F487124

General Info

Members Datasets Scaffolds Average Seq Length
971 422 1942 318

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0006658|Ga0373936_0006658_269_1315
Length 348
Sequence MTSSATPFFERLCPRMTKKNDDQNDLTRLTMKICVAGQGAFGQKHLDALKRIPEVEVTSLVGGNQDATAQVAKKYGVPHFTGELAEGIKRADAVILTTPTKLHFRQGEQVMRAGKHVLVEIPVTDSVADAEALVKIAKATGVVAMGGHVRRFNPSHQWVHKRIQKGELKIQQMDVQTYFFRRKNINAAGQPRSWTDHLLWHHAAHTIDLFQYQAGETISDCYAVQGPIHPQLNIAMDMGIVAKTPSGAVLTLSLSFNNDGPLGSFFRYICDNGTYKAYYDDLSDGKDNKIDLSKVDVSMDGIELEDREFIAAIKQKRGPNASLAALLPCMHVLGRLEKIVDPQRNAHA

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
207 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
233 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
327 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
328 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
329 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
332 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
407 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
408 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
411 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
412 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
413 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
414 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
415 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
416 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
417 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
418 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
419 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
420 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
421 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
422 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.31
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.4
Nodule 0.1
Rhizoplane 8.65
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0006658 3300035113 Bacteria 4350
2 SwRhRL2b_contig_2628462 2162886007 Bacteria 3593
3 SwRhRL2b_contig_58648 2162886007 Bacteria 3931
4 JGI24746J21847_1002925 3300001977 Bacteria 2685
5 JGI24743J22301_10008228 3300001991 Bacteria 1826
6 JGI24738J21930_10002238 3300002075 Bacteria 5135
7 JGI24034J26672_10016529 3300002239 Bacteria 1137
8 JGI25406J46586_10019988 3300003203 Bacteria 2719
9 JGI25153J46596_10001063 3300003215 Bacteria 16760
10 rootL2_10020853 3300003322 Bacteria 2646
11 JGI25405J52794_10017961 3300003911 Bacteria 1409
12 Ga0055543_1018963 3300004625 Bacteria 1278
13 Ga0065704_10113311 3300005289 Bacteria 1915
14 Ga0065715_10280549 3300005293 Bacteria 1074
15 Ga0065707_10099655 3300005295 Bacteria 2989
16 Ga0065707_10133474 3300005295 Bacteria 1880
17 Ga0065707_10153752 3300005295 Bacteria 1630
18 Ga0070658_10000534 3300005327 Bacteria 33047
19 Ga0070676_10154994 3300005328 Bacteria 1469
20 Ga0070690_100000216 3300005330 Bacteria 30017
21 Ga0070690_100012374 3300005330 Bacteria 5021
22 Ga0070690_100068462 3300005330 Bacteria 2302
23 Ga0070690_100373498 3300005330 Bacteria 1041
24 Ga0070670_100081469 3300005331 Bacteria 2781
25 Ga0070670_100098177 3300005331 Bacteria 2520
26 Ga0070670_100153016 3300005331 Bacteria 1996
27 Ga0070677_10007082 3300005333 Bacteria 3734
28 Ga0070677_10023218 3300005333 Bacteria 2294
29 Ga0068869_100000759 3300005334 Bacteria 18318
30 Ga0068869_100242126 3300005334 Bacteria 1437
31 Ga0070666_10010599 3300005335 Bacteria 5767
32 Ga0070666_10064004 3300005335 Bacteria 2494
33 Ga0070666_10114932 3300005335 Bacteria 1864
34 Ga0070680_100003121 3300005336 Bacteria 12304
35 Ga0070680_100006895 3300005336 Bacteria 8661
36 Ga0070680_100008902 3300005336 Bacteria 7695
37 Ga0070682_100004786 3300005337 Bacteria 7521
38 Ga0068868_100004312 3300005338 Bacteria 9964
39 Ga0068868_100005010 3300005338 Bacteria 9304
40 Ga0068868_100051086 3300005338 Bacteria 3250
41 Ga0070660_100138867 3300005339 Bacteria 1948
42 Ga0070689_100000399 3300005340 Bacteria 25458
43 Ga0070689_100006563 3300005340 Bacteria 8068
44 Ga0070689_100053981 3300005340 Bacteria 3111
45 Ga0070689_100148812 3300005340 Bacteria 1887
46 Ga0070691_10000528 3300005341 Bacteria 14397
47 Ga0070691_10062583 3300005341 Bacteria 1792
48 Ga0070687_100000604 3300005343 Bacteria 11929
49 Ga0070692_10002623 3300005345 Bacteria 7019
50 Ga0070692_10057329 3300005345 Bacteria 2042
51 Ga0070668_100213743 3300005347 Bacteria 1587
52 Ga0070669_100013431 3300005353 Bacteria 5822
53 Ga0070669_100085688 3300005353 Bacteria 2352
54 Ga0070675_100011655 3300005354 Bacteria 6889
55 Ga0070675_100076146 3300005354 Bacteria 2790
56 Ga0070675_100141421 3300005354 Bacteria 2057
57 Ga0070671_100001928 3300005355 Bacteria 15902
58 Ga0070671_100019910 3300005355 Bacteria 5467
59 Ga0070671_100023857 3300005355 Bacteria 5006
60 Ga0070671_100054746 3300005355 Bacteria 3317
61 Ga0070674_100000456 3300005356 Bacteria 20586
62 Ga0070674_100159480 3300005356 Bacteria 1710
63 Ga0070673_100026117 3300005364 Bacteria 4308
64 Ga0070673_100066945 3300005364 Bacteria 2871
65 Ga0070673_100145316 3300005364 Bacteria 2004
66 Ga0070688_100022931 3300005365 Bacteria 3665
67 Ga0070667_100012483 3300005367 Bacteria 7029
68 Ga0070667_100027609 3300005367 Bacteria 4723
69 Ga0070714_100007015 3300005435 Bacteria 8732
70 Ga0070714_100021227 3300005435 Bacteria 5312
71 Ga0070714_100186416 3300005435 Bacteria 1891
72 Ga0070714_100346423 3300005435 Bacteria 1395
73 Ga0070713_100005924 3300005436 Bacteria 8405
74 Ga0070713_100043906 3300005436 Bacteria 3657
75 Ga0070713_100321600 3300005436 Bacteria 1429
76 Ga0070710_10005399 3300005437 Bacteria 6069
77 Ga0070701_10129194 3300005438 Bacteria 1434
78 Ga0070701_10227212 3300005438 Bacteria 1116
79 Ga0070711_100010002 3300005439 Bacteria 5853
80 Ga0070711_100023557 3300005439 Bacteria 4006
81 Ga0070711_100034687 3300005439 Bacteria 3367
82 Ga0070711_100164991 3300005439 Bacteria 1683
83 Ga0070711_100495344 3300005439 Bacteria 1007
84 Ga0070705_100000554 3300005440 Bacteria 21689
85 Ga0070705_100072555 3300005440 Bacteria 2086
86 Ga0070705_100149842 3300005440 Bacteria 1546
87 Ga0070705_100292763 3300005440 Bacteria 1163
88 Ga0070700_100000281 3300005441 Bacteria 27271
89 Ga0070700_100044716 3300005441 Bacteria 2729
90 Ga0070694_100000565 3300005444 Bacteria 20475
91 Ga0070694_100070278 3300005444 Bacteria 2410
92 Ga0070678_100035789 3300005456 Bacteria 3470
93 Ga0070678_100184370 3300005456 Bacteria 1711
94 Ga0070678_100292960 3300005456 Bacteria 1380
95 Ga0070681_10001127 3300005458 Bacteria 22938
96 Ga0070681_10118881 3300005458 Bacteria 2579
97 Ga0070681_10154948 3300005458 Bacteria 2216
98 Ga0070681_10320812 3300005458 Bacteria 1459
99 Ga0070681_10414014 3300005458 Bacteria 1260
100 Ga0068867_100000206 3300005459 Bacteria 39309
101 Ga0068867_100103433 3300005459 Bacteria 2178
102 Ga0070685_10005577 3300005466 Bacteria 6386
103 Ga0070685_10146707 3300005466 Bacteria 1491
104 Ga0070706_100306244 3300005467 Bacteria 1482
105 Ga0070707_100128303 3300005468 Bacteria 2465
106 Ga0070707_100602851 3300005468 Bacteria 1061
107 Ga0070698_100365274 3300005471 Bacteria 1375
108 Ga0070699_100184203 3300005518 Bacteria 1854
109 Ga0070699_100276236 3300005518 Bacteria 1504
110 Ga0070679_100003183 3300005530 Bacteria 15003
111 Ga0070679_100034844 3300005530 Bacteria 4992
112 Ga0070679_100149712 3300005530 Bacteria 2311
113 Ga0070697_100121192 3300005536 Bacteria 2188
114 Ga0070697_100180798 3300005536 Bacteria 1788
115 Ga0068853_100063354 3300005539 Bacteria 3202
116 Ga0070672_100268961 3300005543 Bacteria 1439
117 Ga0070672_100293793 3300005543 Bacteria 1376
118 Ga0070672_100314723 3300005543 Bacteria 1329
119 Ga0070686_100000711 3300005544 Bacteria 19359
120 Ga0070695_100000281 3300005545 Bacteria 25630
121 Ga0070696_100004140 3300005546 Bacteria 9667
122 Ga0070696_100010174 3300005546 Bacteria 6296
123 Ga0070693_100000162 3300005547 Bacteria 30827
124 Ga0070693_100364173 3300005547 Bacteria 993
125 Ga0070665_100000011 3300005548 Bacteria 525539
126 Ga0070665_100000169 3300005548 Bacteria 118043
