F487119
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 971 | 388 | 1942 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10002528|Ga0163162_100025282 |
| Length | 290 |
| Sequence | MGRVQQTIASSGEKCFHALFSTSIAAYSRFIAQFAPNRTGNAKLLMSQPDAEIVQFDNVGLRYGTGKEVLTDISFTLYPGCFYFLTGASGAGKTSLLKLLYLSQRPSRGLIRMFGTDAITLPRERLPGFRRRLGVVFQDFRLVPHLSAFDNVALPLRVAGVSEKEITKPVTEMLDWVGLGDRINARPATLSGGEQQRVAIARAVIARPDMLVADEPTGNVDPDMALKLLRLFESLNRLGTTVVVATHDLHLIRNVPESLIMRLDKGRLSDPTGALRYPPRRSTTSASGVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 210 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 218 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 219 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 220 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 221 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 224 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 225 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 226 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 227 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 228 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 229 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 230 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 231 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 303 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 304 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 305 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 306 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 309 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 310 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 311 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 312 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 313 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 324 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 330 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 343 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 345 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 347 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 350 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 364 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 365 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 366 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 368 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 369 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 370 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 371 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 372 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 373 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 374 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 375 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 376 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 377 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 378 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 379 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 380 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 381 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 382 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 383 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 384 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 385 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 386 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 387 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 388 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.84 |
| Metatranscriptomes | 0.21 |
| Isolates | 1.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.26 |
| Nodule | 0 |
| Rhizoplane | 4.22 |
| Rhizosphere | 73.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10002528 | 3300013306 | Bacteria | 17307 |
| 2 | SwRhRL2b_contig_1117632 | 2162886007 | Bacteria | 1287 |
| 3 | SwRhRL2b_contig_1955283 | 2162886007 | Bacteria | 9060 |
| 4 | SwRhRL2b_contig_2752641 | 2162886007 | Bacteria | 1143 |
| 5 | SwRhRL2b_contig_3948926 | 2162886007 | Bacteria | 15742 |
| 6 | JGI24736J21556_1001607 | 3300001904 | Bacteria | 4109 |
| 7 | JGI24741J21665_1000677 | 3300001915 | Bacteria | 10260 |
| 8 | JGI24752J21851_1004063 | 3300001976 | Bacteria | 1921 |
| 9 | JGI24740J21852_10002676 | 3300001979 | Bacteria | 7995 |
| 10 | JGI24739J22299_10012561 | 3300001989 | Bacteria | 3106 |
| 11 | JGI24737J22298_10002657 | 3300001990 | Bacteria | 6320 |
| 12 | JGI24737J22298_10003202 | 3300001990 | Bacteria | 5808 |
| 13 | JGI24737J22298_10018518 | 3300001990 | Bacteria | 2234 |
| 14 | JGI24735J21928_10000951 | 3300002067 | Bacteria | 10337 |
| 15 | JGI24748J21848_1001609 | 3300002074 | Bacteria | 2510 |
| 16 | JGI24738J21930_10001235 | 3300002075 | Bacteria | 7187 |
| 17 | JGI24738J21930_10005188 | 3300002075 | Bacteria | 3145 |
| 18 | JGI24742J22300_10016742 | 3300002244 | Bacteria | 1238 |
| 19 | JGI24751J29686_10000323 | 3300002459 | Bacteria | 17632 |
| 20 | JGI24751J29686_10019978 | 3300002459 | Bacteria | 1387 |
| 21 | JGI25150J39212_1000966 | 3300002774 | Bacteria | 9083 |
| 22 | JGI25151J46595_10005487 | 3300003187 | Bacteria | 6544 |
| 23 | JGI25153J46596_10000045 | 3300003215 | Bacteria | 149347 |
| 24 | Ga0055532_1011407 | 3300003758 | Bacteria | 1047 |
| 25 | Ga0055525_1000080 | 3300003759 | Bacteria | 164642 |
| 26 | Ga0055542_1000012 | 3300003762 | Bacteria | 391808 |
| 27 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 28 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 29 | Ga0055526_1004036 | 3300003771 | Bacteria | 9020 |
| 30 | Ga0055537_1002102 | 3300003773 | Bacteria | 6999 |
| 31 | Ga0055524_1000244 | 3300003775 | Bacteria | 56875 |
| 32 | Ga0055530_10000429 | 3300003791 | Bacteria | 37251 |
| 33 | Ga0055530_10005249 | 3300003791 | Bacteria | 6251 |
| 34 | Ga0055540_1001899 | 3300003792 | Bacteria | 11712 |
| 35 | Ga0055531_10000472 | 3300003794 | Bacteria | 37251 |
| 36 | Ga0055531_10009286 | 3300003794 | Bacteria | 5048 |
| 37 | Ga0055531_10022390 | 3300003794 | Bacteria | 2409 |
| 38 | Ga0055543_1020794 | 3300004625 | Bacteria | 1202 |
| 39 | Ga0065165_1002357 | 3300005262 | Bacteria | 16372 |
| 40 | Ga0065165_1007153 | 3300005262 | Bacteria | 5584 |
| 41 | Ga0065165_1038795 | 3300005262 | Bacteria | 1432 |
| 42 | Ga0065165_1042953 | 3300005262 | Bacteria | 1330 |
| 43 | Ga0065704_10075413 | 3300005289 | Bacteria | 5605 |
| 44 | Ga0065704_10082534 | 3300005289 | Bacteria | 3587 |
| 45 | Ga0065704_10129257 | 3300005289 | Bacteria | 1651 |
| 46 | Ga0065704_10173451 | 3300005289 | Bacteria | 1278 |
| 47 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 48 | Ga0070658_10000062 | 3300005327 | Bacteria | 107844 |
| 49 | Ga0070658_10000167 | 3300005327 | Bacteria | 57334 |
| 50 | Ga0070658_10004751 | 3300005327 | Bacteria | 11051 |
| 51 | Ga0070658_10017808 | 3300005327 | Bacteria | 5681 |
| 52 | Ga0070658_10044462 | 3300005327 | Bacteria | 3589 |
| 53 | Ga0070658_10054793 | 3300005327 | Bacteria | 3238 |
| 54 | Ga0070658_10102810 | 3300005327 | Bacteria | 2363 |
| 55 | Ga0070658_10115593 | 3300005327 | Bacteria | 2226 |
| 56 | Ga0070658_10158829 | 3300005327 | Bacteria | 1896 |
| 57 | Ga0070658_10275481 | 3300005327 | Bacteria | 1431 |
| 58 | Ga0070670_100025864 | 3300005331 | Bacteria | 5049 |
| 59 | Ga0070670_100059410 | 3300005331 | Bacteria | 3282 |
| 60 | Ga0070670_100084102 | 3300005331 | Bacteria | 2734 |
| 61 | Ga0070677_10000114 | 3300005333 | Bacteria | 26571 |
| 62 | Ga0068869_100126975 | 3300005334 | Bacteria | 1957 |
| 63 | Ga0070666_10001598 | 3300005335 | Bacteria | 13778 |
| 64 | Ga0070666_10005216 | 3300005335 | Bacteria | 7957 |
| 65 | Ga0070666_10025868 | 3300005335 | Bacteria | 3828 |
| 66 | Ga0070666_10298636 | 3300005335 | Bacteria | 1147 |
| 67 | Ga0070680_100002171 | 3300005336 | Bacteria | 14459 |
| 68 | Ga0070680_100112775 | 3300005336 | Bacteria | 2264 |
| 69 | Ga0070680_100512988 | 3300005336 | Bacteria | 1026 |
| 70 | Ga0070660_100000991 | 3300005339 | Bacteria | 19050 |
| 71 | Ga0070660_100001813 | 3300005339 | Bacteria | 14658 |
| 72 | Ga0070660_100003112 | 3300005339 | Bacteria | 11392 |
| 73 | Ga0070660_100007024 | 3300005339 | Bacteria | 7819 |
| 74 | Ga0070660_100045418 | 3300005339 | Bacteria | 3362 |
| 75 | Ga0070660_100173063 | 3300005339 | Bacteria | 1745 |
| 76 | Ga0070660_100182926 | 3300005339 | Bacteria | 1696 |
| 77 | Ga0070660_100264924 | 3300005339 | Bacteria | 1404 |
| 78 | Ga0070687_100219985 | 3300005343 | Bacteria | 1162 |
| 79 | Ga0070661_100006660 | 3300005344 | Bacteria | 7965 |
| 80 | Ga0070661_100006864 | 3300005344 | Bacteria | 7853 |
| 81 | Ga0070661_100097671 | 3300005344 | Bacteria | 2181 |
| 82 | Ga0070661_100121778 | 3300005344 | Bacteria | 1955 |
| 83 | Ga0070661_100248303 | 3300005344 | Bacteria | 1372 |
| 84 | Ga0070692_10000469 | 3300005345 | Bacteria | 12367 |
| 85 | Ga0070668_100000050 | 3300005347 | Bacteria | 73885 |
| 86 | Ga0070668_100001905 | 3300005347 | Bacteria | 15260 |
| 87 | Ga0070668_100010145 | 3300005347 | Bacteria | 6983 |
| 88 | Ga0070668_100037299 | 3300005347 | Bacteria | 3711 |
| 89 | Ga0070668_100084213 | 3300005347 | Bacteria | 2497 |
| 90 | Ga0070669_100000039 | 3300005353 | Bacteria | 135033 |
| 91 | Ga0070669_100000048 | 3300005353 | Bacteria | 118472 |
| 92 | Ga0070669_100000094 | 3300005353 | Bacteria | 87053 |
| 93 | Ga0070669_100002467 | 3300005353 | Bacteria | 13394 |
| 94 | Ga0070669_100007602 | 3300005353 | Bacteria | 7749 |
| 95 | Ga0070669_100039460 | 3300005353 | Bacteria | 3431 |
| 96 | Ga0070669_100105111 | 3300005353 | Bacteria | 2135 |
| 97 | Ga0070669_100257216 | 3300005353 | Bacteria | 1392 |
| 98 | Ga0070675_100106692 | 3300005354 | Bacteria | 2364 |
| 99 | Ga0070675_100142897 | 3300005354 | Bacteria | 2047 |
| 100 | Ga0070671_100000119 | 3300005355 | Bacteria | 51011 |
| 101 | Ga0070671_100000243 | 3300005355 | Bacteria | 36590 |
| 102 | Ga0070671_100007867 | 3300005355 | Bacteria | 8523 |
| 103 | Ga0070671_100119854 | 3300005355 | Bacteria | 2214 |
| 104 | Ga0070671_100129126 | 3300005355 | Bacteria | 2128 |
| 105 | Ga0070671_100134440 | 3300005355 | Bacteria | 2084 |
| 106 | Ga0070674_100039534 | 3300005356 | Bacteria | 3186 |
| 107 | Ga0070673_100039063 | 3300005364 | Bacteria | 3629 |
| 108 | Ga0070659_100000005 | 3300005366 | Bacteria | 259902 |
| 109 | Ga0070659_100014130 | 3300005366 | Bacteria | 5958 |
| 110 | Ga0070659_100017500 | 3300005366 | Bacteria | 5398 |
| 111 | Ga0070659_100154606 | 3300005366 | Bacteria | 1872 |
| 112 | Ga0070659_100157208 | 3300005366 | Bacteria | 1857 |
| 113 | Ga0070659_100243779 | 3300005366 | Bacteria | 1488 |
| 114 | Ga0070659_100251963 | 3300005366 | Bacteria | 1463 |
| 115 | Ga0070667_100000025 | 3300005367 | Bacteria | 190744 |
| 116 | Ga0070667_100000390 | 3300005367 | Bacteria | 47461 |
| 117 | Ga0070667_100000660 | 3300005367 | Bacteria | 33497 |
| 118 | Ga0070667_100017834 | 3300005367 | Bacteria | 5883 |
| 119 | Ga0070667_100022278 | 3300005367 | Bacteria | 5256 |
| 120 | Ga0070667_100045962 | 3300005367 | Bacteria | 3672 |
| 121 | Ga0070667_100049302 | 3300005367 | Bacteria | 3546 |
| 122 | Ga0070667_100070472 | 3300005367 | Bacteria | 2976 |
| 123 | Ga0070667_100313234 | 3300005367 | Bacteria | 1415 |
| 124 | Ga0070705_100076287 | 3300005440 | Bacteria | 2044 |
| 125 | Ga0070708_100019346 | 3300005445 | Bacteria | 5720 |
| 126 | Ga0070663_100012592 | 3300005455 | Bacteria | 5358 |
| 127 | Ga0070663_100094978 | 3300005455 | Bacteria | 2215 |
| 128 | Ga0070663_100151440 | 3300005455 | Bacteria | 1779 |
| 129 | Ga0070663_100329408 | 3300005455 | Bacteria | 1230 |
| 130 | Ga0070678_100002558 | 3300005456 | Bacteria | 9990 |
| 131 | Ga0070662_100000795 | 3300005457 | Bacteria | 19378 |
| 132 | Ga0070662_100004642 | 3300005457 | Bacteria | 8709 |
| 133 | Ga0070662_100034298 | 3300005457 | Bacteria | 3578 |
| 134 | Ga0070662_100057763 | 3300005457 | Bacteria | 2820 |
| 135 | Ga0070662_100070881 | 3300005457 | Bacteria | 2568 |
| 136 | Ga0070681_10032181 | 3300005458 | Bacteria | 5263 |
| 137 | Ga0070681_10044606 | 3300005458 | Bacteria | 4439 |
