10120485 3300026088 Bacteria 2340
419 Ga0207641_10239657 3300026088 Bacteria 1689
420 Ga0207641_10366621 3300026088 Bacteria 1376
421 Ga0207648_10029733 3300026089 Bacteria 4845
422 Ga0207648_10040299 3300026089 Bacteria 4105
423 Ga0207648_10064869 3300026089 Bacteria 3183
424 Ga0207648_10106324 3300026089 Bacteria 2462
425 Ga0207648_10179215 3300026089 Bacteria 1875
426 Ga0207648_10201535 3300026089 Bacteria 1765
427 Ga0207648_10476969 3300026089 Bacteria 1139
428 Ga0207676_10000459 3300026095 Bacteria 34117
429 Ga0207676_10106791 3300026095 Bacteria 2333
430 Ga0207674_10138303 3300026116 Bacteria 2396
431 Ga0207674_10162880 3300026116 Bacteria 2185
432 Ga0207674_10203945 3300026116 Bacteria 1927
433 Ga0207675_100000177 3300026118 Bacteria 57433
434 Ga0207675_100038123 3300026118 Bacteria 4485
435 Ga0207675_100042703 3300026118 Bacteria 4233
436 Ga0207675_100076969 3300026118 Bacteria 3124
437 Ga0207683_10002889 3300026121 Bacteria 14975
438 Ga0207683_10020790 3300026121 Bacteria 5616
439 Ga0207683_10024178 3300026121 Bacteria 5229
440 Ga0207683_10024658 3300026121 Bacteria 5182
441 Ga0207683_10056040 3300026121 Bacteria 3457
442 Ga0207683_10262536 3300026121 Bacteria 1577
443 Ga0207683_10481445 3300026121 Bacteria 1145
444 Ga0207698_10021351 3300026142 Bacteria 4476
445 Ga0207698_10097540 3300026142 Bacteria 2426
446 Ga0207698_10149581 3300026142 Bacteria 2024
447 Ga0207698_10188533 3300026142 Bacteria 1834
448 Ga0207698_10190396 3300026142 Bacteria 1827
449 Ga0207698_10220579 3300026142 Bacteria 1713
450 Ga0209968_1002997 3300027526 Bacteria 2534
451 Ga0209970_1000664 3300027614 Bacteria 5965
452 Ga0209971_1003883 3300027682 Bacteria 3535
453 Ga0209966_1000315 3300027695 Bacteria 15769
454 Ga0209974_10015215 3300027876 Unclassified 2555
455 Ga0268266_10060045 3300028379 Bacteria 3277
456 Ga0268266_10559368 3300028379 Bacteria 1096
457 Ga0268265_10072688 3300028380 Bacteria 2683
458 Ga0268265_10132888 3300028380 Bacteria 2071
459 Ga0268264_10048821 3300028381 Bacteria 3520
460 Ga0268264_10048858 3300028381 Bacteria 3519
461 Ga0268264_10233273 3300028381 Bacteria 1700
462 Ga0265334_10064092 3300028573 Bacteria 1381
463 Ga0265318_10001634 3300028577 Bacteria 12948
464 Ga0307517_10000228 3300028786 Bacteria 94852
465 Ga0307515_10008172 3300028794 Bacteria 20484
466 Ga0307515_10016752 3300028794 Bacteria 13404
467 Ga0265338_10005207 3300028800 Bacteria 17060
468 Ga0265338_10051008 3300028800 Bacteria 3732
469 Ga0307512_10037415 3300030522 Bacteria 4099
470 Ga0265330_10000746 3300031235 Bacteria 20504
471 Ga0265332_10004969 3300031238 Bacteria 6181
472 Ga0265328_10000724 3300031239 Bacteria 15306
473 Ga0265320_10007294 3300031240 Bacteria 6876
474 Ga0265320_10105095 3300031240 Bacteria 1298
475 Ga0265325_10000313 3300031241 Bacteria 34176
476 Ga0265329_10073010 3300031242 Bacteria 1086
477 Ga0265340_10012702 3300031247 Bacteria 4445
478 Ga0265339_10031114 3300031249 Bacteria 3017
479 Ga0265331_10037769 3300031250 Bacteria 2363
480 Ga0265331_10077069 3300031250 Bacteria 1553
481 Ga0265316_10006768 3300031344 Bacteria 10912
482 Ga0265316_10012526 3300031344 Bacteria 7597
483 Ga0307513_10068890 3300031456 Bacteria 3704
484 Ga0307509_10000426 3300031507 Bacteria 70899
485 Ga0307509_10002105 3300031507 Bacteria 32806
486 Ga0307509_10037945 3300031507 Bacteria 5261
487 Ga0307408_100016563 3300031548 Bacteria 4923
488 Ga0307408_100272132 3300031548 Bacteria 1407
489 Ga0265313_10001048 3300031595 Bacteria 26907
490 Ga0265313_10002292 3300031595 Bacteria 16774
491 Ga0265313_10003555 3300031595 Bacteria 12539
492 Ga0307508_10003008 3300031616 Bacteria 17383
493 Ga0307508_10003969 3300031616 Bacteria 14667
494 Ga0316579_10047500 3300031691 Bacteria 2005
495 Ga0265314_10000090 3300031711 Bacteria 137914
496 Ga0265314_10007838 3300031711 Bacteria 9226
497 Ga0265314_10011795 3300031711 Bacteria 7186
498 Ga0265314_10029744 3300031711 Bacteria 4056
499 Ga0265342_10003605 3300031712 Bacteria 12626
500 Ga0265342_10048624 3300031712 Bacteria 2542
501 Ga0316578_10076378 3300031728 Bacteria 1989
502 Ga0307516_10096367 3300031730 Bacteria 2779
503 Ga0307516_10298997 3300031730 Bacteria 1286
504 Ga0307405_10005636 3300031731 Bacteria 6063
505 Ga0307405_10164614 3300031731 Bacteria 1575
506 Ga0316577_10140975 3300031733 Bacteria 1358
507 Ga0307413_10021897 3300031824 Bacteria 3432
508 Ga0307413_10098360 3300031824 Bacteria 1926
509 Ga0307410_10037824 3300031852 Bacteria 3156
510 Ga0307410_10038810 3300031852 Bacteria 3122
511 Ga0307410_10092136 3300031852 Bacteria 2154
512 Ga0307407_10041511 3300031903 Bacteria 2573
513 Ga0307412_10017676 3300031911 Bacteria 4271
514 Ga0307412_10122864 3300031911 Unclassified 1872
515 Ga0307409_100004491 3300031995 Bacteria 7853
516 Ga0307409_100022057 3300031995 Bacteria 4382
517 Ga0307409_100084871 3300031995 Bacteria 2573
518 Ga0307416_100008699 3300032002 Bacteria 6575
519 Ga0307416_100060302 3300032002 Bacteria 3089
520 Ga0307416_100101169 3300032002 Bacteria 2509
521 Ga0307416_100144216 3300032002 Bacteria 2171
522 Ga0307416_100312739 3300032002 Bacteria 1568
523 Ga0307416_100349886 3300032002 Bacteria 1495
524 Ga0307414_10039089 3300032004 Bacteria 3193
525 Ga0307411_10007538 3300032005 Bacteria 5556
526 Ga0307411_10108128 3300032005 Bacteria 1983
527 Ga0307415_100024759 3300032126 Bacteria 3755
528 Ga0307415_100034487 3300032126 Bacteria 3296
529 Ga0307415_100035508 3300032126 Bacteria 3256
530 Ga0307415_100090581 3300032126 Bacteria 2213
531 Ga0316593_10098924 3300032168 Bacteria 1033
532 Ga0307510_10000088 3300033180 Bacteria 69071
533 Ga0307510_10012968 3300033180 Bacteria 9892
534 Ga0307510_10080168 3300033180 Bacteria 3176
535 Ga0373926_0100225 3300035083 Bacteria 1083
536 Ga0373952_0004040 3300035092 Bacteria 2651
537 Ga0373923_0144303 3300035111 Bacteria 1077
538 Ga0373954_0037036 3300035118 Bacteria 2266
539 Ga0373955_0013200 3300035172 Bacteria 3986
540 Ga0373955_0075250 3300035172 Bacteria 1897
541 Ga0373955_0098288 3300035172 Bacteria 1677
542 Ga0316574_0050054 3300035398 Bacteria 2599
543 Ga0316574_0053798 3300035398 Bacteria 2514
544 Ga0373924_0007338 3300035410 Bacteria 3978
545 Ga0373931_0000651 3300035691 Bacteria 14326