127 Ga0070665_100030114 3300005548 Bacteria 5461
128 Ga0070665_100190176 3300005548 Bacteria 2054
129 Ga0070704_100010913 3300005549 Bacteria 5540
130 Ga0070704_100039001 3300005549 Bacteria 3258
131 Ga0070704_100059317 3300005549 Bacteria 2729
132 Ga0068855_100000265 3300005563 Bacteria 65271
133 Ga0068855_100105928 3300005563 Bacteria 3233
134 Ga0068855_100197575 3300005563 Bacteria 2266
135 Ga0068857_100030804 3300005577 Bacteria 4739
136 Ga0068856_100316903 3300005614 Bacteria 1577
137 Ga0068856_100327474 3300005614 Bacteria 1549
138 Ga0070702_100000093 3300005615 Bacteria 26493
139 Ga0068859_100003739 3300005617 Bacteria 15512
140 Ga0068859_100045750 3300005617 Bacteria 4397
141 Ga0068859_100185952 3300005617 Bacteria 2161
142 Ga0068859_100695399 3300005617 Bacteria 1108
143 Ga0068864_100046863 3300005618 Bacteria 3710
144 Ga0068866_10000256 3300005718 Bacteria 24958
145 Ga0068861_100000355 3300005719 Bacteria 26109
146 Ga0068870_10022034 3300005840 Bacteria 3126
147 Ga0068870_10137642 3300005840 Bacteria 1425
148 Ga0068863_100005225 3300005841 Bacteria 12813
149 Ga0068863_100008798 3300005841 Bacteria 9858
150 Ga0068863_100078963 3300005841 Bacteria 3117
151 Ga0068863_100089193 3300005841 Bacteria 2923
152 Ga0068863_100132536 3300005841 Bacteria 2379
153 Ga0068858_100008078 3300005842 Bacteria 10133
154 Ga0068858_100025135 3300005842 Bacteria 5542
155 Ga0068860_100002594 3300005843 Bacteria 18905
156 Ga0068860_100011906 3300005843 Bacteria 8573
157 Ga0068860_100048947 3300005843 Bacteria 4028
158 Ga0068860_100245021 3300005843 Bacteria 1744
159 Ga0068860_100274649 3300005843 Bacteria 1646
160 Ga0068862_100000381 3300005844 Bacteria 47919
161 Ga0068862_100134173 3300005844 Bacteria 2193
162 Ga0081455_10071704 3300005937 Bacteria 2870
163 Ga0081538_10000697 3300005981 Bacteria 36894
164 Ga0081538_10017125 3300005981 Bacteria 5516
165 Ga0081540_1001984 3300005983 Bacteria 17080
166 Ga0081540_1002003 3300005983 Bacteria 17000
167 Ga0081540_1003649 3300005983 Bacteria 12076
168 Ga0081540_1017724 3300005983 Bacteria 4398
169 Ga0081540_1036127 3300005983 Bacteria 2639
170 Ga0081540_1050173 3300005983 Bacteria 2075
171 Ga0081539_10002187 3300005985 Bacteria 28690
172 Ga0081539_10036902 3300005985 Bacteria 2917
173 Ga0070717_10014290 3300006028 Bacteria 6106
174 Ga0075363_100013539 3300006048 Bacteria 3957
175 Ga0075364_10005843 3300006051 Bacteria 7184
176 Ga0075364_10073975 3300006051 Bacteria 2246
177 Ga0070715_10000633 3300006163 Bacteria 9317
178 Ga0070715_10002046 3300006163 Bacteria 6082
179 Ga0070715_10027128 3300006163 Bacteria 2285
180 Ga0070716_100006982 3300006173 Bacteria 5536
181 Ga0070716_100065105 3300006173 Bacteria 2121
182 Ga0070716_100072447 3300006173 Bacteria 2029
183 Ga0070712_100002594 3300006175 Bacteria 11168
184 Ga0070712_100008343 3300006175 Bacteria 6514
185 Ga0070712_100028995 3300006175 Bacteria 3708
186 Ga0070712_100038140 3300006175 Bacteria 3282
187 Ga0070712_100047227 3300006175 Bacteria 2979
188 Ga0070712_100110880 3300006175 Bacteria 2047
189 Ga0070712_100158867 3300006175 Bacteria 1744
190 Ga0075362_10002160 3300006177 Bacteria 6508
191 Ga0075362_10040981 3300006177 Bacteria 2040
192 Ga0075367_10067123 3300006178 Bacteria 2150
193 Ga0075367_10118426 3300006178 Bacteria 1630
194 Ga0075369_10015935 3300006186 Bacteria 3025
195 Ga0075366_10000931 3300006195 Bacteria 14208
196 Ga0075366_10022054 3300006195 Bacteria 3703
197 Ga0075366_10031321 3300006195 Bacteria 3129
198 Ga0097621_100000303 3300006237 Bacteria 33347
199 Ga0097621_100095350 3300006237 Bacteria 2495
200 Ga0097621_100110302 3300006237 Bacteria 2324
201 Ga0097621_100343669 3300006237 Bacteria 1325
202 Ga0097621_100405247 3300006237 Bacteria 1222
203 Ga0068871_100000925 3300006358 Bacteria 19583
204 Ga0068871_100011094 3300006358 Bacteria 6604
205 Ga0068871_100046071 3300006358 Bacteria 3511
206 Ga0068871_100182244 3300006358 Bacteria 1805
207 Ga0068871_100184289 3300006358 Bacteria 1795
208 Ga0068871_100240442 3300006358 Bacteria 1574
209 Ga0075428_100000083 3300006844 Bacteria 78689
210 Ga0075428_100113402 3300006844 Bacteria 2953
211 Ga0075428_100284076 3300006844 Bacteria 1780
212 Ga0075430_100000163 3300006846 Bacteria 43947
213 Ga0075430_100055653 3300006846 Bacteria 3326
214 Ga0075431_100087790 3300006847 Bacteria 3209
215 Ga0075433_10003177 3300006852 Bacteria 12656
216 Ga0075434_100000064 3300006871 Bacteria 54394
217 Ga0075434_100092271 3300006871 Bacteria 3030
218 Ga0075429_100001065 3300006880 Bacteria 21974
219 Ga0068865_100008534 3300006881 Bacteria 6333
220 Ga0068865_100093321 3300006881 Bacteria 2188
221 Ga0075436_100005135 3300006914 Bacteria 9013
222 Ga0075436_100016682 3300006914 Bacteria 5027
223 Ga0097620_100003738 3300006931 Bacteria 15512
224 Ga0097620_100045750 3300006931 Bacteria 4397
225 Ga0097620_100185959 3300006931 Bacteria 2161
226 Ga0097620_100695358 3300006931 Bacteria 1108
227 Ga0099826_10035411 3300006948 Bacteria 3551
228 Ga0075435_100000586 3300007076 Bacteria 22266
229 Ga0075435_100302692 3300007076 Bacteria 1367
230 Ga0099795_10029911 3300007788 Bacteria 1865
231 Ga0099795_10076325 3300007788 Bacteria 1274
232 Ga0105251_10004488 3300009011 Bacteria 9471
233 Ga0105240_10000369 3300009093 Bacteria 84513
234 Ga0105245_10000696 3300009098 Bacteria 30300
235 Ga0105245_10002702 3300009098 Bacteria 15962
236 Ga0105245_10011796 3300009098 Bacteria 7603
237 Ga0105245_10167384 3300009098 Bacteria 2090
238 Ga0105247_10019849 3300009101 Bacteria 4037
239 Ga0105247_10109570 3300009101 Bacteria 1775
240 Ga0114129_10000210 3300009147 Bacteria 65476
241 Ga0114129_10087181 3300009147 Bacteria 4329
242 Ga0105243_10000631 3300009148 Bacteria 34959
243 Ga0105243_10153892 3300009148 Bacteria 1976
244 Ga0105243_10173670 3300009148 Bacteria 1869
245 Ga0105243_10197316 3300009148 Bacteria 1763
246 Ga0105242_10003476 3300009176 Bacteria 12246
247 Ga0105242_10009816 3300009176 Bacteria 7334
248 Ga0105242_10020603 3300009176 Bacteria 5172
249 Ga0105242_10088017 3300009176 Bacteria 2608
250 Ga0105248_10465993 3300009177 Bacteria 1424
251 Ga0105237_10024199 3300009545 Bacteria 6213
252 Ga0105237_10183495 3300009545 Bacteria 2092
253 Ga0105237_10456475 3300009545 Bacteria 1284
254 Ga0105249_10003937 3300009553 Bacteria 12818
255 Ga0099796_10000419 3300010159 Bacteria 7045
256 Ga0105239_10123372 3300010375 Bacteria 2878
257 Ga0105239_10253032 3300010375 Bacteria 1979
258 Ga0105246_10229808 3300011119 Bacteria 1460
259 Ga0105246_10422784 3300011119 Bacteria 1113
260 Ga0157370_10010690 3300013104 Bacteria 9656
261 Ga0157369_10002769 3300013105 Bacteria 20942
262 Ga0157369_10213752 3300013105 Bacteria 2021
263 Ga0157369_10359901 3300013105 Bacteria 1511
264 Ga0157374_10012098 3300013296 Bacteria 7494
265 Ga0157378_10001488 3300013297 Bacteria 21162
266 Ga0163162_10030087 3300013306 Bacteria 5379
267 Ga0163162_10065362 3300013306 Bacteria 3684
268 Ga0163162_10342000 3300013306 Bacteria 1629
269 Ga0157372_10507890 3300013307 Bacteria 1405
270 Ga0157375_10020483 3300013308 Bacteria 6043
271 Ga0157375_10117196 3300013308 Bacteria 2768
272 Ga0157375_10957914 3300013308 Bacteria 997
273 Ga0163163_10001830 3300014325 Bacteria 17956
274 Ga0163163_10275912 3300014325 Bacteria 1732
275 Ga0157380_10017000 3300014326 Bacteria 5373
276 Ga0157380_10019019 3300014326 Bacteria 5112
277 Ga0182008_10146347 3300014497 Bacteria 1184
278 Ga0157379_10016937 3300014968 Bacteria 6412
279 Ga0157376_10013769 3300014969 Bacteria 6047
280 Ga0182007_10071314 3300015262 Bacteria 1138
281 Ga0183362_10002 3300015683 Bacteria 1432711
282 Ga0163161_10238579 3300017792 Bacteria 1413
283 Ga0163161_10291552 3300017792 Bacteria 1283
284 Ga0206350_10617166 3300020080 Bacteria 1254
285 Ga0206350_11377320 3300020080 Bacteria 1270
286 Ga0213872_10000001 3300021361 Bacteria 662532
287 Ga0213872_10009977 3300021361 Bacteria 4533
288 Ga0213872_10039685 3300021361 Bacteria 2148
289 Ga0213876_10024910 3300021384 Bacteria 3159
