F487119

General Info

Members Datasets Scaffolds Average Seq Length
971 388 1942 244

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10002528|Ga0163162_100025282
Length 290
Sequence MGRVQQTIASSGEKCFHALFSTSIAAYSRFIAQFAPNRTGNAKLLMSQPDAEIVQFDNVGLRYGTGKEVLTDISFTLYPGCFYFLTGASGAGKTSLLKLLYLSQRPSRGLIRMFGTDAITLPRERLPGFRRRLGVVFQDFRLVPHLSAFDNVALPLRVAGVSEKEITKPVTEMLDWVGLGDRINARPATLSGGEQQRVAIARAVIARPDMLVADEPTGNVDPDMALKLLRLFESLNRLGTTVVVATHDLHLIRNVPESLIMRLDKGRLSDPTGALRYPPRRSTTSASGVR

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
228 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
229 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
230 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
256 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
257 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
320 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
321 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
322 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
323 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
324 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
332 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
341 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
342 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
345 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
346 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
347 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
350 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
351 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
356 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
361 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
362 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
363 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
364 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
365 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
368 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
371 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
372 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
373 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
374 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
375 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
376 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
377 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
378 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
379 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
380 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
381 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
382 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
383 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
384 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
385 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
386 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
387 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
388 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0.21
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.26
Nodule 0
Rhizoplane 4.22
Rhizosphere 73.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10002528 3300013306 Bacteria 17307
2 SwRhRL2b_contig_1117632 2162886007 Bacteria 1287
3 SwRhRL2b_contig_1955283 2162886007 Bacteria 9060
4 SwRhRL2b_contig_2752641 2162886007 Bacteria 1143
5 SwRhRL2b_contig_3948926 2162886007 Bacteria 15742
6 JGI24736J21556_1001607 3300001904 Bacteria 4109
7 JGI24741J21665_1000677 3300001915 Bacteria 10260
8 JGI24752J21851_1004063 3300001976 Bacteria 1921
9 JGI24740J21852_10002676 3300001979 Bacteria 7995
10 JGI24739J22299_10012561 3300001989 Bacteria 3106
11 JGI24737J22298_10002657 3300001990 Bacteria 6320
12 JGI24737J22298_10003202 3300001990 Bacteria 5808
13 JGI24737J22298_10018518 3300001990 Bacteria 2234
14 JGI24735J21928_10000951 3300002067 Bacteria 10337
15 JGI24748J21848_1001609 3300002074 Bacteria 2510
16 JGI24738J21930_10001235 3300002075 Bacteria 7187
17 JGI24738J21930_10005188 3300002075 Bacteria 3145
18 JGI24742J22300_10016742 3300002244 Bacteria 1238
19 JGI24751J29686_10000323 3300002459 Bacteria 17632
20 JGI24751J29686_10019978 3300002459 Bacteria 1387
21 JGI25150J39212_1000966 3300002774 Bacteria 9083
22 JGI25151J46595_10005487 3300003187 Bacteria 6544
23 JGI25153J46596_10000045 3300003215 Bacteria 149347
24 Ga0055532_1011407 3300003758 Bacteria 1047
25 Ga0055525_1000080 3300003759 Bacteria 164642
26 Ga0055542_1000012 3300003762 Bacteria 391808
27 Ga0055529_1000002 3300003763 Bacteria 537914
28 Ga0055529_1000004 3300003763 Bacteria 433331
29 Ga0055526_1004036 3300003771 Bacteria 9020
30 Ga0055537_1002102 3300003773 Bacteria 6999
31 Ga0055524_1000244 3300003775 Bacteria 56875
32 Ga0055530_10000429 3300003791 Bacteria 37251
33 Ga0055530_10005249 3300003791 Bacteria 6251
34 Ga0055540_1001899 3300003792 Bacteria 11712
35 Ga0055531_10000472 3300003794 Bacteria 37251
36 Ga0055531_10009286 3300003794 Bacteria 5048
37 Ga0055531_10022390 3300003794 Bacteria 2409
38 Ga0055543_1020794 3300004625 Bacteria 1202
39 Ga0065165_1002357 3300005262 Bacteria 16372
40 Ga0065165_1007153 3300005262 Bacteria 5584
41 Ga0065165_1038795 3300005262 Bacteria 1432
42 Ga0065165_1042953 3300005262 Bacteria 1330
43 Ga0065704_10075413 3300005289 Bacteria 5605
44 Ga0065704_10082534 3300005289 Bacteria 3587
45 Ga0065704_10129257 3300005289 Bacteria 1651
46 Ga0065704_10173451 3300005289 Bacteria 1278
47 Ga0070658_10000003 3300005327 Bacteria 465963
48 Ga0070658_10000062 3300005327 Bacteria 107844
49 Ga0070658_10000167 3300005327 Bacteria 57334
50 Ga0070658_10004751 3300005327 Bacteria 11051
51 Ga0070658_10017808 3300005327 Bacteria 5681
52 Ga0070658_10044462 3300005327 Bacteria 3589
53 Ga0070658_10054793 3300005327 Bacteria 3238
54 Ga0070658_10102810 3300005327 Bacteria 2363
55 Ga0070658_10115593 3300005327 Bacteria 2226
56 Ga0070658_10158829 3300005327 Bacteria 1896
57 Ga0070658_10275481 3300005327 Bacteria 1431
58 Ga0070670_100025864 3300005331 Bacteria 5049
59 Ga0070670_100059410 3300005331 Bacteria 3282
60 Ga0070670_100084102 3300005331 Bacteria 2734
61 Ga0070677_10000114 3300005333 Bacteria 26571
62 Ga0068869_100126975 3300005334 Bacteria 1957
63 Ga0070666_10001598 3300005335 Bacteria 13778
64 Ga0070666_10005216 3300005335 Bacteria 7957
65 Ga0070666_10025868 3300005335 Bacteria 3828
66 Ga0070666_10298636 3300005335 Bacteria 1147
67 Ga0070680_100002171 3300005336 Bacteria 14459
68 Ga0070680_100112775 3300005336 Bacteria 2264
69 Ga0070680_100512988 3300005336 Bacteria 1026
70 Ga0070660_100000991 3300005339 Bacteria 19050
71 Ga0070660_100001813 3300005339 Bacteria 14658
72 Ga0070660_100003112 3300005339 Bacteria 11392
73 Ga0070660_100007024 3300005339 Bacteria 7819
74 Ga0070660_100045418 3300005339 Bacteria 3362
75 Ga0070660_100173063 3300005339 Bacteria 1745
76 Ga0070660_100182926 3300005339 Bacteria 1696
77 Ga0070660_100264924 3300005339 Bacteria 1404
78 Ga0070687_100219985 3300005343 Bacteria 1162
79 Ga0070661_100006660 3300005344 Bacteria 7965
80 Ga0070661_100006864 3300005344 Bacteria 7853
81 Ga0070661_100097671 3300005344 Bacteria 2181
82 Ga0070661_100121778 3300005344 Bacteria 1955
83 Ga0070661_100248303 3300005344 Bacteria 1372
84 Ga0070692_10000469 3300005345 Bacteria 12367
85 Ga0070668_100000050 3300005347 Bacteria 73885
86 Ga0070668_100001905 3300005347 Bacteria 15260
87 Ga0070668_100010145 3300005347 Bacteria 6983
88 Ga0070668_100037299 3300005347 Bacteria 3711
89 Ga0070668_100084213 3300005347 Bacteria 2497
90 Ga0070669_100000039 3300005353 Bacteria 135033
91 Ga0070669_100000048 3300005353 Bacteria 118472
92 Ga0070669_100000094 3300005353 Bacteria 87053
93 Ga0070669_100002467 3300005353 Bacteria 13394
94 Ga0070669_100007602 3300005353 Bacteria 7749
95 Ga0070669_100039460 3300005353 Bacteria 3431
96 Ga0070669_100105111 3300005353 Bacteria 2135
97 Ga0070669_100257216 3300005353 Bacteria 1392
98 Ga0070675_100106692 3300005354 Bacteria 2364
99 Ga0070675_100142897 3300005354 Bacteria 2047
100 Ga0070671_100000119 3300005355 Bacteria 51011
101 Ga0070671_100000243 3300005355 Bacteria 36590
102 Ga0070671_100007867 3300005355 Bacteria 8523
103 Ga0070671_100119854 3300005355 Bacteria 2214
104 Ga0070671_100129126 3300005355 Bacteria 2128
105 Ga0070671_100134440 3300005355 Bacteria 2084
106 Ga0070674_100039534 3300005356 Bacteria 3186
107 Ga0070673_100039063 3300005364 Bacteria 3629
108 Ga0070659_100000005 3300005366 Bacteria 259902
109 Ga0070659_100014130 3300005366 Bacteria 5958
110 Ga0070659_100017500 3300005366 Bacteria 5398
111 Ga0070659_100154606 3300005366 Bacteria 1872
112 Ga0070659_100157208 3300005366 Bacteria 1857
113 Ga0070659_100243779 3300005366 Bacteria 1488
114 Ga0070659_100251963 3300005366 Bacteria 1463
115 Ga0070667_100000025 3300005367 Bacteria 190744
116 Ga0070667_100000390 3300005367 Bacteria 47461
117 Ga0070667_100000660 3300005367 Bacteria 33497
118 Ga0070667_100017834 3300005367 Bacteria 5883
119 Ga0070667_100022278 3300005367 Bacteria 5256
120 Ga0070667_100045962 3300005367 Bacteria 3672
121 Ga0070667_100049302 3300005367 Bacteria 3546
122 Ga0070667_100070472 3300005367 Bacteria 2976
123 Ga0070667_100313234 3300005367 Bacteria 1415
124 Ga0070705_100076287 3300005440 Bacteria 2044
125 Ga0070708_100019346 3300005445 Bacteria 5720
126 Ga0070663_100012592 3300005455 Bacteria 5358