546 Ga0373931_0003893 3300035691 Bacteria 6753
547 Ga0373935_0084657 3300035692 Bacteria 2066
548 Ga0373935_0337819 3300035692 Bacteria 1072
549 Ga0373927_0031327 3300035695 Bacteria 3467
550 Ga0373927_0067496 3300035695 Bacteria 2314
551 Ga0373933_0019521 3300035724 Bacteria 3829
552 Ga0373947_0022533 3300035725 Bacteria 3654
553 Ga0373947_0050360 3300035725 Bacteria 2504
554 Ga0373947_0051309 3300035725 Bacteria 2482
555 Ga0373937_0002130 3300036401 Bacteria 16550
556 Ga0373937_0035174 3300036401 Bacteria 4558
557 Ga0373937_0137713 3300036401 Bacteria 2283
558 Ga0373937_0147584 3300036401 Bacteria 2202
559 Ga0373937_0172143 3300036401 Bacteria 2032
560 Ga0373937_0227273 3300036401 Bacteria 1757
561 Ga0316584_0083228 3300036712 Bacteria 2396
562 Ga0316584_0107040 3300036712 Bacteria 2092
563 Ga0373925_0033741 3300037068 Bacteria 3771
564 Ga0373925_0037962 3300037068 Bacteria 3558
565 Ga0373925_0068102 3300037068 Bacteria 2686
566 Ga0373925_0078124 3300037068 Bacteria 2513
567 Ga0373925_0156959 3300037068 Bacteria 1790
568 Ga0373925_0206914 3300037068 Bacteria 1562
569 Ga0373925_0458450 3300037068 Bacteria 1044
570 Ga0395900_0030896 3300037418 Bacteria 5501
571 Ga0395900_0073706 3300037418 Bacteria 3510
572 Ga0395898_0069529 3300037466 Bacteria 3406
573 Ga0395898_0222739 3300037466 Bacteria 1799
574 Ga0395898_0326172 3300037466 Bacteria 1464
575 Ga0395905_0013836 3300037471 Bacteria 7719
576 Ga0395905_0015586 3300037471 Bacteria 7221
577 Ga0395905_0025405 3300037471 Bacteria 5586
578 Ga0395905_0025630 3300037471 Bacteria 5560
579 Ga0395905_0115221 3300037471 Bacteria 2525
580 Ga0395905_0365204 3300037471 Bacteria 1336
581 Ga0436364_1254691 3300037853 Bacteria 1301
582 Ga0436365_0734647 3300039437 Bacteria 4404
583 Ga0436365_0831379 3300039437 Bacteria 2286
584 Ga0436365_1113024 3300039437 Bacteria 21877
585 Ga0436361_0635150 3300039447 Bacteria 2744
586 Ga0436361_0995447 3300039447 Bacteria 133902
587 Ga0436363_0555416 3300039450 Bacteria 2556
588 Ga0439465_0074983 3300041413 Bacteria 1139
589 Ga0451833_0189538 3300041491 Bacteria 1425
590 Ga0451835_0029948 3300041492 Bacteria 883
591 Ga0451837_1504639 3300041494 Bacteria 3739
592 Ga0451841_0147849 3300041498 Bacteria 2512
593 Ga0451845_0056913 3300041501 Bacteria 2291
594 Ga0451847_0742774 3300041503 Bacteria 3267
595 Ga0451847_0888528 3300041503 Bacteria 1563
596 Ga0451849_1224790 3300041505 Bacteria 1425
597 Ga0451851_0090461 3300041507 Bacteria 1351
598 Ga0451855_0221048 3300041511 Bacteria 2924
599 Ga0451853_0843220 3300041512 Bacteria 1680
600 Ga0450921_004460 3300042123 Bacteria 1023
601 Ga0450904_000402 3300042139 Bacteria 8868
602 Ga0439464_0004890 3300042439 Bacteria 3439
603 Ga0451577_0001786 3300042876 Bacteria 27587
604 Ga0466972_0010564 3300044658 Bacteria 4634
605 Ga0453683_0001147 3300044673 Bacteria 24048
606 Ga0466964_0072400 3300044706 Bacteria 1460
607 Ga0453684_0016137 3300044712 Bacteria 11715
608 Ga0466960_0013724 3300044901 Bacteria 3450
609 Ga0451576_0011635 3300045051 Bacteria 9968
610 Ga0451576_0533070 3300045051 Bacteria 1233
611 Ga0495592_0000160 3300046454 Bacteria 59404
612 Ga0495592_0034316 3300046454 Bacteria 3825
613 Ga0495592_0077077 3300046454 Bacteria 2418
614 Ga0495651_0020278 3300046462 Bacteria 5160
615 Ga0495653_0104058 3300046463 Bacteria 2052
616 Ga0495650_0014208 3300046471 Bacteria 4158
617 Ga0495580_0017613 3300046472 Bacteria 5336
618 Ga0495580_0044427 3300046472 Bacteria 3160
619 Ga0495580_0058969 3300046472 Bacteria 2698
620 Ga0495580_0303771 3300046472 Bacteria 1086
621 Ga0495605_0006254 3300046474 Bacteria 6865
622 Ga0495662_0097677 3300046476 Bacteria 1436
623 Ga0495664_0001377 3300046477 Bacteria 12831
624 Ga0495585_0003509 3300046492 Bacteria 10578
625 Ga0495607_0162345 3300046501 Bacteria 1134
626 Ga0495583_0069527 3300046506 Bacteria 1550
627 Ga0495608_0088907 3300046511 Bacteria 1999
628 Ga0495610_0008402 3300046512 Bacteria 6695
629 Ga0495618_0006177 3300046514 Bacteria 7269
630 Ga0495618_0193289 3300046514 Bacteria 1290
631 Ga0495620_0005407 3300046515 Bacteria 7129
632 Ga0495628_0034166 3300046516 Bacteria 4093
633 Ga0495628_0190739 3300046516 Bacteria 1547
634 Ga0495648_0008643 3300046524 Bacteria 7984
635 Ga0495648_0020754 3300046524 Bacteria 4570
636 Ga0495652_0128760 3300046529 Bacteria 2007
637 Ga0495665_0072256 3300046531 Bacteria 1817
638 Ga0495665_0167278 3300046531 Bacteria 1145
639 Ga0495640_0149606 3300046533 Bacteria 1501
640 Ga0495640_0255126 3300046533 Bacteria 1097
641 Ga0495586_0113959 3300046535 Bacteria 1506
642 Ga0495587_0288311 3300046536 Bacteria 919
643 Ga0495598_0003042 3300046537 Bacteria 3520
644 Ga0495621_0006095 3300046539 Bacteria 3502
645 Ga0495645_0067297 3300046543 Bacteria 2587
646 Ga0495645_0119257 3300046543 Bacteria 1859
647 Ga0495633_0059788 3300046558 Bacteria 1786
648 Ga0495667_0007693 3300046559 Bacteria 7303
649 Ga0495668_0180515 3300046616 Bacteria 1156
650 Ga0495625_0009252 3300046660 Bacteria 8268
651 Ga0495625_0024026 3300046660 Bacteria 4646
652 Ga0495635_0047790 3300046663 Bacteria 2950
653 Ga0495661_0005099 3300046665 Bacteria 9366
654 Ga0495661_0011718 3300046665 Bacteria 5939
655 Ga0495588_0002955 3300046674 Bacteria 7340
656 Ga0495657_0053356 3300046675 Bacteria 2706
657 Ga0495657_0067894 3300046675 Bacteria 2338
658 Ga0495599_0030241 3300046678 Bacteria 3397
659 Ga0495599_0035915 3300046678 Bacteria 3110
660 Ga0495623_0018289 3300046679 Bacteria 4526
661 Ga0495646_0010890 3300046680 Bacteria 5777
662 Ga0495647_0073502 3300046681 Bacteria 1373
663 Ga0495658_0014686 3300046683 Bacteria 4005
664 Ga0495658_0047317 3300046683 Bacteria 2422
665 Ga0495613_0262589 3300046689 Bacteria 1203
666 Ga0495671_0006877 3300046692 Bacteria 6526
667 Ga0495671_0024728 3300046692 Bacteria 3125
668 Ga0495649_0015797 3300046694 Bacteria 4292
669 Ga0495600_0026684 3300046809 Bacteria 3729
670 Ga0495600_0241359 3300046809 Bacteria 1151
671 Ga0495581_0285467 3300047315 Bacteria 965
672 Ga0495604_0025746 3300047317 Bacteria 4686
673 Ga0495604_0082493 3300047317 Bacteria 2404
674 Ga0495604_0137969 3300047317 Bacteria 1746
675 Ga0495604_0297716 3300047317 Bacteria 1084
676 Ga0495604_0317998 3300047317 Bacteria 1041