290 Ga0213876_10102662 3300021384 Bacteria 1516
291 Ga0213875_10036455 3300021388 Bacteria 2319
292 Ga0228598_1002924 3300024227 Bacteria 3708
293 Ga0209758_1000079 3300025297 Bacteria 262874
294 Ga0207713_1002844 3300025735 Bacteria 12178
295 Ga0207653_10008178 3300025885 Bacteria 3261
296 Ga0207682_10000543 3300025893 Bacteria 17394
297 Ga0207682_10003858 3300025893 Bacteria 6429
298 Ga0207642_10095412 3300025899 Bacteria 1480
299 Ga0207710_10013829 3300025900 Bacteria 3398
300 Ga0207680_10015096 3300025903 Bacteria 4021
301 Ga0207680_10177686 3300025903 Bacteria 1438
302 Ga0207647_10057890 3300025904 Bacteria 2375
303 Ga0207685_10004756 3300025905 Bacteria 3495
304 Ga0207685_10021335 3300025905 Bacteria 2169
305 Ga0207699_10012944 3300025906 Bacteria 4254
306 Ga0207699_10029996 3300025906 Bacteria 3039
307 Ga0207699_10235555 3300025906 Bacteria 1255
308 Ga0207645_10025828 3300025907 Bacteria 3799
309 Ga0207645_10027950 3300025907 Bacteria 3641
310 Ga0207643_10001848 3300025908 Bacteria 11707
311 Ga0207705_10002747 3300025909 Bacteria 13484
312 Ga0207684_10011372 3300025910 Bacteria 7790
313 Ga0207684_10195609 3300025910 Bacteria 1744
314 Ga0207684_10274560 3300025910 Bacteria 1454
315 Ga0207707_10006531 3300025912 Bacteria 10178
316 Ga0207707_10062009 3300025912 Bacteria 3253
317 Ga0207707_10116094 3300025912 Bacteria 2339
318 Ga0207707_10217828 3300025912 Bacteria 1662
319 Ga0207695_10014477 3300025913 Bacteria 9337
320 Ga0207693_10000068 3300025915 Bacteria 91004
321 Ga0207693_10000855 3300025915 Bacteria 27188
322 Ga0207693_10007507 3300025915 Bacteria 8954
323 Ga0207693_10023422 3300025915 Bacteria 4903
324 Ga0207693_10101537 3300025915 Bacteria 2256
325 Ga0207663_10007458 3300025916 Bacteria 5673
326 Ga0207660_10003314 3300025917 Bacteria 10518
327 Ga0207660_10010746 3300025917 Bacteria 5949
328 Ga0207662_10000257 3300025918 Bacteria 24677
329 Ga0207662_10009537 3300025918 Bacteria 5347
330 Ga0207657_10182571 3300025919 Bacteria 1695
331 Ga0207652_10014091 3300025921 Bacteria 6473
332 Ga0207652_10054007 3300025921 Bacteria 3453
333 Ga0207652_10111925 3300025921 Bacteria 2421
334 Ga0207652_10112577 3300025921 Bacteria 2415
335 Ga0207652_10258852 3300025921 Bacteria 1569
336 Ga0207646_10108859 3300025922 Bacteria 2486
337 Ga0207681_10034479 3300025923 Bacteria 3328
338 Ga0207681_10062274 3300025923 Bacteria 2568
339 Ga0207650_10030542 3300025925 Bacteria 3882
340 Ga0207650_10068465 3300025925 Bacteria 2666
341 Ga0207650_10091002 3300025925 Bacteria 2330
342 Ga0207659_10125838 3300025926 Bacteria 1971
343 Ga0207659_10142786 3300025926 Bacteria 1860
344 Ga0207659_10182438 3300025926 Bacteria 1664
345 Ga0207659_10365432 3300025926 Bacteria 1200
346 Ga0207659_10366032 3300025926 Bacteria 1199
347 Ga0207687_10002535 3300025927 Bacteria 12403
348 Ga0207687_10062110 3300025927 Bacteria 2640
349 Ga0207687_10279310 3300025927 Bacteria 1338
350 Ga0207700_10050072 3300025928 Bacteria 3111
351 Ga0207700_10073659 3300025928 Bacteria 2638
352 Ga0207700_10127448 3300025928 Bacteria 2073
353 Ga0207700_10252912 3300025928 Bacteria 1506
354 Ga0207700_10315408 3300025928 Bacteria 1354
355 Ga0207664_10040999 3300025929 Bacteria 3604
356 Ga0207664_10201736 3300025929 Bacteria 1717
357 Ga0207664_10229820 3300025929 Bacteria 1612
358 Ga0207644_10000409 3300025931 Bacteria 28023
359 Ga0207644_10016411 3300025931 Bacteria 4981
360 Ga0207644_10031985 3300025931 Bacteria 3669
361 Ga0207644_10276929 3300025931 Bacteria 1346
362 Ga0207706_10038152 3300025933 Bacteria 4262
363 Ga0207706_10121373 3300025933 Bacteria 2298
364 Ga0207686_10014985 3300025934 Bacteria 4327
365 Ga0207709_10000662 3300025935 Bacteria 27921
366 Ga0207709_10145655 3300025935 Bacteria 1634
367 Ga0207670_10000333 3300025936 Bacteria 27980
368 Ga0207670_10002665 3300025936 Bacteria 9390
369 Ga0207670_10004310 3300025936 Bacteria 7639
370 Ga0207670_10020940 3300025936 Bacteria 4025
371 Ga0207670_10205270 3300025936 Bacteria 1499
372 Ga0207669_10030218 3300025937 Bacteria 3008
373 Ga0207669_10134855 3300025937 Bacteria 1703
374 Ga0207669_10210730 3300025937 Bacteria 1418
375 Ga0207704_10000798 3300025938 Bacteria 13929
376 Ga0207704_10010936 3300025938 Bacteria 4448
377 Ga0207704_10206684 3300025938 Bacteria 1441
378 Ga0207704_10242318 3300025938 Bacteria 1348
379 Ga0207665_10003244 3300025939 Bacteria 10891
380 Ga0207665_10023145 3300025939 Bacteria 4091
381 Ga0207665_10037567 3300025939 Bacteria 3224
382 Ga0207691_10020089 3300025940 Bacteria 6318
383 Ga0207691_10044610 3300025940 Bacteria 4080
384 Ga0207691_10161849 3300025940 Bacteria 1963
385 Ga0207711_10014397 3300025941 Bacteria 6568
386 Ga0207711_10055281 3300025941 Bacteria 3408
387 Ga0207711_10062514 3300025941 Bacteria 3211
388 Ga0207711_10141067 3300025941 Bacteria 2168
389 Ga0207689_10001220 3300025942 Bacteria 24704
390 Ga0207689_10014839 3300025942 Bacteria 6614
391 Ga0207689_10119685 3300025942 Bacteria 2166
392 Ga0207689_10128018 3300025942 Bacteria 2088
393 Ga0207689_10157051 3300025942 Bacteria 1875
394 Ga0207679_10207272 3300025945 Bacteria 1642
395 Ga0207667_10000029 3300025949 Bacteria 329192
396 Ga0207667_10011463 3300025949 Bacteria 10301
397 Ga0207667_10012740 3300025949 Bacteria 9659
398 Ga0207651_10009279 3300025960 Bacteria 5373
399 Ga0207651_10178410 3300025960 Bacteria 1682
400 Ga0207712_10048334 3300025961 Bacteria 2959
401 Ga0207668_10017068 3300025972 Bacteria 4541
402 Ga0207668_10405555 3300025972 Bacteria 1153
403 Ga0207640_10004352 3300025981 Bacteria 7673
404 Ga0207658_10019851 3300025986 Bacteria 4650
405 Ga0207658_10312615 3300025986 Bacteria 1357
406 Ga0207677_10049518 3300026023 Bacteria 2836
407 Ga0207678_10002574 3300026067 Bacteria 16522
408 Ga0207708_10000993 3300026075 Bacteria 21204
409 Ga0207708_10008364 3300026075 Bacteria 7659
410 Ga0207708_10015584 3300026075 Bacteria 5700
411 Ga0207702_10040209 3300026078 Bacteria 3920
412 Ga0207702_10176628 3300026078 Bacteria 1963
413 Ga0207702_10210465 3300026078 Bacteria 1807
414 Ga0207702_10300355 3300026078 Bacteria 1524
415 Ga0207641_10066100 3300026088 Bacteria 3095
416 Ga0207641_10172491 3300026088 Bacteria 1975
417 Ga0207648_10000840 3300026089 Bacteria 34588
418 Ga0207648_10001304 3300026089 Bacteria 27765
419 Ga0207648_10051080 3300026089 Bacteria 3613
420 Ga0207676_10018327 3300026095 Bacteria 5088
421 Ga0207676_10441243 3300026095 Bacteria 1225
422 Ga0207674_10067184 3300026116 Bacteria 3610
423 Ga0207674_10187815 3300026116 Bacteria 2017
424 Ga0207675_100000900 3300026118 Bacteria 29714
425 Ga0207675_100002492 3300026118 Bacteria 18230
426 Ga0207675_100152416 3300026118 Bacteria 2201
427 Ga0207675_100182211 3300026118 Bacteria 2011
428 Ga0207683_10002913 3300026121 Bacteria 14927
429 Ga0207683_10015669 3300026121 Bacteria 6452
430 Ga0207683_10242126 3300026121 Bacteria 1645
431 Ga0207683_10353005 3300026121 Bacteria 1350
432 Ga0207698_10169618 3300026142 Bacteria 1920
433 Ga0209969_1002388 3300027360 Bacteria 2597
434 Ga0209967_1007468 3300027364 Bacteria 1495
435 Ga0209179_1014773 3300027512 Bacteria 1439
436 Ga0209968_1005378 3300027526 Bacteria 1927
437 Ga0209999_1000224 3300027543 Bacteria 8056
438 Ga0207428_10000321 3300027907 Bacteria 62664
439 Ga0207428_10046915 3300027907 Bacteria 3471
440 Ga0265357_1005616 3300028023 Bacteria 1165
441 Ga0268266_10000063 3300028379 Bacteria 253339
442 Ga0268266_10001173 3300028379 Bacteria 32393
443 Ga0268265_10005803 3300028380 Bacteria 8422
444 Ga0268265_10241621 3300028380 Bacteria 1594
445 Ga0268265_10388220 3300028380 Bacteria 1286
446 Ga0268264_10003658 3300028381 Bacteria 13220
447 Ga0268264_10023040 3300028381 Bacteria 5081
448 Ga0268264_10169224 3300028381 Bacteria 1975
449 Ga0265337_1001602 3300028556 Bacteria 11051
450 Ga0265334_10000375 3300028573 Bacteria 23930
451 Ga0307515_10000292 3300028794 Bacteria 123160
452 Ga0265338_10017937 3300028800 Bacteria 7601
453 Ga0265760_10022541 3300031090 Bacteria 1825
454 Ga0265330_10025350 3300031235 Bacteria 2688