| 138 | Ga0070698_100134563 | 3300005471 | Bacteria | 2426 |
| 139 | Ga0070679_100001927 | 3300005530 | Bacteria | 18644 |
| 140 | Ga0070679_100022137 | 3300005530 | Bacteria | 6210 |
| 141 | Ga0070679_100032968 | 3300005530 | Bacteria | 5126 |
| 142 | Ga0070679_100780336 | 3300005530 | Bacteria | 899 |
| 143 | Ga0070684_100077170 | 3300005535 | Bacteria | 2942 |
| 144 | Ga0070684_100302988 | 3300005535 | Bacteria | 1466 |
| 145 | Ga0068853_100003449 | 3300005539 | Bacteria | 12095 |
| 146 | Ga0068853_100022626 | 3300005539 | Bacteria | 5252 |
| 147 | Ga0068853_100030617 | 3300005539 | Bacteria | 4547 |
| 148 | Ga0068853_100118110 | 3300005539 | Bacteria | 2363 |
| 149 | Ga0068853_100359093 | 3300005539 | Bacteria | 1357 |
| 150 | Ga0068853_100455372 | 3300005539 | Bacteria | 1204 |
| 151 | Ga0070672_100018880 | 3300005543 | Bacteria | 4994 |
| 152 | Ga0070672_100150810 | 3300005543 | Bacteria | 1923 |
| 153 | Ga0070686_100000191 | 3300005544 | Bacteria | 42686 |
| 154 | Ga0070665_100000088 | 3300005548 | Bacteria | 177729 |
| 155 | Ga0070665_100000168 | 3300005548 | Bacteria | 119133 |
| 156 | Ga0070665_100001278 | 3300005548 | Bacteria | 30172 |
| 157 | Ga0070665_100003938 | 3300005548 | Bacteria | 15667 |
| 158 | Ga0070665_100019960 | 3300005548 | Bacteria | 6730 |
| 159 | Ga0070665_100090309 | 3300005548 | Bacteria | 3069 |
| 160 | Ga0070665_100105251 | 3300005548 | Bacteria | 2823 |
| 161 | Ga0068855_100001435 | 3300005563 | Bacteria | 29650 |
| 162 | Ga0068855_100021313 | 3300005563 | Bacteria | 7771 |
| 163 | Ga0068855_100026517 | 3300005563 | Bacteria | 6932 |
| 164 | Ga0068855_100037627 | 3300005563 | Bacteria | 5753 |
| 165 | Ga0068855_100039611 | 3300005563 | Bacteria | 5594 |
| 166 | Ga0068855_100188948 | 3300005563 | Bacteria | 2325 |
| 167 | Ga0068855_100476651 | 3300005563 | Bacteria | 1359 |
| 168 | Ga0070664_100019373 | 3300005564 | Bacteria | 5599 |
| 169 | Ga0070664_100023476 | 3300005564 | Bacteria | 5095 |
| 170 | Ga0070664_100119593 | 3300005564 | Bacteria | 2305 |
| 171 | Ga0070664_100611300 | 3300005564 | Bacteria | 1011 |
| 172 | Ga0068857_100036896 | 3300005577 | Bacteria | 4329 |
| 173 | Ga0068857_100096790 | 3300005577 | Bacteria | 2645 |
| 174 | Ga0068857_100232343 | 3300005577 | Bacteria | 1687 |
| 175 | Ga0068857_100273925 | 3300005577 | Bacteria | 1551 |
| 176 | Ga0068857_100288371 | 3300005577 | Bacteria | 1511 |
| 177 | Ga0068857_100850541 | 3300005577 | Bacteria | 873 |
| 178 | Ga0068854_100001399 | 3300005578 | Bacteria | 14551 |
| 179 | Ga0068854_100173017 | 3300005578 | Bacteria | 1681 |
| 180 | Ga0068854_100215264 | 3300005578 | Bacteria | 1517 |
| 181 | Ga0068854_100264331 | 3300005578 | Bacteria | 1379 |
| 182 | Ga0068854_100311138 | 3300005578 | Bacteria | 1277 |
| 183 | Ga0068856_100003976 | 3300005614 | Bacteria | 14808 |
| 184 | Ga0068856_100009259 | 3300005614 | Bacteria | 9568 |
| 185 | Ga0068856_100052680 | 3300005614 | Bacteria | 4013 |
| 186 | Ga0068856_100369712 | 3300005614 | Bacteria | 1453 |
| 187 | Ga0068852_100000919 | 3300005616 | Bacteria | 19508 |
| 188 | Ga0068852_100050975 | 3300005616 | Bacteria | 3549 |
| 189 | Ga0068852_100264633 | 3300005616 | Bacteria | 1652 |
| 190 | Ga0068852_100349433 | 3300005616 | Bacteria | 1443 |
| 191 | Ga0068852_100769502 | 3300005616 | Bacteria | 976 |
| 192 | Ga0068852_100892356 | 3300005616 | Bacteria | 906 |
| 193 | Ga0068859_100015185 | 3300005617 | Bacteria | 7730 |
| 194 | Ga0068859_100033051 | 3300005617 | Bacteria | 5196 |
| 195 | Ga0068864_100002231 | 3300005618 | Bacteria | 16006 |
| 196 | Ga0068864_100008568 | 3300005618 | Bacteria | 8440 |
| 197 | Ga0068851_10018950 | 3300005834 | Bacteria | 3322 |
| 198 | Ga0068851_10121208 | 3300005834 | Bacteria | 1405 |
| 199 | Ga0068851_10130618 | 3300005834 | Bacteria | 1358 |
| 200 | Ga0068863_100000058 | 3300005841 | Bacteria | 123096 |
| 201 | Ga0068863_100000187 | 3300005841 | Bacteria | 65873 |
| 202 | Ga0068863_100001079 | 3300005841 | Bacteria | 27286 |
| 203 | Ga0068863_100006943 | 3300005841 | Bacteria | 11101 |
| 204 | Ga0068863_100035369 | 3300005841 | Bacteria | 4758 |
| 205 | Ga0068863_100039107 | 3300005841 | Bacteria | 4514 |
| 206 | Ga0068863_100097701 | 3300005841 | Bacteria | 2789 |
| 207 | Ga0068858_100017541 | 3300005842 | Bacteria | 6714 |
| 208 | Ga0068858_100027896 | 3300005842 | Bacteria | 5245 |
| 209 | Ga0068858_100069896 | 3300005842 | Bacteria | 3254 |
| 210 | Ga0068858_100602663 | 3300005842 | Bacteria | 1065 |
| 211 | Ga0068860_100000057 | 3300005843 | Bacteria | 201847 |
| 212 | Ga0068860_100003627 | 3300005843 | Bacteria | 15876 |
| 213 | Ga0068860_100021480 | 3300005843 | Bacteria | 6249 |
| 214 | Ga0068860_100024116 | 3300005843 | Bacteria | 5881 |
| 215 | Ga0068860_100058249 | 3300005843 | Bacteria | 3672 |
| 216 | Ga0068860_100058391 | 3300005843 | Bacteria | 3667 |
| 217 | Ga0068860_100096730 | 3300005843 | Bacteria | 2814 |
| 218 | Ga0068862_100000191 | 3300005844 | Bacteria | 67742 |
| 219 | Ga0068862_100032566 | 3300005844 | Bacteria | 4405 |
| 220 | Ga0068862_100054582 | 3300005844 | Bacteria | 3421 |
| 221 | Ga0081539_10019651 | 3300005985 | Bacteria | 4612 |
| 222 | Ga0075368_10000565 | 3300006042 | Bacteria | 11108 |
| 223 | Ga0075364_10040053 | 3300006051 | Bacteria | 3039 |
| 224 | Ga0075364_10079961 | 3300006051 | Bacteria | 2161 |
| 225 | Ga0075432_10002220 | 3300006058 | Bacteria | 6464 |
| 226 | Ga0075362_10000029 | 3300006177 | Bacteria | 56587 |
| 227 | Ga0075362_10058309 | 3300006177 | Bacteria | 1741 |
| 228 | Ga0075367_10007298 | 3300006178 | Bacteria | 5652 |
| 229 | Ga0075369_10015041 | 3300006186 | Bacteria | 3100 |
| 230 | Ga0075369_10040936 | 3300006186 | Bacteria | 1982 |
| 231 | Ga0075366_10052037 | 3300006195 | Bacteria | 2433 |
| 232 | Ga0097621_100122169 | 3300006237 | Bacteria | 2210 |
| 233 | Ga0075370_10000011 | 3300006353 | Bacteria | 66429 |
| 234 | Ga0075370_10002340 | 3300006353 | Bacteria | 8759 |
| 235 | Ga0075370_10175836 | 3300006353 | Bacteria | 1259 |
| 236 | Ga0075370_10218609 | 3300006353 | Bacteria | 1126 |
| 237 | Ga0075434_100248156 | 3300006871 | Bacteria | 1799 |
| 238 | Ga0075429_100105775 | 3300006880 | Bacteria | 2458 |
| 239 | Ga0097620_100015185 | 3300006931 | Bacteria | 7730 |
| 240 | Ga0097620_100023748 | 3300006931 | Bacteria | 6154 |
| 241 | Ga0097620_100033051 | 3300006931 | Bacteria | 5196 |
| 242 | Ga0105251_10000276 | 3300009011 | Bacteria | 51560 |
| 243 | Ga0105251_10008893 | 3300009011 | Bacteria | 6011 |
| 244 | Ga0105251_10035720 | 3300009011 | Bacteria | 2450 |
| 245 | Ga0105250_10009073 | 3300009092 | Bacteria | 4201 |
| 246 | Ga0105240_10003393 | 3300009093 | Bacteria | 24772 |
| 247 | Ga0105240_10010858 | 3300009093 | Bacteria | 12756 |
| 248 | Ga0105240_10252079 | 3300009093 | Bacteria | 2041 |
| 249 | Ga0105240_10269265 | 3300009093 | Bacteria | 1962 |
| 250 | Ga0105240_10319237 | 3300009093 | Bacteria | 1771 |
| 251 | Ga0105240_10501760 | 3300009093 | Bacteria | 1349 |
| 252 | Ga0105247_10033832 | 3300009101 | Bacteria | 3111 |
| 253 | Ga0114129_10441353 | 3300009147 | Bacteria | 1708 |
| 254 | Ga0105243_10001077 | 3300009148 | Bacteria | 24977 |
| 255 | Ga0105243_10094543 | 3300009148 | Bacteria | 2468 |
| 256 | Ga0105243_10155385 | 3300009148 | Bacteria | 1967 |
| 257 | Ga0105243_10326533 | 3300009148 | Bacteria | 1400 |
| 258 | Ga0105241_10002141 | 3300009174 | Bacteria | 14918 |
| 259 | Ga0105241_10028145 | 3300009174 | Bacteria | 4186 |
| 260 | Ga0105241_10650088 | 3300009174 | Bacteria | 958 |
| 261 | Ga0105248_10026581 | 3300009177 | Bacteria | 6437 |
| 262 | Ga0105248_10068994 | 3300009177 | Bacteria | 3969 |
| 263 | Ga0105237_10001660 | 3300009545 | Bacteria | 28885 |
| 264 | Ga0105237_10017714 | 3300009545 | Bacteria | 7383 |
| 265 | Ga0105237_10443373 | 3300009545 | Bacteria | 1304 |
| 266 | Ga0105237_10512954 | 3300009545 | Bacteria | 1205 |
| 267 | Ga0105238_10370976 | 3300009551 | Bacteria | 1421 |
| 268 | Ga0105238_10797365 | 3300009551 | Bacteria | 960 |
| 269 | Ga0105249_10002820 | 3300009553 | Bacteria | 14999 |
| 270 | Ga0105249_10007484 | 3300009553 | Bacteria | 9528 |
| 271 | Ga0105249_10057499 | 3300009553 | Bacteria | 3563 |
| 272 | Ga0105249_10101485 | 3300009553 | Bacteria | 2706 |
| 273 | Ga0105249_10398377 | 3300009553 | Bacteria | 1406 |
| 274 | Ga0105148_100452 | 3300009978 | Bacteria | 3936 |
| 275 | Ga0105239_10002472 | 3300010375 | Bacteria | 23554 |
| 276 | Ga0105246_10001372 | 3300011119 | Bacteria | 14354 |
| 277 | Ga0105246_10951712 | 3300011119 | Bacteria | 774 |
| 278 | Ga0157327_1001126 | 3300012512 | Bacteria | 1611 |
| 279 | Ga0157373_10003673 | 3300013100 | Bacteria | 11604 |
| 280 | Ga0157373_10014350 | 3300013100 | Bacteria | 5805 |
| 281 | Ga0157373_10109959 | 3300013100 | Bacteria | 1937 |
| 282 | Ga0157371_10000062 | 3300013102 | Bacteria | 169669 |
| 283 | Ga0157371_10002207 | 3300013102 | Bacteria | 18854 |
| 284 | Ga0157371_10021083 | 3300013102 | Bacteria | 4790 |
| 285 | Ga0157371_10504304 | 3300013102 | Bacteria | 894 |
| 286 | Ga0157370_10005110 | 3300013104 | Bacteria | 14804 |
| 287 | Ga0157370_10051227 | 3300013104 | Bacteria | 3943 |
| 288 | Ga0157370_10074081 | 3300013104 | Bacteria | 3212 |
| 289 | Ga0157369_10118596 | 3300013105 | Bacteria | 2809 |
| 290 | Ga0157369_10167954 | 3300013105 | Bacteria | 2313 |
| 291 | Ga0157369_10240104 | 3300013105 | Bacteria | 1893 |
| 292 | Ga0157378_10006122 | 3300013297 | Bacteria | 10534 |
| 293 | Ga0163162_10000232 | 3300013306 | Bacteria | 51019 |
| 294 | Ga0163162_10010482 | 3300013306 | Bacteria | 9011 |
| 295 | Ga0163162_10023635 | 3300013306 | Bacteria | 6068 |
| 296 | Ga0157372_10007274 | 3300013307 | Bacteria | 11788 |
| 297 | Ga0157372_10014494 | 3300013307 | Bacteria | 8436 |
| 298 | Ga0157372_10128915 | 3300013307 | Bacteria | 2909 |
| 299 | Ga0157372_10137500 | 3300013307 | Bacteria | 2814 |
| 300 | Ga0157372_10357253 | 3300013307 | Bacteria | 1702 |
| 301 | Ga0157372_10497766 | 3300013307 | Bacteria | 1421 |
| 302 | Ga0157375_10107516 | 3300013308 | Bacteria | 2883 |
| 303 | Ga0157375_10548635 | 3300013308 | Bacteria | 1318 |
| 304 | Ga0157375_11003094 | 3300013308 | Bacteria | 975 |
| 305 | Ga0163163_10028485 | 3300014325 | Bacteria | 5365 |
| 306 | Ga0163163_10655296 | 3300014325 | Bacteria | 1113 |
| 307 | Ga0157379_10150015 | 3300014968 | Bacteria | 2103 |
| 308 | Ga0157379_10323996 | 3300014968 | Bacteria | 1407 |
| 309 | Ga0157376_11034093 | 3300014969 | Bacteria | 845 |
| 310 | Ga0163161_10065480 | 3300017792 | Bacteria | 2652 |
| 311 | Ga0163161_10117356 | 3300017792 | Bacteria | 1996 |
| 312 | Ga0163161_10123799 | 3300017792 | Bacteria | 1945 |
| 313 | Ga0206356_10967351 | 3300020070 | Bacteria | 1154 |
| 314 | Ga0206353_11419480 | 3300020082 | Bacteria | 1555 |
| 315 | Ga0213873_10000026 | 3300021358 | Bacteria | 74525 |
| 316 | Ga0213876_10000149 | 3300021384 | Bacteria | 74548 |
| 317 | Ga0213876_10000371 | 3300021384 | Bacteria | 38154 |
| 318 | Ga0213876_10012241 | 3300021384 | Bacteria | 4567 |
| 319 | Ga0209674_104378 | 3300025226 | Bacteria | 2310 |
| 320 | Ga0209147_100882 | 3300025229 | Bacteria | 13811 |
| 321 | Ga0209563_100058 | 3300025230 | Bacteria | 302571 |
| 322 | Ga0209677_109030 | 3300025253 | Bacteria | 1841 |
| 323 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 324 | Ga0209129_1003496 | 3300025258 | Bacteria | 6786 |
| 325 | Ga0209565_1000029 | 3300025263 | Bacteria | 340335 |
| 326 | Ga0209565_1000251 | 3300025263 | Bacteria | 57054 |
| 327 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 328 | Ga0209673_1009829 | 3300025273 | Bacteria | 4098 |
| 329 | Ga0209673_1025148 | 3300025273 | Bacteria | 1985 |
| 330 | Ga0209025_1000993 | 3300025294 | Bacteria | 42002 |
| 331 | Ga0209025_1103877 | 3300025294 | Bacteria | 891 |
| 332 | Ga0209564_1001873 | 3300025295 | Bacteria | 18970 |
| 333 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 334 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 335 | Ga0209758_1010016 | 3300025297 | Bacteria | 5756 |
| 336 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 337 | Ga0209050_1000167 | 3300025298 | Bacteria | 151608 |