127 Ga0070663_100094978 3300005455 Bacteria 2215
128 Ga0070663_100151440 3300005455 Bacteria 1779
129 Ga0070663_100329408 3300005455 Bacteria 1230
130 Ga0070678_100002558 3300005456 Bacteria 9990
131 Ga0070662_100000795 3300005457 Bacteria 19378
132 Ga0070662_100004642 3300005457 Bacteria 8709
133 Ga0070662_100034298 3300005457 Bacteria 3578
134 Ga0070662_100057763 3300005457 Bacteria 2820
135 Ga0070662_100070881 3300005457 Bacteria 2568
136 Ga0070681_10032181 3300005458 Bacteria 5263
137 Ga0070681_10044606 3300005458 Bacteria 4439
138 Ga0070698_100134563 3300005471 Bacteria 2426
139 Ga0070679_100001927 3300005530 Bacteria 18644
140 Ga0070679_100022137 3300005530 Bacteria 6210
141 Ga0070679_100032968 3300005530 Bacteria 5126
142 Ga0070679_100780336 3300005530 Bacteria 899
143 Ga0070684_100077170 3300005535 Bacteria 2942
144 Ga0070684_100302988 3300005535 Bacteria 1466
145 Ga0068853_100003449 3300005539 Bacteria 12095
146 Ga0068853_100022626 3300005539 Bacteria 5252
147 Ga0068853_100030617 3300005539 Bacteria 4547
148 Ga0068853_100118110 3300005539 Bacteria 2363
149 Ga0068853_100359093 3300005539 Bacteria 1357
150 Ga0068853_100455372 3300005539 Bacteria 1204
151 Ga0070672_100018880 3300005543 Bacteria 4994
152 Ga0070672_100150810 3300005543 Bacteria 1923
153 Ga0070686_100000191 3300005544 Bacteria 42686
154 Ga0070665_100000088 3300005548 Bacteria 177729
155 Ga0070665_100000168 3300005548 Bacteria 119133
156 Ga0070665_100001278 3300005548 Bacteria 30172
157 Ga0070665_100003938 3300005548 Bacteria 15667
158 Ga0070665_100019960 3300005548 Bacteria 6730
159 Ga0070665_100090309 3300005548 Bacteria 3069
160 Ga0070665_100105251 3300005548 Bacteria 2823
161 Ga0068855_100001435 3300005563 Bacteria 29650
162 Ga0068855_100021313 3300005563 Bacteria 7771
163 Ga0068855_100026517 3300005563 Bacteria 6932
164 Ga0068855_100037627 3300005563 Bacteria 5753
165 Ga0068855_100039611 3300005563 Bacteria 5594
166 Ga0068855_100188948 3300005563 Bacteria 2325
167 Ga0068855_100476651 3300005563 Bacteria 1359
168 Ga0070664_100019373 3300005564 Bacteria 5599
169 Ga0070664_100023476 3300005564 Bacteria 5095
170 Ga0070664_100119593 3300005564 Bacteria 2305
171 Ga0070664_100611300 3300005564 Bacteria 1011
172 Ga0068857_100036896 3300005577 Bacteria 4329
173 Ga0068857_100096790 3300005577 Bacteria 2645
174 Ga0068857_100232343 3300005577 Bacteria 1687
175 Ga0068857_100273925 3300005577 Bacteria 1551
176 Ga0068857_100288371 3300005577 Bacteria 1511
177 Ga0068857_100850541 3300005577 Bacteria 873
178 Ga0068854_100001399 3300005578 Bacteria 14551
179 Ga0068854_100173017 3300005578 Bacteria 1681
180 Ga0068854_100215264 3300005578 Bacteria 1517
181 Ga0068854_100264331 3300005578 Bacteria 1379
182 Ga0068854_100311138 3300005578 Bacteria 1277
183 Ga0068856_100003976 3300005614 Bacteria 14808
184 Ga0068856_100009259 3300005614 Bacteria 9568
185 Ga0068856_100052680 3300005614 Bacteria 4013
186 Ga0068856_100369712 3300005614 Bacteria 1453
187 Ga0068852_100000919 3300005616 Bacteria 19508
188 Ga0068852_100050975 3300005616 Bacteria 3549
189 Ga0068852_100264633 3300005616 Bacteria 1652
190 Ga0068852_100349433 3300005616 Bacteria 1443
191 Ga0068852_100769502 3300005616 Bacteria 976
192 Ga0068852_100892356 3300005616 Bacteria 906
193 Ga0068859_100015185 3300005617 Bacteria 7730
194 Ga0068859_100033051 3300005617 Bacteria 5196
195 Ga0068864_100002231 3300005618 Bacteria 16006
196 Ga0068864_100008568 3300005618 Bacteria 8440
197 Ga0068851_10018950 3300005834 Bacteria 3322
198 Ga0068851_10121208 3300005834 Bacteria 1405
199 Ga0068851_10130618 3300005834 Bacteria 1358
200 Ga0068863_100000058 3300005841 Bacteria 123096
201 Ga0068863_100000187 3300005841 Bacteria 65873
202 Ga0068863_100001079 3300005841 Bacteria 27286
203 Ga0068863_100006943 3300005841 Bacteria 11101
204 Ga0068863_100035369 3300005841 Bacteria 4758
205 Ga0068863_100039107 3300005841 Bacteria 4514
206 Ga0068863_100097701 3300005841 Bacteria 2789
207 Ga0068858_100017541 3300005842 Bacteria 6714
208 Ga0068858_100027896 3300005842 Bacteria 5245
209 Ga0068858_100069896 3300005842 Bacteria 3254
210 Ga0068858_100602663 3300005842 Bacteria 1065
211 Ga0068860_100000057 3300005843 Bacteria 201847
212 Ga0068860_100003627 3300005843 Bacteria 15876
213 Ga0068860_100021480 3300005843 Bacteria 6249
214 Ga0068860_100024116 3300005843 Bacteria 5881
215 Ga0068860_100058249 3300005843 Bacteria 3672
216 Ga0068860_100058391 3300005843 Bacteria 3667
217 Ga0068860_100096730 3300005843 Bacteria 2814
218 Ga0068862_100000191 3300005844 Bacteria 67742
219 Ga0068862_100032566 3300005844 Bacteria 4405
220 Ga0068862_100054582 3300005844 Bacteria 3421
221 Ga0081539_10019651 3300005985 Bacteria 4612
222 Ga0075368_10000565 3300006042 Bacteria 11108
223 Ga0075364_10040053 3300006051 Bacteria 3039
224 Ga0075364_10079961 3300006051 Bacteria 2161
225 Ga0075432_10002220 3300006058 Bacteria 6464
226 Ga0075362_10000029 3300006177 Bacteria 56587
227 Ga0075362_10058309 3300006177 Bacteria 1741
228 Ga0075367_10007298 3300006178 Bacteria 5652
229 Ga0075369_10015041 3300006186 Bacteria 3100
230 Ga0075369_10040936 3300006186 Bacteria 1982
231 Ga0075366_10052037 3300006195 Bacteria 2433
232 Ga0097621_100122169 3300006237 Bacteria 2210
233 Ga0075370_10000011 3300006353 Bacteria 66429
234 Ga0075370_10002340 3300006353 Bacteria 8759
235 Ga0075370_10175836 3300006353 Bacteria 1259
236 Ga0075370_10218609 3300006353 Bacteria 1126
237 Ga0075434_100248156 3300006871 Bacteria 1799
238 Ga0075429_100105775 3300006880 Bacteria 2458
239 Ga0097620_100015185 3300006931 Bacteria 7730
240 Ga0097620_100023748 3300006931 Bacteria 6154
241 Ga0097620_100033051 3300006931 Bacteria 5196
242 Ga0105251_10000276 3300009011 Bacteria 51560
243 Ga0105251_10008893 3300009011 Bacteria 6011
244 Ga0105251_10035720 3300009011 Bacteria 2450
245 Ga0105250_10009073 3300009092 Bacteria 4201
246 Ga0105240_10003393 3300009093 Bacteria 24772
247 Ga0105240_10010858 3300009093 Bacteria 12756
248 Ga0105240_10252079 3300009093 Bacteria 2041
249 Ga0105240_10269265 3300009093 Bacteria 1962
250 Ga0105240_10319237 3300009093 Bacteria 1771
251 Ga0105240_10501760 3300009093 Bacteria 1349
252 Ga0105247_10033832 3300009101 Bacteria 3111
253 Ga0114129_10441353 3300009147 Bacteria 1708
254 Ga0105243_10001077 3300009148 Bacteria 24977
255 Ga0105243_10094543 3300009148 Bacteria 2468
256 Ga0105243_10155385 3300009148 Bacteria 1967
257 Ga0105243_10326533 3300009148 Bacteria 1400
258 Ga0105241_10002141 3300009174 Bacteria 14918
259 Ga0105241_10028145 3300009174 Bacteria 4186
260 Ga0105241_10650088 3300009174 Bacteria 958
261 Ga0105248_10026581 3300009177 Bacteria 6437
262 Ga0105248_10068994 3300009177 Bacteria 3969
263 Ga0105237_10001660 3300009545 Bacteria 28885
264 Ga0105237_10017714 3300009545 Bacteria 7383
265 Ga0105237_10443373 3300009545 Bacteria 1304
266 Ga0105237_10512954 3300009545 Bacteria 1205
267 Ga0105238_10370976 3300009551 Bacteria 1421
268 Ga0105238_10797365 3300009551 Bacteria 960
269 Ga0105249_10002820 3300009553 Bacteria 14999
270 Ga0105249_10007484 3300009553 Bacteria 9528
271 Ga0105249_10057499 3300009553 Bacteria 3563
272 Ga0105249_10101485 3300009553 Bacteria 2706
273 Ga0105249_10398377 3300009553 Bacteria 1406
274 Ga0105148_100452 3300009978 Bacteria 3936
275 Ga0105239_10002472 3300010375 Bacteria 23554
276 Ga0105246_10001372 3300011119 Bacteria 14354
277 Ga0105246_10951712 3300011119 Bacteria 774
278 Ga0157327_1001126 3300012512 Bacteria 1611
279 Ga0157373_10003673 3300013100 Bacteria 11604
280 Ga0157373_10014350 3300013100 Bacteria 5805
281 Ga0157373_10109959 3300013100 Bacteria 1937
282 Ga0157371_10000062 3300013102 Bacteria 169669
283 Ga0157371_10002207 3300013102 Bacteria 18854
284 Ga0157371_10021083 3300013102 Bacteria 4790
285 Ga0157371_10504304 3300013102 Bacteria 894
286 Ga0157370_10005110 3300013104 Bacteria 14804
287 Ga0157370_10051227 3300013104 Bacteria 3943
288 Ga0157370_10074081 3300013104 Bacteria 3212
289 Ga0157369_10118596 3300013105 Bacteria 2809
290 Ga0157369_10167954 3300013105 Bacteria 2313
291 Ga0157369_10240104 3300013105 Bacteria 1893
292 Ga0157378_10006122 3300013297 Bacteria 10534
293 Ga0163162_10000232 3300013306 Bacteria 51019
294 Ga0163162_10010482 3300013306 Bacteria 9011
295 Ga0163162_10023635 3300013306 Bacteria 6068
296 Ga0157372_10007274 3300013307 Bacteria 11788
297 Ga0157372_10014494 3300013307 Bacteria 8436
298 Ga0157372_10128915 3300013307 Bacteria 2909
299 Ga0157372_10137500 3300013307 Bacteria 2814
300 Ga0157372_10357253 3300013307 Bacteria 1702
301 Ga0157372_10497766 3300013307 Bacteria 1421
302 Ga0157375_10107516 3300013308 Bacteria 2883
303 Ga0157375_10548635 3300013308 Bacteria 1318
304 Ga0157375_11003094 3300013308 Bacteria 975
305 Ga0163163_10028485 3300014325 Bacteria 5365
306 Ga0163163_10655296 3300014325 Bacteria 1113
307 Ga0157379_10150015 3300014968 Bacteria 2103
308 Ga0157379_10323996 3300014968 Bacteria 1407
309 Ga0157376_11034093 3300014969 Bacteria 845
310 Ga0163161_10065480 3300017792 Bacteria 2652
311 Ga0163161_10117356 3300017792 Bacteria 1996
312 Ga0163161_10123799 3300017792 Bacteria 1945
313 Ga0206356_10967351 3300020070 Bacteria 1154
314 Ga0206353_11419480 3300020082 Bacteria 1555
315 Ga0213873_10000026 3300021358 Bacteria 74525
316 Ga0213876_10000149 3300021384 Bacteria 74548
317 Ga0213876_10000371 3300021384 Bacteria 38154