455 Ga0265332_10090049 3300031238 Bacteria 1298
456 Ga0265320_10064213 3300031240 Bacteria 1744
457 Ga0265325_10000649 3300031241 Bacteria 25279
458 Ga0265325_10086558 3300031241 Bacteria 1550
459 Ga0265325_10093049 3300031241 Bacteria 1484
460 Ga0265329_10006400 3300031242 Bacteria 4672
461 Ga0265340_10058038 3300031247 Bacteria 1859
462 Ga0265340_10075674 3300031247 Bacteria 1590
463 Ga0265340_10114843 3300031247 Bacteria 1242
464 Ga0265339_10000269 3300031249 Bacteria 41988
465 Ga0265339_10036335 3300031249 Bacteria 2758
466 Ga0265316_10183496 3300031344 Bacteria 1557
467 Ga0307408_100070914 3300031548 Bacteria 2574
468 Ga0265313_10022761 3300031595 Bacteria 3391
469 Ga0307508_10089616 3300031616 Bacteria 2661
470 Ga0265314_10038574 3300031711 Bacteria 3449
471 Ga0265314_10043616 3300031711 Bacteria 3187
472 Ga0265342_10043768 3300031712 Bacteria 2700
473 Ga0307405_10012768 3300031731 Bacteria 4461
474 Ga0307413_10001952 3300031824 Bacteria 8191
475 Ga0307406_10004403 3300031901 Bacteria 7660
476 Ga0307407_10013466 3300031903 Bacteria 3971
477 Ga0307412_10007438 3300031911 Bacteria 6212
478 Ga0307414_10227671 3300032004 Bacteria 1535
479 Ga0307411_10003851 3300032005 Bacteria 7067
480 Ga0307415_100005865 3300032126 Bacteria 6568
481 Ga0316583_10005706 3300032133 Bacteria 4476
482 Ga0373930_0015062 3300034816 Bacteria 1448
483 Ga0373926_0003071 3300035083 Bacteria 5358
484 Ga0373926_0016641 3300035083 Bacteria 2518
485 Ga0373928_0004469 3300035084 Bacteria 2666
486 Ga0373929_0012853 3300035085 Bacteria 1596
487 Ga0373940_0019433 3300035088 Bacteria 1716
488 Ga0373944_0018964 3300035089 Bacteria 1969
489 Ga0373944_0036368 3300035089 Bacteria 1504
490 Ga0373944_0103233 3300035089 Bacteria 966
491 Ga0373951_0005912 3300035091 Bacteria 2824
492 Ga0373952_0003713 3300035092 Bacteria 2758
493 Ga0373932_0001983 3300035112 Bacteria 5402
494 Ga0373936_0029845 3300035113 Bacteria 2148
495 Ga0373945_0000969 3300035116 Bacteria 8556
496 Ga0373945_0003484 3300035116 Bacteria 4953
497 Ga0373945_0006884 3300035116 Bacteria 3675
498 Ga0373953_0020708 3300035117 Bacteria 2459
499 Ga0373954_0032131 3300035118 Bacteria 2426
500 Ga0373954_0056964 3300035118 Bacteria 1840
501 Ga0373954_0125623 3300035118 Bacteria 1247
502 Ga0373956_0026912 3300035119 Bacteria 2493
503 Ga0373957_0037722 3300035120 Bacteria 1806
504 Ga0373960_0033881 3300035121 Bacteria 1442
505 Ga0373943_0000185 3300035170 Bacteria 24985
506 Ga0373943_0014863 3300035170 Bacteria 3532
507 Ga0373943_0083775 3300035170 Bacteria 1639
508 Ga0373943_0152461 3300035170 Bacteria 1253
509 Ga0373946_0000642 3300035171 Bacteria 11673
510 Ga0373946_0174843 3300035171 Bacteria 1016
511 Ga0373955_0001304 3300035172 Bacteria 10611
512 Ga0373955_0002912 3300035172 Bacteria 7514
513 Ga0373955_0003944 3300035172 Bacteria 6545
514 Ga0373955_0068444 3300035172 Bacteria 1978
515 Ga0373961_0006705 3300035241 Bacteria 2768
516 Ga0373962_0012148 3300035242 Bacteria 2166
517 Ga0373962_0019134 3300035242 Bacteria 1789
518 Ga0373924_0008512 3300035410 Bacteria 3732
519 Ga0373924_0020013 3300035410 Bacteria 2598
520 Ga0373931_0000134 3300035691 Bacteria 33430
521 Ga0373931_0054056 3300035691 Bacteria 2145
522 Ga0373931_0140963 3300035691 Bacteria 1396
523 Ga0373931_0179923 3300035691 Bacteria 1251
524 Ga0373935_0000023 3300035692 Bacteria 61461
525 Ga0373935_0010837 3300035692 Bacteria 5476
526 Ga0373935_0039428 3300035692 Bacteria 2962
527 Ga0373935_0124974 3300035692 Bacteria 1722
528 Ga0373935_0163631 3300035692 Bacteria 1518
529 Ga0373935_0176776 3300035692 Bacteria 1463
530 Ga0373927_0000434 3300035695 Bacteria 32038
531 Ga0373927_0013020 3300035695 Bacteria 5532
532 Ga0373927_0020220 3300035695 Bacteria 4365
533 Ga0373927_0041756 3300035695 Bacteria 2974
534 Ga0373927_0051817 3300035695 Bacteria 2654
535 Ga0373927_0070058 3300035695 Bacteria 2270
536 Ga0373927_0072642 3300035695 Bacteria 2227
537 Ga0373933_0001503 3300035724 Bacteria 13639
538 Ga0373933_0006249 3300035724 Bacteria 6484
539 Ga0373933_0011490 3300035724 Bacteria 4883
540 Ga0373947_0000583 3300035725 Bacteria 21422
541 Ga0373947_0017670 3300035725 Bacteria 4104
542 Ga0373947_0070482 3300035725 Bacteria 2142
543 Ga0373947_0208520 3300035725 Bacteria 1281
544 Ga0373947_0213124 3300035725 Bacteria 1267
545 Ga0373937_0000005 3300036401 Bacteria 199965
546 Ga0373937_0003414 3300036401 Bacteria 13333
547 Ga0373937_0008905 3300036401 Bacteria 8714
548 Ga0373937_0009993 3300036401 Bacteria 8274
549 Ga0373937_0010352 3300036401 Bacteria 8143
550 Ga0373937_0091795 3300036401 Bacteria 2814
551 Ga0373925_0000007 3300037068 Bacteria 257023
552 Ga0373925_0000749 3300037068 Bacteria 29795
553 Ga0373925_0030549 3300037068 Bacteria 3955
554 Ga0373925_0104188 3300037068 Bacteria 2184
555 Ga0373925_0107062 3300037068 Bacteria 2156
556 Ga0373925_0132701 3300037068 Bacteria 1943
557 Ga0373925_0330088 3300037068 Bacteria 1235
558 Ga0395898_0152595 3300037466 Bacteria 2210
559 Ga0395898_0182889 3300037466 Bacteria 2003
560 Ga0436364_0611812 3300037853 Bacteria 1686
561 Ga0436364_1488218 3300037853 Bacteria 1913
562 Ga0436365_0053879 3300039437 Bacteria 2344
563 Ga0436365_0072895 3300039437 Bacteria 53725
564 Ga0436365_0120456 3300039437 Bacteria 3440
565 Ga0436365_0395269 3300039437 Bacteria 1213
566 Ga0436365_1548351 3300039437 Bacteria 1282
567 Ga0436365_1582443 3300039437 Bacteria 6857
568 Ga0436365_1849126 3300039437 Bacteria 3360
569 Ga0436360_0157058 3300039438 Bacteria 1376
570 Ga0436360_0793447 3300039438 Bacteria 1379
571 Ga0436360_1115848 3300039438 Bacteria 1921
572 Ga0436361_0028664 3300039447 Bacteria 69721
573 Ga0436361_0081134 3300039447 Bacteria 1491
574 Ga0436361_0200590 3300039447 Bacteria 2148
575 Ga0436361_0328438 3300039447 Bacteria 1311
576 Ga0436361_0340102 3300039447 Bacteria 1972
577 Ga0436363_0460787 3300039450 Bacteria 1715
578 Ga0436363_1144933 3300039450 Bacteria 1753
579 Ga0436362_0233360 3300039453 Bacteria 1195
580 Ga0436362_0463249 3300039453 Bacteria 4420
581 Ga0436362_0742152 3300039453 Bacteria 1104
582 Ga0436362_0992192 3300039453 Bacteria 2095
583 Ga0436362_1187034 3300039453 Bacteria 1608
584 Ga0451807_0095181 3300041486 Bacteria 3744
585 Ga0439434_0000107 3300042435 Bacteria 21642
586 Ga0439434_0027711 3300042435 Bacteria 1714
587 Ga0439435_0000076 3300042436 Bacteria 11878
588 Ga0451577_0000863 3300042876 Bacteria 45151
589 Ga0451577_0100523 3300042876 Bacteria 2583
590 Ga0466963_0016237 3300044694 Bacteria 4628
591 Ga0466957_0067767 3300044842 Bacteria 2202
592 Ga0466959_0064196 3300045049 Bacteria 2666
593 Ga0451576_0001387 3300045051 Bacteria 41619
594 Ga0466958_0000079 3300045836 Bacteria 29664
595 Ga0495627_051507 3300046453 Bacteria 1237
596 Ga0495592_0007203 3300046454 Bacteria 8333
597 Ga0495592_0021131 3300046454 Bacteria 4949
598 Ga0495592_0034241 3300046454 Bacteria 3829
599 Ga0495592_0038795 3300046454 Bacteria 3582
600 Ga0495592_0072080 3300046454 Bacteria 2514
601 Ga0495592_0231287 3300046454 Bacteria 1231
602 Ga0495603_0025282 3300046455 Bacteria 3591
603 Ga0495603_0237504 3300046455 Bacteria 1050
604 Ga0495629_0012162 3300046459 Bacteria 6236
605 Ga0495629_0017119 3300046459 Bacteria 5199
606 Ga0495629_0153118 3300046459 Bacteria 1602
607 Ga0495638_0008417 3300046460 Bacteria 7317
608 Ga0495638_0040866 3300046460 Bacteria 2937
609 Ga0495641_0020520 3300046461 Bacteria 3347
610 Ga0495651_0001105 3300046462 Bacteria 20821
611 Ga0495651_0007669 3300046462 Bacteria 8251
612 Ga0495651_0050378 3300046462 Bacteria 3212
613 Ga0495653_0000308 3300046463 Bacteria 39628
614 Ga0495653_0001999 3300046463 Bacteria 16036
615 Ga0495580_0001449 3300046472 Bacteria 20800
616 Ga0495580_0058208 3300046472 Bacteria 2718
617 Ga0495580_0110115 3300046472 Bacteria 1912
618 Ga0495580_0139388 3300046472 Bacteria 1681
619 Ga0495580_0189984 3300046472 Bacteria 1417
620 Ga0495639_0013308 3300046475 Bacteria 3552
621 Ga0495662_0008076 3300046476 Bacteria 5186
622 Ga0495662_0010733 3300046476 Bacteria 4479
623 Ga0495662_0054256 3300046476 Bacteria 1936