| 338 | Ga0209050_1005376 | 3300025298 | Bacteria | 8093 |
| 339 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 340 | Ga0209051_1000360 | 3300025303 | Bacteria | 67080 |
| 341 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 342 | Ga0209257_1000893 | 3300025304 | Bacteria | 41890 |
| 343 | Ga0209257_1007672 | 3300025304 | Bacteria | 6448 |
| 344 | Ga0209257_1014531 | 3300025304 | Bacteria | 3375 |
| 345 | Ga0209257_1015466 | 3300025304 | Bacteria | 3172 |
| 346 | Ga0207656_10009546 | 3300025321 | Bacteria | 3605 |
| 347 | Ga0207656_10079668 | 3300025321 | Bacteria | 1470 |
| 348 | Ga0207656_10090765 | 3300025321 | Bacteria | 1386 |
| 349 | Ga0207696_1005122 | 3300025711 | Bacteria | 5504 |
| 350 | Ga0207713_1002506 | 3300025735 | Bacteria | 13305 |
| 351 | Ga0207682_10002396 | 3300025893 | Bacteria | 8436 |
| 352 | Ga0207710_10003855 | 3300025900 | Bacteria | 6629 |
| 353 | Ga0207710_10050837 | 3300025900 | Bacteria | 1860 |
| 354 | Ga0207688_10172340 | 3300025901 | Bacteria | 1287 |
| 355 | Ga0207680_10000817 | 3300025903 | Bacteria | 14674 |
| 356 | Ga0207680_10003518 | 3300025903 | Bacteria | 7370 |
| 357 | Ga0207680_10092063 | 3300025903 | Bacteria | 1931 |
| 358 | Ga0207680_10360599 | 3300025903 | Bacteria | 1022 |
| 359 | Ga0207647_10004690 | 3300025904 | Bacteria | 10121 |
| 360 | Ga0207647_10007524 | 3300025904 | Bacteria | 7859 |
| 361 | Ga0207647_10017114 | 3300025904 | Bacteria | 4935 |
| 362 | Ga0207647_10040920 | 3300025904 | Bacteria | 2916 |
| 363 | Ga0207647_10169648 | 3300025904 | Bacteria | 1271 |
| 364 | Ga0207645_10140691 | 3300025907 | Bacteria | 1572 |
| 365 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 366 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 367 | Ga0207705_10000103 | 3300025909 | Bacteria | 97511 |
| 368 | Ga0207705_10002703 | 3300025909 | Bacteria | 13568 |
| 369 | Ga0207705_10046649 | 3300025909 | Bacteria | 3114 |
| 370 | Ga0207705_10047290 | 3300025909 | Bacteria | 3094 |
| 371 | Ga0207705_10089732 | 3300025909 | Bacteria | 2250 |
| 372 | Ga0207705_10146704 | 3300025909 | Bacteria | 1766 |
| 373 | Ga0207654_10000150 | 3300025911 | Bacteria | 44134 |
| 374 | Ga0207654_10080212 | 3300025911 | Bacteria | 1962 |
| 375 | Ga0207707_10023608 | 3300025912 | Bacteria | 5379 |
| 376 | Ga0207707_10042890 | 3300025912 | Bacteria | 3948 |
| 377 | Ga0207707_10342203 | 3300025912 | Bacteria | 1289 |
| 378 | Ga0207695_10013603 | 3300025913 | Bacteria | 9692 |
| 379 | Ga0207695_10018738 | 3300025913 | Bacteria | 7991 |
| 380 | Ga0207695_10028019 | 3300025913 | Bacteria | 6257 |
| 381 | Ga0207695_10132032 | 3300025913 | Bacteria | 2454 |
| 382 | Ga0207695_10216992 | 3300025913 | Bacteria | 1821 |
| 383 | Ga0207671_10000567 | 3300025914 | Bacteria | 49547 |
| 384 | Ga0207671_10007737 | 3300025914 | Bacteria | 9257 |
| 385 | Ga0207671_10034313 | 3300025914 | Bacteria | 3770 |
| 386 | Ga0207660_10018096 | 3300025917 | Bacteria | 4693 |
| 387 | Ga0207660_10463219 | 3300025917 | Bacteria | 1026 |
| 388 | Ga0207657_10002582 | 3300025919 | Bacteria | 19592 |
| 389 | Ga0207657_10002937 | 3300025919 | Bacteria | 18285 |
| 390 | Ga0207657_10003198 | 3300025919 | Bacteria | 17527 |
| 391 | Ga0207657_10008473 | 3300025919 | Bacteria | 10431 |
| 392 | Ga0207657_10020085 | 3300025919 | Bacteria | 6325 |
| 393 | Ga0207657_10088520 | 3300025919 | Bacteria | 2588 |
| 394 | Ga0207657_10406177 | 3300025919 | Bacteria | 1071 |
| 395 | Ga0207649_10003386 | 3300025920 | Bacteria | 8721 |
| 396 | Ga0207649_10013635 | 3300025920 | Bacteria | 4541 |
| 397 | Ga0207649_10312493 | 3300025920 | Bacteria | 1152 |
| 398 | Ga0207652_10000489 | 3300025921 | Bacteria | 40293 |
| 399 | Ga0207652_10026835 | 3300025921 | Bacteria | 4799 |
| 400 | Ga0207652_10029162 | 3300025921 | Bacteria | 4611 |
| 401 | Ga0207652_10095574 | 3300025921 | Bacteria | 2618 |
| 402 | Ga0207652_10612319 | 3300025921 | Bacteria | 976 |
| 403 | Ga0207681_10000050 | 3300025923 | Bacteria | 118481 |
| 404 | Ga0207681_10000144 | 3300025923 | Bacteria | 59200 |
| 405 | Ga0207681_10001096 | 3300025923 | Bacteria | 17540 |
| 406 | Ga0207681_10003059 | 3300025923 | Bacteria | 10513 |
| 407 | Ga0207681_10005654 | 3300025923 | Bacteria | 7674 |
| 408 | Ga0207681_10133717 | 3300025923 | Bacteria | 1837 |
| 409 | Ga0207681_10159210 | 3300025923 | Bacteria | 1700 |
| 410 | Ga0207694_10131777 | 3300025924 | Bacteria | 2004 |
| 411 | Ga0207650_10067376 | 3300025925 | Bacteria | 2686 |
| 412 | Ga0207650_10228576 | 3300025925 | Bacteria | 1500 |
| 413 | Ga0207650_10268151 | 3300025925 | Bacteria | 1387 |
| 414 | Ga0207650_10374090 | 3300025925 | Bacteria | 1176 |
| 415 | Ga0207659_10115202 | 3300025926 | Bacteria | 2050 |
| 416 | Ga0207644_10000056 | 3300025931 | Bacteria | 84033 |
| 417 | Ga0207644_10000134 | 3300025931 | Bacteria | 53152 |
| 418 | Ga0207644_10000367 | 3300025931 | Bacteria | 29435 |
| 419 | Ga0207644_10027263 | 3300025931 | Bacteria | 3946 |
| 420 | Ga0207644_10097687 | 3300025931 | Bacteria | 2200 |
| 421 | Ga0207644_10123750 | 3300025931 | Bacteria | 1972 |
| 422 | Ga0207644_10160788 | 3300025931 | Bacteria | 1746 |
| 423 | Ga0207644_10174712 | 3300025931 | Bacteria | 1679 |
| 424 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 425 | Ga0207690_10001516 | 3300025932 | Bacteria | 14528 |
| 426 | Ga0207690_10002450 | 3300025932 | Bacteria | 11213 |
| 427 | Ga0207690_10022186 | 3300025932 | Bacteria | 3946 |
| 428 | Ga0207690_10228960 | 3300025932 | Bacteria | 1426 |
| 429 | Ga0207706_10002382 | 3300025933 | Bacteria | 18355 |
| 430 | Ga0207706_10030470 | 3300025933 | Bacteria | 4811 |
| 431 | Ga0207706_10048453 | 3300025933 | Bacteria | 3758 |
| 432 | Ga0207706_10053084 | 3300025933 | Bacteria | 3578 |
| 433 | Ga0207706_10080509 | 3300025933 | Bacteria | 2864 |
| 434 | Ga0207706_10087295 | 3300025933 | Bacteria | 2743 |
| 435 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 436 | Ga0207709_10253795 | 3300025935 | Bacteria | 1286 |
| 437 | Ga0207669_10000174 | 3300025937 | Bacteria | 30026 |
| 438 | Ga0207691_10033158 | 3300025940 | Bacteria | 4810 |
| 439 | Ga0207691_10268079 | 3300025940 | Bacteria | 1471 |
| 440 | Ga0207711_10021765 | 3300025941 | Bacteria | 5354 |
| 441 | Ga0207689_10075646 | 3300025942 | Bacteria | 2768 |
| 442 | Ga0207661_10030507 | 3300025944 | Bacteria | 4154 |
| 443 | Ga0207661_10032877 | 3300025944 | Bacteria | 4023 |
| 444 | Ga0207661_10674760 | 3300025944 | Bacteria | 950 |
| 445 | Ga0207679_10015535 | 3300025945 | Bacteria | 5034 |
| 446 | Ga0207679_10053837 | 3300025945 | Bacteria | 2960 |
| 447 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 448 | Ga0207667_10001089 | 3300025949 | Bacteria | 34437 |
| 449 | Ga0207667_10002432 | 3300025949 | Bacteria | 23319 |
| 450 | Ga0207667_10009256 | 3300025949 | Bacteria | 11628 |
| 451 | Ga0207667_10043432 | 3300025949 | Bacteria | 4770 |
| 452 | Ga0207667_10105863 | 3300025949 | Bacteria | 2902 |
| 453 | Ga0207667_10108443 | 3300025949 | Bacteria | 2864 |
| 454 | Ga0207667_10484163 | 3300025949 | Bacteria | 1256 |
| 455 | Ga0207651_10080622 | 3300025960 | Bacteria | 2343 |
| 456 | Ga0207712_10001292 | 3300025961 | Bacteria | 17177 |
| 457 | Ga0207712_10007474 | 3300025961 | Bacteria | 6899 |
| 458 | Ga0207712_10011280 | 3300025961 | Bacteria | 5688 |
| 459 | Ga0207712_10071925 | 3300025961 | Bacteria | 2489 |
| 460 | Ga0207668_10000094 | 3300025972 | Bacteria | 63810 |
| 461 | Ga0207668_10000436 | 3300025972 | Bacteria | 26329 |
| 462 | Ga0207668_10068584 | 3300025972 | Bacteria | 2522 |
| 463 | Ga0207668_10093353 | 3300025972 | Bacteria | 2217 |
| 464 | Ga0207668_10171525 | 3300025972 | Bacteria | 1702 |
| 465 | Ga0207640_10004898 | 3300025981 | Bacteria | 7275 |
| 466 | Ga0207640_10007874 | 3300025981 | Bacteria | 5880 |
| 467 | Ga0207640_10013210 | 3300025981 | Bacteria | 4727 |
| 468 | Ga0207640_10038253 | 3300025981 | Bacteria | 3026 |
| 469 | Ga0207640_10070550 | 3300025981 | Bacteria | 2350 |
| 470 | Ga0207640_10092308 | 3300025981 | Bacteria | 2100 |
| 471 | Ga0207640_10268623 | 3300025981 | Bacteria | 1333 |
| 472 | Ga0207640_10284912 | 3300025981 | Bacteria | 1300 |
| 473 | Ga0207658_10000023 | 3300025986 | Bacteria | 190806 |
| 474 | Ga0207658_10000216 | 3300025986 | Bacteria | 60563 |
| 475 | Ga0207658_10002737 | 3300025986 | Bacteria | 12730 |
| 476 | Ga0207658_10003041 | 3300025986 | Bacteria | 11988 |
| 477 | Ga0207658_10008354 | 3300025986 | Bacteria | 7047 |
| 478 | Ga0207658_10010305 | 3300025986 | Bacteria | 6352 |
| 479 | Ga0207658_10061944 | 3300025986 | Bacteria | 2798 |
| 480 | Ga0207658_10115529 | 3300025986 | Bacteria | 2130 |
| 481 | Ga0207677_10000100 | 3300026023 | Bacteria | 70908 |
| 482 | Ga0207677_10226311 | 3300026023 | Bacteria | 1503 |
| 483 | Ga0207703_10002369 | 3300026035 | Bacteria | 16392 |
| 484 | Ga0207703_10003301 | 3300026035 | Bacteria | 13539 |
| 485 | Ga0207703_10019876 | 3300026035 | Bacteria | 5249 |
| 486 | Ga0207703_10105257 | 3300026035 | Bacteria | 2398 |
| 487 | Ga0207703_10305518 | 3300026035 | Bacteria | 1452 |
| 488 | Ga0207639_10001191 | 3300026041 | Bacteria | 17663 |
| 489 | Ga0207639_10003214 | 3300026041 | Bacteria | 10985 |
| 490 | Ga0207639_10007673 | 3300026041 | Bacteria | 7364 |
| 491 | Ga0207639_10041254 | 3300026041 | Bacteria | 3451 |
| 492 | Ga0207639_10097932 | 3300026041 | Bacteria | 2363 |
| 493 | Ga0207639_10182258 | 3300026041 | Bacteria | 1787 |
| 494 | Ga0207639_10287754 | 3300026041 | Bacteria | 1448 |
| 495 | Ga0207678_10000079 | 3300026067 | Bacteria | 78764 |
| 496 | Ga0207678_10013240 | 3300026067 | Bacteria | 7238 |
| 497 | Ga0207678_10091516 | 3300026067 | Bacteria | 2600 |
| 498 | Ga0207678_10320248 | 3300026067 | Bacteria | 1334 |
| 499 | Ga0207702_10001332 | 3300026078 | Bacteria | 24705 |
| 500 | Ga0207702_10013826 | 3300026078 | Bacteria | 6703 |
| 501 | Ga0207702_10041221 | 3300026078 | Bacteria | 3871 |
| 502 | Ga0207702_10187154 | 3300026078 | Bacteria | 1910 |
| 503 | Ga0207702_10338539 | 3300026078 | Bacteria | 1437 |
| 504 | Ga0207641_10000269 | 3300026088 | Bacteria | 66008 |
| 505 | Ga0207641_10002412 | 3300026088 | Bacteria | 17264 |
| 506 | Ga0207641_10003855 | 3300026088 | Bacteria | 13129 |
| 507 | Ga0207641_10004669 | 3300026088 | Bacteria | 11816 |
| 508 | Ga0207641_10004972 | 3300026088 | Bacteria | 11403 |
| 509 | Ga0207641_10017468 | 3300026088 | Bacteria | 5873 |
| 510 | Ga0207641_10089951 | 3300026088 | Bacteria | 2683 |
| 511 | Ga0207641_10127064 | 3300026088 | Bacteria | 2284 |
| 512 | Ga0207676_10001569 | 3300026095 | Bacteria | 16846 |
| 513 | Ga0207676_10027677 | 3300026095 | Bacteria | 4224 |
| 514 | Ga0207676_10032111 | 3300026095 | Bacteria | 3954 |
| 515 | Ga0207676_10111941 | 3300026095 | Bacteria | 2286 |
| 516 | Ga0207674_10016564 | 3300026116 | Bacteria | 8062 |
| 517 | Ga0207674_10028880 | 3300026116 | Bacteria | 5846 |
| 518 | Ga0207674_10124108 | 3300026116 | Bacteria | 2548 |
| 519 | Ga0207674_10124747 | 3300026116 | Bacteria | 2541 |
| 520 | Ga0207674_10810575 | 3300026116 | Bacteria | 903 |
| 521 | Ga0207675_100009530 | 3300026118 | Bacteria | 9083 |
| 522 | Ga0207683_10003668 | 3300026121 | Bacteria | 13351 |
| 523 | Ga0207683_10230163 | 3300026121 | Bacteria | 1690 |
| 524 | Ga0207698_10000019 | 3300026142 | Bacteria | 145910 |
| 525 | Ga0207698_10000186 | 3300026142 | Bacteria | 38318 |
| 526 | Ga0207698_10028185 | 3300026142 | Bacteria | 4001 |
| 527 | Ga0207698_10041197 | 3300026142 | Bacteria | 3439 |
| 528 | Ga0207698_10788321 | 3300026142 | Bacteria | 952 |
| 529 | Ga0207698_10812398 | 3300026142 | Bacteria | 938 |
| 530 | Ga0209813_10001114 | 3300027866 | Bacteria | 5991 |
| 531 | Ga0207428_10069745 | 3300027907 | Bacteria | 2764 |
| 532 | Ga0268266_10000074 | 3300028379 | Bacteria | 230993 |
| 533 | Ga0268266_10000130 | 3300028379 | Bacteria | 147912 |
| 534 | Ga0268266_10001691 | 3300028379 | Bacteria | 25327 |
| 535 | Ga0268266_10002428 | 3300028379 | Bacteria | 20045 |
| 536 | Ga0268266_10002447 | 3300028379 | Bacteria | 19919 |
| 537 | Ga0268266_10019026 | 3300028379 | Bacteria | 5850 |