318 Ga0213876_10012241 3300021384 Bacteria 4567
319 Ga0209674_104378 3300025226 Bacteria 2310
320 Ga0209147_100882 3300025229 Bacteria 13811
321 Ga0209563_100058 3300025230 Bacteria 302571
322 Ga0209677_109030 3300025253 Bacteria 1841
323 Ga0209148_1000008 3300025254 Bacteria 1504371
324 Ga0209129_1003496 3300025258 Bacteria 6786
325 Ga0209565_1000029 3300025263 Bacteria 340335
326 Ga0209565_1000251 3300025263 Bacteria 57054
327 Ga0209455_1000002 3300025272 Bacteria 1505459
328 Ga0209673_1009829 3300025273 Bacteria 4098
329 Ga0209673_1025148 3300025273 Bacteria 1985
330 Ga0209025_1000993 3300025294 Bacteria 42002
331 Ga0209025_1103877 3300025294 Bacteria 891
332 Ga0209564_1001873 3300025295 Bacteria 18970
333 Ga0209758_1000002 3300025297 Bacteria 1400310
334 Ga0209758_1000007 3300025297 Bacteria 1270410
335 Ga0209758_1010016 3300025297 Bacteria 5756
336 Ga0209050_1000001 3300025298 Bacteria 3563507
337 Ga0209050_1000167 3300025298 Bacteria 151608
338 Ga0209050_1005376 3300025298 Bacteria 8093
339 Ga0209256_1000008 3300025299 Bacteria 975723
340 Ga0209051_1000360 3300025303 Bacteria 67080
341 Ga0209257_1000028 3300025304 Bacteria 699493
342 Ga0209257_1000893 3300025304 Bacteria 41890
343 Ga0209257_1007672 3300025304 Bacteria 6448
344 Ga0209257_1014531 3300025304 Bacteria 3375
345 Ga0209257_1015466 3300025304 Bacteria 3172
346 Ga0207656_10009546 3300025321 Bacteria 3605
347 Ga0207656_10079668 3300025321 Bacteria 1470
348 Ga0207656_10090765 3300025321 Bacteria 1386
349 Ga0207696_1005122 3300025711 Bacteria 5504
350 Ga0207713_1002506 3300025735 Bacteria 13305
351 Ga0207682_10002396 3300025893 Bacteria 8436
352 Ga0207710_10003855 3300025900 Bacteria 6629
353 Ga0207710_10050837 3300025900 Bacteria 1860
354 Ga0207688_10172340 3300025901 Bacteria 1287
355 Ga0207680_10000817 3300025903 Bacteria 14674
356 Ga0207680_10003518 3300025903 Bacteria 7370
357 Ga0207680_10092063 3300025903 Bacteria 1931
358 Ga0207680_10360599 3300025903 Bacteria 1022
359 Ga0207647_10004690 3300025904 Bacteria 10121
360 Ga0207647_10007524 3300025904 Bacteria 7859
361 Ga0207647_10017114 3300025904 Bacteria 4935
362 Ga0207647_10040920 3300025904 Bacteria 2916
363 Ga0207647_10169648 3300025904 Bacteria 1271
364 Ga0207645_10140691 3300025907 Bacteria 1572
365 Ga0207705_10000004 3300025909 Bacteria 705756
366 Ga0207705_10000005 3300025909 Bacteria 673478
367 Ga0207705_10000103 3300025909 Bacteria 97511
368 Ga0207705_10002703 3300025909 Bacteria 13568
369 Ga0207705_10046649 3300025909 Bacteria 3114
370 Ga0207705_10047290 3300025909 Bacteria 3094
371 Ga0207705_10089732 3300025909 Bacteria 2250
372 Ga0207705_10146704 3300025909 Bacteria 1766
373 Ga0207654_10000150 3300025911 Bacteria 44134
374 Ga0207654_10080212 3300025911 Bacteria 1962
375 Ga0207707_10023608 3300025912 Bacteria 5379
376 Ga0207707_10042890 3300025912 Bacteria 3948
377 Ga0207707_10342203 3300025912 Bacteria 1289
378 Ga0207695_10013603 3300025913 Bacteria 9692
379 Ga0207695_10018738 3300025913 Bacteria 7991
380 Ga0207695_10028019 3300025913 Bacteria 6257
381 Ga0207695_10132032 3300025913 Bacteria 2454
382 Ga0207695_10216992 3300025913 Bacteria 1821
383 Ga0207671_10000567 3300025914 Bacteria 49547
384 Ga0207671_10007737 3300025914 Bacteria 9257
385 Ga0207671_10034313 3300025914 Bacteria 3770
386 Ga0207660_10018096 3300025917 Bacteria 4693
387 Ga0207660_10463219 3300025917 Bacteria 1026
388 Ga0207657_10002582 3300025919 Bacteria 19592
389 Ga0207657_10002937 3300025919 Bacteria 18285
390 Ga0207657_10003198 3300025919 Bacteria 17527
391 Ga0207657_10008473 3300025919 Bacteria 10431
392 Ga0207657_10020085 3300025919 Bacteria 6325
393 Ga0207657_10088520 3300025919 Bacteria 2588
394 Ga0207657_10406177 3300025919 Bacteria 1071
395 Ga0207649_10003386 3300025920 Bacteria 8721
396 Ga0207649_10013635 3300025920 Bacteria 4541
397 Ga0207649_10312493 3300025920 Bacteria 1152
398 Ga0207652_10000489 3300025921 Bacteria 40293
399 Ga0207652_10026835 3300025921 Bacteria 4799
400 Ga0207652_10029162 3300025921 Bacteria 4611
401 Ga0207652_10095574 3300025921 Bacteria 2618
402 Ga0207652_10612319 3300025921 Bacteria 976
403 Ga0207681_10000050 3300025923 Bacteria 118481
404 Ga0207681_10000144 3300025923 Bacteria 59200
405 Ga0207681_10001096 3300025923 Bacteria 17540
406 Ga0207681_10003059 3300025923 Bacteria 10513
407 Ga0207681_10005654 3300025923 Bacteria 7674
408 Ga0207681_10133717 3300025923 Bacteria 1837
409 Ga0207681_10159210 3300025923 Bacteria 1700
410 Ga0207694_10131777 3300025924 Bacteria 2004
411 Ga0207650_10067376 3300025925 Bacteria 2686
412 Ga0207650_10228576 3300025925 Bacteria 1500
413 Ga0207650_10268151 3300025925 Bacteria 1387
414 Ga0207650_10374090 3300025925 Bacteria 1176
415 Ga0207659_10115202 3300025926 Bacteria 2050
416 Ga0207644_10000056 3300025931 Bacteria 84033
417 Ga0207644_10000134 3300025931 Bacteria 53152
418 Ga0207644_10000367 3300025931 Bacteria 29435
419 Ga0207644_10027263 3300025931 Bacteria 3946
420 Ga0207644_10097687 3300025931 Bacteria 2200
421 Ga0207644_10123750 3300025931 Bacteria 1972
422 Ga0207644_10160788 3300025931 Bacteria 1746
423 Ga0207644_10174712 3300025931 Bacteria 1679
424 Ga0207690_10000002 3300025932 Bacteria 807473
425 Ga0207690_10001516 3300025932 Bacteria 14528
426 Ga0207690_10002450 3300025932 Bacteria 11213
427 Ga0207690_10022186 3300025932 Bacteria 3946
428 Ga0207690_10228960 3300025932 Bacteria 1426
429 Ga0207706_10002382 3300025933 Bacteria 18355
430 Ga0207706_10030470 3300025933 Bacteria 4811
431 Ga0207706_10048453 3300025933 Bacteria 3758
432 Ga0207706_10053084 3300025933 Bacteria 3578
433 Ga0207706_10080509 3300025933 Bacteria 2864
434 Ga0207706_10087295 3300025933 Bacteria 2743
435 Ga0207709_10000005 3300025935 Bacteria 806813
436 Ga0207709_10253795 3300025935 Bacteria 1286
437 Ga0207669_10000174 3300025937 Bacteria 30026
438 Ga0207691_10033158 3300025940 Bacteria 4810
439 Ga0207691_10268079 3300025940 Bacteria 1471
440 Ga0207711_10021765 3300025941 Bacteria 5354
441 Ga0207689_10075646 3300025942 Bacteria 2768
442 Ga0207661_10030507 3300025944 Bacteria 4154
443 Ga0207661_10032877 3300025944 Bacteria 4023
444 Ga0207661_10674760 3300025944 Bacteria 950
445 Ga0207679_10015535 3300025945 Bacteria 5034
446 Ga0207679_10053837 3300025945 Bacteria 2960
447 Ga0207667_10000001 3300025949 Bacteria 1178522
448 Ga0207667_10001089 3300025949 Bacteria 34437
449 Ga0207667_10002432 3300025949 Bacteria 23319
450 Ga0207667_10009256 3300025949 Bacteria 11628
451 Ga0207667_10043432 3300025949 Bacteria 4770
452 Ga0207667_10105863 3300025949 Bacteria 2902
453 Ga0207667_10108443 3300025949 Bacteria 2864
454 Ga0207667_10484163 3300025949 Bacteria 1256
455 Ga0207651_10080622 3300025960 Bacteria 2343
456 Ga0207712_10001292 3300025961 Bacteria 17177
457 Ga0207712_10007474 3300025961 Bacteria 6899
458 Ga0207712_10011280 3300025961 Bacteria 5688
459 Ga0207712_10071925 3300025961 Bacteria 2489
460 Ga0207668_10000094 3300025972 Bacteria 63810
461 Ga0207668_10000436 3300025972 Bacteria 26329
462 Ga0207668_10068584 3300025972 Bacteria 2522
463 Ga0207668_10093353 3300025972 Bacteria 2217
464 Ga0207668_10171525 3300025972 Bacteria 1702
465 Ga0207640_10004898 3300025981 Bacteria 7275
466 Ga0207640_10007874 3300025981 Bacteria 5880
467 Ga0207640_10013210 3300025981 Bacteria 4727
468 Ga0207640_10038253 3300025981 Bacteria 3026
469 Ga0207640_10070550 3300025981 Bacteria 2350
470 Ga0207640_10092308 3300025981 Bacteria 2100
471 Ga0207640_10268623 3300025981 Bacteria 1333
472 Ga0207640_10284912 3300025981 Bacteria 1300
473 Ga0207658_10000023 3300025986 Bacteria 190806
474 Ga0207658_10000216 3300025986 Bacteria 60563
475 Ga0207658_10002737 3300025986 Bacteria 12730
476 Ga0207658_10003041 3300025986 Bacteria 11988
477 Ga0207658_10008354 3300025986 Bacteria 7047
478 Ga0207658_10010305 3300025986 Bacteria 6352
479 Ga0207658_10061944 3300025986 Bacteria 2798
480 Ga0207658_10115529 3300025986 Bacteria 2130
481 Ga0207677_10000100 3300026023 Bacteria 70908
482 Ga0207677_10226311 3300026023 Bacteria 1503
483 Ga0207703_10002369 3300026035 Bacteria 16392
484 Ga0207703_10003301 3300026035 Bacteria 13539
485 Ga0207703_10019876 3300026035 Bacteria 5249
486 Ga0207703_10105257 3300026035 Bacteria 2398
487 Ga0207703_10305518 3300026035 Bacteria 1452
488 Ga0207639_10001191 3300026041 Bacteria 17663
489 Ga0207639_10003214 3300026041 Bacteria 10985
490 Ga0207639_10007673 3300026041 Bacteria 7364
491 Ga0207639_10041254 3300026041 Bacteria 3451
492 Ga0207639_10097932 3300026041 Bacteria 2363
493 Ga0207639_10182258 3300026041 Bacteria 1787
494 Ga0207639_10287754 3300026041 Bacteria 1448
495 Ga0207678_10000079 3300026067 Bacteria 78764
496 Ga0207678_10013240 3300026067 Bacteria 7238
497 Ga0207678_10091516 3300026067 Bacteria 2600
498 Ga0207678_10320248 3300026067 Bacteria 1334
499 Ga0207702_10001332 3300026078 Bacteria 24705
500 Ga0207702_10013826 3300026078 Bacteria 6703
501 Ga0207702_10041221 3300026078 Bacteria 3871
502 Ga0207702_10187154 3300026078 Bacteria 1910
503 Ga0207702_10338539 3300026078 Bacteria 1437
504 Ga0207641_10000269 3300026088 Bacteria 66008
505 Ga0207641_10002412 3300026088 Bacteria 17264
506 Ga0207641_10003855 3300026088 Bacteria 13129
507 Ga0207641_10004669 3300026088 Bacteria 11816
508 Ga0207641_10004972 3300026088 Bacteria 11403
509 Ga0207641_10017468 3300026088 Bacteria 5873