677 Ga0495674_0017913 3300047319 Bacteria 6595
678 Ga0495672_0000005 3300047320 Bacteria 593294
679 Ga0495672_0018829 3300047320 Bacteria 4573
680 Ga0495680_0089923 3300047322 Bacteria 2304
681 Ga0495680_0092862 3300047322 Bacteria 2260
682 Ga0495680_0286001 3300047322 Bacteria 1161
683 Ga0495680_0313412 3300047322 Bacteria 1099
684 Ga0495683_0061916 3300047323 Bacteria 1852
685 Ga0495675_0055802 3300047444 Bacteria 2505
686 Ga0495675_0219190 3300047444 Bacteria 1152
687 Ga0495679_000069 3300047446 Bacteria 99286
688 Ga0495673_0012297 3300047469 Bacteria 4549
689 Ga0495681_0063816 3300047470 Bacteria 1689
690 Ga0495684_0019708 3300047471 Bacteria 5197
691 Ga0495684_0064488 3300047471 Bacteria 2784
692 Ga0495684_0087936 3300047471 Bacteria 2355
693 Ga0495686_0057870 3300047472 Bacteria 2418
694 Ga0495686_0068836 3300047472 Bacteria 2184
695 Ga0495686_0069660 3300047472 Bacteria 2168
696 Ga0495593_0155673 3300047673 Bacteria 1155
697 Ga0495602_0000654 3300048088 Bacteria 32531
698 Ga0495602_0014636 3300048088 Bacteria 7959
699 Ga0495602_0048920 3300048088 Bacteria 3793
700 Ga0495602_0215228 3300048088 Bacteria 1455
701 Ga0495626_0069346 3300048091 Bacteria 1588
702 Ga0496100_0369030 3300048903 Bacteria 1088
703 Ga0496101_0116976 3300048904 Bacteria 2012
704 Ga0496101_0223770 3300048904 Bacteria 1461
705 Ga0496102_0152064 3300048905 Bacteria 2175
706 Ga0496103_0037667 3300048906 Bacteria 2964
707 Ga0496104_0150041 3300048907 Bacteria 2238
708 Ga0496104_0270590 3300048907 Bacteria 1611
709 Ga0496104_0396488 3300048907 Bacteria 1292
710 Ga0496104_0491933 3300048907 Bacteria 1138
711 Ga0496105_0140964 3300048908 Bacteria 1984
712 Ga0496105_0436832 3300048908 Bacteria 1035
713 Ga0496106_0121056 3300048909 Bacteria 2046
714 Ga0496106_0135433 3300048909 Bacteria 1934
715 Ga0496108_0013180 3300048911 Bacteria 6738
716 Ga0496108_0032030 3300048911 Bacteria 4364
717 Ga0496108_0075186 3300048911 Bacteria 2854
718 Ga0496109_0055351 3300048912 Bacteria 3619
719 Ga0496109_0285233 3300048912 Bacteria 1556
720 Ga0496110_0008118 3300048913 Bacteria 8433
721 Ga0496110_0028269 3300048913 Bacteria 4814
722 Ga0496110_0187400 3300048913 Bacteria 1879
723 Ga0496111_0031879 3300048914 Bacteria 3756
724 Ga0496112_0197006 3300048915 Bacteria 1975
725 Ga0496113_0006977 3300048916 Bacteria 7223
726 Ga0496113_0070091 3300048916 Bacteria 2664
727 Ga0496114_0144436 3300048917 Bacteria 2062
728 Ga0496114_0420977 3300048917 Bacteria 1183
729 Ga0496115_0018360 3300048918 Bacteria 5368
730 Ga0496115_0256428 3300048918 Bacteria 1439
731 Ga0496116_0041343 3300048919 Bacteria 3163
732 Ga0496117_0020996 3300048920 Bacteria 5305
733 Ga0496117_0066748 3300048920 Bacteria 2438
734 Ga0496118_0012563 3300048921 Bacteria 8111
735 Ga0496119_0011032 3300048922 Bacteria 7534
736 Ga0496121_0000217 3300048924 Bacteria 126231
737 Ga0496121_0019157 3300048924 Bacteria 6858
738 Ga0496121_0129927 3300048924 Bacteria 1887
739 Ga0496122_0008239 3300048925 Bacteria 11314
740 Ga0496122_0013748 3300048925 Bacteria 7893
741 Ga0496123_0033098 3300048926 Bacteria 3727
742 Ga0496123_0076676 3300048926 Bacteria 2056
743 Ga0496124_0149576 3300048927 Bacteria 1833
744 Ga0496124_0168474 3300048927 Bacteria 1699
745 Ga0496124_0190213 3300048927 Bacteria 1571
746 Ga0496125_0000093 3300048928 Bacteria 210896
747 Ga0496125_0058068 3300048928 Bacteria 3128
748 Ga0496125_0131041 3300048928 Bacteria 1765
749 Ga0496126_0000018 3300048929 Bacteria 581170
750 Ga0496126_0000254 3300048929 Bacteria 114937
751 Ga0496126_0055634 3300048929 Bacteria 3579
752 Ga0496126_0326452 3300048929 Bacteria 1260
753 Ga0495682_0054755 3300049460 Bacteria 1447
754 Ga0501292_003943 3300049515 Bacteria 2006
755 Ga0501031_0014606 3300049568 Bacteria 5105
756 Ga0501033_0019694 3300049570 Bacteria 5099
757 Ga0501034_0017664 3300049571 Bacteria 7315
758 Ga0501034_0094661 3300049571 Bacteria 2984
759 Ga0501036_0289016 3300049572 Bacteria 1372
760 Ga0501037_0046119 3300049573 Bacteria 3197
761 Ga0501038_0069093 3300049574 Bacteria 3001
762 Ga0501042_0018302 3300049578 Bacteria 4848
763 Ga0501043_0027549 3300049579 Bacteria 4460
764 Ga0501048_0138778 3300049582 Bacteria 1719
765 Ga0501067_0157258 3300049583 Bacteria 1266
766 Ga0501068_0034300 3300049584 Bacteria 3026
767 Ga0501070_0374065 3300049586 Bacteria 1154
768 Ga0501073_0013080 3300049589 Bacteria 6053
769 Ga0501074_0050627 3300049590 Bacteria 2998
770 Ga0501075_0021218 3300049591 Bacteria 4734
771 Ga0501076_0029380 3300049592 Bacteria 4275
772 Ga0501080_0010872 3300049742 Bacteria 8330
773 Ga0501035_0002107 3300049822 Bacteria 19783
774 Ga0501035_0028788 3300049822 Bacteria 5069
775 Ga0501044_0042012 3300049823 Bacteria 4759
776 Ga0501044_0098080 3300049823 Bacteria 2951
777 Ga0501045_0007322 3300049824 Bacteria 7669
778 Ga0501045_0379776 3300049824 Bacteria 1052
779 nmdc:mga03683_9542_c1 3300050489 Bacteria 3456
780 nmdc:mga0yw44_106413_c1 3300050492 Bacteria 1793
781 nmdc:mga0yw44_2618_c1 3300050492 Bacteria 7741
782 nmdc:mga0k408_37337_c1 3300050493 Bacteria 2789
783 nmdc:mga0k408_781_c1 3300050493 Bacteria 17522
784 nmdc:mga0k408_8467_c1 3300050493 Bacteria 5524
785 nmdc:mga05p37_143209_c1 3300050507 Unclassified 2928
786 nmdc:mga05p37_212664_c1 3300050507 Bacteria 2337
787 nmdc:mga05p37_296365_c1 3300050507 Bacteria 1923
788 nmdc:mga09592_2080_c1 3300050508 Bacteria 16148
789 nmdc:mga09592_374736_c1 3300050508 Bacteria 1231
790 nmdc:mga06r32_125762_c1 3300050510 Bacteria 2532
791 nmdc:mga06r32_80654_c1 3300050510 Bacteria 3167
792 nmdc:mga0a205_1145_c1 3300050515 Bacteria 15364
793 nmdc:mga0a205_180142_c1 3300050515 Bacteria 2007
794 Ga0495601_0087663 3300053077 Bacteria 2001
795 Ga0495601_0366448 3300053077 Bacteria 936
796 Ga0495612_0001162 3300053078 Bacteria 10816
797 Ga0495595_0042977 3300053084 Bacteria 2072
798 Ga0495619_0005338 3300053085 Bacteria 8137
799 Ga0500644_0037249 3300053088 Bacteria 1588
800 Ga0500651_0106196 3300053093 Bacteria 1717
801 Ga0500560_026558 3300053107 Bacteria 1711
802 Ga0500594_0016023 3300053118 Bacteria 1816
803 Ga0500559_0005329 3300053136 Bacteria 5927
804 Ga0500622_0008298 3300053156 Bacteria 5821
805 Ga0500622_0026514 3300053156 Bacteria 3058