| 538 | Ga0268266_10416723 | 3300028379 | Bacteria | 1272 |
| 539 | Ga0268265_10000102 | 3300028380 | Bacteria | 106737 |
| 540 | Ga0268265_10000271 | 3300028380 | Bacteria | 58874 |
| 541 | Ga0268265_10018322 | 3300028380 | Bacteria | 4849 |
| 542 | Ga0268265_10040823 | 3300028380 | Bacteria | 3428 |
| 543 | Ga0268265_10054272 | 3300028380 | Bacteria | 3040 |
| 544 | Ga0268265_10273429 | 3300028380 | Bacteria | 1508 |
| 545 | Ga0268264_10000078 | 3300028381 | Bacteria | 249595 |
| 546 | Ga0268264_10000180 | 3300028381 | Bacteria | 134339 |
| 547 | Ga0268264_10004368 | 3300028381 | Bacteria | 12064 |
| 548 | Ga0268264_10007758 | 3300028381 | Bacteria | 8936 |
| 549 | Ga0268264_10008451 | 3300028381 | Bacteria | 8563 |
| 550 | Ga0268264_10017221 | 3300028381 | Bacteria | 5919 |
| 551 | Ga0268264_10046311 | 3300028381 | Bacteria | 3612 |
| 552 | Ga0268264_10071817 | 3300028381 | Bacteria | 2934 |
| 553 | Ga0307517_10012427 | 3300028786 | Bacteria | 11686 |
| 554 | Ga0307517_10037285 | 3300028786 | Bacteria | 5435 |
| 555 | Ga0316177_1051669 | 3300030731 | Bacteria | 1174 |
| 556 | Ga0265331_10086685 | 3300031250 | Bacteria | 1450 |
| 557 | Ga0307513_10060125 | 3300031456 | Bacteria | 4029 |
| 558 | Ga0307513_10132909 | 3300031456 | Bacteria | 2430 |
| 559 | Ga0307408_100055244 | 3300031548 | Bacteria | 2874 |
| 560 | Ga0307408_100078202 | 3300031548 | Bacteria | 2465 |
| 561 | Ga0307408_100150390 | 3300031548 | Bacteria | 1837 |
| 562 | Ga0307408_100575655 | 3300031548 | Bacteria | 997 |
| 563 | Ga0307508_10218068 | 3300031616 | Bacteria | 1508 |
| 564 | Ga0307405_10003177 | 3300031731 | Bacteria | 7475 |
| 565 | Ga0307405_10413462 | 3300031731 | Bacteria | 1059 |
| 566 | Ga0307413_10005727 | 3300031824 | Bacteria | 5585 |
| 567 | Ga0307413_10009668 | 3300031824 | Bacteria | 4628 |
| 568 | Ga0307413_10327094 | 3300031824 | Bacteria | 1173 |
| 569 | Ga0307410_10005363 | 3300031852 | Bacteria | 6780 |
| 570 | Ga0307410_10035115 | 3300031852 | Bacteria | 3253 |
| 571 | Ga0307410_10096682 | 3300031852 | Bacteria | 2108 |
| 572 | Ga0307410_10120342 | 3300031852 | Bacteria | 1914 |
| 573 | Ga0307406_10248438 | 3300031901 | Bacteria | 1338 |
| 574 | Ga0307407_10208043 | 3300031903 | Bacteria | 1315 |
| 575 | Ga0307412_10000126 | 3300031911 | Bacteria | 56270 |
| 576 | Ga0307412_10005327 | 3300031911 | Bacteria | 7220 |
| 577 | Ga0307412_10171259 | 3300031911 | Bacteria | 1624 |
| 578 | Ga0307409_100231919 | 3300031995 | Bacteria | 1674 |
| 579 | Ga0307409_100331238 | 3300031995 | Bacteria | 1429 |
| 580 | Ga0307409_100519028 | 3300031995 | Bacteria | 1163 |
| 581 | Ga0307416_100122197 | 3300032002 | Bacteria | 2323 |
| 582 | Ga0307416_100212031 | 3300032002 | Bacteria | 1848 |
| 583 | Ga0307416_100370836 | 3300032002 | Bacteria | 1457 |
| 584 | Ga0307416_100451249 | 3300032002 | Bacteria | 1338 |
| 585 | Ga0307414_10000270 | 3300032004 | Bacteria | 32016 |
| 586 | Ga0307414_10044113 | 3300032004 | Bacteria | 3042 |
| 587 | Ga0307414_10103634 | 3300032004 | Bacteria | 2147 |
| 588 | Ga0307414_10145329 | 3300032004 | Bacteria | 1862 |
| 589 | Ga0307414_10253571 | 3300032004 | Bacteria | 1464 |
| 590 | Ga0307414_10467753 | 3300032004 | Bacteria | 1109 |
| 591 | Ga0307414_10628695 | 3300032004 | Bacteria | 966 |
| 592 | Ga0307411_10074514 | 3300032005 | Bacteria | 2313 |
| 593 | Ga0307411_10119820 | 3300032005 | Bacteria | 1902 |
| 594 | Ga0307411_10165095 | 3300032005 | Bacteria | 1663 |
| 595 | Ga0307411_10234898 | 3300032005 | Bacteria | 1431 |
| 596 | Ga0307411_10299278 | 3300032005 | Bacteria | 1289 |
| 597 | Ga0307415_100064979 | 3300032126 | Bacteria | 2541 |
| 598 | Ga0307415_100315582 | 3300032126 | Bacteria | 1301 |
| 599 | Ga0316583_10007557 | 3300032133 | Bacteria | 3914 |
| 600 | Ga0307510_10211222 | 3300033180 | Bacteria | 1463 |
| 601 | Ga0307510_10356259 | 3300033180 | Bacteria | 913 |
| 602 | Ga0373962_0068779 | 3300035242 | Bacteria | 1054 |
| 603 | Ga0373931_0003323 | 3300035691 | Bacteria | 7206 |
| 604 | Ga0373927_0232837 | 3300035695 | Bacteria | 1210 |
| 605 | Ga0316582_0030777 | 3300036647 | Bacteria | 3273 |
| 606 | Ga0316584_0106575 | 3300036712 | Bacteria | 2097 |
| 607 | Ga0316584_0345309 | 3300036712 | Bacteria | 1069 |
| 608 | Ga0316584_0556861 | 3300036712 | Bacteria | 800 |
| 609 | Ga0395899_0037987 | 3300037312 | Bacteria | 3609 |
| 610 | Ga0395900_0050564 | 3300037418 | Bacteria | 4281 |
| 611 | Ga0395905_0081567 | 3300037471 | Bacteria | 3031 |
| 612 | Ga0395905_0230214 | 3300037471 | Bacteria | 1733 |
| 613 | Ga0237819_03911 | 3300038705 | Bacteria | 2543 |
| 614 | Ga0436365_0083543 | 3300039437 | Bacteria | 85224 |
| 615 | Ga0436365_0124207 | 3300039437 | Bacteria | 44215 |
| 616 | Ga0436365_0922968 | 3300039437 | Bacteria | 9993 |
| 617 | Ga0436365_1181252 | 3300039437 | Bacteria | 2793 |
| 618 | Ga0436365_1272877 | 3300039437 | Bacteria | 2798 |
| 619 | Ga0436363_0832933 | 3300039450 | Bacteria | 1410 |
| 620 | Ga0436363_1317039 | 3300039450 | Bacteria | 777 |
| 621 | Ga0436362_0376260 | 3300039453 | Bacteria | 74620 |
| 622 | Ga0439436_0006762 | 3300041404 | Bacteria | 3524 |
| 623 | Ga0439439_0011842 | 3300041406 | Bacteria | 2103 |
| 624 | Ga0439439_0040713 | 3300041406 | Bacteria | 1203 |
| 625 | Ga0439461_0000005 | 3300041410 | Bacteria | 28399 |
| 626 | Ga0439461_0001836 | 3300041410 | Bacteria | 3342 |
| 627 | Ga0439465_0005156 | 3300041413 | Bacteria | 4192 |
| 628 | Ga0439465_0005367 | 3300041413 | Bacteria | 4088 |
| 629 | Ga0439431_0000066 | 3300041997 | Bacteria | 16712 |
| 630 | Ga0439431_0011328 | 3300041997 | Bacteria | 2036 |
| 631 | Ga0439442_024642 | 3300042002 | Bacteria | 1252 |
| 632 | Ga0439445_0003763 | 3300042004 | Bacteria | 3406 |
| 633 | Ga0439445_0003804 | 3300042004 | Bacteria | 3392 |
| 634 | Ga0439445_0013081 | 3300042004 | Bacteria | 2005 |
| 635 | Ga0439448_0035805 | 3300042005 | Bacteria | 1591 |
| 636 | Ga0439448_0039282 | 3300042005 | Bacteria | 1525 |
| 637 | Ga0439448_0083156 | 3300042005 | Bacteria | 1076 |
| 638 | Ga0439432_008221 | 3300042006 | Bacteria | 3669 |
| 639 | Ga0439452_007753 | 3300042010 | Bacteria | 3267 |
| 640 | Ga0439452_016440 | 3300042010 | Bacteria | 2010 |
| 641 | Ga0439455_0002972 | 3300042012 | Bacteria | 3177 |
| 642 | Ga0439455_0028443 | 3300042012 | Bacteria | 1376 |
| 643 | Ga0439462_0000552 | 3300042015 | Bacteria | 7411 |
| 644 | Ga0439462_0000631 | 3300042015 | Bacteria | 7071 |
| 645 | Ga0450894_011747 | 3300042131 | Bacteria | 1141 |
| 646 | Ga0439458_0000263 | 3300042157 | Bacteria | 12825 |
| 647 | Ga0439458_0004273 | 3300042157 | Bacteria | 3295 |
| 648 | Ga0439458_0006327 | 3300042157 | Bacteria | 2641 |
| 649 | Ga0439434_0005169 | 3300042435 | Bacteria | 3816 |
| 650 | Ga0439434_0018492 | 3300042435 | Bacteria | 2086 |
| 651 | Ga0466966_0058247 | 3300044684 | Bacteria | 2442 |
| 652 | Ga0466961_0009584 | 3300044693 | Bacteria | 6164 |
| 653 | Ga0466964_0016699 | 3300044706 | Bacteria | 2804 |
| 654 | Ga0466971_0011526 | 3300044719 | Bacteria | 3870 |
| 655 | Ga0466971_0066471 | 3300044719 | Bacteria | 1634 |
| 656 | Ga0466968_0004499 | 3300044735 | Bacteria | 5214 |
| 657 | Ga0466970_0024989 | 3300044765 | Bacteria | 3126 |
| 658 | Ga0466957_0020005 | 3300044842 | Bacteria | 3940 |
| 659 | Ga0466960_0000991 | 3300044901 | Bacteria | 10127 |
| 660 | Ga0466959_0021515 | 3300045049 | Bacteria | 4757 |
| 661 | Ga0451576_0000017 | 3300045051 | Bacteria | 558261 |
| 662 | Ga0466958_0030818 | 3300045836 | Bacteria | 3187 |
| 663 | Ga0466958_0034088 | 3300045836 | Bacteria | 3036 |
| 664 | Ga0466967_0462283 | 3300045976 | Bacteria | 1241 |
| 665 | Ga0495617_006845 | 3300046452 | Bacteria | 3982 |
| 666 | Ga0495617_010490 | 3300046452 | Bacteria | 3174 |
| 667 | Ga0495627_000336 | 3300046453 | Bacteria | 44344 |
| 668 | Ga0495627_001139 | 3300046453 | Bacteria | 17196 |
| 669 | Ga0495638_0000068 | 3300046460 | Bacteria | 167596 |
| 670 | Ga0495638_0016810 | 3300046460 | Bacteria | 4892 |
| 671 | Ga0495638_0046222 | 3300046460 | Bacteria | 2736 |
| 672 | Ga0495650_0000091 | 3300046471 | Bacteria | 228697 |
| 673 | Ga0495650_0001028 | 3300046471 | Bacteria | 31367 |
| 674 | Ga0495650_0001420 | 3300046471 | Bacteria | 23288 |
| 675 | Ga0495650_0051284 | 3300046471 | Bacteria | 1701 |
| 676 | Ga0495584_0136670 | 3300046491 | Bacteria | 1244 |
| 677 | Ga0495585_0005357 | 3300046492 | Bacteria | 8098 |
| 678 | Ga0495596_0000267 | 3300046500 | Bacteria | 34545 |
| 679 | Ga0495607_0020242 | 3300046501 | Bacteria | 4211 |
| 680 | Ga0495607_0030552 | 3300046501 | Bacteria | 3306 |
| 681 | Ga0495583_0000269 | 3300046506 | Bacteria | 85380 |
| 682 | Ga0495583_0000406 | 3300046506 | Bacteria | 65391 |
| 683 | Ga0495583_0017415 | 3300046506 | Bacteria | 3815 |
| 684 | Ga0495606_0000457 | 3300046507 | Bacteria | 67044 |
| 685 | Ga0495606_0142636 | 3300046507 | Bacteria | 1413 |
| 686 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 687 | Ga0495610_0000083 | 3300046512 | Bacteria | 112946 |
| 688 | Ga0495616_0000010 | 3300046513 | Bacteria | 224378 |
| 689 | Ga0495616_0097461 | 3300046513 | Bacteria | 1383 |
| 690 | Ga0495620_0029925 | 3300046515 | Bacteria | 2513 |
| 691 | Ga0495631_0074987 | 3300046518 | Bacteria | 1460 |
| 692 | Ga0495631_0128273 | 3300046518 | Bacteria | 1090 |
| 693 | Ga0495632_0000351 | 3300046519 | Bacteria | 43708 |
| 694 | Ga0495632_0001120 | 3300046519 | Bacteria | 22955 |
| 695 | Ga0495632_0029442 | 3300046519 | Bacteria | 2859 |
| 696 | Ga0495632_0052897 | 3300046519 | Bacteria | 1995 |
| 697 | Ga0495632_0161298 | 3300046519 | Bacteria | 1033 |
| 698 | Ga0495637_0105205 | 3300046520 | Bacteria | 1099 |
| 699 | Ga0495643_0009428 | 3300046522 | Bacteria | 6068 |
| 700 | Ga0495643_0011767 | 3300046522 | Bacteria | 5308 |
| 701 | Ga0495643_0025484 | 3300046522 | Bacteria | 3345 |
| 702 | Ga0495643_0030194 | 3300046522 | Bacteria | 3028 |
| 703 | Ga0495643_0044184 | 3300046522 | Bacteria | 2422 |
| 704 | Ga0495643_0048857 | 3300046522 | Bacteria | 2284 |
| 705 | Ga0495643_0052511 | 3300046522 | Bacteria | 2188 |
| 706 | Ga0495648_0000046 | 3300046524 | Bacteria | 167725 |
| 707 | Ga0495648_0000114 | 3300046524 | Bacteria | 98677 |
| 708 | Ga0495648_0013048 | 3300046524 | Bacteria | 6164 |
| 709 | Ga0495648_0156523 | 3300046524 | Bacteria | 1182 |
| 710 | Ga0495663_0006507 | 3300046525 | Bacteria | 3225 |
| 711 | Ga0495642_0003030 | 3300046528 | Bacteria | 6691 |
| 712 | Ga0495654_0044137 | 3300046530 | Bacteria | 2206 |
| 713 | Ga0495654_0061539 | 3300046530 | Bacteria | 1802 |
| 714 | Ga0495654_0074574 | 3300046530 | Bacteria | 1602 |
| 715 | Ga0495654_0094515 | 3300046530 | Bacteria | 1383 |
| 716 | Ga0495621_0004419 | 3300046539 | Bacteria | 3950 |
| 717 | Ga0495597_0038934 | 3300046542 | Bacteria | 2130 |
| 718 | Ga0495633_0000739 | 3300046558 | Bacteria | 29507 |
| 719 | Ga0495633_0000929 | 3300046558 | Bacteria | 24783 |
| 720 | Ga0495633_0016576 | 3300046558 | Bacteria | 3794 |
| 721 | Ga0495633_0033973 | 3300046558 | Bacteria | 2455 |
| 722 | Ga0495633_0034668 | 3300046558 | Bacteria | 2426 |
| 723 | Ga0495668_0000022 | 3300046616 | Bacteria | 363999 |
| 724 | Ga0495668_0031988 | 3300046616 | Bacteria | 2962 |
| 725 | Ga0495668_0087011 | 3300046616 | Bacteria | 1714 |
| 726 | Ga0495611_0062972 | 3300046648 | Bacteria | 1687 |
| 727 | Ga0495611_0076407 | 3300046648 | Bacteria | 1535 |
| 728 | Ga0495625_0032785 | 3300046660 | Bacteria | 3847 |
| 729 | Ga0495625_0047750 | 3300046660 | Bacteria | 3086 |
| 730 | Ga0495625_0048759 | 3300046660 | Bacteria | 3047 |
| 731 | Ga0495625_0140058 | 3300046660 | Bacteria | 1632 |
| 732 | Ga0495625_0372997 | 3300046660 | Bacteria | 897 |
| 733 | Ga0495661_0027151 | 3300046665 | Bacteria | 3677 |
| 734 | Ga0495661_0143917 | 3300046665 | Bacteria | 1294 |
| 735 | Ga0495669_0000047 | 3300046684 | Bacteria | 82672 |
| 736 | Ga0495670_0000019 | 3300046691 | Bacteria | 114488 |
| 737 | Ga0495670_0032241 | 3300046691 | Bacteria | 2606 |
| 738 | Ga0495671_0000057 | 3300046692 | Bacteria | 114166 |
| 739 | Ga0495671_0015063 | 3300046692 | Bacteria | 4152 |
| 740 | Ga0495660_0010290 | 3300046810 | Bacteria | 5438 |