624 Ga0495664_0000003 3300046477 Bacteria 551602
625 Ga0495664_0001762 3300046477 Bacteria 11503
626 Ga0495584_0164884 3300046491 Bacteria 1126
627 Ga0495583_0000840 3300046506 Bacteria 37393
628 Ga0495606_0003584 3300046507 Bacteria 16361
629 Ga0495608_0000072 3300046511 Bacteria 76887
630 Ga0495608_0001418 3300046511 Bacteria 17055
631 Ga0495618_0000019 3300046514 Bacteria 136770
632 Ga0495618_0003872 3300046514 Bacteria 9249
633 Ga0495618_0017589 3300046514 Bacteria 4384
634 Ga0495628_0000015 3300046516 Bacteria 198912
635 Ga0495628_0104293 3300046516 Bacteria 2185
636 Ga0495628_0198013 3300046516 Bacteria 1514
637 Ga0495630_0027301 3300046517 Bacteria 4233
638 Ga0495630_0029121 3300046517 Bacteria 4105
639 Ga0495630_0142109 3300046517 Bacteria 1825
640 Ga0495663_0017948 3300046525 Bacteria 2012
641 Ga0495666_0040519 3300046526 Bacteria 2258
642 Ga0495666_0110666 3300046526 Bacteria 1290
643 Ga0495652_0000006 3300046529 Bacteria 459709
644 Ga0495652_0024988 3300046529 Bacteria 5286
645 Ga0495665_0013808 3300046531 Bacteria 4362
646 Ga0495665_0039593 3300046531 Bacteria 2510
647 Ga0495640_0000002 3300046533 Bacteria 646434
648 Ga0495640_0007626 3300046533 Bacteria 8505
649 Ga0495640_0007854 3300046533 Bacteria 8388
650 Ga0495640_0036736 3300046533 Bacteria 3459
651 Ga0495640_0063367 3300046533 Bacteria 2504
652 Ga0495640_0232222 3300046533 Bacteria 1160
653 Ga0495586_0001019 3300046535 Bacteria 15828
654 Ga0495587_0000001 3300046536 Bacteria 724132
655 Ga0495587_0000718 3300046536 Bacteria 22128
656 Ga0495587_0211790 3300046536 Bacteria 1094
657 Ga0495598_0029042 3300046537 Bacteria 1538
658 Ga0495621_0053406 3300046539 Bacteria 1451
659 Ga0495645_0002525 3300046543 Bacteria 12424
660 Ga0495645_0010377 3300046543 Bacteria 6527
661 Ga0495645_0061883 3300046543 Bacteria 2712
662 Ga0495667_0000021 3300046559 Bacteria 180625
663 Ga0495667_0015887 3300046559 Bacteria 5090
664 Ga0495667_0047937 3300046559 Bacteria 2821
665 Ga0495667_0069839 3300046559 Bacteria 2292
666 Ga0495667_0247884 3300046559 Bacteria 1134
667 Ga0495656_0011244 3300046615 Bacteria 3283
668 Ga0495656_0122948 3300046615 Bacteria 1227
669 Ga0495668_0188938 3300046616 Bacteria 1128
670 Ga0495634_0000251 3300046642 Bacteria 50728
671 Ga0495634_0004679 3300046642 Bacteria 10644
672 Ga0495634_0005356 3300046642 Bacteria 9887
673 Ga0495634_0008363 3300046642 Bacteria 7713
674 Ga0495634_0031218 3300046642 Bacteria 3671
675 Ga0495634_0147046 3300046642 Bacteria 1492
676 Ga0495625_0073164 3300046660 Bacteria 2403
677 Ga0495635_0000001 3300046663 Bacteria 704901
678 Ga0495635_0013586 3300046663 Bacteria 5698
679 Ga0495635_0309483 3300046663 Bacteria 1058
680 Ga0495588_0014197 3300046674 Bacteria 3809
681 Ga0495657_0000486 3300046675 Bacteria 37325
682 Ga0495657_0004121 3300046675 Bacteria 11643
683 Ga0495657_0094272 3300046675 Bacteria 1915
684 Ga0495599_0000203 3300046678 Bacteria 39491
685 Ga0495599_0061678 3300046678 Bacteria 2342
686 Ga0495599_0121767 3300046678 Bacteria 1621
687 Ga0495623_0000058 3300046679 Bacteria 68197
688 Ga0495623_0014685 3300046679 Bacteria 5065
689 Ga0495623_0040238 3300046679 Bacteria 2985
690 Ga0495646_0000003 3300046680 Bacteria 287773
691 Ga0495646_0118020 3300046680 Bacteria 1504
692 Ga0495647_0002041 3300046681 Bacteria 6316
693 Ga0495647_0019408 3300046681 Bacteria 2430
694 Ga0495647_0061291 3300046681 Bacteria 1485
695 Ga0495647_0063946 3300046681 Bacteria 1458
696 Ga0495658_0006634 3300046683 Bacteria 5688
697 Ga0495658_0021666 3300046683 Bacteria 3391
698 Ga0495613_0032385 3300046689 Bacteria 3883
699 Ga0495613_0044368 3300046689 Bacteria 3290
700 Ga0495613_0270040 3300046689 Bacteria 1183
701 Ga0495624_0019722 3300046690 Bacteria 4495
702 Ga0495624_0043998 3300046690 Bacteria 2847
703 Ga0495624_0066538 3300046690 Bacteria 2249
704 Ga0495624_0110338 3300046690 Bacteria 1692
705 Ga0495624_0226103 3300046690 Bacteria 1134
706 Ga0495670_0078096 3300046691 Bacteria 1684
707 Ga0495670_0089661 3300046691 Bacteria 1573
708 Ga0495600_0000002 3300046809 Bacteria 186597
709 Ga0495600_0006243 3300046809 Bacteria 7235
710 Ga0495600_0071440 3300046809 Bacteria 2267
711 Ga0495581_0018810 3300047315 Bacteria 4010
712 Ga0495604_0000001 3300047317 Bacteria 708627
713 Ga0495604_0003884 3300047317 Bacteria 11896
714 Ga0495604_0173303 3300047317 Bacteria 1515
715 Ga0495674_0000018 3300047319 Bacteria 204024
716 Ga0495674_0001596 3300047319 Bacteria 22233
717 Ga0495674_0006703 3300047319 Bacteria 11034
718 Ga0495674_0069384 3300047319 Bacteria 3048
719 Ga0495672_0033481 3300047320 Bacteria 3183
720 Ga0495672_0041858 3300047320 Bacteria 2767
721 Ga0495676_0004556 3300047321 Bacteria 12679
722 Ga0495676_0048763 3300047321 Bacteria 3411
723 Ga0495676_0069526 3300047321 Bacteria 2716
724 Ga0495680_0001109 3300047322 Bacteria 29730
725 Ga0495680_0010419 3300047322 Bacteria 8294
726 Ga0495683_0137760 3300047323 Bacteria 1146
727 Ga0495675_0003039 3300047444 Bacteria 10087
728 Ga0495675_0004157 3300047444 Bacteria 8756
729 Ga0495675_0075237 3300047444 Bacteria 2128
730 Ga0495679_040933 3300047446 Bacteria 1438
731 Ga0495685_049860 3300047447 Bacteria 1421
732 Ga0495684_0000010 3300047471 Bacteria 198915
733 Ga0495684_0007596 3300047471 Bacteria 8388
734 Ga0495684_0011645 3300047471 Bacteria 6790
735 Ga0495684_0027615 3300047471 Bacteria 4357
736 Ga0495684_0048735 3300047471 Bacteria 3238
737 Ga0495686_0000606 3300047472 Bacteria 49623
738 Ga0495593_0007996 3300047673 Bacteria 6157
739 Ga0495593_0048567 3300047673 Bacteria 2255
740 Ga0495593_0121493 3300047673 Bacteria 1329
741 Ga0495602_0013088 3300048088 Bacteria 8484
742 Ga0495602_0049699 3300048088 Bacteria 3754
743 Ga0495602_0284528 3300048088 Bacteria 1216
744 Ga0496100_0005463 3300048903 Bacteria 6850
745 Ga0496100_0023107 3300048903 Bacteria 3772
746 Ga0496100_0098803 3300048903 Bacteria 2007
747 Ga0496101_0001025 3300048904 Bacteria 16469
748 Ga0496101_0008677 3300048904 Bacteria 6646
749 Ga0496101_0020913 3300048904 Bacteria 4489
750 Ga0496101_0227973 3300048904 Bacteria 1447
751 Ga0496102_0001685 3300048905 Bacteria 19401
752 Ga0496102_0010694 3300048905 Bacteria 7904
753 Ga0496102_0041079 3300048905 Bacteria 4187
754 Ga0496102_0087737 3300048905 Bacteria 2874
755 Ga0496102_0151094 3300048905 Bacteria 2182
756 Ga0496103_0012080 3300048906 Bacteria 5130
757 Ga0496103_0045036 3300048906 Bacteria 2721
758 Ga0496103_0372135 3300048906 Bacteria 918
759 Ga0496104_0003048 3300048907 Bacteria 14438
760 Ga0496104_0012586 3300048907 Bacteria 7613
761 Ga0496104_0020110 3300048907 Bacteria 6117
762 Ga0496104_0125825 3300048907 Bacteria 2461
763 Ga0496104_0235547 3300048907 Bacteria 1742
764 Ga0496104_0307706 3300048907 Bacteria 1497
765 Ga0496104_0427971 3300048907 Bacteria 1235
766 Ga0496104_0504321 3300048907 Bacteria 1121
767 Ga0496105_0005567 3300048908 Bacteria 9565
768 Ga0496105_0005922 3300048908 Bacteria 9329
769 Ga0496105_0011176 3300048908 Bacteria 7082
770 Ga0496105_0050257 3300048908 Bacteria 3444
771 Ga0496105_0060568 3300048908 Bacteria 3123
772 Ga0496105_0092139 3300048908 Bacteria 2502
773 Ga0496105_0129449 3300048908 Bacteria 2081
774 Ga0496105_0136590 3300048908 Bacteria 2020
775 Ga0496106_0010565 3300048909 Bacteria 6819
776 Ga0496106_0023192 3300048909 Bacteria 4610
777 Ga0496106_0051071 3300048909 Bacteria 3117
778 Ga0496106_0177004 3300048909 Bacteria 1692
779 Ga0496106_0286611 3300048909 Bacteria 1320
780 Ga0496107_0007469 3300048910 Bacteria 7535
781 Ga0496107_0015009 3300048910 Bacteria 5425
782 Ga0496108_0002364 3300048911 Bacteria 15107
783 Ga0496108_0029304 3300048911 Bacteria 4556
784 Ga0496108_0050992 3300048911 Bacteria 3466
785 Ga0496108_0079831 3300048911 Bacteria 2770
786 Ga0496108_0169416 3300048911 Bacteria 1889
787 Ga0496109_0001638 3300048912 Bacteria 18700
788 Ga0496109_0002461 3300048912 Bacteria 15523
789 Ga0496109_0011159 3300048912 Bacteria 7707
790 Ga0496109_0029136 3300048912 Bacteria 4942
791 Ga0496109_0051551 3300048912 Bacteria 3748