806 Ga0501084_0023194 3300054114 Bacteria 5180
807 Ga0587070_005921 3300059491 Bacteria 1625
808 Ga0587083_0034802 3300059505 Bacteria 1024
809 Ga0587092_015679 3300059512 Bacteria 1113
810 Ga0587071_011935 3300060344 Bacteria 1475
811 Ga0501082_0015520 3300060353 Bacteria 6557
812 Ga0530510_0076192 3300061734 Bacteria 2437
813 2509370330 2509276018 Bacteria 6910194
814 2510895897 2510461076 Bacteria 8618824
815 2513611441 2513237090 Bacteria 7096802
816 2513632102 2513237093 Bacteria 7545552
817 2513712427 2513237103 Bacteria 7647401
818 2514017798 2513237162 Bacteria 7468464
819 2514423273 2513237305 Bacteria 7293571
820 2515635346 2515154113 Bacteria 7807172
821 2515646041 2515154114 Bacteria 7848616
822 2515654835 2515154116 Bacteria 7552979
823 2517037249 2516653077 Bacteria 7555578
824 2517096358 2517093000 Bacteria 7412387
825 2517408214 2517287029 Bacteria 6905599
826 2644340571 2643221660 Bacteria 4208257
827 2694629014 2693429783 Bacteria 7019804
828 2694637070 2693429784 Bacteria 7241525
829 2723575161 2721755686 Bacteria 7343952
830 2739248884 2738543013 Bacteria 5618633
831 2766066386 2765235942 Bacteria 7445910
832 2842115471 2842110456 Bacteria 7656360
833 2842218464 2842217011 Bacteria 7497767
834 2844012479 2844009547 Bacteria 6728125
835 2847670887 2847670302 Bacteria 6165597
836 2847692134 2847686936 Bacteria 6278406
837 2856316344 2856314179 Bacteria 6477897
838 2856338020 2856334872 Bacteria 7037011
839 2856354473 2856349417 Bacteria 6230045
840 2856361039 2856356410 Bacteria 6297484
841 2857370307 2857367948 Bacteria 6965560
842 2857516904 2857516855 Bacteria 7787325
843 2869174112 2869169390 Bacteria 6659796
844 2869238685 2869234852 Bacteria 6654993
845 2869244894 2869242130 Bacteria 6609239
846 2869254822 2869249662 Bacteria 6868783
847 2869259731 2869256925 Bacteria 6981691
848 2869264802 2869264136 Bacteria 6880765
849 2869276123 2869271264 Bacteria 6908218
850 2871438900 2871435913 Bacteria 6880295
851 2871447082 2871444079 Bacteria 6423508
852 2871453492 2871451962 Bacteria 7336357
853 2871463011 2871459585 Bacteria 6866887
854 2871484890 2871481445 Bacteria 6700002
855 2871496270 2871495908 Bacteria 6935695
856 2874117140 2874116593 Bacteria 6674494
857 2874132816 2874131515 Bacteria 6820270
858 2874165011 2874162495 Bacteria 6174670
859 2876370664 2876369609 Bacteria 6807521
860 2876379231 2876377896 Bacteria 6565995
861 2876387856 2876386047 Bacteria 6698674
862 2876405049 2876399893 Bacteria 6927900
863 2876408659 2876406927 Bacteria 6191900
864 2876427776 2876420981 Bacteria 6687741
865 2878041668 2878035449 Bacteria 6555736
866 2878753173 2878753008 Bacteria 6922523
867 2878760499 2878760144 Bacteria 6823465
868 2878767462 2878767105 Bacteria 6898628
869 2878777988 2878774303 Bacteria 6108671
870 2878784554 2878781027 Bacteria 6834456
871 2881151178 2881147464 Bacteria 7779814
872 2881158495 2881155292 Bacteria 6461656
873 2881167313 2881161766 Bacteria 7127907
874 2881861021 2881853255 Bacteria 6698367
875 2885348760 2885342637 Bacteria 7011821
876 2885355534 2885350715 Bacteria 6787678
877 2894026065 2894023352 Bacteria 5167372
878 2894772497 2894772417 Bacteria 5305674
879 2903521497 2903513507 Bacteria 6344008
880 2903541064 2903540706 Bacteria 7062119
881 2906330129 2906328253 Bacteria 6585166
882 2906377865 2906370794 Bacteria 6881062
883 2906401473 2906401398 Bacteria 6693206
884 2906411180 2906408224 Bacteria 6162342
885 2906416481 2906414383 Bacteria 6580790
886 2906646481 2906643746 Bacteria 8722424
887 2922157574 2922151315 Bacteria 6902399
888 2922164670 2922158528 Bacteria 6573167
889 2922178470 2922172374 Bacteria 6167644
890 2922185573 2922178524 Bacteria 6025201
891 2924716959 2924710171 Bacteria 6752351
892 2924728703 2924726620 Bacteria 6271473
893 2924738017 2924733363 Bacteria 7574837
894 2924750781 2924748358 Bacteria 6154725
895 2924754963 2924754689 Bacteria 6774424
896 2924791232 2924784321 Bacteria 7416538
897 2933591886 2933586486 Bacteria 7667493
898 2936371523 2936367885 Bacteria 7324495
899 2936376894 2936375103 Bacteria 6652732
900 2937866577 2937861824 Bacteria 6660327
901 2937897919 2937891427 Bacteria 6357007
902 2937987687 2937980651 Bacteria 6517427
903 2937994917 2937994558 Bacteria 7036190
904 2938017205 2938014810 Bacteria 6700592
905 2958118338 2958115193 Bacteria 6923548
906 2958128742 2958122699 Bacteria 7280457
907 2958140945 2958137437 Bacteria 6050276
908 2958162645 2958158011 Bacteria 6058449
909 2958165397 2958165035 Bacteria 6906348
910 2961138910 2961136820 Bacteria 6775228
911 2961163855 2961163497 Bacteria 6901077
912 2961176989 2961170736 Bacteria 7072258
913 2961186009 2961183825 Bacteria 6688536
914 2965018660 2965018300 Bacteria 6883036
915 2965025921 2965025482 Bacteria 6532201
916 2965034804 2965032056 Bacteria 6887443
917 2965040934 2965040258 Bacteria 6855979
918 2965050961 2965047637 Bacteria 6623551
919 2965069070 2965062239 Bacteria 7412989
920 2965092196 2965089291 Bacteria 6866420
921 2965105616 2965102966 Bacteria 6800987
922 2965114508 2965110997 Bacteria 6693150
923 2968096244 2968091066 Bacteria 6052692
924 2968098745 2968097103 Bacteria 6107094
925 2968119803 2968117919 Bacteria 6536078
926 2968129768 2968128360 Bacteria 6270294
927 2968140354 2968138860 Bacteria 6605449
928 2968172261 2968171901 Bacteria 6894245
929 2970509662 2970503327 Bacteria 7099517
930 2970514348 2970510686 Bacteria 7006402
931 2970535637 2970532167 Bacteria 6553173
932 2970551615 2970547951 Bacteria 6931819
933 2970555351 2970554993 Bacteria 6814252
934 2970623553 2970619444 Bacteria 6986144
935 2970629295 2970627176 Bacteria 6680862
936 2977822104 2977821940 Bacteria 6906439
937 2977834117 2977828996 Bacteria 7007971
938 2977855994 2977851361 Bacteria 6694324
939 2977866017 2977864932 Bacteria 7534097
940 2977873787 2977872689 Bacteria 7270173
941 2977904109 2977898635 Bacteria 6675551
942 2977912859 2977907340 Bacteria 6577984
943 2977916285 2977915119 Bacteria 6829656
944 2977942012 2977935797 Bacteria 6252826
945 2977957024 2977950692 Bacteria 6893264
946 2979774687 2979772303 Bacteria 6618277
947 2979814449 2979808191 Bacteria 7179355
948 2987646679 2987645492 Bacteria 6117018