| 741 | Ga0495683_0008682 | 3300047323 | Bacteria | 5424 |
| 742 | Ga0495687_000043 | 3300047443 | Bacteria | 216711 |
| 743 | Ga0495687_000083 | 3300047443 | Bacteria | 145688 |
| 744 | Ga0495687_029728 | 3300047443 | Bacteria | 2524 |
| 745 | Ga0495677_0007237 | 3300047445 | Bacteria | 4152 |
| 746 | Ga0495673_0000110 | 3300047469 | Bacteria | 166127 |
| 747 | Ga0495673_0037586 | 3300047469 | Bacteria | 2210 |
| 748 | Ga0495673_0052135 | 3300047469 | Bacteria | 1789 |
| 749 | Ga0495681_0000036 | 3300047470 | Bacteria | 124207 |
| 750 | Ga0495681_0000445 | 3300047470 | Bacteria | 31682 |
| 751 | Ga0495681_0051438 | 3300047470 | Bacteria | 1937 |
| 752 | Ga0495686_0000273 | 3300047472 | Bacteria | 91936 |
| 753 | Ga0495686_0000985 | 3300047472 | Bacteria | 34770 |
| 754 | Ga0495593_0198735 | 3300047673 | Bacteria | 1008 |
| 755 | Ga0495615_0001607 | 3300048090 | Bacteria | 3403 |
| 756 | Ga0495626_0000808 | 3300048091 | Bacteria | 28273 |
| 757 | Ga0496100_0002118 | 3300048903 | Bacteria | 9992 |
| 758 | Ga0496100_0221074 | 3300048903 | Bacteria | 1390 |
| 759 | Ga0496100_0494182 | 3300048903 | Bacteria | 942 |
| 760 | Ga0496101_0028746 | 3300048904 | Bacteria | 3884 |
| 761 | Ga0496102_0000022 | 3300048905 | Bacteria | 246314 |
| 762 | Ga0496102_0001244 | 3300048905 | Bacteria | 23041 |
| 763 | Ga0496102_0139972 | 3300048905 | Bacteria | 2269 |
| 764 | Ga0496103_0000167 | 3300048906 | Bacteria | 68561 |
| 765 | Ga0496103_0000648 | 3300048906 | Bacteria | 26322 |
| 766 | Ga0496103_0001474 | 3300048906 | Bacteria | 15742 |
| 767 | Ga0496103_0030200 | 3300048906 | Bacteria | 3297 |
| 768 | Ga0496104_0000882 | 3300048907 | Bacteria | 25819 |
| 769 | Ga0496104_0001962 | 3300048907 | Bacteria | 17811 |
| 770 | Ga0496104_0025352 | 3300048907 | Bacteria | 5466 |
| 771 | Ga0496105_0000447 | 3300048908 | Bacteria | 27187 |
| 772 | Ga0496105_0000479 | 3300048908 | Bacteria | 26244 |
| 773 | Ga0496105_0006155 | 3300048908 | Bacteria | 9200 |
| 774 | Ga0496105_0017067 | 3300048908 | Bacteria | 5811 |
| 775 | Ga0496106_0007027 | 3300048909 | Bacteria | 8313 |
| 776 | Ga0496107_0000287 | 3300048910 | Bacteria | 26834 |
| 777 | Ga0496107_0093085 | 3300048910 | Bacteria | 2204 |
| 778 | Ga0496108_0000270 | 3300048911 | Bacteria | 44669 |
| 779 | Ga0496109_0267471 | 3300048912 | Bacteria | 1611 |
| 780 | Ga0496109_0537217 | 3300048912 | Bacteria | 1103 |
| 781 | Ga0496110_0018059 | 3300048913 | Bacteria | 5908 |
| 782 | Ga0496110_0119140 | 3300048913 | Bacteria | 2377 |
| 783 | Ga0496110_0523614 | 3300048913 | Bacteria | 1078 |
| 784 | Ga0496110_0583010 | 3300048913 | Bacteria | 1015 |
| 785 | Ga0496111_0013236 | 3300048914 | Bacteria | 5607 |
| 786 | Ga0496111_0020176 | 3300048914 | Bacteria | 4637 |
| 787 | Ga0496111_0054137 | 3300048914 | Bacteria | 2900 |
| 788 | Ga0496111_0106914 | 3300048914 | Bacteria | 2059 |
| 789 | Ga0496111_0145735 | 3300048914 | Bacteria | 1755 |
| 790 | Ga0496112_0014916 | 3300048915 | Bacteria | 7230 |
| 791 | Ga0496113_0000442 | 3300048916 | Bacteria | 20174 |
| 792 | Ga0496113_0002636 | 3300048916 | Bacteria | 10501 |
| 793 | Ga0496113_0021719 | 3300048916 | Bacteria | 4531 |
| 794 | Ga0496114_0002987 | 3300048917 | Bacteria | 12971 |
| 795 | Ga0496114_0023598 | 3300048917 | Bacteria | 5021 |
| 796 | Ga0496115_0000029 | 3300048918 | Bacteria | 141359 |
| 797 | Ga0496115_0000665 | 3300048918 | Bacteria | 25387 |
| 798 | Ga0496116_0008266 | 3300048919 | Bacteria | 9052 |
| 799 | Ga0496116_0031125 | 3300048919 | Bacteria | 3826 |
| 800 | Ga0496116_0055889 | 3300048919 | Bacteria | 2590 |
| 801 | Ga0496117_0000260 | 3300048920 | Bacteria | 99636 |
| 802 | Ga0496117_0000566 | 3300048920 | Bacteria | 60778 |
| 803 | Ga0496117_0005957 | 3300048920 | Bacteria | 12569 |
| 804 | Ga0496117_0016880 | 3300048920 | Bacteria | 6129 |
| 805 | Ga0496117_0029232 | 3300048920 | Bacteria | 4252 |
| 806 | Ga0496117_0090680 | 3300048920 | Bacteria | 1968 |
| 807 | Ga0496117_0090940 | 3300048920 | Bacteria | 1965 |
| 808 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 809 | Ga0496118_0009583 | 3300048921 | Bacteria | 9748 |
| 810 | Ga0496118_0013474 | 3300048921 | Bacteria | 7728 |
| 811 | Ga0496118_0015672 | 3300048921 | Bacteria | 7000 |
| 812 | Ga0496118_0016400 | 3300048921 | Bacteria | 6799 |
| 813 | Ga0496118_0018558 | 3300048921 | Bacteria | 6266 |
| 814 | Ga0496118_0019153 | 3300048921 | Bacteria | 6129 |
| 815 | Ga0496118_0020492 | 3300048921 | Bacteria | 5859 |
| 816 | Ga0496118_0048476 | 3300048921 | Bacteria | 3281 |
| 817 | Ga0496119_0002088 | 3300048922 | Bacteria | 22564 |
| 818 | Ga0496119_0010119 | 3300048922 | Bacteria | 7964 |
| 819 | Ga0496120_0001454 | 3300048923 | Bacteria | 28335 |
| 820 | Ga0496120_0017516 | 3300048923 | Bacteria | 4642 |
| 821 | Ga0496120_0031863 | 3300048923 | Bacteria | 3186 |
| 822 | Ga0496121_0000683 | 3300048924 | Bacteria | 63257 |
| 823 | Ga0496121_0001144 | 3300048924 | Bacteria | 46508 |
| 824 | Ga0496121_0001713 | 3300048924 | Bacteria | 35897 |
| 825 | Ga0496121_0002098 | 3300048924 | Bacteria | 31368 |
| 826 | Ga0496121_0002348 | 3300048924 | Bacteria | 29182 |
| 827 | Ga0496121_0003389 | 3300048924 | Bacteria | 22816 |
| 828 | Ga0496121_0014109 | 3300048924 | Bacteria | 8516 |
| 829 | Ga0496121_0022572 | 3300048924 | Bacteria | 6098 |
| 830 | Ga0496121_0031799 | 3300048924 | Bacteria | 4813 |
| 831 | Ga0496122_0003064 | 3300048925 | Bacteria | 22543 |
| 832 | Ga0496122_0007119 | 3300048925 | Bacteria | 12558 |
| 833 | Ga0496122_0012916 | 3300048925 | Bacteria | 8245 |
| 834 | Ga0496122_0028094 | 3300048925 | Bacteria | 4787 |
| 835 | Ga0496122_0045084 | 3300048925 | Bacteria | 3432 |
| 836 | Ga0496122_0057644 | 3300048925 | Bacteria | 2882 |
| 837 | Ga0496122_0066300 | 3300048925 | Bacteria | 2610 |
| 838 | Ga0496123_0002028 | 3300048926 | Bacteria | 26145 |
| 839 | Ga0496123_0009892 | 3300048926 | Bacteria | 8510 |
| 840 | Ga0496123_0012423 | 3300048926 | Bacteria | 7260 |
| 841 | Ga0496123_0173308 | 3300048926 | Bacteria | 1135 |
| 842 | Ga0496124_0000076 | 3300048927 | Bacteria | 215767 |
| 843 | Ga0496124_0001874 | 3300048927 | Bacteria | 28945 |
| 844 | Ga0496124_0002194 | 3300048927 | Bacteria | 26062 |
| 845 | Ga0496124_0008780 | 3300048927 | Bacteria | 10497 |
| 846 | Ga0496124_0011818 | 3300048927 | Bacteria | 8697 |
| 847 | Ga0496124_0019841 | 3300048927 | Bacteria | 6237 |
| 848 | Ga0496124_0019879 | 3300048927 | Bacteria | 6229 |
| 849 | Ga0496124_0063899 | 3300048927 | Bacteria | 3073 |
| 850 | Ga0496124_0105055 | 3300048927 | Bacteria | 2283 |
| 851 | Ga0496124_0118901 | 3300048927 | Bacteria | 2114 |
| 852 | Ga0496125_0000505 | 3300048928 | Bacteria | 67726 |
| 853 | Ga0496125_0007784 | 3300048928 | Bacteria | 11334 |
| 854 | Ga0496125_0009478 | 3300048928 | Bacteria | 9993 |
| 855 | Ga0496125_0014467 | 3300048928 | Bacteria | 7683 |
| 856 | Ga0496125_0020907 | 3300048928 | Bacteria | 6123 |
| 857 | Ga0496125_0034865 | 3300048928 | Bacteria | 4427 |
| 858 | Ga0496125_0062742 | 3300048928 | Bacteria | 2969 |
| 859 | Ga0496125_0066007 | 3300048928 | Bacteria | 2862 |
| 860 | Ga0496125_0087920 | 3300048928 | Bacteria | 2344 |
| 861 | Ga0496126_0000158 | 3300048929 | Bacteria | 156032 |
| 862 | Ga0496126_0000469 | 3300048929 | Bacteria | 80156 |
| 863 | Ga0496126_0003395 | 3300048929 | Bacteria | 20150 |
| 864 | Ga0496126_0016624 | 3300048929 | Bacteria | 7353 |
| 865 | Ga0496126_0018513 | 3300048929 | Bacteria | 6896 |
| 866 | Ga0496126_0034157 | 3300048929 | Bacteria | 4780 |
| 867 | Ga0496126_0037665 | 3300048929 | Bacteria | 4510 |
| 868 | Ga0496126_0054595 | 3300048929 | Bacteria | 3617 |
| 869 | Ga0496126_0079211 | 3300048929 | Bacteria | 2909 |
| 870 | Ga0495678_027194 | 3300049459 | Bacteria | 2430 |
| 871 | Ga0501033_0340072 | 3300049570 | Bacteria | 1052 |
| 872 | Ga0501034_0021162 | 3300049571 | Bacteria | 6635 |
| 873 | Ga0501034_0036153 | 3300049571 | Bacteria | 5005 |
| 874 | Ga0501034_0079638 | 3300049571 | Bacteria | 3280 |
| 875 | Ga0501034_0555334 | 3300049571 | Bacteria | 1057 |
| 876 | Ga0501036_0151941 | 3300049572 | Bacteria | 1953 |
| 877 | Ga0501037_0099976 | 3300049573 | Bacteria | 2095 |
| 878 | Ga0501047_0241651 | 3300049581 | Bacteria | 1656 |
| 879 | Ga0501047_0305110 | 3300049581 | Bacteria | 1434 |
| 880 | Ga0501223_000135 | 3300049663 | Bacteria | 20935 |
| 881 | Ga0501224_000042 | 3300049664 | Bacteria | 22403 |
| 882 | Ga0501233_035122 | 3300049668 | Bacteria | 1153 |
| 883 | Ga0501235_010553 | 3300049669 | Bacteria | 2018 |
| 884 | Ga0501249_000256 | 3300049679 | Bacteria | 15740 |
| 885 | Ga0501225_0000134 | 3300049705 | Bacteria | 22398 |
| 886 | Ga0501225_0005268 | 3300049705 | Bacteria | 3806 |
| 887 | Ga0501080_0604152 | 3300049742 | Bacteria | 974 |
| 888 | Ga0501083_0070382 | 3300049744 | Bacteria | 2327 |
| 889 | Ga0501035_0376890 | 3300049822 | Bacteria | 1184 |
| 890 | Ga0501044_0237619 | 3300049823 | Bacteria | 1767 |
| 891 | Ga0501044_0338903 | 3300049823 | Bacteria | 1425 |
| 892 | Ga0501226_000099 | 3300049853 | Bacteria | 21088 |
| 893 | nmdc:mga03683_52_c1 | 3300050489 | Bacteria | 49169 |
| 894 | nmdc:mga03683_757_c1 | 3300050489 | Bacteria | 9260 |
| 895 | nmdc:mga03n38_1944_c1 | 3300050490 | Bacteria | 6196 |
| 896 | nmdc:mga00v17_205795_c1 | 3300050491 | Bacteria | 1273 |
| 897 | nmdc:mga0k408_118952_c1 | 3300050493 | Bacteria | 1564 |
| 898 | nmdc:mga0k408_12_c1 | 3300050493 | Bacteria | 125427 |
| 899 | nmdc:mga06z11_119_c1 | 3300050494 | Bacteria | 32670 |
| 900 | nmdc:mga04h51_37_c1 | 3300050495 | Bacteria | 45941 |
| 901 | nmdc:mga07m45_11_c1 | 3300050496 | Bacteria | 163532 |
| 902 | nmdc:mga07m45_172015_c1 | 3300050496 | Bacteria | 1259 |
| 903 | nmdc:mga07m45_9729_c1 | 3300050496 | Bacteria | 4997 |
| 904 | nmdc:mga05p37_847944_c1 | 3300050507 | Bacteria | 993 |
| 905 | nmdc:mga09592_111294_c1 | 3300050508 | Bacteria | 2349 |
| 906 | nmdc:mga0n895_28520_c1 | 3300050512 | Bacteria | 5310 |
| 907 | nmdc:mga0sz30_1423_c1 | 3300050516 | Bacteria | 8554 |
| 908 | nmdc:mga0sz30_39425_c1 | 3300050516 | Bacteria | 1982 |
| 909 | Ga0500610_0000508 | 3300053079 | Bacteria | 11987 |
| 910 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 911 | Ga0500643_000044 | 3300053087 | Bacteria | 155319 |
| 912 | Ga0500643_007423 | 3300053087 | Bacteria | 4425 |
| 913 | Ga0500643_012451 | 3300053087 | Bacteria | 3046 |
| 914 | Ga0500643_015888 | 3300053087 | Bacteria | 2568 |
| 915 | Ga0500643_021524 | 3300053087 | Bacteria | 2088 |
| 916 | Ga0500566_0004226 | 3300053094 | Bacteria | 8564 |
| 917 | Ga0500562_003253 | 3300053108 | Bacteria | 4061 |
| 918 | Ga0500594_0005674 | 3300053118 | Bacteria | 2774 |
| 919 | Ga0500594_0027135 | 3300053118 | Bacteria | 1480 |
| 920 | Ga0500595_000814 | 3300053119 | Bacteria | 18012 |
| 921 | Ga0500595_050618 | 3300053119 | Bacteria | 1289 |
| 922 | Ga0500597_000193 | 3300053120 | Bacteria | 12502 |
| 923 | Ga0500608_000042 | 3300053122 | Bacteria | 56626 |
| 924 | Ga0500626_111952 | 3300053128 | Bacteria | 1177 |
| 925 | Ga0500642_0001178 | 3300053130 | Bacteria | 7485 |
| 926 | Ga0500658_0001159 | 3300053134 | Bacteria | 10717 |
| 927 | Ga0500658_0010532 | 3300053134 | Bacteria | 3410 |
| 928 | Ga0500559_0001036 | 3300053136 | Bacteria | 16988 |
| 929 | Ga0500559_0027208 | 3300053136 | Bacteria | 2440 |
| 930 | Ga0500559_0065641 | 3300053136 | Bacteria | 1626 |
| 931 | Ga0500559_0135001 | 3300053136 | Bacteria | 1153 |
| 932 | Ga0500564_005997 | 3300053138 | Bacteria | 5025 |
| 933 | Ga0500568_0022365 | 3300053139 | Bacteria | 2705 |
| 934 | Ga0500590_102144 | 3300053148 | Bacteria | 1375 |
| 935 | Ga0500604_0000108 | 3300053151 | Bacteria | 25410 |
| 936 | Ga0500604_0004017 | 3300053151 | Bacteria | 3924 |
| 937 | Ga0500616_0000161 | 3300053153 | Bacteria | 111424 |
| 938 | Ga0500616_0001142 | 3300053153 | Bacteria | 27275 |
| 939 | Ga0500616_0001975 | 3300053153 | Bacteria | 18211 |
| 940 | Ga0500619_016693 | 3300053154 | Bacteria | 2026 |
| 941 | Ga0500622_0011523 | 3300053156 | Bacteria | 4813 |
| 942 | Ga0500624_000003 | 3300053157 | Bacteria | 253364 |