792 Ga0496109_0105357 3300048912 Bacteria 2619
793 Ga0496109_0373964 3300048912 Bacteria 1346
794 Ga0496110_0003528 3300048913 Bacteria 12009
795 Ga0496110_0011641 3300048913 Bacteria 7212
796 Ga0496110_0037760 3300048913 Bacteria 4199
797 Ga0496110_0144854 3300048913 Bacteria 2148
798 Ga0496110_0179453 3300048913 Bacteria 1922
799 Ga0496111_0003518 3300048914 Bacteria 9693
800 Ga0496111_0005819 3300048914 Bacteria 7950
801 Ga0496111_0017449 3300048914 Bacteria 4963
802 Ga0496111_0018422 3300048914 Bacteria 4838
803 Ga0496111_0027735 3300048914 Bacteria 4009
804 Ga0496111_0147169 3300048914 Bacteria 1746
805 Ga0496111_0265230 3300048914 Bacteria 1274
806 Ga0496112_0037915 3300048915 Bacteria 4707
807 Ga0496112_0039123 3300048915 Bacteria 4632
808 Ga0496112_0067536 3300048915 Bacteria 3529
809 Ga0496112_0122371 3300048915 Bacteria 2572
810 Ga0496112_0135215 3300048915 Bacteria 2436
811 Ga0496112_0154557 3300048915 Bacteria 2261
812 Ga0496112_0157700 3300048915 Bacteria 2236
813 Ga0496112_0355360 3300048915 Bacteria 1407
814 Ga0496112_0366697 3300048915 Bacteria 1382
815 Ga0496113_0000175 3300048916 Bacteria 28436
816 Ga0496113_0001647 3300048916 Bacteria 12592
817 Ga0496113_0030542 3300048916 Bacteria 3901
818 Ga0496113_0030825 3300048916 Bacteria 3886
819 Ga0496113_0337568 3300048916 Unclassified 1208
820 Ga0496114_0027134 3300048917 Bacteria 4690
821 Ga0496114_0057372 3300048917 Bacteria 3251
822 Ga0496114_0085526 3300048917 Bacteria 2671
823 Ga0496115_0023215 3300048918 Bacteria 4813
824 Ga0496115_0084063 3300048918 Bacteria 2595
825 Ga0496115_0159650 3300048918 Bacteria 1863
826 Ga0496115_0235455 3300048918 Bacteria 1509
827 Ga0496117_0022967 3300048920 Bacteria 4989
828 Ga0496117_0087606 3300048920 Bacteria 2017
829 Ga0496118_0027984 3300048921 Bacteria 4759
830 Ga0496118_0037082 3300048921 Bacteria 3929
831 Ga0496118_0048685 3300048921 Bacteria 3269
832 Ga0496121_0009918 3300048924 Bacteria 10841
833 Ga0496124_0006822 3300048927 Bacteria 12323
834 Ga0496124_0191576 3300048927 Bacteria 1564
835 Ga0496126_0035095 3300048929 Bacteria 4703
836 Ga0496126_0039717 3300048929 Bacteria 4365
837 Ga0501294_004642 3300049517 Bacteria 1295
838 Ga0501031_0001402 3300049568 Bacteria 14899
839 Ga0501033_0017562 3300049570 Bacteria 5405
840 Ga0501034_0218199 3300049571 Bacteria 1860
841 Ga0501036_0009279 3300049572 Bacteria 8085
842 Ga0501036_0022892 3300049572 Bacteria 5260
843 Ga0501038_0030524 3300049574 Bacteria 4768
844 Ga0501038_0142363 3300049574 Bacteria 1961
845 Ga0501039_0001656 3300049575 Bacteria 16415
846 Ga0501039_0019439 3300049575 Bacteria 5208
847 Ga0501040_0055715 3300049576 Bacteria 2712
848 Ga0501041_0000600 3300049577 Bacteria 18846
849 Ga0501041_0009888 3300049577 Bacteria 5617
850 Ga0501041_0047078 3300049577 Bacteria 2625
851 Ga0501042_0004577 3300049578 Bacteria 8827
852 Ga0501042_0044082 3300049578 Bacteria 3178
853 Ga0501043_0027712 3300049579 Bacteria 4447
854 Ga0501043_0041339 3300049579 Bacteria 3622
855 Ga0501046_0000126 3300049580 Bacteria 81334
856 Ga0501046_0001057 3300049580 Bacteria 26945
857 Ga0501046_0363357 3300049580 Bacteria 1049
858 Ga0501047_0000160 3300049581 Bacteria 81946
859 Ga0501047_0332725 3300049581 Bacteria 1357
860 Ga0501048_0000040 3300049582 Bacteria 63031
861 Ga0501048_0011924 3300049582 Bacteria 6480
862 Ga0501048_0028075 3300049582 Bacteria 4086
863 Ga0501048_0184491 3300049582 Bacteria 1479
864 Ga0501069_0012334 3300049585 Bacteria 4541
865 Ga0501070_0104679 3300049586 Bacteria 2339
866 Ga0501070_0242388 3300049586 Bacteria 1475
867 Ga0501071_0044976 3300049587 Bacteria 3168
868 Ga0501071_0051424 3300049587 Bacteria 2969
869 Ga0501071_0344170 3300049587 Bacteria 1134
870 Ga0501072_0001862 3300049588 Bacteria 15708
871 Ga0501072_0016678 3300049588 Bacteria 5643
872 Ga0501072_0025063 3300049588 Bacteria 4644
873 Ga0501072_0280682 3300049588 Bacteria 1325
874 Ga0501073_0111896 3300049589 Bacteria 1894
875 Ga0501074_0013084 3300049590 Bacteria 6031
876 Ga0501074_0025976 3300049590 Bacteria 4247
877 Ga0501075_0003996 3300049591 Bacteria 9947
878 Ga0501075_0069220 3300049591 Bacteria 2667
879 Ga0501076_0000348 3300049592 Bacteria 28519
880 Ga0501076_0018281 3300049592 Bacteria 5341
881 Ga0501076_0031097 3300049592 Bacteria 4162
882 Ga0501076_0152057 3300049592 Bacteria 1883
883 Ga0501225_0008565 3300049705 Bacteria 2931
884 Ga0501079_0000859 3300049741 Bacteria 20782
885 Ga0501079_0125204 3300049741 Bacteria 1999
886 Ga0501080_0066965 3300049742 Bacteria 3340
887 Ga0501081_0000131 3300049743 Bacteria 33122
888 Ga0501081_0018251 3300049743 Bacteria 4657
889 Ga0501081_0089723 3300049743 Bacteria 2160
890 Ga0501083_0062007 3300049744 Bacteria 2496
891 Ga0501272_006773 3300049769 Bacteria 1230
892 Ga0501035_0379950 3300049822 Bacteria 1178
893 Ga0501044_0000743 3300049823 Bacteria 39318
894 Ga0501044_0139155 3300049823 Bacteria 2416
895 Ga0501044_0289665 3300049823 Bacteria 1569
896 Ga0501045_0004944 3300049824 Bacteria 9234
897 Ga0501045_0014083 3300049824 Bacteria 5663
898 Ga0501045_0018427 3300049824 Bacteria 4965
899 Ga0501045_0083981 3300049824 Bacteria 2349
900 nmdc:mga03683_20525_c1 3300050489 Bacteria 2536
901 nmdc:mga00v17_107895_c1 3300050491 Bacteria 1764
902 nmdc:mga00v17_188780_c1 3300050491 Bacteria 1331
903 nmdc:mga0k408_12633_c1 3300050493 Bacteria 4616
904 nmdc:mga0k408_2138_c1 3300050493 Bacteria 10590
905 nmdc:mga0k408_23217_c1 3300050493 Bacteria 3497
906 nmdc:mga06z11_104161_c1 3300050494 Bacteria 1562
907 nmdc:mga06z11_148497_c1 3300050494 Bacteria 1331
908 nmdc:mga07m45_64254_c1 3300050496 Bacteria 2082
909 nmdc:mga07m45_97530_c1 3300050496 Bacteria 1687
910 nmdc:mga05p37_132_c1 3300050507 Bacteria 68371
911 nmdc:mga05p37_261301_c1 3300050507 Bacteria 2072
912 nmdc:mga05p37_673219_c1 3300050507 Bacteria 1155
913 nmdc:mga09592_418_c1 3300050508 Bacteria 31192
914 nmdc:mga08y16_108320_c1 3300050511 Bacteria 2892
915 nmdc:mga08y16_425018_c1 3300050511 Bacteria 1357
916 nmdc:mga08y16_9476_c1 3300050511 Bacteria 10220
917 nmdc:mga0n895_109188_c1 3300050512 Bacteria 2782
918 nmdc:mga0n895_252410_c1 3300050512 Bacteria 1790
919 nmdc:mga0n895_290807_c1 3300050512 Bacteria 1657
920 nmdc:mga0n895_40845_c1 3300050512 Bacteria 4507
921 nmdc:mga0n895_468_c1 3300050512 Bacteria 27132
922 nmdc:mga0n895_93917_c1 3300050512 Bacteria 3003
923 nmdc:mga0rr50_145_c1 3300050513 Bacteria 39313
924 nmdc:mga0rr50_89121_c1 3300050513 Bacteria 2398
925 nmdc:mga08x19_14066_c1 3300050514 Bacteria 4849
926 nmdc:mga08x19_522_c1 3300050514 Bacteria 25573
927 nmdc:mga0a205_11596_c1 3300050515 Bacteria 8121
928 nmdc:mga0a205_54289_c1 3300050515 Bacteria 3868
929 nmdc:mga0sz30_20124_c1 3300050516 Bacteria 2690
930 nmdc:mga0sz30_60152_c1 3300050516 Bacteria 1140
931 Ga0495601_0000001 3300053077 Bacteria 549454
932 Ga0495601_0000243 3300053077 Bacteria 29083
933 Ga0495601_0016790 3300053077 Bacteria 4439
934 Ga0495601_0022082 3300053077 Bacteria 3905
935 Ga0495601_0025060 3300053077 Bacteria 3676
936 Ga0495601_0152994 3300053077 Bacteria 1506
937 Ga0495601_0164211 3300053077 Bacteria 1451
938 Ga0495612_0000063 3300053078 Bacteria 48104
939 Ga0495612_0001332 3300053078 Bacteria 10178
940 Ga0495612_0006769 3300053078 Bacteria 4694
941 Ga0495612_0009391 3300053078 Bacteria 3969
942 Ga0495595_0002319 3300053084 Bacteria 7421
943 Ga0495595_0046083 3300053084 Bacteria 2007
944 Ga0495619_0000004 3300053085 Bacteria 500068
945 Ga0495619_0004170 3300053085 Bacteria 9234
946 Ga0495619_0112964 3300053085 Bacteria 1857
947 Ga0500578_0178410 3300053086 Bacteria 1310
948 Ga0500643_063804 3300053087 Bacteria 1030
949 Ga0500583_0164039 3300053092 Bacteria 1107
950 Ga0500641_0003400 3300053096 Bacteria 5626
951 Ga0500555_000886 3300053103 Bacteria 10651
952 Ga0500595_016248 3300053119 Bacteria 2776
953 Ga0500652_000023 3300053131 Bacteria 116316
954 Ga0501084_0064199 3300054114 Bacteria 3073
955 Ga0501084_0071132 3300054114 Bacteria 2913
956 Ga0501084_0090900 3300054114 Bacteria 2563