510 Ga0207641_10089951 3300026088 Bacteria 2683
511 Ga0207641_10127064 3300026088 Bacteria 2284
512 Ga0207676_10001569 3300026095 Bacteria 16846
513 Ga0207676_10027677 3300026095 Bacteria 4224
514 Ga0207676_10032111 3300026095 Bacteria 3954
515 Ga0207676_10111941 3300026095 Bacteria 2286
516 Ga0207674_10016564 3300026116 Bacteria 8062
517 Ga0207674_10028880 3300026116 Bacteria 5846
518 Ga0207674_10124108 3300026116 Bacteria 2548
519 Ga0207674_10124747 3300026116 Bacteria 2541
520 Ga0207674_10810575 3300026116 Bacteria 903
521 Ga0207675_100009530 3300026118 Bacteria 9083
522 Ga0207683_10003668 3300026121 Bacteria 13351
523 Ga0207683_10230163 3300026121 Bacteria 1690
524 Ga0207698_10000019 3300026142 Bacteria 145910
525 Ga0207698_10000186 3300026142 Bacteria 38318
526 Ga0207698_10028185 3300026142 Bacteria 4001
527 Ga0207698_10041197 3300026142 Bacteria 3439
528 Ga0207698_10788321 3300026142 Bacteria 952
529 Ga0207698_10812398 3300026142 Bacteria 938
530 Ga0209813_10001114 3300027866 Bacteria 5991
531 Ga0207428_10069745 3300027907 Bacteria 2764
532 Ga0268266_10000074 3300028379 Bacteria 230993
533 Ga0268266_10000130 3300028379 Bacteria 147912
534 Ga0268266_10001691 3300028379 Bacteria 25327
535 Ga0268266_10002428 3300028379 Bacteria 20045
536 Ga0268266_10002447 3300028379 Bacteria 19919
537 Ga0268266_10019026 3300028379 Bacteria 5850
538 Ga0268266_10416723 3300028379 Bacteria 1272
539 Ga0268265_10000102 3300028380 Bacteria 106737
540 Ga0268265_10000271 3300028380 Bacteria 58874
541 Ga0268265_10018322 3300028380 Bacteria 4849
542 Ga0268265_10040823 3300028380 Bacteria 3428
543 Ga0268265_10054272 3300028380 Bacteria 3040
544 Ga0268265_10273429 3300028380 Bacteria 1508
545 Ga0268264_10000078 3300028381 Bacteria 249595
546 Ga0268264_10000180 3300028381 Bacteria 134339
547 Ga0268264_10004368 3300028381 Bacteria 12064
548 Ga0268264_10007758 3300028381 Bacteria 8936
549 Ga0268264_10008451 3300028381 Bacteria 8563
550 Ga0268264_10017221 3300028381 Bacteria 5919
551 Ga0268264_10046311 3300028381 Bacteria 3612
552 Ga0268264_10071817 3300028381 Bacteria 2934
553 Ga0307517_10012427 3300028786 Bacteria 11686
554 Ga0307517_10037285 3300028786 Bacteria 5435
555 Ga0316177_1051669 3300030731 Bacteria 1174
556 Ga0265331_10086685 3300031250 Bacteria 1450
557 Ga0307513_10060125 3300031456 Bacteria 4029
558 Ga0307513_10132909 3300031456 Bacteria 2430
559 Ga0307408_100055244 3300031548 Bacteria 2874
560 Ga0307408_100078202 3300031548 Bacteria 2465
561 Ga0307408_100150390 3300031548 Bacteria 1837
562 Ga0307408_100575655 3300031548 Bacteria 997
563 Ga0307508_10218068 3300031616 Bacteria 1508
564 Ga0307405_10003177 3300031731 Bacteria 7475
565 Ga0307405_10413462 3300031731 Bacteria 1059
566 Ga0307413_10005727 3300031824 Bacteria 5585
567 Ga0307413_10009668 3300031824 Bacteria 4628
568 Ga0307413_10327094 3300031824 Bacteria 1173
569 Ga0307410_10005363 3300031852 Bacteria 6780
570 Ga0307410_10035115 3300031852 Bacteria 3253
571 Ga0307410_10096682 3300031852 Bacteria 2108
572 Ga0307410_10120342 3300031852 Bacteria 1914
573 Ga0307406_10248438 3300031901 Bacteria 1338
574 Ga0307407_10208043 3300031903 Bacteria 1315
575 Ga0307412_10000126 3300031911 Bacteria 56270
576 Ga0307412_10005327 3300031911 Bacteria 7220
577 Ga0307412_10171259 3300031911 Bacteria 1624
578 Ga0307409_100231919 3300031995 Bacteria 1674
579 Ga0307409_100331238 3300031995 Bacteria 1429
580 Ga0307409_100519028 3300031995 Bacteria 1163
581 Ga0307416_100122197 3300032002 Bacteria 2323
582 Ga0307416_100212031 3300032002 Bacteria 1848
583 Ga0307416_100370836 3300032002 Bacteria 1457
584 Ga0307416_100451249 3300032002 Bacteria 1338
585 Ga0307414_10000270 3300032004 Bacteria 32016
586 Ga0307414_10044113 3300032004 Bacteria 3042
587 Ga0307414_10103634 3300032004 Bacteria 2147
588 Ga0307414_10145329 3300032004 Bacteria 1862
589 Ga0307414_10253571 3300032004 Bacteria 1464
590 Ga0307414_10467753 3300032004 Bacteria 1109
591 Ga0307414_10628695 3300032004 Bacteria 966
592 Ga0307411_10074514 3300032005 Bacteria 2313
593 Ga0307411_10119820 3300032005 Bacteria 1902
594 Ga0307411_10165095 3300032005 Bacteria 1663
595 Ga0307411_10234898 3300032005 Bacteria 1431
596 Ga0307411_10299278 3300032005 Bacteria 1289
597 Ga0307415_100064979 3300032126 Bacteria 2541
598 Ga0307415_100315582 3300032126 Bacteria 1301
599 Ga0316583_10007557 3300032133 Bacteria 3914
600 Ga0307510_10211222 3300033180 Bacteria 1463
601 Ga0307510_10356259 3300033180 Bacteria 913
602 Ga0373962_0068779 3300035242 Bacteria 1054
603 Ga0373931_0003323 3300035691 Bacteria 7206
604 Ga0373927_0232837 3300035695 Bacteria 1210
605 Ga0316582_0030777 3300036647 Bacteria 3273
606 Ga0316584_0106575 3300036712 Bacteria 2097
607 Ga0316584_0345309 3300036712 Bacteria 1069
608 Ga0316584_0556861 3300036712 Bacteria 800
609 Ga0395899_0037987 3300037312 Bacteria 3609
610 Ga0395900_0050564 3300037418 Bacteria 4281
611 Ga0395905_0081567 3300037471 Bacteria 3031
612 Ga0395905_0230214 3300037471 Bacteria 1733
613 Ga0237819_03911 3300038705 Bacteria 2543
614 Ga0436365_0083543 3300039437 Bacteria 85224
615 Ga0436365_0124207 3300039437 Bacteria 44215
616 Ga0436365_0922968 3300039437 Bacteria 9993
617 Ga0436365_1181252 3300039437 Bacteria 2793
618 Ga0436365_1272877 3300039437 Bacteria 2798
619 Ga0436363_0832933 3300039450 Bacteria 1410
620 Ga0436363_1317039 3300039450 Bacteria 777
621 Ga0436362_0376260 3300039453 Bacteria 74620
622 Ga0439436_0006762 3300041404 Bacteria 3524
623 Ga0439439_0011842 3300041406 Bacteria 2103
624 Ga0439439_0040713 3300041406 Bacteria 1203
625 Ga0439461_0000005 3300041410 Bacteria 28399
626 Ga0439461_0001836 3300041410 Bacteria 3342
627 Ga0439465_0005156 3300041413 Bacteria 4192
628 Ga0439465_0005367 3300041413 Bacteria 4088
629 Ga0439431_0000066 3300041997 Bacteria 16712
630 Ga0439431_0011328 3300041997 Bacteria 2036
631 Ga0439442_024642 3300042002 Bacteria 1252
632 Ga0439445_0003763 3300042004 Bacteria 3406
633 Ga0439445_0003804 3300042004 Bacteria 3392
634 Ga0439445_0013081 3300042004 Bacteria 2005
635 Ga0439448_0035805 3300042005 Bacteria 1591
636 Ga0439448_0039282 3300042005 Bacteria 1525
637 Ga0439448_0083156 3300042005 Bacteria 1076
638 Ga0439432_008221 3300042006 Bacteria 3669
639 Ga0439452_007753 3300042010 Bacteria 3267
640 Ga0439452_016440 3300042010 Bacteria 2010
641 Ga0439455_0002972 3300042012 Bacteria 3177
642 Ga0439455_0028443 3300042012 Bacteria 1376
643 Ga0439462_0000552 3300042015 Bacteria 7411
644 Ga0439462_0000631 3300042015 Bacteria 7071
645 Ga0450894_011747 3300042131 Bacteria 1141
646 Ga0439458_0000263 3300042157 Bacteria 12825
647 Ga0439458_0004273 3300042157 Bacteria 3295
648 Ga0439458_0006327 3300042157 Bacteria 2641
649 Ga0439434_0005169 3300042435 Bacteria 3816
650 Ga0439434_0018492 3300042435 Bacteria 2086
651 Ga0466966_0058247 3300044684 Bacteria 2442
652 Ga0466961_0009584 3300044693 Bacteria 6164
653 Ga0466964_0016699 3300044706 Bacteria 2804
654 Ga0466971_0011526 3300044719 Bacteria 3870
655 Ga0466971_0066471 3300044719 Bacteria 1634
656 Ga0466968_0004499 3300044735 Bacteria 5214
657 Ga0466970_0024989 3300044765 Bacteria 3126
658 Ga0466957_0020005 3300044842 Bacteria 3940
659 Ga0466960_0000991 3300044901 Bacteria 10127
660 Ga0466959_0021515 3300045049 Bacteria 4757
661 Ga0451576_0000017 3300045051 Bacteria 558261
662 Ga0466958_0030818 3300045836 Bacteria 3187
663 Ga0466958_0034088 3300045836 Bacteria 3036
664 Ga0466967_0462283 3300045976 Bacteria 1241
665 Ga0495617_006845 3300046452 Bacteria 3982
666 Ga0495617_010490 3300046452 Bacteria 3174
667 Ga0495627_000336 3300046453 Bacteria 44344
668 Ga0495627_001139 3300046453 Bacteria 17196
669 Ga0495638_0000068 3300046460 Bacteria 167596
670 Ga0495638_0016810 3300046460 Bacteria 4892
671 Ga0495638_0046222 3300046460 Bacteria 2736
672 Ga0495650_0000091 3300046471 Bacteria 228697
673 Ga0495650_0001028 3300046471 Bacteria 31367
674 Ga0495650_0001420 3300046471 Bacteria 23288
675 Ga0495650_0051284 3300046471 Bacteria 1701
676 Ga0495584_0136670 3300046491 Bacteria 1244
677 Ga0495585_0005357 3300046492 Bacteria 8098
678 Ga0495596_0000267 3300046500 Bacteria 34545
679 Ga0495607_0020242 3300046501 Bacteria 4211
680 Ga0495607_0030552 3300046501 Bacteria 3306
681 Ga0495583_0000269 3300046506 Bacteria 85380
682 Ga0495583_0000406 3300046506 Bacteria 65391
683 Ga0495583_0017415 3300046506 Bacteria 3815
684 Ga0495606_0000457 3300046507 Bacteria 67044
685 Ga0495606_0142636 3300046507 Bacteria 1413
686 Ga0495610_0000015 3300046512 Bacteria 391489
687 Ga0495610_0000083 3300046512 Bacteria 112946
688 Ga0495616_0000010 3300046513 Bacteria 224378
689 Ga0495616_0097461 3300046513 Bacteria 1383
690 Ga0495620_0029925 3300046515 Bacteria 2513
691 Ga0495631_0074987 3300046518 Bacteria 1460
692 Ga0495631_0128273 3300046518 Bacteria 1090
693 Ga0495632_0000351 3300046519 Bacteria 43708
694 Ga0495632_0001120 3300046519 Bacteria 22955
695 Ga0495632_0029442 3300046519 Bacteria 2859
696 Ga0495632_0052897 3300046519 Bacteria 1995
697 Ga0495632_0161298 3300046519 Bacteria 1033
698 Ga0495637_0105205 3300046520 Bacteria 1099
699 Ga0495643_0009428 3300046522 Bacteria 6068
700 Ga0495643_0011767 3300046522 Bacteria 5308
701 Ga0495643_0025484 3300046522 Bacteria 3345
702 Ga0495643_0030194 3300046522 Bacteria 3028
703 Ga0495643_0044184 3300046522 Bacteria 2422
704 Ga0495643_0048857 3300046522 Bacteria 2284