| 943 | Ga0500627_0000204 | 3300053158 | Bacteria | 17192 |
| 944 | Ga0500636_0007966 | 3300053177 | Bacteria | 6129 |
| 945 | Ga0500637_0000024 | 3300053178 | Bacteria | 59926 |
| 946 | Ga0500567_000588 | 3300053723 | Bacteria | 12916 |
| 947 | Ga0500625_000157 | 3300053729 | Bacteria | 14392 |
| 948 | Ga0500645_000038 | 3300053730 | Bacteria | 112786 |
| 949 | Ga0500645_000842 | 3300053730 | Bacteria | 18101 |
| 950 | Ga0500596_003694 | 3300053735 | Bacteria | 2875 |
| 951 | Ga0500661_013092 | 3300055283 | Bacteria | 1495 |
| 952 | Ga0466962_0021624 | 3300061719 | Bacteria | 3087 |
| 953 | 2511128130 | 2510917021 | Bacteria | 5705459 |
| 954 | 2643951557 | 2643221588 | Bacteria | 3692460 |
| 955 | 2738712804 | 2738541275 | Bacteria | 4830863 |
| 956 | 2738851228 | 2738541301 | Bacteria | 4834102 |
| 957 | 2738866958 | 2738541304 | Bacteria | 4833665 |
| 958 | 2739299475 | 2738543022 | Bacteria | 4835059 |
| 959 | 2739361154 | 2738543033 | Bacteria | 4833336 |
| 960 | 2739649041 | 2739367664 | Bacteria | 4114334 |
| 961 | 2740027514 | 2739367865 | Bacteria | 4114482 |
| 962 | 2819554733 | 2818991438 | Bacteria | 5793701 |
| 963 | 2895882177 | 2895880812 | Bacteria | 11255272 |
| 964 | 2896185912 | 2896184354 | Bacteria | 3258548 |
| 965 | 2896256083 | 2896253425 | Bacteria | 3418029 |
| 966 | 2919142568 | 2919138771 | Bacteria | 5281312 |
| 967 | 2919712539 | 2919709256 | Bacteria | 4318106 |
| 968 | 2928104539 | 2928100450 | Bacteria | 4837635 |
| 969 | 2928963164 | 2928959182 | Bacteria | 4725774 |
| 970 | 3000867166 | 3000865235 | Bacteria | 3106258 |
| 971 | 8054305263 | 8054302542 | Bacteria | 5698134 |
| 972 | Ga0163162_10002528 | |||
| 973 | SwRhRL2b_contig_1117632 | |||
| 974 | SwRhRL2b_contig_1955283 | |||
| 975 | SwRhRL2b_contig_2752641 | |||
| 976 | SwRhRL2b_contig_3948926 | |||
| 977 | JGI24736J21556_1001607 | |||
| 978 | JGI24741J21665_1000677 | |||
| 979 | JGI24752J21851_1004063 | |||
| 980 | JGI24740J21852_10002676 | |||
| 981 | JGI24739J22299_10012561 | |||
| 982 | JGI24737J22298_10002657 | |||
| 983 | JGI24737J22298_10003202 | |||
| 984 | JGI24737J22298_10018518 | |||
| 985 | JGI24735J21928_10000951 | |||
| 986 | JGI24748J21848_1001609 | |||
| 987 | JGI24738J21930_10001235 | |||
| 988 | JGI24738J21930_10005188 | |||
| 989 | JGI24742J22300_10016742 | |||
| 990 | JGI24751J29686_10000323 | |||
| 991 | JGI24751J29686_10019978 | |||
| 992 | JGI25150J39212_1000966 | |||
| 993 | JGI25151J46595_10005487 | |||
| 994 | JGI25153J46596_10000045 | |||
| 995 | Ga0055532_1011407 | |||
| 996 | Ga0055525_1000080 | |||
| 997 | Ga0055542_1000012 | |||
| 998 | Ga0055529_1000002 | |||
| 999 | Ga0055529_1000004 | |||
| 1000 | Ga0055526_1004036 | |||
| 1001 | Ga0055537_1002102 | |||
| 1002 | Ga0055524_1000244 | |||
| 1003 | Ga0055530_10000429 | |||
| 1004 | Ga0055530_10005249 | |||
| 1005 | Ga0055540_1001899 | |||
| 1006 | Ga0055531_10000472 | |||
| 1007 | Ga0055531_10009286 | |||
| 1008 | Ga0055531_10022390 | |||
| 1009 | Ga0055543_1020794 | |||
| 1010 | Ga0065165_1002357 | |||
| 1011 | Ga0065165_1007153 | |||
| 1012 | Ga0065165_1038795 | |||
| 1013 | Ga0065165_1042953 | |||
| 1014 | Ga0065704_10075413 | |||
| 1015 | Ga0065704_10082534 | |||
| 1016 | Ga0065704_10129257 | |||
| 1017 | Ga0065704_10173451 | |||
| 1018 | Ga0070658_10000003 | |||
| 1019 | Ga0070658_10000062 | |||
| 1020 | Ga0070658_10000167 | |||
| 1021 | Ga0070658_10004751 | |||
| 1022 | Ga0070658_10017808 | |||
| 1023 | Ga0070658_10044462 | |||
| 1024 | Ga0070658_10054793 | |||
| 1025 | Ga0070658_10102810 | |||
| 1026 | Ga0070658_10115593 | |||
| 1027 | Ga0070658_10158829 | |||
| 1028 | Ga0070658_10275481 | |||
| 1029 | Ga0070670_100025864 | |||
| 1030 | Ga0070670_100059410 | |||
| 1031 | Ga0070670_100084102 | |||
| 1032 | Ga0070677_10000114 | |||
| 1033 | Ga0068869_100126975 | |||
| 1034 | Ga0070666_10001598 | |||
| 1035 | Ga0070666_10005216 | |||
| 1036 | Ga0070666_10025868 | |||
| 1037 | Ga0070666_10298636 | |||
| 1038 | Ga0070680_100002171 | |||
| 1039 | Ga0070680_100112775 | |||
| 1040 | Ga0070680_100512988 | |||
| 1041 | Ga0070660_100000991 | |||
| 1042 | Ga0070660_100001813 | |||
| 1043 | Ga0070660_100003112 | |||
| 1044 | Ga0070660_100007024 | |||
| 1045 | Ga0070660_100045418 | |||
| 1046 | Ga0070660_100173063 | |||
| 1047 | Ga0070660_100182926 | |||
| 1048 | Ga0070660_100264924 | |||
| 1049 | Ga0070687_100219985 | |||
| 1050 | Ga0070661_100006660 | |||
| 1051 | Ga0070661_100006864 | |||
| 1052 | Ga0070661_100097671 | |||
| 1053 | Ga0070661_100121778 | |||
| 1054 | Ga0070661_100248303 | |||
| 1055 | Ga0070692_10000469 | |||
| 1056 | Ga0070668_100000050 | |||
| 1057 | Ga0070668_100001905 | |||
| 1058 | Ga0070668_100010145 | |||
| 1059 | Ga0070668_100037299 | |||
| 1060 | Ga0070668_100084213 | |||
| 1061 | Ga0070669_100000039 | |||
| 1062 | Ga0070669_100000048 | |||
| 1063 | Ga0070669_100000094 | |||
| 1064 | Ga0070669_100002467 | |||
| 1065 | Ga0070669_100007602 | |||
| 1066 | Ga0070669_100039460 | |||
| 1067 | Ga0070669_100105111 | |||
| 1068 | Ga0070669_100257216 | |||
| 1069 | Ga0070675_100106692 | |||
| 1070 | Ga0070675_100142897 | |||
| 1071 | Ga0070671_100000119 | |||
| 1072 | Ga0070671_100000243 | |||
| 1073 | Ga0070671_100007867 | |||
| 1074 | Ga0070671_100119854 | |||
| 1075 | Ga0070671_100129126 | |||
| 1076 | Ga0070671_100134440 | |||
| 1077 | Ga0070674_100039534 | |||
| 1078 | Ga0070673_100039063 | |||
| 1079 | Ga0070659_100000005 | |||
| 1080 | Ga0070659_100014130 | |||
| 1081 | Ga0070659_100017500 | |||
| 1082 | Ga0070659_100154606 | |||
| 1083 | Ga0070659_100157208 | |||
| 1084 | Ga0070659_100243779 | |||
| 1085 | Ga0070659_100251963 | |||
| 1086 | Ga0070667_100000025 | |||
| 1087 | Ga0070667_100000390 | |||
| 1088 | Ga0070667_100000660 | |||
| 1089 | Ga0070667_100017834 | |||
| 1090 | Ga0070667_100022278 | |||
| 1091 | Ga0070667_100045962 | |||
| 1092 | Ga0070667_100049302 | |||
| 1093 | Ga0070667_100070472 | |||
| 1094 | Ga0070667_100313234 | |||
| 1095 | Ga0070705_100076287 | |||
| 1096 | Ga0070708_100019346 | |||
| 1097 | Ga0070663_100012592 | |||
| 1098 | Ga0070663_100094978 | |||
| 1099 | Ga0070663_100151440 | |||
| 1100 | Ga0070663_100329408 | |||
| 1101 | Ga0070678_100002558 | |||
| 1102 | Ga0070662_100000795 | |||
| 1103 | Ga0070662_100004642 | |||
| 1104 | Ga0070662_100034298 | |||
| 1105 | Ga0070662_100057763 | |||
| 1106 | Ga0070662_100070881 | |||
| 1107 | Ga0070681_10032181 | |||
| 1108 | Ga0070681_10044606 | |||
| 1109 | Ga0070698_100134563 | |||
| 1110 | Ga0070679_100001927 | |||
| 1111 | Ga0070679_100022137 | |||
| 1112 | Ga0070679_100032968 | |||
| 1113 | Ga0070679_100780336 | |||
| 1114 | Ga0070684_100077170 | |||
| 1115 | Ga0070684_100302988 | |||
| 1116 | Ga0068853_100003449 | |||
| 1117 | Ga0068853_100022626 | |||
| 1118 | Ga0068853_100030617 | |||
| 1119 | Ga0068853_100118110 | |||
| 1120 | Ga0068853_100359093 | |||
| 1121 | Ga0068853_100455372 | |||
| 1122 | Ga0070672_100018880 | |||
| 1123 | Ga0070672_100150810 | |||
| 1124 | Ga0070686_100000191 | |||
| 1125 | Ga0070665_100000088 | |||
| 1126 | Ga0070665_100000168 | |||
| 1127 | Ga0070665_100001278 | |||
| 1128 | Ga0070665_100003938 | |||
| 1129 | Ga0070665_100019960 | |||
| 1130 | Ga0070665_100090309 | |||
| 1131 | Ga0070665_100105251 | |||
| 1132 | Ga0068855_100001435 | |||
| 1133 | Ga0068855_100021313 | |||
| 1134 | Ga0068855_100026517 | |||
| 1135 | Ga0068855_100037627 | |||
| 1136 | Ga0068855_100039611 | |||
| 1137 | Ga0068855_100188948 | |||
| 1138 | Ga0068855_100476651 | |||
| 1139 | Ga0070664_100019373 | |||
| 1140 | Ga0070664_100023476 | |||
| 1141 | Ga0070664_100119593 | |||
| 1142 | Ga0070664_100611300 | |||
| 1143 | Ga0068857_100036896 | |||
| 1144 | Ga0068857_100096790 | |||
| 1145 | Ga0068857_100232343 | |||
| 1146 | Ga0068857_100273925 | |||
| 1147 | Ga0068857_100288371 | |||
| 1148 | Ga0068857_100850541 | |||
| 1149 | Ga0068854_100001399 | |||
| 1150 | Ga0068854_100173017 | |||
| 1151 | Ga0068854_100215264 | |||
| 1152 | Ga0068854_100264331 | |||
| 1153 | Ga0068854_100311138 | |||
| 1154 | Ga0068856_100003976 | |||
| 1155 | Ga0068856_100009259 | |||
| 1156 | Ga0068856_100052680 | |||
| 1157 | Ga0068856_100369712 | |||
| 1158 | Ga0068852_100000919 | |||
| 1159 | Ga0068852_100050975 | |||
| 1160 | Ga0068852_100264633 | |||
| 1161 | Ga0068852_100349433 | |||
| 1162 | Ga0068852_100769502 | |||
| 1163 | Ga0068852_100892356 | |||
| 1164 | Ga0068859_100015185 | |||
| 1165 | Ga0068859_100033051 | |||
| 1166 | Ga0068864_100002231 | |||
| 1167 | Ga0068864_100008568 | |||
| 1168 | Ga0068851_10018950 | |||
| 1169 | Ga0068851_10121208 | |||
| 1170 | Ga0068851_10130618 | |||
| 1171 | Ga0068863_100000058 | |||
| 1172 | Ga0068863_100000187 | |||
| 1173 | Ga0068863_100001079 | |||
| 1174 | Ga0068863_100006943 | |||
| 1175 | Ga0068863_100035369 | |||
| 1176 | Ga0068863_100039107 | |||
| 1177 | Ga0068863_100097701 | |||
| 1178 | Ga0068858_100017541 | |||
| 1179 | Ga0068858_100027896 | |||
| 1180 | Ga0068858_100069896 | |||
| 1181 | Ga0068858_100602663 | |||
| 1182 | Ga0068860_100000057 | |||
| 1183 | Ga0068860_100003627 | |||
| 1184 | Ga0068860_100021480 | |||
| 1185 | Ga0068860_100024116 | |||
| 1186 | Ga0068860_100058249 | |||
| 1187 | Ga0068860_100058391 | |||
| 1188 | Ga0068860_100096730 | |||
| 1189 | Ga0068862_100000191 | |||
| 1190 | Ga0068862_100032566 | |||
| 1191 | Ga0068862_100054582 | |||
| 1192 | Ga0081539_10019651 | |||
| 1193 | Ga0075368_10000565 | |||
| 1194 | Ga0075364_10040053 | |||
| 1195 | Ga0075364_10079961 | |||
| 1196 | Ga0075432_10002220 | |||
| 1197 | Ga0075362_10000029 | |||
| 1198 | Ga0075362_10058309 | |||
| 1199 | Ga0075367_10007298 | |||
| 1200 | Ga0075369_10015041 | |||
| 1201 | Ga0075369_10040936 | |||
| 1202 | Ga0075366_10052037 | |||
| 1203 | Ga0097621_100122169 | |||
| 1204 | Ga0075370_10000011 | |||
| 1205 | Ga0075370_10002340 | |||
| 1206 | Ga0075370_10175836 | |||
| 1207 | Ga0075370_10218609 | |||
| 1208 | Ga0075434_100248156 | |||
| 1209 | Ga0075429_100105775 | |||
| 1210 | Ga0097620_100015185 | |||
| 1211 | Ga0097620_100023748 | |||
| 1212 | Ga0097620_100033051 | |||
| 1213 | Ga0105251_10000276 | |||
| 1214 | Ga0105251_10008893 | |||
| 1215 | Ga0105251_10035720 | |||
| 1216 | Ga0105250_10009073 | |||
| 1217 | Ga0105240_10003393 | |||
| 1218 | Ga0105240_10010858 | |||
| 1219 | Ga0105240_10252079 | |||
| 1220 | Ga0105240_10269265 | |||
| 1221 | Ga0105240_10319237 | |||
| 1222 | Ga0105240_10501760 | |||
| 1223 | Ga0105247_10033832 | |||
| 1224 | Ga0114129_10441353 | |||
| 1225 | Ga0105243_10001077 | |||
| 1226 | Ga0105243_10094543 | |||
| 1227 | Ga0105243_10155385 | |||
| 1228 | Ga0105243_10326533 | |||
| 1229 | Ga0105241_10002141 | |||
| 1230 | Ga0105241_10028145 | |||
| 1231 | Ga0105241_10650088 | |||
| 1232 | Ga0105248_10026581 | |||
| 1233 | Ga0105248_10068994 | |||
| 1234 | Ga0105237_10001660 | |||
| 1235 | Ga0105237_10017714 | |||
| 1236 | Ga0105237_10443373 | |||
| 1237 | Ga0105237_10512954 | |||
| 1238 | Ga0105238_10370976 | |||
| 1239 | Ga0105238_10797365 | |||
| 1240 | Ga0105249_10002820 | |||
| 1241 | Ga0105249_10007484 | |||
| 1242 | Ga0105249_10057499 | |||
| 1243 | Ga0105249_10101485 | |||
| 1244 | Ga0105249_10398377 | |||
| 1245 | Ga0105148_100452 | |||
| 1246 | Ga0105239_10002472 | |||
| 1247 | Ga0105246_10001372 | |||
| 1248 | Ga0105246_10951712 | |||
| 1249 | Ga0157327_1001126 | |||
| 1250 | Ga0157373_10003673 | |||
| 1251 | Ga0157373_10014350 | |||
| 1252 | Ga0157373_10109959 | |||
| 1253 | Ga0157371_10000062 | |||
| 1254 | Ga0157371_10002207 | |||
| 1255 | Ga0157371_10021083 | |||
| 1256 | Ga0157371_10504304 | |||
| 1257 | Ga0157370_10005110 | |||
| 1258 | Ga0157370_10051227 | |||
| 1259 | Ga0157370_10074081 | |||
| 1260 | Ga0157369_10118596 | |||
| 1261 | Ga0157369_10167954 | |||
| 1262 | Ga0157369_10240104 | |||
| 1263 | Ga0157378_10006122 | |||
| 1264 | Ga0163162_10000232 | |||
| 1265 | Ga0163162_10010482 | |||
| 1266 | Ga0163162_10023635 | |||
| 1267 | Ga0157372_10007274 | |||
| 1268 | Ga0157372_10014494 | |||
| 1269 | Ga0157372_10128915 | |||
| 1270 | Ga0157372_10137500 | |||
| 1271 | Ga0157372_10357253 | |||
| 1272 | Ga0157372_10497766 | |||