949 2987659867 2987659509 Bacteria 6966464
950 2987677502 2987673487 Bacteria 6884027
951 2996346213 2996341866 Bacteria 6643098
952 2996389255 2996386984 Bacteria 6978667
953 3004168207 3004167301 Bacteria 8330599
954 3004188914 3004188549 Bacteria 6952365
955 3004199538 3004195979 Bacteria 6776956
956 3004238637 3004232784 Bacteria 6662140
957 3004246632 3004239961 Bacteria 6892290
958 3004250581 3004248173 Bacteria 6563236
959 3004274037 3004268573 Bacteria 7043476
960 639649675 639633055 Bacteria 7751309
961 649872455 649633066 Bacteria 6690028
962 8002392887 8002392321 Bacteria 4159911
963 8004307236 8004300914 Bacteria 6132239
964 8004374744 8004374579 Bacteria 6898112
965 8004643800 8004640170 Bacteria 6723001
966 8004709240 8004703790 Bacteria 8006957
967 8005382583 8005376324 Bacteria 6590079
968 8005561734 8005556819 Bacteria 6908598
969 8018163245 8018163183 Bacteria 7277977
970 8024486010 8024479707 Bacteria 6954785
971 8046773416 8046767195 Bacteria 7547379
972 8057878814 8057874678 Bacteria 7494653
973 Ga0070659_100096892
974 JGI25152J39213_1003114
975 JGI25159J45721_1000313
976 JGI25165J46597_1000076
977 rootH1_10006788
978 rootH2_10062461
979 rootH1_10001121
980 JGI25160J50197_1000226
981 JGI25160J50197_1023160
982 JGI25161J50226_1000037
983 JGI26138J51218_100778
984 Ga0055524_1005357
985 Ga0055528_1001938
986 Ga0055543_1000708
987 Ga0055543_1010893
988 Ga0065165_1000248
989 Ga0065165_1000608
990 Ga0065165_1009335
991 Ga0065165_1009879
992 Ga0065712_10068036
993 Ga0065712_10087842
994 Ga0065707_10002804
995 Ga0070658_10055449
996 Ga0070658_10063877
997 Ga0070676_10003450
998 Ga0070676_10019078
999 Ga0070676_10028370
1000 Ga0070676_10033704
1001 Ga0070676_10039991
1002 Ga0070683_100093887
1003 Ga0070683_100282736
1004 Ga0070683_100473792
1005 Ga0070690_100010864
1006 Ga0070690_100178382
1007 Ga0070670_100005073
1008 Ga0070670_100149299
1009 Ga0070677_10042156
1010 Ga0070677_10061429
1011 Ga0068869_100007131
1012 Ga0068869_100019096
1013 Ga0068869_100022810
1014 Ga0068869_100073064
1015 Ga0070666_10261657
1016 Ga0068868_100001782
1017 Ga0068868_100003524
1018 Ga0068868_100080240
1019 Ga0068868_100085365
1020 Ga0068868_100132224
1021 Ga0068868_100220568
1022 Ga0070689_100011360
1023 Ga0070687_100039628
1024 Ga0070687_100043617
1025 Ga0070661_100000421
1026 Ga0070661_100035098
1027 Ga0070661_100380526
1028 Ga0070668_100110947
1029 Ga0070669_100030633
1030 Ga0070675_100000866
1031 Ga0070675_100014161
1032 Ga0070675_100035964
1033 Ga0070675_100057719
1034 Ga0070675_100115405
1035 Ga0070675_100118730
1036 Ga0070675_100230740
1037 Ga0070671_100004656
1038 Ga0070671_100021651
1039 Ga0070671_100035031
1040 Ga0070671_100202982
1041 Ga0070671_100207754
1042 Ga0070671_100313214
1043 Ga0070674_100050214
1044 Ga0070674_100064160
1045 Ga0070674_100228301
1046 Ga0070673_100008291
1047 Ga0070673_100079739
1048 Ga0070673_100083110
1049 Ga0070673_100128333
1050 Ga0070673_100175005
1051 Ga0070673_100408404
1052 Ga0070688_100182474
1053 Ga0070659_100001131
1054 Ga0070659_100153310
1055 Ga0070667_100002208
1056 Ga0070667_100049104
1057 Ga0070667_100152617
1058 Ga0070709_10016715
1059 Ga0070714_100000239
1060 Ga0070714_100010965
1061 Ga0070714_100171347
1062 Ga0070713_100189149
1063 Ga0070710_10005098
1064 Ga0070710_10033872
1065 Ga0070710_10155154
1066 Ga0070711_100104617
1067 Ga0070711_100285285
1068 Ga0070711_100331649
1069 Ga0070694_100046946
1070 Ga0070708_100136925
1071 Ga0070663_100097108
1072 Ga0070663_100205385
1073 Ga0070663_100388252
1074 Ga0070678_100001312
1075 Ga0070678_100015658
1076 Ga0070678_100063793
1077 Ga0070678_100160161
1078 Ga0070678_100204366
1079 Ga0070678_100324138
1080 Ga0070662_100003497
1081 Ga0068867_100021425
1082 Ga0068867_100031464
1083 Ga0068867_100059695
1084 Ga0068867_100089619
1085 Ga0068867_100116787
1086 Ga0070699_100447116
1087 Ga0070684_100138009
1088 Ga0070697_100076610
1089 Ga0070672_100002150
1090 Ga0070672_100008361
1091 Ga0070672_100013213
1092 Ga0070672_100084137
1093 Ga0070672_100164979
1094 Ga0070672_100181641
1095 Ga0070672_100282199
1096 Ga0070686_100453656
1097 Ga0070665_100048226
1098 Ga0068855_100017631
1099 Ga0070664_100001426
1100 Ga0070664_100106351
1101 Ga0070664_100192032
1102 Ga0070664_100490371
1103 Ga0068857_100062734
1104 Ga0068857_100094213
1105 Ga0068854_100085085
1106 Ga0068856_100292701
1107 Ga0068856_100339202
1108 Ga0068852_100070622
1109 Ga0068852_100093258
1110 Ga0068852_100119591
1111 Ga0068852_100145428
1112 Ga0068859_100003928
1113 Ga0068859_100123572
1114 Ga0068859_100395883
1115 Ga0068864_100002466
1116 Ga0068864_100021034
1117 Ga0068864_100038973
1118 Ga0068864_100059686
1119 Ga0068864_100095122
1120 Ga0068864_100320878
1121 Ga0068861_100006231
1122 Ga0068861_100044512
1123 Ga0068851_10032364
1124 Ga0068851_10046404
1125 Ga0068863_100002188
1126 Ga0068863_100047716
1127 Ga0068863_100258187
1128 Ga0068863_100261003
1129 Ga0068863_100460737
1130 Ga0068858_100013210
1131 Ga0068858_100014936
1132 Ga0068858_100024392
1133 Ga0068860_100063283
1134 Ga0068860_100084462
1135 Ga0068862_100052915
1136 Ga0068862_100081613
1137 Ga0081455_10009631
1138 Ga0081538_10044446
1139 Ga0081539_10036751
1140 Ga0070717_10047833
1141 Ga0070717_10328904
1142 Ga0070715_10039192
1143 Ga0070712_100037571
1144 Ga0070712_100120911
1145 Ga0070712_100203204
1146 Ga0075362_10015121
1147 Ga0075367_10033175
1148 Ga0075367_10193444
1149 Ga0075366_10000654
1150 Ga0075366_10000689
1151 Ga0075366_10041951
1152 Ga0075366_10054506
1153 Ga0075366_10153331
1154 Ga0097621_100048992
1155 Ga0097621_100051212
1156 Ga0097621_100149573
1157 Ga0097621_100566377
1158 Ga0068871_100036324
1159 Ga0068871_100084672
1160 Ga0068871_100090227
1161 Ga0068871_100133339
1162 Ga0068871_100231330
1163 Ga0068871_100296293
1164 Ga0075431_100195429
1165 Ga0075433_10016698
1166 Ga0075429_100001716
1167 Ga0075429_100122924
1168 Ga0068865_100029455
1169 Ga0097620_100003928
1170 Ga0097620_100123572
1171 Ga0097620_100395902
1172 Ga0075435_100283287
1173 Ga0105251_10014736
1174 Ga0105240_10215261
1175 Ga0105240_10220319
1176 Ga0111539_10262996
1177 Ga0105245_10007672
1178 Ga0105245_10377354
1179 Ga0114129_10017649
1180 Ga0114129_10106146
1181 Ga0105241_10457472