957 Ga0501084_0159463 3300054114 Bacteria 1903
958 Ga0501084_0479070 3300054114 Bacteria 1052
959 Ga0590071_008354 3300059421 Bacteria 2440
960 Ga0501082_0000205 3300060353 Bacteria 51540
961 Ga0501082_0008926 3300060353 Bacteria 8651
962 Ga0501082_0025577 3300060353 Bacteria 5087
963 Ga0501082_0144096 3300060353 Bacteria 2068
964 Ga0530510_0000425 3300061734 Bacteria 27205
965 Ga0530510_0057591 3300061734 Bacteria 2808
966 2842719397 2842718218 Bacteria 4560148
967 2904482832 2904479285 Bacteria 5073931
968 2928117050 2928115317 Bacteria 6477646
969 2935393018 2935390628 Bacteria 7043367
970 2974321326 2974320154 Bacteria 4571377
971 2997605428 2997600082 Bacteria 9896405
972 Ga0373936_0006658
973 SwRhRL2b_contig_2628462
974 SwRhRL2b_contig_58648
975 JGI24746J21847_1002925
976 JGI24743J22301_10008228
977 JGI24738J21930_10002238
978 JGI24034J26672_10016529
979 JGI25406J46586_10019988
980 JGI25153J46596_10001063
981 rootL2_10020853
982 JGI25405J52794_10017961
983 Ga0055543_1018963
984 Ga0065704_10113311
985 Ga0065715_10280549
986 Ga0065707_10099655
987 Ga0065707_10133474
988 Ga0065707_10153752
989 Ga0070658_10000534
990 Ga0070676_10154994
991 Ga0070690_100000216
992 Ga0070690_100012374
993 Ga0070690_100068462
994 Ga0070690_100373498
995 Ga0070670_100081469
996 Ga0070670_100098177
997 Ga0070670_100153016
998 Ga0070677_10007082
999 Ga0070677_10023218
1000 Ga0068869_100000759
1001 Ga0068869_100242126
1002 Ga0070666_10010599
1003 Ga0070666_10064004
1004 Ga0070666_10114932
1005 Ga0070680_100003121
1006 Ga0070680_100006895
1007 Ga0070680_100008902
1008 Ga0070682_100004786
1009 Ga0068868_100004312
1010 Ga0068868_100005010
1011 Ga0068868_100051086
1012 Ga0070660_100138867
1013 Ga0070689_100000399
1014 Ga0070689_100006563
1015 Ga0070689_100053981
1016 Ga0070689_100148812
1017 Ga0070691_10000528
1018 Ga0070691_10062583
1019 Ga0070687_100000604
1020 Ga0070692_10002623
1021 Ga0070692_10057329
1022 Ga0070668_100213743
1023 Ga0070669_100013431
1024 Ga0070669_100085688
1025 Ga0070675_100011655
1026 Ga0070675_100076146
1027 Ga0070675_100141421
1028 Ga0070671_100001928
1029 Ga0070671_100019910
1030 Ga0070671_100023857
1031 Ga0070671_100054746
1032 Ga0070674_100000456
1033 Ga0070674_100159480
1034 Ga0070673_100026117
1035 Ga0070673_100066945
1036 Ga0070673_100145316
1037 Ga0070688_100022931
1038 Ga0070667_100012483
1039 Ga0070667_100027609
1040 Ga0070714_100007015
1041 Ga0070714_100021227
1042 Ga0070714_100186416
1043 Ga0070714_100346423
1044 Ga0070713_100005924
1045 Ga0070713_100043906
1046 Ga0070713_100321600
1047 Ga0070710_10005399
1048 Ga0070701_10129194
1049 Ga0070701_10227212
1050 Ga0070711_100010002
1051 Ga0070711_100023557
1052 Ga0070711_100034687
1053 Ga0070711_100164991
1054 Ga0070711_100495344
1055 Ga0070705_100000554
1056 Ga0070705_100072555
1057 Ga0070705_100149842
1058 Ga0070705_100292763
1059 Ga0070700_100000281
1060 Ga0070700_100044716
1061 Ga0070694_100000565
1062 Ga0070694_100070278
1063 Ga0070678_100035789
1064 Ga0070678_100184370
1065 Ga0070678_100292960
1066 Ga0070681_10001127
1067 Ga0070681_10118881
1068 Ga0070681_10154948
1069 Ga0070681_10320812
1070 Ga0070681_10414014
1071 Ga0068867_100000206
1072 Ga0068867_100103433
1073 Ga0070685_10005577
1074 Ga0070685_10146707
1075 Ga0070706_100306244
1076 Ga0070707_100128303
1077 Ga0070707_100602851
1078 Ga0070698_100365274
1079 Ga0070699_100184203
1080 Ga0070699_100276236
1081 Ga0070679_100003183
1082 Ga0070679_100034844
1083 Ga0070679_100149712
1084 Ga0070697_100121192
1085 Ga0070697_100180798
1086 Ga0068853_100063354
1087 Ga0070672_100268961
1088 Ga0070672_100293793
1089 Ga0070672_100314723
1090 Ga0070686_100000711
1091 Ga0070695_100000281
1092 Ga0070696_100004140
1093 Ga0070696_100010174
1094 Ga0070693_100000162
1095 Ga0070693_100364173
1096 Ga0070665_100000011
1097 Ga0070665_100000169
1098 Ga0070665_100030114
1099 Ga0070665_100190176
1100 Ga0070704_100010913
1101 Ga0070704_100039001
1102 Ga0070704_100059317
1103 Ga0068855_100000265
1104 Ga0068855_100105928
1105 Ga0068855_100197575
1106 Ga0068857_100030804
1107 Ga0068856_100316903
1108 Ga0068856_100327474
1109 Ga0070702_100000093
1110 Ga0068859_100003739
1111 Ga0068859_100045750
1112 Ga0068859_100185952
1113 Ga0068859_100695399
1114 Ga0068864_100046863
1115 Ga0068866_10000256
1116 Ga0068861_100000355
1117 Ga0068870_10022034
1118 Ga0068870_10137642
1119 Ga0068863_100005225
1120 Ga0068863_100008798
1121 Ga0068863_100078963
1122 Ga0068863_100089193
1123 Ga0068863_100132536
1124 Ga0068858_100008078
1125 Ga0068858_100025135
1126 Ga0068860_100002594
1127 Ga0068860_100011906
1128 Ga0068860_100048947
1129 Ga0068860_100245021
1130 Ga0068860_100274649
1131 Ga0068862_100000381
1132 Ga0068862_100134173
1133 Ga0081455_10071704
1134 Ga0081538_10000697
1135 Ga0081538_10017125
1136 Ga0081540_1001984
1137 Ga0081540_1002003
1138 Ga0081540_1003649
1139 Ga0081540_1017724
1140 Ga0081540_1036127
1141 Ga0081540_1050173
1142 Ga0081539_10002187
1143 Ga0081539_10036902
1144 Ga0070717_10014290
1145 Ga0075363_100013539
1146 Ga0075364_10005843
1147 Ga0075364_10073975
1148 Ga0070715_10000633
1149 Ga0070715_10002046
1150 Ga0070715_10027128
1151 Ga0070716_100006982
1152 Ga0070716_100065105
1153 Ga0070716_100072447
1154 Ga0070712_100002594
1155 Ga0070712_100008343
1156 Ga0070712_100028995
1157 Ga0070712_100038140
1158 Ga0070712_100047227
1159 Ga0070712_100110880
1160 Ga0070712_100158867
1161 Ga0075362_10002160
1162 Ga0075362_10040981
1163 Ga0075367_10067123
1164 Ga0075367_10118426
1165 Ga0075369_10015935
1166 Ga0075366_10000931
1167 Ga0075366_10022054
1168 Ga0075366_10031321
1169 Ga0097621_100000303
1170 Ga0097621_100095350
1171 Ga0097621_100110302
1172 Ga0097621_100343669
1173 Ga0097621_100405247
1174 Ga0068871_100000925
1175 Ga0068871_100011094
1176 Ga0068871_100046071
1177 Ga0068871_100182244
1178 Ga0068871_100184289
1179 Ga0068871_100240442
1180 Ga0075428_100000083
1181 Ga0075428_100113402
1182 Ga0075428_100284076
1183 Ga0075430_100000163
1184 Ga0075430_100055653
1185 Ga0075431_100087790
1186 Ga0075433_10003177
1187 Ga0075434_100000064
1188 Ga0075434_100092271
1189 Ga0075429_100001065
1190 Ga0068865_100008534
1191 Ga0068865_100093321
1192 Ga0075436_100005135
1193 Ga0075436_100016682
1194 Ga0097620_100003738
1195 Ga0097620_100045750
1196 Ga0097620_100185959
1197 Ga0097620_100695358
1198 Ga0099826_10035411
1199 Ga0075435_100000586
1200 Ga0075435_100302692
1201 Ga0099795_10029911
1202 Ga0099795_10076325
1203 Ga0105251_10004488
1204 Ga0105240_10000369
1205 Ga0105245_10000696
1206 Ga0105245_10002702
1207 Ga0105245_10011796
1208 Ga0105245_10167384
1209 Ga0105247_10019849
1210 Ga0105247_10109570
1211 Ga0114129_10000210
1212 Ga0114129_10087181
1213 Ga0105243_10000631
1214 Ga0105243_10153892
1215 Ga0105243_10173670
1216 Ga0105243_10197316
1217 Ga0105242_10003476
1218 Ga0105242_10009816
1219 Ga0105242_10020603
1220 Ga0105242_10088017
1221 Ga0105248_10465993
1222 Ga0105237_10024199
1223 Ga0105237_10183495
1224 Ga0105237_10456475
1225 Ga0105249_10003937
1226 Ga0099796_10000419
1227 Ga0105239_10123372
1228 Ga0105239_10253032
1229 Ga0105246_10229808
1230 Ga0105246_10422784
1231 Ga0157370_10010690
1232 Ga0157369_10002769
1233 Ga0157369_10213752
1234 Ga0157369_10359901
1235 Ga0157374_10012098
1236 Ga0157378_10001488
1237 Ga0163162_10030087
1238 Ga0163162_10065362
1239 Ga0163162_10342000
1240 Ga0157372_10507890
1241 Ga0157375_10020483
1242 Ga0157375_10117196
1243 Ga0157375_10957914
1244 Ga0163163_10001830
1245 Ga0163163_10275912
1246 Ga0157380_10017000
1247 Ga0157380_10019019
1248 Ga0182008_10146347
1249 Ga0157379_10016937
1250 Ga0157376_10013769
1251 Ga0182007_10071314
1252 Ga0183362_10002
1253 Ga0163161_10238579
1254 Ga0163161_10291552
1255 Ga0206350_10617166
1256 Ga0206350_11377320
1257 Ga0213872_10000001
1258 Ga0213872_10009977
1259 Ga0213872_10039685
1260 Ga0213876_10024910
1261 Ga0213876_10102662
1262 Ga0213875_10036455
1263 Ga0228598_1002924
1264 Ga0209758_1000079
1265 Ga0207713_1002844
1266 Ga0207653_10008178
1267 Ga0207682_10000543
1268 Ga0207682_10003858