705 Ga0495643_0052511 3300046522 Bacteria 2188
706 Ga0495648_0000046 3300046524 Bacteria 167725
707 Ga0495648_0000114 3300046524 Bacteria 98677
708 Ga0495648_0013048 3300046524 Bacteria 6164
709 Ga0495648_0156523 3300046524 Bacteria 1182
710 Ga0495663_0006507 3300046525 Bacteria 3225
711 Ga0495642_0003030 3300046528 Bacteria 6691
712 Ga0495654_0044137 3300046530 Bacteria 2206
713 Ga0495654_0061539 3300046530 Bacteria 1802
714 Ga0495654_0074574 3300046530 Bacteria 1602
715 Ga0495654_0094515 3300046530 Bacteria 1383
716 Ga0495621_0004419 3300046539 Bacteria 3950
717 Ga0495597_0038934 3300046542 Bacteria 2130
718 Ga0495633_0000739 3300046558 Bacteria 29507
719 Ga0495633_0000929 3300046558 Bacteria 24783
720 Ga0495633_0016576 3300046558 Bacteria 3794
721 Ga0495633_0033973 3300046558 Bacteria 2455
722 Ga0495633_0034668 3300046558 Bacteria 2426
723 Ga0495668_0000022 3300046616 Bacteria 363999
724 Ga0495668_0031988 3300046616 Bacteria 2962
725 Ga0495668_0087011 3300046616 Bacteria 1714
726 Ga0495611_0062972 3300046648 Bacteria 1687
727 Ga0495611_0076407 3300046648 Bacteria 1535
728 Ga0495625_0032785 3300046660 Bacteria 3847
729 Ga0495625_0047750 3300046660 Bacteria 3086
730 Ga0495625_0048759 3300046660 Bacteria 3047
731 Ga0495625_0140058 3300046660 Bacteria 1632
732 Ga0495625_0372997 3300046660 Bacteria 897
733 Ga0495661_0027151 3300046665 Bacteria 3677
734 Ga0495661_0143917 3300046665 Bacteria 1294
735 Ga0495669_0000047 3300046684 Bacteria 82672
736 Ga0495670_0000019 3300046691 Bacteria 114488
737 Ga0495670_0032241 3300046691 Bacteria 2606
738 Ga0495671_0000057 3300046692 Bacteria 114166
739 Ga0495671_0015063 3300046692 Bacteria 4152
740 Ga0495660_0010290 3300046810 Bacteria 5438
741 Ga0495683_0008682 3300047323 Bacteria 5424
742 Ga0495687_000043 3300047443 Bacteria 216711
743 Ga0495687_000083 3300047443 Bacteria 145688
744 Ga0495687_029728 3300047443 Bacteria 2524
745 Ga0495677_0007237 3300047445 Bacteria 4152
746 Ga0495673_0000110 3300047469 Bacteria 166127
747 Ga0495673_0037586 3300047469 Bacteria 2210
748 Ga0495673_0052135 3300047469 Bacteria 1789
749 Ga0495681_0000036 3300047470 Bacteria 124207
750 Ga0495681_0000445 3300047470 Bacteria 31682
751 Ga0495681_0051438 3300047470 Bacteria 1937
752 Ga0495686_0000273 3300047472 Bacteria 91936
753 Ga0495686_0000985 3300047472 Bacteria 34770
754 Ga0495593_0198735 3300047673 Bacteria 1008
755 Ga0495615_0001607 3300048090 Bacteria 3403
756 Ga0495626_0000808 3300048091 Bacteria 28273
757 Ga0496100_0002118 3300048903 Bacteria 9992
758 Ga0496100_0221074 3300048903 Bacteria 1390
759 Ga0496100_0494182 3300048903 Bacteria 942
760 Ga0496101_0028746 3300048904 Bacteria 3884
761 Ga0496102_0000022 3300048905 Bacteria 246314
762 Ga0496102_0001244 3300048905 Bacteria 23041
763 Ga0496102_0139972 3300048905 Bacteria 2269
764 Ga0496103_0000167 3300048906 Bacteria 68561
765 Ga0496103_0000648 3300048906 Bacteria 26322
766 Ga0496103_0001474 3300048906 Bacteria 15742
767 Ga0496103_0030200 3300048906 Bacteria 3297
768 Ga0496104_0000882 3300048907 Bacteria 25819
769 Ga0496104_0001962 3300048907 Bacteria 17811
770 Ga0496104_0025352 3300048907 Bacteria 5466
771 Ga0496105_0000447 3300048908 Bacteria 27187
772 Ga0496105_0000479 3300048908 Bacteria 26244
773 Ga0496105_0006155 3300048908 Bacteria 9200
774 Ga0496105_0017067 3300048908 Bacteria 5811
775 Ga0496106_0007027 3300048909 Bacteria 8313
776 Ga0496107_0000287 3300048910 Bacteria 26834
777 Ga0496107_0093085 3300048910 Bacteria 2204
778 Ga0496108_0000270 3300048911 Bacteria 44669
779 Ga0496109_0267471 3300048912 Bacteria 1611
780 Ga0496109_0537217 3300048912 Bacteria 1103
781 Ga0496110_0018059 3300048913 Bacteria 5908
782 Ga0496110_0119140 3300048913 Bacteria 2377
783 Ga0496110_0523614 3300048913 Bacteria 1078
784 Ga0496110_0583010 3300048913 Bacteria 1015
785 Ga0496111_0013236 3300048914 Bacteria 5607
786 Ga0496111_0020176 3300048914 Bacteria 4637
787 Ga0496111_0054137 3300048914 Bacteria 2900
788 Ga0496111_0106914 3300048914 Bacteria 2059
789 Ga0496111_0145735 3300048914 Bacteria 1755
790 Ga0496112_0014916 3300048915 Bacteria 7230
791 Ga0496113_0000442 3300048916 Bacteria 20174
792 Ga0496113_0002636 3300048916 Bacteria 10501
793 Ga0496113_0021719 3300048916 Bacteria 4531
794 Ga0496114_0002987 3300048917 Bacteria 12971
795 Ga0496114_0023598 3300048917 Bacteria 5021
796 Ga0496115_0000029 3300048918 Bacteria 141359
797 Ga0496115_0000665 3300048918 Bacteria 25387
798 Ga0496116_0008266 3300048919 Bacteria 9052
799 Ga0496116_0031125 3300048919 Bacteria 3826
800 Ga0496116_0055889 3300048919 Bacteria 2590
801 Ga0496117_0000260 3300048920 Bacteria 99636
802 Ga0496117_0000566 3300048920 Bacteria 60778
803 Ga0496117_0005957 3300048920 Bacteria 12569
804 Ga0496117_0016880 3300048920 Bacteria 6129
805 Ga0496117_0029232 3300048920 Bacteria 4252
806 Ga0496117_0090680 3300048920 Bacteria 1968
807 Ga0496117_0090940 3300048920 Bacteria 1965
808 Ga0496118_0000039 3300048921 Bacteria 305458
809 Ga0496118_0009583 3300048921 Bacteria 9748
810 Ga0496118_0013474 3300048921 Bacteria 7728
811 Ga0496118_0015672 3300048921 Bacteria 7000
812 Ga0496118_0016400 3300048921 Bacteria 6799
813 Ga0496118_0018558 3300048921 Bacteria 6266
814 Ga0496118_0019153 3300048921 Bacteria 6129
815 Ga0496118_0020492 3300048921 Bacteria 5859
816 Ga0496118_0048476 3300048921 Bacteria 3281
817 Ga0496119_0002088 3300048922 Bacteria 22564
818 Ga0496119_0010119 3300048922 Bacteria 7964
819 Ga0496120_0001454 3300048923 Bacteria 28335
820 Ga0496120_0017516 3300048923 Bacteria 4642
821 Ga0496120_0031863 3300048923 Bacteria 3186
822 Ga0496121_0000683 3300048924 Bacteria 63257
823 Ga0496121_0001144 3300048924 Bacteria 46508
824 Ga0496121_0001713 3300048924 Bacteria 35897
825 Ga0496121_0002098 3300048924 Bacteria 31368
826 Ga0496121_0002348 3300048924 Bacteria 29182
827 Ga0496121_0003389 3300048924 Bacteria 22816
828 Ga0496121_0014109 3300048924 Bacteria 8516
829 Ga0496121_0022572 3300048924 Bacteria 6098
830 Ga0496121_0031799 3300048924 Bacteria 4813
831 Ga0496122_0003064 3300048925 Bacteria 22543
832 Ga0496122_0007119 3300048925 Bacteria 12558
833 Ga0496122_0012916 3300048925 Bacteria 8245
834 Ga0496122_0028094 3300048925 Bacteria 4787
835 Ga0496122_0045084 3300048925 Bacteria 3432
836 Ga0496122_0057644 3300048925 Bacteria 2882
837 Ga0496122_0066300 3300048925 Bacteria 2610
838 Ga0496123_0002028 3300048926 Bacteria 26145
839 Ga0496123_0009892 3300048926 Bacteria 8510
840 Ga0496123_0012423 3300048926 Bacteria 7260
841 Ga0496123_0173308 3300048926 Bacteria 1135
842 Ga0496124_0000076 3300048927 Bacteria 215767
843 Ga0496124_0001874 3300048927 Bacteria 28945
844 Ga0496124_0002194 3300048927 Bacteria 26062
845 Ga0496124_0008780 3300048927 Bacteria 10497
846 Ga0496124_0011818 3300048927 Bacteria 8697
847 Ga0496124_0019841 3300048927 Bacteria 6237
848 Ga0496124_0019879 3300048927 Bacteria 6229
849 Ga0496124_0063899 3300048927 Bacteria 3073
850 Ga0496124_0105055 3300048927 Bacteria 2283
851 Ga0496124_0118901 3300048927 Bacteria 2114
852 Ga0496125_0000505 3300048928 Bacteria 67726
853 Ga0496125_0007784 3300048928 Bacteria 11334
854 Ga0496125_0009478 3300048928 Bacteria 9993
855 Ga0496125_0014467 3300048928 Bacteria 7683
856 Ga0496125_0020907 3300048928 Bacteria 6123
857 Ga0496125_0034865 3300048928 Bacteria 4427
858 Ga0496125_0062742 3300048928 Bacteria 2969
859 Ga0496125_0066007 3300048928 Bacteria 2862
860 Ga0496125_0087920 3300048928 Bacteria 2344
861 Ga0496126_0000158 3300048929 Bacteria 156032
862 Ga0496126_0000469 3300048929 Bacteria 80156
863 Ga0496126_0003395 3300048929 Bacteria 20150
864 Ga0496126_0016624 3300048929 Bacteria 7353
865 Ga0496126_0018513 3300048929 Bacteria 6896
866 Ga0496126_0034157 3300048929 Bacteria 4780
867 Ga0496126_0037665 3300048929 Bacteria 4510
868 Ga0496126_0054595 3300048929 Bacteria 3617
869 Ga0496126_0079211 3300048929 Bacteria 2909
870 Ga0495678_027194 3300049459 Bacteria 2430
871 Ga0501033_0340072 3300049570 Bacteria 1052
872 Ga0501034_0021162 3300049571 Bacteria 6635
873 Ga0501034_0036153 3300049571 Bacteria 5005
874 Ga0501034_0079638 3300049571 Bacteria 3280
875 Ga0501034_0555334 3300049571 Bacteria 1057
876 Ga0501036_0151941 3300049572 Bacteria 1953
877 Ga0501037_0099976 3300049573 Bacteria 2095
878 Ga0501047_0241651 3300049581 Bacteria 1656
879 Ga0501047_0305110 3300049581 Bacteria 1434
880 Ga0501223_000135 3300049663 Bacteria 20935
881 Ga0501224_000042 3300049664 Bacteria 22403
882 Ga0501233_035122 3300049668 Bacteria 1153
883 Ga0501235_010553 3300049669 Bacteria 2018
884 Ga0501249_000256 3300049679 Bacteria 15740
885 Ga0501225_0000134 3300049705 Bacteria 22398
886 Ga0501225_0005268 3300049705 Bacteria 3806
887 Ga0501080_0604152 3300049742 Bacteria 974
888 Ga0501083_0070382 3300049744 Bacteria 2327
889 Ga0501035_0376890 3300049822 Bacteria 1184
890 Ga0501044_0237619 3300049823 Bacteria 1767
891 Ga0501044_0338903 3300049823 Bacteria 1425
892 Ga0501226_000099 3300049853 Bacteria 21088
893 nmdc:mga03683_52_c1 3300050489 Bacteria 49169
894 nmdc:mga03683_757_c1 3300050489 Bacteria 9260
895 nmdc:mga03n38_1944_c1 3300050490 Bacteria 6196
896 nmdc:mga00v17_205795_c1 3300050491 Bacteria 1273
897 nmdc:mga0k408_118952_c1 3300050493 Bacteria 1564
898 nmdc:mga0k408_12_c1 3300050493 Bacteria 125427
899 nmdc:mga06z11_119_c1 3300050494 Bacteria 32670
900 nmdc:mga04h51_37_c1 3300050495 Bacteria 45941