1182 Ga0105242_10160194
1183 Ga0105242_10162634
1184 Ga0105242_10394126
1185 Ga0105248_10028618
1186 Ga0105248_10033661
1187 Ga0105248_10056309
1188 Ga0105248_10163982
1189 Ga0105248_10545850
1190 Ga0105238_10015654
1191 Ga0105238_10016359
1192 Ga0105238_10204579
1193 Ga0105249_10003228
1194 Ga0105239_10244807
1195 Ga0105239_10453749
1196 Ga0157373_10072260
1197 Ga0157373_10190739
1198 Ga0157374_10009479
1199 Ga0157374_10159195
1200 Ga0157374_10312527
1201 Ga0157378_10103371
1202 Ga0157378_10151275
1203 Ga0157378_10387407
1204 Ga0163162_10001899
1205 Ga0163162_10019285
1206 Ga0163162_10718387
1207 Ga0157372_10020476
1208 Ga0157372_10497643
1209 Ga0157372_10647920
1210 Ga0157375_10088200
1211 Ga0157375_10117747
1212 Ga0157375_10194495
1213 Ga0157375_10319915
1214 Ga0157375_10517876
1215 Ga0163163_10035272
1216 Ga0163163_10035817
1217 Ga0163163_10049468
1218 Ga0163163_10065293
1219 Ga0163163_10191021
1220 Ga0163163_10329238
1221 Ga0163163_10395514
1222 Ga0157380_10009869
1223 Ga0157380_10022924
1224 Ga0157380_10048983
1225 Ga0157377_10007122
1226 Ga0157379_10015133
1227 Ga0157379_10019725
1228 Ga0157379_10240918
1229 Ga0157376_10027735
1230 Ga0157376_10030193
1231 Ga0157376_10083603
1232 Ga0157376_10181121
1233 Ga0157376_10245004
1234 Ga0163161_10028396
1235 Ga0163161_10034948
1236 Ga0197907_10207346
1237 Ga0206354_11358317
1238 Ga0213872_10005750
1239 Ga0213876_10003296
1240 Ga0213876_10013809
1241 Ga0213876_10059143
1242 Ga0209759_1011554
1243 Ga0209129_1008008
1244 Ga0209233_1000010
1245 Ga0209673_1007596
1246 Ga0209673_1042247
1247 Ga0209130_1000202
1248 Ga0209130_1000344
1249 Ga0209130_1021652
1250 Ga0209025_1017085
1251 Ga0209564_1016680
1252 Ga0209564_1039870
1253 Ga0209758_1004351
1254 Ga0209050_1003769
1255 Ga0209256_1028596
1256 Ga0207426_1000145
1257 Ga0207426_1008184
1258 Ga0207426_1015934
1259 Ga0207697_10016381
1260 Ga0207656_10008856
1261 Ga0207656_10017385
1262 Ga0207656_10033266
1263 Ga0207656_10037843
1264 Ga0207682_10028938
1265 Ga0207682_10030865
1266 Ga0207688_10009539
1267 Ga0207688_10061777
1268 Ga0207688_10126173
1269 Ga0207699_10005822
1270 Ga0207699_10010300
1271 Ga0207645_10012581
1272 Ga0207645_10016392
1273 Ga0207645_10099989
1274 Ga0207645_10123012
1275 Ga0207645_10168377
1276 Ga0207705_10185083
1277 Ga0207684_10254469
1278 Ga0207654_10123660
1279 Ga0207695_10310867
1280 Ga0207671_10005913
1281 Ga0207693_10003396
1282 Ga0207693_10055649
1283 Ga0207663_10289885
1284 Ga0207663_10308156
1285 Ga0207662_10040025
1286 Ga0207662_10052495
1287 Ga0207657_10166302
1288 Ga0207649_10000751
1289 Ga0207649_10045266
1290 Ga0207681_10009677
1291 Ga0207681_10013024
1292 Ga0207681_10059515
1293 Ga0207694_10015611
1294 Ga0207694_10023668
1295 Ga0207694_10135269
1296 Ga0207650_10001092
1297 Ga0207650_10009480
1298 Ga0207650_10042019
1299 Ga0207650_10089125
1300 Ga0207650_10114489
1301 Ga0207650_10137681
1302 Ga0207659_10000204
1303 Ga0207659_10045135
1304 Ga0207659_10061369
1305 Ga0207659_10131469
1306 Ga0207659_10155041
1307 Ga0207659_10315351
1308 Ga0207687_10024023
1309 Ga0207700_10008110
1310 Ga0207644_10000730
1311 Ga0207644_10015474
1312 Ga0207644_10064517
1313 Ga0207644_10126989
1314 Ga0207644_10135159
1315 Ga0207644_10347363
1316 Ga0207644_10435603
1317 Ga0207690_10000481
1318 Ga0207690_10010542
1319 Ga0207690_10109637
1320 Ga0207690_10286101
1321 Ga0207706_10006354
1322 Ga0207706_10075957
1323 Ga0207706_10209873
1324 Ga0207686_10041235
1325 Ga0207686_10121334
1326 Ga0207686_10126034
1327 Ga0207709_10062584
1328 Ga0207670_10005270
1329 Ga0207670_10249899
1330 Ga0207669_10012497
1331 Ga0207704_10065386
1332 Ga0207704_10137669
1333 Ga0207665_10197116
1334 Ga0207665_10293172
1335 Ga0207691_10007781
1336 Ga0207691_10009406
1337 Ga0207691_10015487
1338 Ga0207691_10050878
1339 Ga0207691_10116997
1340 Ga0207691_10122319
1341 Ga0207691_10204119
1342 Ga0207691_10359215
1343 Ga0207711_10008092
1344 Ga0207711_10035617
1345 Ga0207711_10164068
1346 Ga0207711_10206310
1347 Ga0207711_10299807
1348 Ga0207689_10000415
1349 Ga0207689_10023985
1350 Ga0207661_10286116
1351 Ga0207679_10000501
1352 Ga0207679_10034938
1353 Ga0207679_10186810
1354 Ga0207679_10340667
1355 Ga0207667_10017829
1356 Ga0207651_10006911
1357 Ga0207651_10128496
1358 Ga0207651_10184217
1359 Ga0207712_10014838
1360 Ga0207668_10021512
1361 Ga0207668_10077602
1362 Ga0207668_10163249
1363 Ga0207640_10017859
1364 Ga0207658_10001441
1365 Ga0207658_10022795
1366 Ga0207658_10023334
1367 Ga0207658_10054469
1368 Ga0207658_10280405
1369 Ga0207658_10378592
1370 Ga0207677_10002347
1371 Ga0207677_10003745
1372 Ga0207677_10057286
1373 Ga0207677_10167615
1374 Ga0207703_10001940
1375 Ga0207703_10017353
1376 Ga0207703_10033131
1377 Ga0207639_10038632
1378 Ga0207639_10093006
1379 Ga0207639_10470858
1380 Ga0207678_10031828
1381 Ga0207678_10144423
1382 Ga0207702_10022577
1383 Ga0207702_10030478
1384 Ga0207702_10102192
1385 Ga0207702_10466356
1386 Ga0207641_10006015
1387 Ga0207641_10024016
1388 Ga0207641_10082413
1389 Ga0207641_10120485
1390 Ga0207641_10239657
1391 Ga0207641_10366621
1392 Ga0207648_10029733
1393 Ga0207648_10040299
1394 Ga0207648_10064869
1395 Ga0207648_10106324
1396 Ga0207648_10179215
1397 Ga0207648_10201535
1398 Ga0207648_10476969
1399 Ga0207676_10000459
1400 Ga0207676_10106791
1401 Ga0207674_10138303
1402 Ga0207674_10162880
1403 Ga0207674_10203945
1404 Ga0207675_100000177
1405 Ga0207675_100038123
1406 Ga0207675_100042703
1407 Ga0207675_100076969
1408 Ga0207683_10002889
1409 Ga0207683_10020790
1410 Ga0207683_10024178
1411 Ga0207683_10024658
1412 Ga0207683_10056040
1413 Ga0207683_10262536
1414 Ga0207683_10481445
1415 Ga0207698_10021351
1416 Ga0207698_10097540
1417 Ga0207698_10149581
1418 Ga0207698_10188533
1419 Ga0207698_10190396
1420 Ga0207698_10220579
1421 Ga0209968_1002997
1422 Ga0209970_1000664
1423 Ga0209971_1003883
1424 Ga0209966_1000315
1425 Ga0209974_10015215
1426 Ga0268266_10060045
1427 Ga0268266_10559368
1428 Ga0268265_10072688
1429 Ga0268265_10132888
1430 Ga0268264_10048821
1431 Ga0268264_10048858
1432 Ga0268264_10233273
1433 Ga0265334_10064092
1434 Ga0265318_10001634
1435 Ga0307517_10000228
1436 Ga0307515_10008172
1437 Ga0307515_10016752
1438 Ga0265338_10005207
1439 Ga0265338_10051008