| 1273 | Ga0157375_10107516 | |||
| 1274 | Ga0157375_10548635 | |||
| 1275 | Ga0157375_11003094 | |||
| 1276 | Ga0163163_10028485 | |||
| 1277 | Ga0163163_10655296 | |||
| 1278 | Ga0157379_10150015 | |||
| 1279 | Ga0157379_10323996 | |||
| 1280 | Ga0157376_11034093 | |||
| 1281 | Ga0163161_10065480 | |||
| 1282 | Ga0163161_10117356 | |||
| 1283 | Ga0163161_10123799 | |||
| 1284 | Ga0206356_10967351 | |||
| 1285 | Ga0206353_11419480 | |||
| 1286 | Ga0213873_10000026 | |||
| 1287 | Ga0213876_10000149 | |||
| 1288 | Ga0213876_10000371 | |||
| 1289 | Ga0213876_10012241 | |||
| 1290 | Ga0209674_104378 | |||
| 1291 | Ga0209147_100882 | |||
| 1292 | Ga0209563_100058 | |||
| 1293 | Ga0209677_109030 | |||
| 1294 | Ga0209148_1000008 | |||
| 1295 | Ga0209129_1003496 | |||
| 1296 | Ga0209565_1000029 | |||
| 1297 | Ga0209565_1000251 | |||
| 1298 | Ga0209455_1000002 | |||
| 1299 | Ga0209673_1009829 | |||
| 1300 | Ga0209673_1025148 | |||
| 1301 | Ga0209025_1000993 | |||
| 1302 | Ga0209025_1103877 | |||
| 1303 | Ga0209564_1001873 | |||
| 1304 | Ga0209758_1000002 | |||
| 1305 | Ga0209758_1000007 | |||
| 1306 | Ga0209758_1010016 | |||
| 1307 | Ga0209050_1000001 | |||
| 1308 | Ga0209050_1000167 | |||
| 1309 | Ga0209050_1005376 | |||
| 1310 | Ga0209256_1000008 | |||
| 1311 | Ga0209051_1000360 | |||
| 1312 | Ga0209257_1000028 | |||
| 1313 | Ga0209257_1000893 | |||
| 1314 | Ga0209257_1007672 | |||
| 1315 | Ga0209257_1014531 | |||
| 1316 | Ga0209257_1015466 | |||
| 1317 | Ga0207656_10009546 | |||
| 1318 | Ga0207656_10079668 | |||
| 1319 | Ga0207656_10090765 | |||
| 1320 | Ga0207696_1005122 | |||
| 1321 | Ga0207713_1002506 | |||
| 1322 | Ga0207682_10002396 | |||
| 1323 | Ga0207710_10003855 | |||
| 1324 | Ga0207710_10050837 | |||
| 1325 | Ga0207688_10172340 | |||
| 1326 | Ga0207680_10000817 | |||
| 1327 | Ga0207680_10003518 | |||
| 1328 | Ga0207680_10092063 | |||
| 1329 | Ga0207680_10360599 | |||
| 1330 | Ga0207647_10004690 | |||
| 1331 | Ga0207647_10007524 | |||
| 1332 | Ga0207647_10017114 | |||
| 1333 | Ga0207647_10040920 | |||
| 1334 | Ga0207647_10169648 | |||
| 1335 | Ga0207645_10140691 | |||
| 1336 | Ga0207705_10000004 | |||
| 1337 | Ga0207705_10000005 | |||
| 1338 | Ga0207705_10000103 | |||
| 1339 | Ga0207705_10002703 | |||
| 1340 | Ga0207705_10046649 | |||
| 1341 | Ga0207705_10047290 | |||
| 1342 | Ga0207705_10089732 | |||
| 1343 | Ga0207705_10146704 | |||
| 1344 | Ga0207654_10000150 | |||
| 1345 | Ga0207654_10080212 | |||
| 1346 | Ga0207707_10023608 | |||
| 1347 | Ga0207707_10042890 | |||
| 1348 | Ga0207707_10342203 | |||
| 1349 | Ga0207695_10013603 | |||
| 1350 | Ga0207695_10018738 | |||
| 1351 | Ga0207695_10028019 | |||
| 1352 | Ga0207695_10132032 | |||
| 1353 | Ga0207695_10216992 | |||
| 1354 | Ga0207671_10000567 | |||
| 1355 | Ga0207671_10007737 | |||
| 1356 | Ga0207671_10034313 | |||
| 1357 | Ga0207660_10018096 | |||
| 1358 | Ga0207660_10463219 | |||
| 1359 | Ga0207657_10002582 | |||
| 1360 | Ga0207657_10002937 | |||
| 1361 | Ga0207657_10003198 | |||
| 1362 | Ga0207657_10008473 | |||
| 1363 | Ga0207657_10020085 | |||
| 1364 | Ga0207657_10088520 | |||
| 1365 | Ga0207657_10406177 | |||
| 1366 | Ga0207649_10003386 | |||
| 1367 | Ga0207649_10013635 | |||
| 1368 | Ga0207649_10312493 | |||
| 1369 | Ga0207652_10000489 | |||
| 1370 | Ga0207652_10026835 | |||
| 1371 | Ga0207652_10029162 | |||
| 1372 | Ga0207652_10095574 | |||
| 1373 | Ga0207652_10612319 | |||
| 1374 | Ga0207681_10000050 | |||
| 1375 | Ga0207681_10000144 | |||
| 1376 | Ga0207681_10001096 | |||
| 1377 | Ga0207681_10003059 | |||
| 1378 | Ga0207681_10005654 | |||
| 1379 | Ga0207681_10133717 | |||
| 1380 | Ga0207681_10159210 | |||
| 1381 | Ga0207694_10131777 | |||
| 1382 | Ga0207650_10067376 | |||
| 1383 | Ga0207650_10228576 | |||
| 1384 | Ga0207650_10268151 | |||
| 1385 | Ga0207650_10374090 | |||
| 1386 | Ga0207659_10115202 | |||
| 1387 | Ga0207644_10000056 | |||
| 1388 | Ga0207644_10000134 | |||
| 1389 | Ga0207644_10000367 | |||
| 1390 | Ga0207644_10027263 | |||
| 1391 | Ga0207644_10097687 | |||
| 1392 | Ga0207644_10123750 | |||
| 1393 | Ga0207644_10160788 | |||
| 1394 | Ga0207644_10174712 | |||
| 1395 | Ga0207690_10000002 | |||
| 1396 | Ga0207690_10001516 | |||
| 1397 | Ga0207690_10002450 | |||
| 1398 | Ga0207690_10022186 | |||
| 1399 | Ga0207690_10228960 | |||
| 1400 | Ga0207706_10002382 | |||
| 1401 | Ga0207706_10030470 | |||
| 1402 | Ga0207706_10048453 | |||
| 1403 | Ga0207706_10053084 | |||
| 1404 | Ga0207706_10080509 | |||
| 1405 | Ga0207706_10087295 | |||
| 1406 | Ga0207709_10000005 | |||
| 1407 | Ga0207709_10253795 | |||
| 1408 | Ga0207669_10000174 | |||
| 1409 | Ga0207691_10033158 | |||
| 1410 | Ga0207691_10268079 | |||
| 1411 | Ga0207711_10021765 | |||
| 1412 | Ga0207689_10075646 | |||
| 1413 | Ga0207661_10030507 | |||
| 1414 | Ga0207661_10032877 | |||
| 1415 | Ga0207661_10674760 | |||
| 1416 | Ga0207679_10015535 | |||
| 1417 | Ga0207679_10053837 | |||
| 1418 | Ga0207667_10000001 | |||
| 1419 | Ga0207667_10001089 | |||
| 1420 | Ga0207667_10002432 | |||
| 1421 | Ga0207667_10009256 | |||
| 1422 | Ga0207667_10043432 | |||
| 1423 | Ga0207667_10105863 | |||
| 1424 | Ga0207667_10108443 | |||
| 1425 | Ga0207667_10484163 | |||
| 1426 | Ga0207651_10080622 | |||
| 1427 | Ga0207712_10001292 | |||
| 1428 | Ga0207712_10007474 | |||
| 1429 | Ga0207712_10011280 | |||
| 1430 | Ga0207712_10071925 | |||
| 1431 | Ga0207668_10000094 | |||
| 1432 | Ga0207668_10000436 | |||
| 1433 | Ga0207668_10068584 | |||
| 1434 | Ga0207668_10093353 | |||
| 1435 | Ga0207668_10171525 | |||
| 1436 | Ga0207640_10004898 | |||
| 1437 | Ga0207640_10007874 | |||
| 1438 | Ga0207640_10013210 | |||
| 1439 | Ga0207640_10038253 | |||
| 1440 | Ga0207640_10070550 | |||
| 1441 | Ga0207640_10092308 | |||
| 1442 | Ga0207640_10268623 | |||
| 1443 | Ga0207640_10284912 | |||
| 1444 | Ga0207658_10000023 | |||
| 1445 | Ga0207658_10000216 | |||
| 1446 | Ga0207658_10002737 | |||
| 1447 | Ga0207658_10003041 | |||
| 1448 | Ga0207658_10008354 | |||
| 1449 | Ga0207658_10010305 | |||
| 1450 | Ga0207658_10061944 | |||
| 1451 | Ga0207658_10115529 | |||
| 1452 | Ga0207677_10000100 | |||
| 1453 | Ga0207677_10226311 | |||
| 1454 | Ga0207703_10002369 | |||
| 1455 | Ga0207703_10003301 | |||
| 1456 | Ga0207703_10019876 | |||
| 1457 | Ga0207703_10105257 | |||
| 1458 | Ga0207703_10305518 | |||
| 1459 | Ga0207639_10001191 | |||
| 1460 | Ga0207639_10003214 | |||
| 1461 | Ga0207639_10007673 | |||
| 1462 | Ga0207639_10041254 | |||
| 1463 | Ga0207639_10097932 | |||
| 1464 | Ga0207639_10182258 | |||
| 1465 | Ga0207639_10287754 | |||
| 1466 | Ga0207678_10000079 | |||
| 1467 | Ga0207678_10013240 | |||
| 1468 | Ga0207678_10091516 | |||
| 1469 | Ga0207678_10320248 | |||
| 1470 | Ga0207702_10001332 | |||
| 1471 | Ga0207702_10013826 | |||
| 1472 | Ga0207702_10041221 | |||
| 1473 | Ga0207702_10187154 | |||
| 1474 | Ga0207702_10338539 | |||
| 1475 | Ga0207641_10000269 | |||
| 1476 | Ga0207641_10002412 | |||
| 1477 | Ga0207641_10003855 | |||
| 1478 | Ga0207641_10004669 | |||
| 1479 | Ga0207641_10004972 | |||
| 1480 | Ga0207641_10017468 | |||
| 1481 | Ga0207641_10089951 | |||
| 1482 | Ga0207641_10127064 | |||
| 1483 | Ga0207676_10001569 | |||
| 1484 | Ga0207676_10027677 | |||
| 1485 | Ga0207676_10032111 | |||
| 1486 | Ga0207676_10111941 | |||
| 1487 | Ga0207674_10016564 | |||
| 1488 | Ga0207674_10028880 | |||
| 1489 | Ga0207674_10124108 | |||
| 1490 | Ga0207674_10124747 | |||
| 1491 | Ga0207674_10810575 | |||
| 1492 | Ga0207675_100009530 | |||
| 1493 | Ga0207683_10003668 | |||
| 1494 | Ga0207683_10230163 | |||
| 1495 | Ga0207698_10000019 | |||
| 1496 | Ga0207698_10000186 | |||
| 1497 | Ga0207698_10028185 | |||
| 1498 | Ga0207698_10041197 | |||
| 1499 | Ga0207698_10788321 | |||
| 1500 | Ga0207698_10812398 | |||
| 1501 | Ga0209813_10001114 | |||
| 1502 | Ga0207428_10069745 | |||
| 1503 | Ga0268266_10000074 | |||
| 1504 | Ga0268266_10000130 | |||
| 1505 | Ga0268266_10001691 | |||
| 1506 | Ga0268266_10002428 | |||
| 1507 | Ga0268266_10002447 | |||
| 1508 | Ga0268266_10019026 | |||
| 1509 | Ga0268266_10416723 | |||
| 1510 | Ga0268265_10000102 | |||
| 1511 | Ga0268265_10000271 | |||
| 1512 | Ga0268265_10018322 | |||
| 1513 | Ga0268265_10040823 | |||
| 1514 | Ga0268265_10054272 | |||
| 1515 | Ga0268265_10273429 | |||
| 1516 | Ga0268264_10000078 | |||
| 1517 | Ga0268264_10000180 | |||
| 1518 | Ga0268264_10004368 | |||
| 1519 | Ga0268264_10007758 | |||
| 1520 | Ga0268264_10008451 | |||
| 1521 | Ga0268264_10017221 | |||
| 1522 | Ga0268264_10046311 | |||
| 1523 | Ga0268264_10071817 | |||
| 1524 | Ga0307517_10012427 | |||
| 1525 | Ga0307517_10037285 | |||
| 1526 | Ga0316177_1051669 | |||
| 1527 | Ga0265331_10086685 | |||
| 1528 | Ga0307513_10060125 | |||
| 1529 | Ga0307513_10132909 | |||
| 1530 | Ga0307408_100055244 | |||
| 1531 | Ga0307408_100078202 | |||
| 1532 | Ga0307408_100150390 | |||
| 1533 | Ga0307408_100575655 | |||
| 1534 | Ga0307508_10218068 | |||
| 1535 | Ga0307405_10003177 | |||
| 1536 | Ga0307405_10413462 | |||
| 1537 | Ga0307413_10005727 | |||
| 1538 | Ga0307413_10009668 | |||
| 1539 | Ga0307413_10327094 | |||
| 1540 | Ga0307410_10005363 | |||
| 1541 | Ga0307410_10035115 | |||
| 1542 | Ga0307410_10096682 | |||
| 1543 | Ga0307410_10120342 | |||
| 1544 | Ga0307406_10248438 | |||
| 1545 | Ga0307407_10208043 | |||
| 1546 | Ga0307412_10000126 | |||
| 1547 | Ga0307412_10005327 | |||
| 1548 | Ga0307412_10171259 | |||
| 1549 | Ga0307409_100231919 | |||
| 1550 | Ga0307409_100331238 | |||
| 1551 | Ga0307409_100519028 | |||
| 1552 | Ga0307416_100122197 | |||
| 1553 | Ga0307416_100212031 | |||
| 1554 | Ga0307416_100370836 | |||
| 1555 | Ga0307416_100451249 | |||
| 1556 | Ga0307414_10000270 | |||
| 1557 | Ga0307414_10044113 | |||
| 1558 | Ga0307414_10103634 | |||
| 1559 | Ga0307414_10145329 | |||
| 1560 | Ga0307414_10253571 | |||
| 1561 | Ga0307414_10467753 | |||
| 1562 | Ga0307414_10628695 | |||
| 1563 | Ga0307411_10074514 | |||
| 1564 | Ga0307411_10119820 | |||
| 1565 | Ga0307411_10165095 | |||
| 1566 | Ga0307411_10234898 | |||
| 1567 | Ga0307411_10299278 | |||
| 1568 | Ga0307415_100064979 | |||
| 1569 | Ga0307415_100315582 | |||
| 1570 | Ga0316583_10007557 | |||
| 1571 | Ga0307510_10211222 | |||
| 1572 | Ga0307510_10356259 | |||
| 1573 | Ga0373962_0068779 | |||
| 1574 | Ga0373931_0003323 | |||
| 1575 | Ga0373927_0232837 | |||
| 1576 | Ga0316582_0030777 | |||
| 1577 | Ga0316584_0106575 | |||
| 1578 | Ga0316584_0345309 | |||
| 1579 | Ga0316584_0556861 | |||
| 1580 | Ga0395899_0037987 | |||
| 1581 | Ga0395900_0050564 | |||
| 1582 | Ga0395905_0081567 | |||
| 1583 | Ga0395905_0230214 | |||
| 1584 | Ga0237819_03911 | |||
| 1585 | Ga0436365_0083543 | |||
| 1586 | Ga0436365_0124207 | |||
| 1587 | Ga0436365_0922968 | |||
| 1588 | Ga0436365_1181252 | |||
| 1589 | Ga0436365_1272877 | |||
| 1590 | Ga0436363_0832933 | |||
| 1591 | Ga0436363_1317039 | |||
| 1592 | Ga0436362_0376260 | |||
| 1593 | Ga0439436_0006762 | |||
| 1594 | Ga0439439_0011842 | |||
| 1595 | Ga0439439_0040713 | |||
| 1596 | Ga0439461_0000005 | |||
| 1597 | Ga0439461_0001836 | |||
| 1598 | Ga0439465_0005156 | |||
| 1599 | Ga0439465_0005367 | |||
| 1600 | Ga0439431_0000066 | |||
| 1601 | Ga0439431_0011328 | |||
| 1602 | Ga0439442_024642 | |||
| 1603 | Ga0439445_0003763 | |||
| 1604 | Ga0439445_0003804 | |||
| 1605 | Ga0439445_0013081 | |||
| 1606 | Ga0439448_0035805 | |||
| 1607 | Ga0439448_0039282 | |||
| 1608 | Ga0439448_0083156 | |||
| 1609 | Ga0439432_008221 | |||
| 1610 | Ga0439452_007753 | |||
| 1611 | Ga0439452_016440 | |||
| 1612 | Ga0439455_0002972 | |||
| 1613 | Ga0439455_0028443 | |||
| 1614 | Ga0439462_0000552 | |||
| 1615 | Ga0439462_0000631 | |||
| 1616 | Ga0450894_011747 | |||
| 1617 | Ga0439458_0000263 | |||
| 1618 | Ga0439458_0004273 | |||
| 1619 | Ga0439458_0006327 | |||
| 1620 | Ga0439434_0005169 | |||
| 1621 | Ga0439434_0018492 | |||
| 1622 | Ga0466966_0058247 | |||
| 1623 | Ga0466961_0009584 | |||
| 1624 | Ga0466964_0016699 | |||
| 1625 | Ga0466971_0011526 | |||
| 1626 | Ga0466971_0066471 | |||
| 1627 | Ga0466968_0004499 | |||
| 1628 | Ga0466970_0024989 | |||
| 1629 | Ga0466957_0020005 | |||