901 nmdc:mga07m45_11_c1 3300050496 Bacteria 163532
902 nmdc:mga07m45_172015_c1 3300050496 Bacteria 1259
903 nmdc:mga07m45_9729_c1 3300050496 Bacteria 4997
904 nmdc:mga05p37_847944_c1 3300050507 Bacteria 993
905 nmdc:mga09592_111294_c1 3300050508 Bacteria 2349
906 nmdc:mga0n895_28520_c1 3300050512 Bacteria 5310
907 nmdc:mga0sz30_1423_c1 3300050516 Bacteria 8554
908 nmdc:mga0sz30_39425_c1 3300050516 Bacteria 1982
909 Ga0500610_0000508 3300053079 Bacteria 11987
910 Ga0500643_000001 3300053087 Bacteria 1440111
911 Ga0500643_000044 3300053087 Bacteria 155319
912 Ga0500643_007423 3300053087 Bacteria 4425
913 Ga0500643_012451 3300053087 Bacteria 3046
914 Ga0500643_015888 3300053087 Bacteria 2568
915 Ga0500643_021524 3300053087 Bacteria 2088
916 Ga0500566_0004226 3300053094 Bacteria 8564
917 Ga0500562_003253 3300053108 Bacteria 4061
918 Ga0500594_0005674 3300053118 Bacteria 2774
919 Ga0500594_0027135 3300053118 Bacteria 1480
920 Ga0500595_000814 3300053119 Bacteria 18012
921 Ga0500595_050618 3300053119 Bacteria 1289
922 Ga0500597_000193 3300053120 Bacteria 12502
923 Ga0500608_000042 3300053122 Bacteria 56626
924 Ga0500626_111952 3300053128 Bacteria 1177
925 Ga0500642_0001178 3300053130 Bacteria 7485
926 Ga0500658_0001159 3300053134 Bacteria 10717
927 Ga0500658_0010532 3300053134 Bacteria 3410
928 Ga0500559_0001036 3300053136 Bacteria 16988
929 Ga0500559_0027208 3300053136 Bacteria 2440
930 Ga0500559_0065641 3300053136 Bacteria 1626
931 Ga0500559_0135001 3300053136 Bacteria 1153
932 Ga0500564_005997 3300053138 Bacteria 5025
933 Ga0500568_0022365 3300053139 Bacteria 2705
934 Ga0500590_102144 3300053148 Bacteria 1375
935 Ga0500604_0000108 3300053151 Bacteria 25410
936 Ga0500604_0004017 3300053151 Bacteria 3924
937 Ga0500616_0000161 3300053153 Bacteria 111424
938 Ga0500616_0001142 3300053153 Bacteria 27275
939 Ga0500616_0001975 3300053153 Bacteria 18211
940 Ga0500619_016693 3300053154 Bacteria 2026
941 Ga0500622_0011523 3300053156 Bacteria 4813
942 Ga0500624_000003 3300053157 Bacteria 253364
943 Ga0500627_0000204 3300053158 Bacteria 17192
944 Ga0500636_0007966 3300053177 Bacteria 6129
945 Ga0500637_0000024 3300053178 Bacteria 59926
946 Ga0500567_000588 3300053723 Bacteria 12916
947 Ga0500625_000157 3300053729 Bacteria 14392
948 Ga0500645_000038 3300053730 Bacteria 112786
949 Ga0500645_000842 3300053730 Bacteria 18101
950 Ga0500596_003694 3300053735 Bacteria 2875
951 Ga0500661_013092 3300055283 Bacteria 1495
952 Ga0466962_0021624 3300061719 Bacteria 3087
953 2511128130 2510917021 Bacteria 5705459
954 2643951557 2643221588 Bacteria 3692460
955 2738712804 2738541275 Bacteria 4830863
956 2738851228 2738541301 Bacteria 4834102
957 2738866958 2738541304 Bacteria 4833665
958 2739299475 2738543022 Bacteria 4835059
959 2739361154 2738543033 Bacteria 4833336
960 2739649041 2739367664 Bacteria 4114334
961 2740027514 2739367865 Bacteria 4114482
962 2819554733 2818991438 Bacteria 5793701
963 2895882177 2895880812 Bacteria 11255272
964 2896185912 2896184354 Bacteria 3258548
965 2896256083 2896253425 Bacteria 3418029
966 2919142568 2919138771 Bacteria 5281312
967 2919712539 2919709256 Bacteria 4318106
968 2928104539 2928100450 Bacteria 4837635
969 2928963164 2928959182 Bacteria 4725774
970 3000867166 3000865235 Bacteria 3106258
971 8054305263 8054302542 Bacteria 5698134
972 Ga0163162_10002528
973 SwRhRL2b_contig_1117632
974 SwRhRL2b_contig_1955283
975 SwRhRL2b_contig_2752641
976 SwRhRL2b_contig_3948926
977 JGI24736J21556_1001607
978 JGI24741J21665_1000677
979 JGI24752J21851_1004063
980 JGI24740J21852_10002676
981 JGI24739J22299_10012561
982 JGI24737J22298_10002657
983 JGI24737J22298_10003202
984 JGI24737J22298_10018518
985 JGI24735J21928_10000951
986 JGI24748J21848_1001609
987 JGI24738J21930_10001235
988 JGI24738J21930_10005188
989 JGI24742J22300_10016742
990 JGI24751J29686_10000323
991 JGI24751J29686_10019978
992 JGI25150J39212_1000966
993 JGI25151J46595_10005487
994 JGI25153J46596_10000045
995 Ga0055532_1011407
996 Ga0055525_1000080
997 Ga0055542_1000012
998 Ga0055529_1000002
999 Ga0055529_1000004
1000 Ga0055526_1004036
1001 Ga0055537_1002102
1002 Ga0055524_1000244
1003 Ga0055530_10000429
1004 Ga0055530_10005249
1005 Ga0055540_1001899
1006 Ga0055531_10000472
1007 Ga0055531_10009286
1008 Ga0055531_10022390
1009 Ga0055543_1020794
1010 Ga0065165_1002357
1011 Ga0065165_1007153
1012 Ga0065165_1038795
1013 Ga0065165_1042953
1014 Ga0065704_10075413
1015 Ga0065704_10082534
1016 Ga0065704_10129257
1017 Ga0065704_10173451
1018 Ga0070658_10000003
1019 Ga0070658_10000062
1020 Ga0070658_10000167
1021 Ga0070658_10004751
1022 Ga0070658_10017808
1023 Ga0070658_10044462
1024 Ga0070658_10054793
1025 Ga0070658_10102810
1026 Ga0070658_10115593
1027 Ga0070658_10158829
1028 Ga0070658_10275481
1029 Ga0070670_100025864
1030 Ga0070670_100059410
1031 Ga0070670_100084102
1032 Ga0070677_10000114
1033 Ga0068869_100126975
1034 Ga0070666_10001598
1035 Ga0070666_10005216
1036 Ga0070666_10025868
1037 Ga0070666_10298636
1038 Ga0070680_100002171
1039 Ga0070680_100112775
1040 Ga0070680_100512988
1041 Ga0070660_100000991
1042 Ga0070660_100001813
1043 Ga0070660_100003112
1044 Ga0070660_100007024
1045 Ga0070660_100045418
1046 Ga0070660_100173063
1047 Ga0070660_100182926
1048 Ga0070660_100264924
1049 Ga0070687_100219985
1050 Ga0070661_100006660
1051 Ga0070661_100006864
1052 Ga0070661_100097671
1053 Ga0070661_100121778
1054 Ga0070661_100248303
1055 Ga0070692_10000469
1056 Ga0070668_100000050
1057 Ga0070668_100001905
1058 Ga0070668_100010145
1059 Ga0070668_100037299
1060 Ga0070668_100084213
1061 Ga0070669_100000039
1062 Ga0070669_100000048
1063 Ga0070669_100000094
1064 Ga0070669_100002467
1065 Ga0070669_100007602
1066 Ga0070669_100039460
1067 Ga0070669_100105111
1068 Ga0070669_100257216
1069 Ga0070675_100106692
1070 Ga0070675_100142897
1071 Ga0070671_100000119
1072 Ga0070671_100000243
1073 Ga0070671_100007867
1074 Ga0070671_100119854
1075 Ga0070671_100129126
1076 Ga0070671_100134440
1077 Ga0070674_100039534
1078 Ga0070673_100039063
1079 Ga0070659_100000005
1080 Ga0070659_100014130
1081 Ga0070659_100017500
1082 Ga0070659_100154606
1083 Ga0070659_100157208
1084 Ga0070659_100243779
1085 Ga0070659_100251963
1086 Ga0070667_100000025
1087 Ga0070667_100000390
1088 Ga0070667_100000660
1089 Ga0070667_100017834
1090 Ga0070667_100022278
1091 Ga0070667_100045962
1092 Ga0070667_100049302
1093 Ga0070667_100070472
1094 Ga0070667_100313234
1095 Ga0070705_100076287
1096 Ga0070708_100019346
1097 Ga0070663_100012592
1098 Ga0070663_100094978
1099 Ga0070663_100151440
1100 Ga0070663_100329408
1101 Ga0070678_100002558
1102 Ga0070662_100000795
1103 Ga0070662_100004642
1104 Ga0070662_100034298
1105 Ga0070662_100057763
1106 Ga0070662_100070881
1107 Ga0070681_10032181
1108 Ga0070681_10044606
1109 Ga0070698_100134563
1110 Ga0070679_100001927
1111 Ga0070679_100022137
1112 Ga0070679_100032968
1113 Ga0070679_100780336
1114 Ga0070684_100077170
1115 Ga0070684_100302988
1116 Ga0068853_100003449
1117 Ga0068853_100022626
1118 Ga0068853_100030617
1119 Ga0068853_100118110
1120 Ga0068853_100359093
1121 Ga0068853_100455372
1122 Ga0070672_100018880
1123 Ga0070672_100150810
1124 Ga0070686_100000191
1125 Ga0070665_100000088
1126 Ga0070665_100000168
1127 Ga0070665_100001278
1128 Ga0070665_100003938
1129 Ga0070665_100019960
1130 Ga0070665_100090309
1131 Ga0070665_100105251
1132 Ga0068855_100001435
1133 Ga0068855_100021313
1134 Ga0068855_100026517
1135 Ga0068855_100037627
1136 Ga0068855_100039611
1137 Ga0068855_100188948
1138 Ga0068855_100476651
1139 Ga0070664_100019373
1140 Ga0070664_100023476
1141 Ga0070664_100119593
1142 Ga0070664_100611300
1143 Ga0068857_100036896
1144 Ga0068857_100096790
1145 Ga0068857_100232343
1146 Ga0068857_100273925
1147 Ga0068857_100288371
1148 Ga0068857_100850541
1149 Ga0068854_100001399
1150 Ga0068854_100173017
1151 Ga0068854_100215264
1152 Ga0068854_100264331
1153 Ga0068854_100311138
1154 Ga0068856_100003976
1155 Ga0068856_100009259
1156 Ga0068856_100052680
1157 Ga0068856_100369712
1158 Ga0068852_100000919
1159 Ga0068852_100050975
1160 Ga0068852_100264633
1161 Ga0068852_100349433
1162 Ga0068852_100769502
1163 Ga0068852_100892356
1164 Ga0068859_100015185
1165 Ga0068859_100033051
1166 Ga0068864_100002231
1167 Ga0068864_100008568
1168 Ga0068851_10018950
1169 Ga0068851_10121208
1170 Ga0068851_10130618
1171 Ga0068863_100000058
1172 Ga0068863_100000187
1173 Ga0068863_100001079
1174 Ga0068863_100006943
1175 Ga0068863_100035369
1176 Ga0068863_100039107
1177 Ga0068863_100097701
1178 Ga0068858_100017541
1179 Ga0068858_100027896
1180 Ga0068858_100069896
1181 Ga0068858_100602663
1182 Ga0068860_100000057
1183 Ga0068860_100003627
1184 Ga0068860_100021480
1185 Ga0068860_100024116
1186 Ga0068860_100058249
1187 Ga0068860_100058391
1188 Ga0068860_100096730
1189 Ga0068862_100000191
1190 Ga0068862_100032566
1191 Ga0068862_100054582
1192 Ga0081539_10019651
1193 Ga0075368_10000565
1194 Ga0075364_10040053
1195 Ga0075364_10079961
1196 Ga0075432_10002220
1197 Ga0075362_10000029
1198 Ga0075362_10058309
1199 Ga0075367_10007298
1200 Ga0075369_10015041
1201 Ga0075369_10040936
1202 Ga0075366_10052037
1203 Ga0097621_100122169
1204 Ga0075370_10000011
1205 Ga0075370_10002340
1206 Ga0075370_10175836
1207 Ga0075370_10218609
1208 Ga0075434_100248156
1209 Ga0075429_100105775
1210 Ga0097620_100015185
1211 Ga0097620_100023748
1212 Ga0097620_100033051