1440 Ga0307512_10037415
1441 Ga0265330_10000746
1442 Ga0265332_10004969
1443 Ga0265328_10000724
1444 Ga0265320_10007294
1445 Ga0265320_10105095
1446 Ga0265325_10000313
1447 Ga0265329_10073010
1448 Ga0265340_10012702
1449 Ga0265339_10031114
1450 Ga0265331_10037769
1451 Ga0265331_10077069
1452 Ga0265316_10006768
1453 Ga0265316_10012526
1454 Ga0307513_10068890
1455 Ga0307509_10000426
1456 Ga0307509_10002105
1457 Ga0307509_10037945
1458 Ga0307408_100016563
1459 Ga0307408_100272132
1460 Ga0265313_10001048
1461 Ga0265313_10002292
1462 Ga0265313_10003555
1463 Ga0307508_10003008
1464 Ga0307508_10003969
1465 Ga0316579_10047500
1466 Ga0265314_10000090
1467 Ga0265314_10007838
1468 Ga0265314_10011795
1469 Ga0265314_10029744
1470 Ga0265342_10003605
1471 Ga0265342_10048624
1472 Ga0316578_10076378
1473 Ga0307516_10096367
1474 Ga0307516_10298997
1475 Ga0307405_10005636
1476 Ga0307405_10164614
1477 Ga0316577_10140975
1478 Ga0307413_10021897
1479 Ga0307413_10098360
1480 Ga0307410_10037824
1481 Ga0307410_10038810
1482 Ga0307410_10092136
1483 Ga0307407_10041511
1484 Ga0307412_10017676
1485 Ga0307412_10122864
1486 Ga0307409_100004491
1487 Ga0307409_100022057
1488 Ga0307409_100084871
1489 Ga0307416_100008699
1490 Ga0307416_100060302
1491 Ga0307416_100101169
1492 Ga0307416_100144216
1493 Ga0307416_100312739
1494 Ga0307416_100349886
1495 Ga0307414_10039089
1496 Ga0307411_10007538
1497 Ga0307411_10108128
1498 Ga0307415_100024759
1499 Ga0307415_100034487
1500 Ga0307415_100035508
1501 Ga0307415_100090581
1502 Ga0316593_10098924
1503 Ga0307510_10000088
1504 Ga0307510_10012968
1505 Ga0307510_10080168
1506 Ga0373926_0100225
1507 Ga0373952_0004040
1508 Ga0373923_0144303
1509 Ga0373954_0037036
1510 Ga0373955_0013200
1511 Ga0373955_0075250
1512 Ga0373955_0098288
1513 Ga0316574_0050054
1514 Ga0316574_0053798
1515 Ga0373924_0007338
1516 Ga0373931_0000651
1517 Ga0373931_0003893
1518 Ga0373935_0084657
1519 Ga0373935_0337819
1520 Ga0373927_0031327
1521 Ga0373927_0067496
1522 Ga0373933_0019521
1523 Ga0373947_0022533
1524 Ga0373947_0050360
1525 Ga0373947_0051309
1526 Ga0373937_0002130
1527 Ga0373937_0035174
1528 Ga0373937_0137713
1529 Ga0373937_0147584
1530 Ga0373937_0172143
1531 Ga0373937_0227273
1532 Ga0316584_0083228
1533 Ga0316584_0107040
1534 Ga0373925_0033741
1535 Ga0373925_0037962
1536 Ga0373925_0068102
1537 Ga0373925_0078124
1538 Ga0373925_0156959
1539 Ga0373925_0206914
1540 Ga0373925_0458450
1541 Ga0395900_0030896
1542 Ga0395900_0073706
1543 Ga0395898_0069529
1544 Ga0395898_0222739
1545 Ga0395898_0326172
1546 Ga0395905_0013836
1547 Ga0395905_0015586
1548 Ga0395905_0025405
1549 Ga0395905_0025630
1550 Ga0395905_0115221
1551 Ga0395905_0365204
1552 Ga0436364_1254691
1553 Ga0436365_0734647
1554 Ga0436365_0831379
1555 Ga0436365_1113024
1556 Ga0436361_0635150
1557 Ga0436361_0995447
1558 Ga0436363_0555416
1559 Ga0439465_0074983
1560 Ga0451833_0189538
1561 Ga0451835_0029948
1562 Ga0451837_1504639
1563 Ga0451841_0147849
1564 Ga0451845_0056913
1565 Ga0451847_0742774
1566 Ga0451847_0888528
1567 Ga0451849_1224790
1568 Ga0451851_0090461
1569 Ga0451855_0221048
1570 Ga0451853_0843220
1571 Ga0450921_004460
1572 Ga0450904_000402
1573 Ga0439464_0004890
1574 Ga0451577_0001786
1575 Ga0466972_0010564
1576 Ga0453683_0001147
1577 Ga0466964_0072400
1578 Ga0453684_0016137
1579 Ga0466960_0013724
1580 Ga0451576_0011635
1581 Ga0451576_0533070
1582 Ga0495592_0000160
1583 Ga0495592_0034316
1584 Ga0495592_0077077
1585 Ga0495651_0020278
1586 Ga0495653_0104058
1587 Ga0495650_0014208
1588 Ga0495580_0017613
1589 Ga0495580_0044427
1590 Ga0495580_0058969
1591 Ga0495580_0303771
1592 Ga0495605_0006254
1593 Ga0495662_0097677
1594 Ga0495664_0001377
1595 Ga0495585_0003509
1596 Ga0495607_0162345
1597 Ga0495583_0069527
1598 Ga0495608_0088907
1599 Ga0495610_0008402
1600 Ga0495618_0006177
1601 Ga0495618_0193289
1602 Ga0495620_0005407
1603 Ga0495628_0034166
1604 Ga0495628_0190739
1605 Ga0495648_0008643
1606 Ga0495648_0020754
1607 Ga0495652_0128760
1608 Ga0495665_0072256
1609 Ga0495665_0167278
1610 Ga0495640_0149606
1611 Ga0495640_0255126
1612 Ga0495586_0113959
1613 Ga0495587_0288311
1614 Ga0495598_0003042
1615 Ga0495621_0006095
1616 Ga0495645_0067297
1617 Ga0495645_0119257
1618 Ga0495633_0059788
1619 Ga0495667_0007693
1620 Ga0495668_0180515
1621 Ga0495625_0009252
1622 Ga0495625_0024026
1623 Ga0495635_0047790
1624 Ga0495661_0005099
1625 Ga0495661_0011718
1626 Ga0495588_0002955
1627 Ga0495657_0053356
1628 Ga0495657_0067894
1629 Ga0495599_0030241
1630 Ga0495599_0035915
1631 Ga0495623_0018289
1632 Ga0495646_0010890
1633 Ga0495647_0073502
1634 Ga0495658_0014686
1635 Ga0495658_0047317
1636 Ga0495613_0262589
1637 Ga0495671_0006877
1638 Ga0495671_0024728
1639 Ga0495649_0015797
1640 Ga0495600_0026684
1641 Ga0495600_0241359
1642 Ga0495581_0285467
1643 Ga0495604_0025746
1644 Ga0495604_0082493
1645 Ga0495604_0137969
1646 Ga0495604_0297716
1647 Ga0495604_0317998
1648 Ga0495674_0017913
1649 Ga0495672_0000005
1650 Ga0495672_0018829
1651 Ga0495680_0089923
1652 Ga0495680_0092862
1653 Ga0495680_0286001
1654 Ga0495680_0313412
1655 Ga0495683_0061916
1656 Ga0495675_0055802
1657 Ga0495675_0219190
1658 Ga0495679_000069
1659 Ga0495673_0012297
1660 Ga0495681_0063816
1661 Ga0495684_0019708
1662 Ga0495684_0064488
1663 Ga0495684_0087936
1664 Ga0495686_0057870
1665 Ga0495686_0068836
1666 Ga0495686_0069660
1667 Ga0495593_0155673
1668 Ga0495602_0000654
1669 Ga0495602_0014636
1670 Ga0495602_0048920
1671 Ga0495602_0215228
1672 Ga0495626_0069346
1673 Ga0496100_0369030
1674 Ga0496101_0116976
1675 Ga0496101_0223770
1676 Ga0496102_0152064
1677 Ga0496103_0037667
1678 Ga0496104_0150041
1679 Ga0496104_0270590
1680 Ga0496104_0396488
1681 Ga0496104_0491933
1682 Ga0496105_0140964
1683 Ga0496105_0436832
1684 Ga0496106_0121056
1685 Ga0496106_0135433
1686 Ga0496108_0013180
1687 Ga0496108_0032030
1688 Ga0496108_0075186
1689 Ga0496109_0055351
1690 Ga0496109_0285233
1691 Ga0496110_0008118
1692 Ga0496110_0028269
1693 Ga0496110_0187400
1694 Ga0496111_0031879
1695 Ga0496112_0197006
1696 Ga0496113_0006977
1697 Ga0496113_0070091
1698 Ga0496114_0144436
1699 Ga0496114_0420977
1700 Ga0496115_0018360
1701 Ga0496115_0256428
1702 Ga0496116_0041343
1703 Ga0496117_0020996