| 1630 | Ga0466960_0000991 | |||
| 1631 | Ga0466959_0021515 | |||
| 1632 | Ga0451576_0000017 | |||
| 1633 | Ga0466958_0030818 | |||
| 1634 | Ga0466958_0034088 | |||
| 1635 | Ga0466967_0462283 | |||
| 1636 | Ga0495617_006845 | |||
| 1637 | Ga0495617_010490 | |||
| 1638 | Ga0495627_000336 | |||
| 1639 | Ga0495627_001139 | |||
| 1640 | Ga0495638_0000068 | |||
| 1641 | Ga0495638_0016810 | |||
| 1642 | Ga0495638_0046222 | |||
| 1643 | Ga0495650_0000091 | |||
| 1644 | Ga0495650_0001028 | |||
| 1645 | Ga0495650_0001420 | |||
| 1646 | Ga0495650_0051284 | |||
| 1647 | Ga0495584_0136670 | |||
| 1648 | Ga0495585_0005357 | |||
| 1649 | Ga0495596_0000267 | |||
| 1650 | Ga0495607_0020242 | |||
| 1651 | Ga0495607_0030552 | |||
| 1652 | Ga0495583_0000269 | |||
| 1653 | Ga0495583_0000406 | |||
| 1654 | Ga0495583_0017415 | |||
| 1655 | Ga0495606_0000457 | |||
| 1656 | Ga0495606_0142636 | |||
| 1657 | Ga0495610_0000015 | |||
| 1658 | Ga0495610_0000083 | |||
| 1659 | Ga0495616_0000010 | |||
| 1660 | Ga0495616_0097461 | |||
| 1661 | Ga0495620_0029925 | |||
| 1662 | Ga0495631_0074987 | |||
| 1663 | Ga0495631_0128273 | |||
| 1664 | Ga0495632_0000351 | |||
| 1665 | Ga0495632_0001120 | |||
| 1666 | Ga0495632_0029442 | |||
| 1667 | Ga0495632_0052897 | |||
| 1668 | Ga0495632_0161298 | |||
| 1669 | Ga0495637_0105205 | |||
| 1670 | Ga0495643_0009428 | |||
| 1671 | Ga0495643_0011767 | |||
| 1672 | Ga0495643_0025484 | |||
| 1673 | Ga0495643_0030194 | |||
| 1674 | Ga0495643_0044184 | |||
| 1675 | Ga0495643_0048857 | |||
| 1676 | Ga0495643_0052511 | |||
| 1677 | Ga0495648_0000046 | |||
| 1678 | Ga0495648_0000114 | |||
| 1679 | Ga0495648_0013048 | |||
| 1680 | Ga0495648_0156523 | |||
| 1681 | Ga0495663_0006507 | |||
| 1682 | Ga0495642_0003030 | |||
| 1683 | Ga0495654_0044137 | |||
| 1684 | Ga0495654_0061539 | |||
| 1685 | Ga0495654_0074574 | |||
| 1686 | Ga0495654_0094515 | |||
| 1687 | Ga0495621_0004419 | |||
| 1688 | Ga0495597_0038934 | |||
| 1689 | Ga0495633_0000739 | |||
| 1690 | Ga0495633_0000929 | |||
| 1691 | Ga0495633_0016576 | |||
| 1692 | Ga0495633_0033973 | |||
| 1693 | Ga0495633_0034668 | |||
| 1694 | Ga0495668_0000022 | |||
| 1695 | Ga0495668_0031988 | |||
| 1696 | Ga0495668_0087011 | |||
| 1697 | Ga0495611_0062972 | |||
| 1698 | Ga0495611_0076407 | |||
| 1699 | Ga0495625_0032785 | |||
| 1700 | Ga0495625_0047750 | |||
| 1701 | Ga0495625_0048759 | |||
| 1702 | Ga0495625_0140058 | |||
| 1703 | Ga0495625_0372997 | |||
| 1704 | Ga0495661_0027151 | |||
| 1705 | Ga0495661_0143917 | |||
| 1706 | Ga0495669_0000047 | |||
| 1707 | Ga0495670_0000019 | |||
| 1708 | Ga0495670_0032241 | |||
| 1709 | Ga0495671_0000057 | |||
| 1710 | Ga0495671_0015063 | |||
| 1711 | Ga0495660_0010290 | |||
| 1712 | Ga0495683_0008682 | |||
| 1713 | Ga0495687_000043 | |||
| 1714 | Ga0495687_000083 | |||
| 1715 | Ga0495687_029728 | |||
| 1716 | Ga0495677_0007237 | |||
| 1717 | Ga0495673_0000110 | |||
| 1718 | Ga0495673_0037586 | |||
| 1719 | Ga0495673_0052135 | |||
| 1720 | Ga0495681_0000036 | |||
| 1721 | Ga0495681_0000445 | |||
| 1722 | Ga0495681_0051438 | |||
| 1723 | Ga0495686_0000273 | |||
| 1724 | Ga0495686_0000985 | |||
| 1725 | Ga0495593_0198735 | |||
| 1726 | Ga0495615_0001607 | |||
| 1727 | Ga0495626_0000808 | |||
| 1728 | Ga0496100_0002118 | |||
| 1729 | Ga0496100_0221074 | |||
| 1730 | Ga0496100_0494182 | |||
| 1731 | Ga0496101_0028746 | |||
| 1732 | Ga0496102_0000022 | |||
| 1733 | Ga0496102_0001244 | |||
| 1734 | Ga0496102_0139972 | |||
| 1735 | Ga0496103_0000167 | |||
| 1736 | Ga0496103_0000648 | |||
| 1737 | Ga0496103_0001474 | |||
| 1738 | Ga0496103_0030200 | |||
| 1739 | Ga0496104_0000882 | |||
| 1740 | Ga0496104_0001962 | |||
| 1741 | Ga0496104_0025352 | |||
| 1742 | Ga0496105_0000447 | |||
| 1743 | Ga0496105_0000479 | |||
| 1744 | Ga0496105_0006155 | |||
| 1745 | Ga0496105_0017067 | |||
| 1746 | Ga0496106_0007027 | |||
| 1747 | Ga0496107_0000287 | |||
| 1748 | Ga0496107_0093085 | |||
| 1749 | Ga0496108_0000270 | |||
| 1750 | Ga0496109_0267471 | |||
| 1751 | Ga0496109_0537217 | |||
| 1752 | Ga0496110_0018059 | |||
| 1753 | Ga0496110_0119140 | |||
| 1754 | Ga0496110_0523614 | |||
| 1755 | Ga0496110_0583010 | |||
| 1756 | Ga0496111_0013236 | |||
| 1757 | Ga0496111_0020176 | |||
| 1758 | Ga0496111_0054137 | |||
| 1759 | Ga0496111_0106914 | |||
| 1760 | Ga0496111_0145735 | |||
| 1761 | Ga0496112_0014916 | |||
| 1762 | Ga0496113_0000442 | |||
| 1763 | Ga0496113_0002636 | |||
| 1764 | Ga0496113_0021719 | |||
| 1765 | Ga0496114_0002987 | |||
| 1766 | Ga0496114_0023598 | |||
| 1767 | Ga0496115_0000029 | |||
| 1768 | Ga0496115_0000665 | |||
| 1769 | Ga0496116_0008266 | |||
| 1770 | Ga0496116_0031125 | |||
| 1771 | Ga0496116_0055889 | |||
| 1772 | Ga0496117_0000260 | |||
| 1773 | Ga0496117_0000566 | |||
| 1774 | Ga0496117_0005957 | |||
| 1775 | Ga0496117_0016880 | |||
| 1776 | Ga0496117_0029232 | |||
| 1777 | Ga0496117_0090680 | |||
| 1778 | Ga0496117_0090940 | |||
| 1779 | Ga0496118_0000039 | |||
| 1780 | Ga0496118_0009583 | |||
| 1781 | Ga0496118_0013474 | |||
| 1782 | Ga0496118_0015672 | |||
| 1783 | Ga0496118_0016400 | |||
| 1784 | Ga0496118_0018558 | |||
| 1785 | Ga0496118_0019153 | |||
| 1786 | Ga0496118_0020492 | |||
| 1787 | Ga0496118_0048476 | |||
| 1788 | Ga0496119_0002088 | |||
| 1789 | Ga0496119_0010119 | |||
| 1790 | Ga0496120_0001454 | |||
| 1791 | Ga0496120_0017516 | |||
| 1792 | Ga0496120_0031863 | |||
| 1793 | Ga0496121_0000683 | |||
| 1794 | Ga0496121_0001144 | |||
| 1795 | Ga0496121_0001713 | |||
| 1796 | Ga0496121_0002098 | |||
| 1797 | Ga0496121_0002348 | |||
| 1798 | Ga0496121_0003389 | |||
| 1799 | Ga0496121_0014109 | |||
| 1800 | Ga0496121_0022572 | |||
| 1801 | Ga0496121_0031799 | |||
| 1802 | Ga0496122_0003064 | |||
| 1803 | Ga0496122_0007119 | |||
| 1804 | Ga0496122_0012916 | |||
| 1805 | Ga0496122_0028094 | |||
| 1806 | Ga0496122_0045084 | |||
| 1807 | Ga0496122_0057644 | |||
| 1808 | Ga0496122_0066300 | |||
| 1809 | Ga0496123_0002028 | |||
| 1810 | Ga0496123_0009892 | |||
| 1811 | Ga0496123_0012423 | |||
| 1812 | Ga0496123_0173308 | |||
| 1813 | Ga0496124_0000076 | |||
| 1814 | Ga0496124_0001874 | |||
| 1815 | Ga0496124_0002194 | |||
| 1816 | Ga0496124_0008780 | |||
| 1817 | Ga0496124_0011818 | |||
| 1818 | Ga0496124_0019841 | |||
| 1819 | Ga0496124_0019879 | |||
| 1820 | Ga0496124_0063899 | |||
| 1821 | Ga0496124_0105055 | |||
| 1822 | Ga0496124_0118901 | |||
| 1823 | Ga0496125_0000505 | |||
| 1824 | Ga0496125_0007784 | |||
| 1825 | Ga0496125_0009478 | |||
| 1826 | Ga0496125_0014467 | |||
| 1827 | Ga0496125_0020907 | |||
| 1828 | Ga0496125_0034865 | |||
| 1829 | Ga0496125_0062742 | |||
| 1830 | Ga0496125_0066007 | |||
| 1831 | Ga0496125_0087920 | |||
| 1832 | Ga0496126_0000158 | |||
| 1833 | Ga0496126_0000469 | |||
| 1834 | Ga0496126_0003395 | |||
| 1835 | Ga0496126_0016624 | |||
| 1836 | Ga0496126_0018513 | |||
| 1837 | Ga0496126_0034157 | |||
| 1838 | Ga0496126_0037665 | |||
| 1839 | Ga0496126_0054595 | |||
| 1840 | Ga0496126_0079211 | |||
| 1841 | Ga0495678_027194 | |||
| 1842 | Ga0501033_0340072 | |||
| 1843 | Ga0501034_0021162 | |||
| 1844 | Ga0501034_0036153 | |||
| 1845 | Ga0501034_0079638 | |||
| 1846 | Ga0501034_0555334 | |||
| 1847 | Ga0501036_0151941 | |||
| 1848 | Ga0501037_0099976 | |||
| 1849 | Ga0501047_0241651 | |||
| 1850 | Ga0501047_0305110 | |||
| 1851 | Ga0501223_000135 | |||
| 1852 | Ga0501224_000042 | |||
| 1853 | Ga0501233_035122 | |||
| 1854 | Ga0501235_010553 | |||
| 1855 | Ga0501249_000256 | |||
| 1856 | Ga0501225_0000134 | |||
| 1857 | Ga0501225_0005268 | |||
| 1858 | Ga0501080_0604152 | |||
| 1859 | Ga0501083_0070382 | |||
| 1860 | Ga0501035_0376890 | |||
| 1861 | Ga0501044_0237619 | |||
| 1862 | Ga0501044_0338903 | |||
| 1863 | Ga0501226_000099 | |||
| 1864 | nmdc:mga03683_52_c1 | |||
| 1865 | nmdc:mga03683_757_c1 | |||
| 1866 | nmdc:mga03n38_1944_c1 | |||
| 1867 | nmdc:mga00v17_205795_c1 | |||
| 1868 | nmdc:mga0k408_118952_c1 | |||
| 1869 | nmdc:mga0k408_12_c1 | |||
| 1870 | nmdc:mga06z11_119_c1 | |||
| 1871 | nmdc:mga04h51_37_c1 | |||
| 1872 | nmdc:mga07m45_11_c1 | |||
| 1873 | nmdc:mga07m45_172015_c1 | |||
| 1874 | nmdc:mga07m45_9729_c1 | |||
| 1875 | nmdc:mga05p37_847944_c1 | |||
| 1876 | nmdc:mga09592_111294_c1 | |||
| 1877 | nmdc:mga0n895_28520_c1 | |||
| 1878 | nmdc:mga0sz30_1423_c1 | |||
| 1879 | nmdc:mga0sz30_39425_c1 | |||
| 1880 | Ga0500610_0000508 | |||
| 1881 | Ga0500643_000001 | |||
| 1882 | Ga0500643_000044 | |||
| 1883 | Ga0500643_007423 | |||
| 1884 | Ga0500643_012451 | |||
| 1885 | Ga0500643_015888 | |||
| 1886 | Ga0500643_021524 | |||
| 1887 | Ga0500566_0004226 | |||
| 1888 | Ga0500562_003253 | |||
| 1889 | Ga0500594_0005674 | |||
| 1890 | Ga0500594_0027135 | |||
| 1891 | Ga0500595_000814 | |||
| 1892 | Ga0500595_050618 | |||
| 1893 | Ga0500597_000193 | |||
| 1894 | Ga0500608_000042 | |||
| 1895 | Ga0500626_111952 | |||
| 1896 | Ga0500642_0001178 | |||
| 1897 | Ga0500658_0001159 | |||
| 1898 | Ga0500658_0010532 | |||
| 1899 | Ga0500559_0001036 | |||
| 1900 | Ga0500559_0027208 | |||
| 1901 | Ga0500559_0065641 | |||
| 1902 | Ga0500559_0135001 | |||
| 1903 | Ga0500564_005997 | |||
| 1904 | Ga0500568_0022365 | |||
| 1905 | Ga0500590_102144 | |||
| 1906 | Ga0500604_0000108 | |||
| 1907 | Ga0500604_0004017 | |||
| 1908 | Ga0500616_0000161 | |||
| 1909 | Ga0500616_0001142 | |||
| 1910 | Ga0500616_0001975 | |||
| 1911 | Ga0500619_016693 | |||
| 1912 | Ga0500622_0011523 | |||
| 1913 | Ga0500624_000003 | |||
| 1914 | Ga0500627_0000204 | |||
| 1915 | Ga0500636_0007966 | |||
| 1916 | Ga0500637_0000024 | |||
| 1917 | Ga0500567_000588 | |||
| 1918 | Ga0500625_000157 | |||
| 1919 | Ga0500645_000038 | |||
| 1920 | Ga0500645_000842 | |||
| 1921 | Ga0500596_003694 | |||
| 1922 | Ga0500661_013092 | |||
| 1923 | Ga0466962_0021624 | |||
| 1924 | 2511128130 | |||
| 1925 | 2643951557 | |||
| 1926 | 2738712804 | |||
| 1927 | 2738851228 | |||
| 1928 | 2738866958 | |||
| 1929 | 2739299475 | |||
| 1930 | 2739361154 | |||
| 1931 | 2739649041 | |||
| 1932 | 2740027514 | |||
| 1933 | 2819554733 | |||
| 1934 | 2895882177 | |||
| 1935 | 2896185912 | |||
| 1936 | 2896256083 | |||
| 1937 | 2919142568 | |||
| 1938 | 2919712539 | |||
| 1939 | 2928104539 | |||
| 1940 | 2928963164 | |||
| 1941 | 3000867166 | |||
| 1942 | 8054305263 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8w6j-assembly1.cif.gz_B | cryo-em structure of escherichia coli str k12 ftse(e163q)x/envc complex with atp in peptidisc | 0.9569 | 15 | 230 |
| 7v8i-assembly1.cif.gz_F | lolcd(e171q)e with bound amppnp in nanodiscs | 0.9544 | 13 | 230 |
| 6cvl-assembly1.cif.gz_D | crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein | 0.954 | 14 | 229 |
| 6cvl-assembly1.cif.gz_C | crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein | 0.9494 | 14 | 229 |
| 8w6j-assembly1.cif.gz_B | cryo-em structure of escherichia coli str k12 ftse(e163q)x/envc complex with atp in peptidisc | 0.9483 | 15 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P16679_1_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9363 | 15 | 224 | 3.40.50.300 |
| af_P0A9R7_1_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.932 | 15 | 230 | 3.40.50.300 |
| af_Q55EH8_3_247_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9252 | 13 | 229 | 3.40.50.300 |
| af_Q9VRG3_1356_1574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9245 | 13 | 231 | 3.40.50.300 |
| af_A4HRM7_2286_2560_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9232 | 13 | 230 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0G8E7-F1-model_v4 | Cell division ATP-binding protein FtsE | 0.9834 | 13 | 230 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0051301 |
| AF-A0A2H0MND8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9512 | 13 | 229 |
GO:0005524
GO:0016887 |
| AF-A0A1M6SP75-F1-model_v4 | Putative ABC transport system ATP-binding protein | 0.9499 | 13 | 231 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A2E0G8E7-F1-model_v4 | Cell division ATP-binding protein FtsE | 0.9489 | 13 | 230 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0051301 |
| AF-A0A037US35-F1-model_v4 | deleted | 0.9438 | 13 | 224 |
|