1213 Ga0105251_10000276
1214 Ga0105251_10008893
1215 Ga0105251_10035720
1216 Ga0105250_10009073
1217 Ga0105240_10003393
1218 Ga0105240_10010858
1219 Ga0105240_10252079
1220 Ga0105240_10269265
1221 Ga0105240_10319237
1222 Ga0105240_10501760
1223 Ga0105247_10033832
1224 Ga0114129_10441353
1225 Ga0105243_10001077
1226 Ga0105243_10094543
1227 Ga0105243_10155385
1228 Ga0105243_10326533
1229 Ga0105241_10002141
1230 Ga0105241_10028145
1231 Ga0105241_10650088
1232 Ga0105248_10026581
1233 Ga0105248_10068994
1234 Ga0105237_10001660
1235 Ga0105237_10017714
1236 Ga0105237_10443373
1237 Ga0105237_10512954
1238 Ga0105238_10370976
1239 Ga0105238_10797365
1240 Ga0105249_10002820
1241 Ga0105249_10007484
1242 Ga0105249_10057499
1243 Ga0105249_10101485
1244 Ga0105249_10398377
1245 Ga0105148_100452
1246 Ga0105239_10002472
1247 Ga0105246_10001372
1248 Ga0105246_10951712
1249 Ga0157327_1001126
1250 Ga0157373_10003673
1251 Ga0157373_10014350
1252 Ga0157373_10109959
1253 Ga0157371_10000062
1254 Ga0157371_10002207
1255 Ga0157371_10021083
1256 Ga0157371_10504304
1257 Ga0157370_10005110
1258 Ga0157370_10051227
1259 Ga0157370_10074081
1260 Ga0157369_10118596
1261 Ga0157369_10167954
1262 Ga0157369_10240104
1263 Ga0157378_10006122
1264 Ga0163162_10000232
1265 Ga0163162_10010482
1266 Ga0163162_10023635
1267 Ga0157372_10007274
1268 Ga0157372_10014494
1269 Ga0157372_10128915
1270 Ga0157372_10137500
1271 Ga0157372_10357253
1272 Ga0157372_10497766
1273 Ga0157375_10107516
1274 Ga0157375_10548635
1275 Ga0157375_11003094
1276 Ga0163163_10028485
1277 Ga0163163_10655296
1278 Ga0157379_10150015
1279 Ga0157379_10323996
1280 Ga0157376_11034093
1281 Ga0163161_10065480
1282 Ga0163161_10117356
1283 Ga0163161_10123799
1284 Ga0206356_10967351
1285 Ga0206353_11419480
1286 Ga0213873_10000026
1287 Ga0213876_10000149
1288 Ga0213876_10000371
1289 Ga0213876_10012241
1290 Ga0209674_104378
1291 Ga0209147_100882
1292 Ga0209563_100058
1293 Ga0209677_109030
1294 Ga0209148_1000008
1295 Ga0209129_1003496
1296 Ga0209565_1000029
1297 Ga0209565_1000251
1298 Ga0209455_1000002
1299 Ga0209673_1009829
1300 Ga0209673_1025148
1301 Ga0209025_1000993
1302 Ga0209025_1103877
1303 Ga0209564_1001873
1304 Ga0209758_1000002
1305 Ga0209758_1000007
1306 Ga0209758_1010016
1307 Ga0209050_1000001
1308 Ga0209050_1000167
1309 Ga0209050_1005376
1310 Ga0209256_1000008
1311 Ga0209051_1000360
1312 Ga0209257_1000028
1313 Ga0209257_1000893
1314 Ga0209257_1007672
1315 Ga0209257_1014531
1316 Ga0209257_1015466
1317 Ga0207656_10009546
1318 Ga0207656_10079668
1319 Ga0207656_10090765
1320 Ga0207696_1005122
1321 Ga0207713_1002506
1322 Ga0207682_10002396
1323 Ga0207710_10003855
1324 Ga0207710_10050837
1325 Ga0207688_10172340
1326 Ga0207680_10000817
1327 Ga0207680_10003518
1328 Ga0207680_10092063
1329 Ga0207680_10360599
1330 Ga0207647_10004690
1331 Ga0207647_10007524
1332 Ga0207647_10017114
1333 Ga0207647_10040920
1334 Ga0207647_10169648
1335 Ga0207645_10140691
1336 Ga0207705_10000004
1337 Ga0207705_10000005
1338 Ga0207705_10000103
1339 Ga0207705_10002703
1340 Ga0207705_10046649
1341 Ga0207705_10047290
1342 Ga0207705_10089732
1343 Ga0207705_10146704
1344 Ga0207654_10000150
1345 Ga0207654_10080212
1346 Ga0207707_10023608
1347 Ga0207707_10042890
1348 Ga0207707_10342203
1349 Ga0207695_10013603
1350 Ga0207695_10018738
1351 Ga0207695_10028019
1352 Ga0207695_10132032
1353 Ga0207695_10216992
1354 Ga0207671_10000567
1355 Ga0207671_10007737
1356 Ga0207671_10034313
1357 Ga0207660_10018096
1358 Ga0207660_10463219
1359 Ga0207657_10002582
1360 Ga0207657_10002937
1361 Ga0207657_10003198
1362 Ga0207657_10008473
1363 Ga0207657_10020085
1364 Ga0207657_10088520
1365 Ga0207657_10406177
1366 Ga0207649_10003386
1367 Ga0207649_10013635
1368 Ga0207649_10312493
1369 Ga0207652_10000489
1370 Ga0207652_10026835
1371 Ga0207652_10029162
1372 Ga0207652_10095574
1373 Ga0207652_10612319
1374 Ga0207681_10000050
1375 Ga0207681_10000144
1376 Ga0207681_10001096
1377 Ga0207681_10003059
1378 Ga0207681_10005654
1379 Ga0207681_10133717
1380 Ga0207681_10159210
1381 Ga0207694_10131777
1382 Ga0207650_10067376
1383 Ga0207650_10228576
1384 Ga0207650_10268151
1385 Ga0207650_10374090
1386 Ga0207659_10115202
1387 Ga0207644_10000056
1388 Ga0207644_10000134
1389 Ga0207644_10000367
1390 Ga0207644_10027263
1391 Ga0207644_10097687
1392 Ga0207644_10123750
1393 Ga0207644_10160788
1394 Ga0207644_10174712
1395 Ga0207690_10000002
1396 Ga0207690_10001516
1397 Ga0207690_10002450
1398 Ga0207690_10022186
1399 Ga0207690_10228960
1400 Ga0207706_10002382
1401 Ga0207706_10030470
1402 Ga0207706_10048453
1403 Ga0207706_10053084
1404 Ga0207706_10080509
1405 Ga0207706_10087295
1406 Ga0207709_10000005
1407 Ga0207709_10253795
1408 Ga0207669_10000174
1409 Ga0207691_10033158
1410 Ga0207691_10268079
1411 Ga0207711_10021765
1412 Ga0207689_10075646
1413 Ga0207661_10030507
1414 Ga0207661_10032877
1415 Ga0207661_10674760
1416 Ga0207679_10015535
1417 Ga0207679_10053837
1418 Ga0207667_10000001
1419 Ga0207667_10001089
1420 Ga0207667_10002432
1421 Ga0207667_10009256
1422 Ga0207667_10043432
1423 Ga0207667_10105863
1424 Ga0207667_10108443
1425 Ga0207667_10484163
1426 Ga0207651_10080622
1427 Ga0207712_10001292
1428 Ga0207712_10007474
1429 Ga0207712_10011280
1430 Ga0207712_10071925
1431 Ga0207668_10000094
1432 Ga0207668_10000436
1433 Ga0207668_10068584
1434 Ga0207668_10093353
1435 Ga0207668_10171525
1436 Ga0207640_10004898
1437 Ga0207640_10007874
1438 Ga0207640_10013210
1439 Ga0207640_10038253
1440 Ga0207640_10070550
1441 Ga0207640_10092308
1442 Ga0207640_10268623
1443 Ga0207640_10284912
1444 Ga0207658_10000023
1445 Ga0207658_10000216
1446 Ga0207658_10002737
1447 Ga0207658_10003041
1448 Ga0207658_10008354
1449 Ga0207658_10010305
1450 Ga0207658_10061944
1451 Ga0207658_10115529
1452 Ga0207677_10000100
1453 Ga0207677_10226311
1454 Ga0207703_10002369
1455 Ga0207703_10003301
1456 Ga0207703_10019876
1457 Ga0207703_10105257
1458 Ga0207703_10305518
1459 Ga0207639_10001191
1460 Ga0207639_10003214
1461 Ga0207639_10007673
1462 Ga0207639_10041254
1463 Ga0207639_10097932
1464 Ga0207639_10182258
1465 Ga0207639_10287754
1466 Ga0207678_10000079
1467 Ga0207678_10013240
1468 Ga0207678_10091516
1469 Ga0207678_10320248
1470 Ga0207702_10001332
1471 Ga0207702_10013826
1472 Ga0207702_10041221
1473 Ga0207702_10187154
1474 Ga0207702_10338539
1475 Ga0207641_10000269
1476 Ga0207641_10002412
1477 Ga0207641_10003855
1478 Ga0207641_10004669
1479 Ga0207641_10004972
1480 Ga0207641_10017468
1481 Ga0207641_10089951
1482 Ga0207641_10127064
1483 Ga0207676_10001569
1484 Ga0207676_10027677
1485 Ga0207676_10032111
1486 Ga0207676_10111941
1487 Ga0207674_10016564
1488 Ga0207674_10028880
1489 Ga0207674_10124108
1490 Ga0207674_10124747
1491 Ga0207674_10810575
1492 Ga0207675_100009530
1493 Ga0207683_10003668
1494 Ga0207683_10230163
1495 Ga0207698_10000019
1496 Ga0207698_10000186
1497 Ga0207698_10028185
1498 Ga0207698_10041197
1499 Ga0207698_10788321
1500 Ga0207698_10812398
1501 Ga0209813_10001114
1502 Ga0207428_10069745
1503 Ga0268266_10000074
1504 Ga0268266_10000130
1505 Ga0268266_10001691
1506 Ga0268266_10002428
1507 Ga0268266_10002447
1508 Ga0268266_10019026
1509 Ga0268266_10416723
1510 Ga0268265_10000102
1511 Ga0268265_10000271
1512 Ga0268265_10018322
1513 Ga0268265_10040823
1514 Ga0268265_10054272
1515 Ga0268265_10273429
1516 Ga0268264_10000078
1517 Ga0268264_10000180
1518 Ga0268264_10004368
1519 Ga0268264_10007758
1520 Ga0268264_10008451
1521 Ga0268264_10017221
1522 Ga0268264_10046311
1523 Ga0268264_10071817
1524 Ga0307517_10012427
1525 Ga0307517_10037285
1526 Ga0316177_1051669
1527 Ga0265331_10086685
1528 Ga0307513_10060125
1529 Ga0307513_10132909
1530 Ga0307408_100055244
1531 Ga0307408_100078202
1532 Ga0307408_100150390
1533 Ga0307408_100575655
1534 Ga0307508_10218068
1535 Ga0307405_10003177
1536 Ga0307405_10413462
1537 Ga0307413_10005727
1538 Ga0307413_10009668
1539 Ga0307413_10327094
1540 Ga0307410_10005363
1541 Ga0307410_10035115
1542 Ga0307410_10096682
1543 Ga0307410_10120342
1544 Ga0307406_10248438
1545 Ga0307407_10208043
1546 Ga0307412_10000126
1547 Ga0307412_10005327
1548 Ga0307412_10171259
1549 Ga0307409_100231919
1550 Ga0307409_100331238
1551 Ga0307409_100519028
1552 Ga0307416_100122197
1553 Ga0307416_100212031
1554 Ga0307416_100370836
1555 Ga0307416_100451249
1556 Ga0307414_10000270
1557 Ga0307414_10044113
1558 Ga0307414_10103634
1559 Ga0307414_10145329
1560 Ga0307414_10253571
1561 Ga0307414_10467753
1562 Ga0307414_10628695
1563 Ga0307411_10074514
1564 Ga0307411_10119820
1565 Ga0307411_10165095
1566 Ga0307411_10234898
1567 Ga0307411_10299278
1568 Ga0307415_100064979
1569 Ga0307415_100315582
1570 Ga0316583_10007557
1571 Ga0307510_10211222
1572 Ga0307510_10356259
1573 Ga0373962_0068779
1574 Ga0373931_0003323
1575 Ga0373927_0232837
1576 Ga0316582_0030777
1577 Ga0316584_0106575
1578 Ga0316584_0345309
1579 Ga0316584_0556861
1580 Ga0395899_0037987
1581 Ga0395900_0050564
1582 Ga0395905_0081567
1583 Ga0395905_0230214
1584 Ga0237819_03911
1585 Ga0436365_0083543
1586 Ga0436365_0124207
1587 Ga0436365_0922968
1588 Ga0436365_1181252
1589 Ga0436365_1272877
1590 Ga0436363_0832933
1591 Ga0436363_1317039
1592 Ga0436362_0376260
1593 Ga0439436_0006762
1594 Ga0439439_0011842
1595 Ga0439439_0040713
1596 Ga0439461_0000005
1597 Ga0439461_0001836
1598 Ga0439465_0005156
1599 Ga0439465_0005367
1600 Ga0439431_0000066
1601 Ga0439431_0011328