1704 Ga0496117_0066748
1705 Ga0496118_0012563
1706 Ga0496119_0011032
1707 Ga0496121_0000217
1708 Ga0496121_0019157
1709 Ga0496121_0129927
1710 Ga0496122_0008239
1711 Ga0496122_0013748
1712 Ga0496123_0033098
1713 Ga0496123_0076676
1714 Ga0496124_0149576
1715 Ga0496124_0168474
1716 Ga0496124_0190213
1717 Ga0496125_0000093
1718 Ga0496125_0058068
1719 Ga0496125_0131041
1720 Ga0496126_0000018
1721 Ga0496126_0000254
1722 Ga0496126_0055634
1723 Ga0496126_0326452
1724 Ga0495682_0054755
1725 Ga0501292_003943
1726 Ga0501031_0014606
1727 Ga0501033_0019694
1728 Ga0501034_0017664
1729 Ga0501034_0094661
1730 Ga0501036_0289016
1731 Ga0501037_0046119
1732 Ga0501038_0069093
1733 Ga0501042_0018302
1734 Ga0501043_0027549
1735 Ga0501048_0138778
1736 Ga0501067_0157258
1737 Ga0501068_0034300
1738 Ga0501070_0374065
1739 Ga0501073_0013080
1740 Ga0501074_0050627
1741 Ga0501075_0021218
1742 Ga0501076_0029380
1743 Ga0501080_0010872
1744 Ga0501035_0002107
1745 Ga0501035_0028788
1746 Ga0501044_0042012
1747 Ga0501044_0098080
1748 Ga0501045_0007322
1749 Ga0501045_0379776
1750 nmdc:mga03683_9542_c1
1751 nmdc:mga0yw44_106413_c1
1752 nmdc:mga0yw44_2618_c1
1753 nmdc:mga0k408_37337_c1
1754 nmdc:mga0k408_781_c1
1755 nmdc:mga0k408_8467_c1
1756 nmdc:mga05p37_143209_c1
1757 nmdc:mga05p37_212664_c1
1758 nmdc:mga05p37_296365_c1
1759 nmdc:mga09592_2080_c1
1760 nmdc:mga09592_374736_c1
1761 nmdc:mga06r32_125762_c1
1762 nmdc:mga06r32_80654_c1
1763 nmdc:mga0a205_1145_c1
1764 nmdc:mga0a205_180142_c1
1765 Ga0495601_0087663
1766 Ga0495601_0366448
1767 Ga0495612_0001162
1768 Ga0495595_0042977
1769 Ga0495619_0005338
1770 Ga0500644_0037249
1771 Ga0500651_0106196
1772 Ga0500560_026558
1773 Ga0500594_0016023
1774 Ga0500559_0005329
1775 Ga0500622_0008298
1776 Ga0500622_0026514
1777 Ga0501084_0023194
1778 Ga0587070_005921
1779 Ga0587083_0034802
1780 Ga0587092_015679
1781 Ga0587071_011935
1782 Ga0501082_0015520
1783 Ga0530510_0076192
1784 2509370330
1785 2510895897
1786 2513611441
1787 2513632102
1788 2513712427
1789 2514017798
1790 2514423273
1791 2515635346
1792 2515646041
1793 2515654835
1794 2517037249
1795 2517096358
1796 2517408214
1797 2644340571
1798 2694629014
1799 2694637070
1800 2723575161
1801 2739248884
1802 2766066386
1803 2842115471
1804 2842218464
1805 2844012479
1806 2847670887
1807 2847692134
1808 2856316344
1809 2856338020
1810 2856354473
1811 2856361039
1812 2857370307
1813 2857516904
1814 2869174112
1815 2869238685
1816 2869244894
1817 2869254822
1818 2869259731
1819 2869264802
1820 2869276123
1821 2871438900
1822 2871447082
1823 2871453492
1824 2871463011
1825 2871484890
1826 2871496270
1827 2874117140
1828 2874132816
1829 2874165011
1830 2876370664
1831 2876379231
1832 2876387856
1833 2876405049
1834 2876408659
1835 2876427776
1836 2878041668
1837 2878753173
1838 2878760499
1839 2878767462
1840 2878777988
1841 2878784554
1842 2881151178
1843 2881158495
1844 2881167313
1845 2881861021
1846 2885348760
1847 2885355534
1848 2894026065
1849 2894772497
1850 2903521497
1851 2903541064
1852 2906330129
1853 2906377865
1854 2906401473
1855 2906411180
1856 2906416481
1857 2906646481
1858 2922157574
1859 2922164670
1860 2922178470
1861 2922185573
1862 2924716959
1863 2924728703
1864 2924738017
1865 2924750781
1866 2924754963
1867 2924791232
1868 2933591886
1869 2936371523
1870 2936376894
1871 2937866577
1872 2937897919
1873 2937987687
1874 2937994917
1875 2938017205
1876 2958118338
1877 2958128742
1878 2958140945
1879 2958162645
1880 2958165397
1881 2961138910
1882 2961163855
1883 2961176989
1884 2961186009
1885 2965018660
1886 2965025921
1887 2965034804
1888 2965040934
1889 2965050961
1890 2965069070
1891 2965092196
1892 2965105616
1893 2965114508
1894 2968096244
1895 2968098745
1896 2968119803
1897 2968129768
1898 2968140354
1899 2968172261
1900 2970509662
1901 2970514348
1902 2970535637
1903 2970551615
1904 2970555351
1905 2970623553
1906 2970629295
1907 2977822104
1908 2977834117
1909 2977855994
1910 2977866017
1911 2977873787
1912 2977904109
1913 2977912859
1914 2977916285
1915 2977942012
1916 2977957024
1917 2979774687
1918 2979814449
1919 2987646679
1920 2987659867
1921 2987677502
1922 2996346213
1923 2996389255
1924 3004168207
1925 3004188914
1926 3004199538
1927 3004238637
1928 3004246632
1929 3004250581
1930 3004274037
1931 639649675
1932 649872455
1933 8002392887
1934 8004307236
1935 8004374744
1936 8004643800
1937 8004709240
1938 8005382583
1939 8005561734
1940 8018163245
1941 8024486010
1942 8046773416
1943 8057878814

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

22

181

0.97

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

183

303

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

22

114

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gf2-assembly1.cif.gz_A crystal structure of human hydroxyisobutyrate dehydrogenase 0.955 1 283
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9547 2 283
4dll-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9537 2 285
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9516 1 282
4dll-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9498 1 288
ID Description Score Start End Superfamily
af_P77161_159_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9808 159 289 1.10.1040.10
af_Q8T079_480_601_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9806 167 282 1.10.1040.10
3pduA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9792 167 283 1.10.1040.10
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9782 2 162 3.40.50.720
3pefB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9761 167 282 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A352S2Q2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 1.006 68 157 GO:0050661
AF-A0A352S2Q2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9945 68 157 GO:0050661
AF-A0A1V5L763-F1-model_v4 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) 0.9865 36 290 GO:0008679
GO:0016054
GO:0050661
GO:0051287
AF-A0A1C2E3J6-F1-model_v4 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein 0.9853 136 287 GO:0051287
AF-A0A7Y1V436-F1-model_v4 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) 0.982 2 288 GO:0008679
GO:0016054
GO:0046487
GO:0050661
GO:0051287

Map