1602 Ga0439442_024642
1603 Ga0439445_0003763
1604 Ga0439445_0003804
1605 Ga0439445_0013081
1606 Ga0439448_0035805
1607 Ga0439448_0039282
1608 Ga0439448_0083156
1609 Ga0439432_008221
1610 Ga0439452_007753
1611 Ga0439452_016440
1612 Ga0439455_0002972
1613 Ga0439455_0028443
1614 Ga0439462_0000552
1615 Ga0439462_0000631
1616 Ga0450894_011747
1617 Ga0439458_0000263
1618 Ga0439458_0004273
1619 Ga0439458_0006327
1620 Ga0439434_0005169
1621 Ga0439434_0018492
1622 Ga0466966_0058247
1623 Ga0466961_0009584
1624 Ga0466964_0016699
1625 Ga0466971_0011526
1626 Ga0466971_0066471
1627 Ga0466968_0004499
1628 Ga0466970_0024989
1629 Ga0466957_0020005
1630 Ga0466960_0000991
1631 Ga0466959_0021515
1632 Ga0451576_0000017
1633 Ga0466958_0030818
1634 Ga0466958_0034088
1635 Ga0466967_0462283
1636 Ga0495617_006845
1637 Ga0495617_010490
1638 Ga0495627_000336
1639 Ga0495627_001139
1640 Ga0495638_0000068
1641 Ga0495638_0016810
1642 Ga0495638_0046222
1643 Ga0495650_0000091
1644 Ga0495650_0001028
1645 Ga0495650_0001420
1646 Ga0495650_0051284
1647 Ga0495584_0136670
1648 Ga0495585_0005357
1649 Ga0495596_0000267
1650 Ga0495607_0020242
1651 Ga0495607_0030552
1652 Ga0495583_0000269
1653 Ga0495583_0000406
1654 Ga0495583_0017415
1655 Ga0495606_0000457
1656 Ga0495606_0142636
1657 Ga0495610_0000015
1658 Ga0495610_0000083
1659 Ga0495616_0000010
1660 Ga0495616_0097461
1661 Ga0495620_0029925
1662 Ga0495631_0074987
1663 Ga0495631_0128273
1664 Ga0495632_0000351
1665 Ga0495632_0001120
1666 Ga0495632_0029442
1667 Ga0495632_0052897
1668 Ga0495632_0161298
1669 Ga0495637_0105205
1670 Ga0495643_0009428
1671 Ga0495643_0011767
1672 Ga0495643_0025484
1673 Ga0495643_0030194
1674 Ga0495643_0044184
1675 Ga0495643_0048857
1676 Ga0495643_0052511
1677 Ga0495648_0000046
1678 Ga0495648_0000114
1679 Ga0495648_0013048
1680 Ga0495648_0156523
1681 Ga0495663_0006507
1682 Ga0495642_0003030
1683 Ga0495654_0044137
1684 Ga0495654_0061539
1685 Ga0495654_0074574
1686 Ga0495654_0094515
1687 Ga0495621_0004419
1688 Ga0495597_0038934
1689 Ga0495633_0000739
1690 Ga0495633_0000929
1691 Ga0495633_0016576
1692 Ga0495633_0033973
1693 Ga0495633_0034668
1694 Ga0495668_0000022
1695 Ga0495668_0031988
1696 Ga0495668_0087011
1697 Ga0495611_0062972
1698 Ga0495611_0076407
1699 Ga0495625_0032785
1700 Ga0495625_0047750
1701 Ga0495625_0048759
1702 Ga0495625_0140058
1703 Ga0495625_0372997
1704 Ga0495661_0027151
1705 Ga0495661_0143917
1706 Ga0495669_0000047
1707 Ga0495670_0000019
1708 Ga0495670_0032241
1709 Ga0495671_0000057
1710 Ga0495671_0015063
1711 Ga0495660_0010290
1712 Ga0495683_0008682
1713 Ga0495687_000043
1714 Ga0495687_000083
1715 Ga0495687_029728
1716 Ga0495677_0007237
1717 Ga0495673_0000110
1718 Ga0495673_0037586
1719 Ga0495673_0052135
1720 Ga0495681_0000036
1721 Ga0495681_0000445
1722 Ga0495681_0051438
1723 Ga0495686_0000273
1724 Ga0495686_0000985
1725 Ga0495593_0198735
1726 Ga0495615_0001607
1727 Ga0495626_0000808
1728 Ga0496100_0002118
1729 Ga0496100_0221074
1730 Ga0496100_0494182
1731 Ga0496101_0028746
1732 Ga0496102_0000022
1733 Ga0496102_0001244
1734 Ga0496102_0139972
1735 Ga0496103_0000167
1736 Ga0496103_0000648
1737 Ga0496103_0001474
1738 Ga0496103_0030200
1739 Ga0496104_0000882
1740 Ga0496104_0001962
1741 Ga0496104_0025352
1742 Ga0496105_0000447
1743 Ga0496105_0000479
1744 Ga0496105_0006155
1745 Ga0496105_0017067
1746 Ga0496106_0007027
1747 Ga0496107_0000287
1748 Ga0496107_0093085
1749 Ga0496108_0000270
1750 Ga0496109_0267471
1751 Ga0496109_0537217
1752 Ga0496110_0018059
1753 Ga0496110_0119140
1754 Ga0496110_0523614
1755 Ga0496110_0583010
1756 Ga0496111_0013236
1757 Ga0496111_0020176
1758 Ga0496111_0054137
1759 Ga0496111_0106914
1760 Ga0496111_0145735
1761 Ga0496112_0014916
1762 Ga0496113_0000442
1763 Ga0496113_0002636
1764 Ga0496113_0021719
1765 Ga0496114_0002987
1766 Ga0496114_0023598
1767 Ga0496115_0000029
1768 Ga0496115_0000665
1769 Ga0496116_0008266
1770 Ga0496116_0031125
1771 Ga0496116_0055889
1772 Ga0496117_0000260
1773 Ga0496117_0000566
1774 Ga0496117_0005957
1775 Ga0496117_0016880
1776 Ga0496117_0029232
1777 Ga0496117_0090680
1778 Ga0496117_0090940
1779 Ga0496118_0000039
1780 Ga0496118_0009583
1781 Ga0496118_0013474
1782 Ga0496118_0015672
1783 Ga0496118_0016400
1784 Ga0496118_0018558
1785 Ga0496118_0019153
1786 Ga0496118_0020492
1787 Ga0496118_0048476
1788 Ga0496119_0002088
1789 Ga0496119_0010119
1790 Ga0496120_0001454
1791 Ga0496120_0017516
1792 Ga0496120_0031863
1793 Ga0496121_0000683
1794 Ga0496121_0001144
1795 Ga0496121_0001713
1796 Ga0496121_0002098
1797 Ga0496121_0002348
1798 Ga0496121_0003389
1799 Ga0496121_0014109
1800 Ga0496121_0022572
1801 Ga0496121_0031799
1802 Ga0496122_0003064
1803 Ga0496122_0007119
1804 Ga0496122_0012916
1805 Ga0496122_0028094
1806 Ga0496122_0045084
1807 Ga0496122_0057644
1808 Ga0496122_0066300
1809 Ga0496123_0002028
1810 Ga0496123_0009892
1811 Ga0496123_0012423
1812 Ga0496123_0173308
1813 Ga0496124_0000076
1814 Ga0496124_0001874
1815 Ga0496124_0002194
1816 Ga0496124_0008780
1817 Ga0496124_0011818
1818 Ga0496124_0019841
1819 Ga0496124_0019879
1820 Ga0496124_0063899
1821 Ga0496124_0105055
1822 Ga0496124_0118901
1823 Ga0496125_0000505
1824 Ga0496125_0007784
1825 Ga0496125_0009478
1826 Ga0496125_0014467
1827 Ga0496125_0020907
1828 Ga0496125_0034865
1829 Ga0496125_0062742
1830 Ga0496125_0066007
1831 Ga0496125_0087920
1832 Ga0496126_0000158
1833 Ga0496126_0000469
1834 Ga0496126_0003395
1835 Ga0496126_0016624
1836 Ga0496126_0018513
1837 Ga0496126_0034157
1838 Ga0496126_0037665
1839 Ga0496126_0054595
1840 Ga0496126_0079211
1841 Ga0495678_027194
1842 Ga0501033_0340072
1843 Ga0501034_0021162
1844 Ga0501034_0036153
1845 Ga0501034_0079638
1846 Ga0501034_0555334
1847 Ga0501036_0151941
1848 Ga0501037_0099976
1849 Ga0501047_0241651
1850 Ga0501047_0305110
1851 Ga0501223_000135
1852 Ga0501224_000042
1853 Ga0501233_035122
1854 Ga0501235_010553
1855 Ga0501249_000256
1856 Ga0501225_0000134
1857 Ga0501225_0005268
1858 Ga0501080_0604152
1859 Ga0501083_0070382
1860 Ga0501035_0376890
1861 Ga0501044_0237619
1862 Ga0501044_0338903
1863 Ga0501226_000099
1864 nmdc:mga03683_52_c1
1865 nmdc:mga03683_757_c1
1866 nmdc:mga03n38_1944_c1
1867 nmdc:mga00v17_205795_c1
1868 nmdc:mga0k408_118952_c1
1869 nmdc:mga0k408_12_c1
1870 nmdc:mga06z11_119_c1
1871 nmdc:mga04h51_37_c1
1872 nmdc:mga07m45_11_c1
1873 nmdc:mga07m45_172015_c1
1874 nmdc:mga07m45_9729_c1
1875 nmdc:mga05p37_847944_c1
1876 nmdc:mga09592_111294_c1
1877 nmdc:mga0n895_28520_c1
1878 nmdc:mga0sz30_1423_c1
1879 nmdc:mga0sz30_39425_c1
1880 Ga0500610_0000508
1881 Ga0500643_000001
1882 Ga0500643_000044
1883 Ga0500643_007423
1884 Ga0500643_012451
1885 Ga0500643_015888
1886 Ga0500643_021524
1887 Ga0500566_0004226
1888 Ga0500562_003253
1889 Ga0500594_0005674
1890 Ga0500594_0027135
1891 Ga0500595_000814
1892 Ga0500595_050618
1893 Ga0500597_000193
1894 Ga0500608_000042
1895 Ga0500626_111952
1896 Ga0500642_0001178
1897 Ga0500658_0001159
1898 Ga0500658_0010532
1899 Ga0500559_0001036
1900 Ga0500559_0027208
1901 Ga0500559_0065641
1902 Ga0500559_0135001
1903 Ga0500564_005997
1904 Ga0500568_0022365
1905 Ga0500590_102144
1906 Ga0500604_0000108
1907 Ga0500604_0004017
1908 Ga0500616_0000161
1909 Ga0500616_0001142
1910 Ga0500616_0001975
1911 Ga0500619_016693
1912 Ga0500622_0011523
1913 Ga0500624_000003
1914 Ga0500627_0000204
1915 Ga0500636_0007966
1916 Ga0500637_0000024
1917 Ga0500567_000588
1918 Ga0500625_000157
1919 Ga0500645_000038
1920 Ga0500645_000842
1921 Ga0500596_003694
1922 Ga0500661_013092
1923 Ga0466962_0021624
1924 2511128130
1925 2643951557
1926 2738712804
1927 2738851228
1928 2738866958
1929 2739299475
1930 2739361154
1931 2739649041
1932 2740027514
1933 2819554733
1934 2895882177
1935 2896185912
1936 2896256083
1937 2919142568
1938 2919712539
1939 2928104539
1940 2928963164
1941 3000867166
1942 8054305263

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

70

218

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8w6j-assembly1.cif.gz_B cryo-em structure of escherichia coli str k12 ftse(e163q)x/envc complex with atp in peptidisc 0.9569 15 230
7v8i-assembly1.cif.gz_F lolcd(e171q)e with bound amppnp in nanodiscs 0.9544 13 230
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.954 14 229
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9494 14 229
8w6j-assembly1.cif.gz_B cryo-em structure of escherichia coli str k12 ftse(e163q)x/envc complex with atp in peptidisc 0.9483 15 230
ID Description Score Start End Superfamily
af_P16679_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9363 15 224 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.932 15 230 3.40.50.300
af_Q55EH8_3_247_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9252 13 229 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9245 13 231 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9232 13 230 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E0G8E7-F1-model_v4 Cell division ATP-binding protein FtsE 0.9834 13 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A2H0MND8-F1-model_v4 ABC transporter ATP-binding protein 0.9512 13 229 GO:0005524
GO:0016887
AF-A0A1M6SP75-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9499 13 231 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2E0G8E7-F1-model_v4 Cell division ATP-binding protein FtsE 0.9489 13 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A037US35-F1-model_v4 deleted 0.9438 13 224

Map