1269 Ga0207642_10095412
1270 Ga0207710_10013829
1271 Ga0207680_10015096
1272 Ga0207680_10177686
1273 Ga0207647_10057890
1274 Ga0207685_10004756
1275 Ga0207685_10021335
1276 Ga0207699_10012944
1277 Ga0207699_10029996
1278 Ga0207699_10235555
1279 Ga0207645_10025828
1280 Ga0207645_10027950
1281 Ga0207643_10001848
1282 Ga0207705_10002747
1283 Ga0207684_10011372
1284 Ga0207684_10195609
1285 Ga0207684_10274560
1286 Ga0207707_10006531
1287 Ga0207707_10062009
1288 Ga0207707_10116094
1289 Ga0207707_10217828
1290 Ga0207695_10014477
1291 Ga0207693_10000068
1292 Ga0207693_10000855
1293 Ga0207693_10007507
1294 Ga0207693_10023422
1295 Ga0207693_10101537
1296 Ga0207663_10007458
1297 Ga0207660_10003314
1298 Ga0207660_10010746
1299 Ga0207662_10000257
1300 Ga0207662_10009537
1301 Ga0207657_10182571
1302 Ga0207652_10014091
1303 Ga0207652_10054007
1304 Ga0207652_10111925
1305 Ga0207652_10112577
1306 Ga0207652_10258852
1307 Ga0207646_10108859
1308 Ga0207681_10034479
1309 Ga0207681_10062274
1310 Ga0207650_10030542
1311 Ga0207650_10068465
1312 Ga0207650_10091002
1313 Ga0207659_10125838
1314 Ga0207659_10142786
1315 Ga0207659_10182438
1316 Ga0207659_10365432
1317 Ga0207659_10366032
1318 Ga0207687_10002535
1319 Ga0207687_10062110
1320 Ga0207687_10279310
1321 Ga0207700_10050072
1322 Ga0207700_10073659
1323 Ga0207700_10127448
1324 Ga0207700_10252912
1325 Ga0207700_10315408
1326 Ga0207664_10040999
1327 Ga0207664_10201736
1328 Ga0207664_10229820
1329 Ga0207644_10000409
1330 Ga0207644_10016411
1331 Ga0207644_10031985
1332 Ga0207644_10276929
1333 Ga0207706_10038152
1334 Ga0207706_10121373
1335 Ga0207686_10014985
1336 Ga0207709_10000662
1337 Ga0207709_10145655
1338 Ga0207670_10000333
1339 Ga0207670_10002665
1340 Ga0207670_10004310
1341 Ga0207670_10020940
1342 Ga0207670_10205270
1343 Ga0207669_10030218
1344 Ga0207669_10134855
1345 Ga0207669_10210730
1346 Ga0207704_10000798
1347 Ga0207704_10010936
1348 Ga0207704_10206684
1349 Ga0207704_10242318
1350 Ga0207665_10003244
1351 Ga0207665_10023145
1352 Ga0207665_10037567
1353 Ga0207691_10020089
1354 Ga0207691_10044610
1355 Ga0207691_10161849
1356 Ga0207711_10014397
1357 Ga0207711_10055281
1358 Ga0207711_10062514
1359 Ga0207711_10141067
1360 Ga0207689_10001220
1361 Ga0207689_10014839
1362 Ga0207689_10119685
1363 Ga0207689_10128018
1364 Ga0207689_10157051
1365 Ga0207679_10207272
1366 Ga0207667_10000029
1367 Ga0207667_10011463
1368 Ga0207667_10012740
1369 Ga0207651_10009279
1370 Ga0207651_10178410
1371 Ga0207712_10048334
1372 Ga0207668_10017068
1373 Ga0207668_10405555
1374 Ga0207640_10004352
1375 Ga0207658_10019851
1376 Ga0207658_10312615
1377 Ga0207677_10049518
1378 Ga0207678_10002574
1379 Ga0207708_10000993
1380 Ga0207708_10008364
1381 Ga0207708_10015584
1382 Ga0207702_10040209
1383 Ga0207702_10176628
1384 Ga0207702_10210465
1385 Ga0207702_10300355
1386 Ga0207641_10066100
1387 Ga0207641_10172491
1388 Ga0207648_10000840
1389 Ga0207648_10001304
1390 Ga0207648_10051080
1391 Ga0207676_10018327
1392 Ga0207676_10441243
1393 Ga0207674_10067184
1394 Ga0207674_10187815
1395 Ga0207675_100000900
1396 Ga0207675_100002492
1397 Ga0207675_100152416
1398 Ga0207675_100182211
1399 Ga0207683_10002913
1400 Ga0207683_10015669
1401 Ga0207683_10242126
1402 Ga0207683_10353005
1403 Ga0207698_10169618
1404 Ga0209969_1002388
1405 Ga0209967_1007468
1406 Ga0209179_1014773
1407 Ga0209968_1005378
1408 Ga0209999_1000224
1409 Ga0207428_10000321
1410 Ga0207428_10046915
1411 Ga0265357_1005616
1412 Ga0268266_10000063
1413 Ga0268266_10001173
1414 Ga0268265_10005803
1415 Ga0268265_10241621
1416 Ga0268265_10388220
1417 Ga0268264_10003658
1418 Ga0268264_10023040
1419 Ga0268264_10169224
1420 Ga0265337_1001602
1421 Ga0265334_10000375
1422 Ga0307515_10000292
1423 Ga0265338_10017937
1424 Ga0265760_10022541
1425 Ga0265330_10025350
1426 Ga0265332_10090049
1427 Ga0265320_10064213
1428 Ga0265325_10000649
1429 Ga0265325_10086558
1430 Ga0265325_10093049
1431 Ga0265329_10006400
1432 Ga0265340_10058038
1433 Ga0265340_10075674
1434 Ga0265340_10114843
1435 Ga0265339_10000269
1436 Ga0265339_10036335
1437 Ga0265316_10183496
1438 Ga0307408_100070914
1439 Ga0265313_10022761
1440 Ga0307508_10089616
1441 Ga0265314_10038574
1442 Ga0265314_10043616
1443 Ga0265342_10043768
1444 Ga0307405_10012768
1445 Ga0307413_10001952
1446 Ga0307406_10004403
1447 Ga0307407_10013466
1448 Ga0307412_10007438
1449 Ga0307414_10227671
1450 Ga0307411_10003851
1451 Ga0307415_100005865
1452 Ga0316583_10005706
1453 Ga0373930_0015062
1454 Ga0373926_0003071
1455 Ga0373926_0016641
1456 Ga0373928_0004469
1457 Ga0373929_0012853
1458 Ga0373940_0019433
1459 Ga0373944_0018964
1460 Ga0373944_0036368
1461 Ga0373944_0103233
1462 Ga0373951_0005912
1463 Ga0373952_0003713
1464 Ga0373932_0001983
1465 Ga0373936_0029845
1466 Ga0373945_0000969
1467 Ga0373945_0003484
1468 Ga0373945_0006884
1469 Ga0373953_0020708
1470 Ga0373954_0032131
1471 Ga0373954_0056964
1472 Ga0373954_0125623
1473 Ga0373956_0026912
1474 Ga0373957_0037722
1475 Ga0373960_0033881
1476 Ga0373943_0000185
1477 Ga0373943_0014863
1478 Ga0373943_0083775
1479 Ga0373943_0152461
1480 Ga0373946_0000642
1481 Ga0373946_0174843
1482 Ga0373955_0001304
1483 Ga0373955_0002912
1484 Ga0373955_0003944
1485 Ga0373955_0068444
1486 Ga0373961_0006705
1487 Ga0373962_0012148
1488 Ga0373962_0019134
1489 Ga0373924_0008512
1490 Ga0373924_0020013
1491 Ga0373931_0000134
1492 Ga0373931_0054056
1493 Ga0373931_0140963
1494 Ga0373931_0179923
1495 Ga0373935_0000023
1496 Ga0373935_0010837
1497 Ga0373935_0039428
1498 Ga0373935_0124974
1499 Ga0373935_0163631
1500 Ga0373935_0176776
1501 Ga0373927_0000434
1502 Ga0373927_0013020
1503 Ga0373927_0020220
1504 Ga0373927_0041756
1505 Ga0373927_0051817
1506 Ga0373927_0070058
1507 Ga0373927_0072642
1508 Ga0373933_0001503
1509 Ga0373933_0006249
1510 Ga0373933_0011490
1511 Ga0373947_0000583
1512 Ga0373947_0017670
1513 Ga0373947_0070482
1514 Ga0373947_0208520
1515 Ga0373947_0213124
1516 Ga0373937_0000005
1517 Ga0373937_0003414
1518 Ga0373937_0008905
1519 Ga0373937_0009993
1520 Ga0373937_0010352
1521 Ga0373937_0091795
1522 Ga0373925_0000007
1523 Ga0373925_0000749
1524 Ga0373925_0030549
1525 Ga0373925_0104188
1526 Ga0373925_0107062
1527 Ga0373925_0132701
1528 Ga0373925_0330088
1529 Ga0395898_0152595
1530 Ga0395898_0182889
1531 Ga0436364_0611812
1532 Ga0436364_1488218
1533 Ga0436365_0053879
1534 Ga0436365_0072895
1535 Ga0436365_0120456
1536 Ga0436365_0395269
1537 Ga0436365_1548351
1538 Ga0436365_1582443
1539 Ga0436365_1849126
1540 Ga0436360_0157058
1541 Ga0436360_0793447
1542 Ga0436360_1115848
1543 Ga0436361_0028664
1544 Ga0436361_0081134
1545 Ga0436361_0200590
1546 Ga0436361_0328438
1547 Ga0436361_0340102
1548 Ga0436363_0460787
1549 Ga0436363_1144933
1550 Ga0436362_0233360
1551 Ga0436362_0463249
1552 Ga0436362_0742152
1553 Ga0436362_0992192
1554 Ga0436362_1187034
1555 Ga0451807_0095181
1556 Ga0439434_0000107
1557 Ga0439434_0027711
1558 Ga0439435_0000076
1559 Ga0451577_0000863
1560 Ga0451577_0100523
1561 Ga0466963_0016237
1562 Ga0466957_0067767
1563 Ga0466959_0064196
1564 Ga0451576_0001387
1565 Ga0466958_0000079
1566 Ga0495627_051507
1567 Ga0495592_0007203
1568 Ga0495592_0021131
1569 Ga0495592_0034241
1570 Ga0495592_0038795
1571 Ga0495592_0072080
1572 Ga0495592_0231287
1573 Ga0495603_0025282
1574 Ga0495603_0237504
1575 Ga0495629_0012162
1576 Ga0495629_0017119
1577 Ga0495629_0153118
1578 Ga0495638_0008417
1579 Ga0495638_0040866
1580 Ga0495641_0020520
1581 Ga0495651_0001105
1582 Ga0495651_0007669
1583 Ga0495651_0050378
1584 Ga0495653_0000308
1585 Ga0495653_0001999
1586 Ga0495580_0001449
1587 Ga0495580_0058208
1588 Ga0495580_0110115
1589 Ga0495580_0139388
1590 Ga0495580_0189984
1591 Ga0495639_0013308
1592 Ga0495662_0008076
1593 Ga0495662_0010733
1594 Ga0495662_0054256
1595 Ga0495664_0000003
1596 Ga0495664_0001762
1597 Ga0495584_0164884
1598 Ga0495583_0000840
1599 Ga0495606_0003584
1600 Ga0495608_0000072
1601 Ga0495608_0001418
1602 Ga0495618_0000019
1603 Ga0495618_0003872
1604 Ga0495618_0017589
1605 Ga0495628_0000015
1606 Ga0495628_0104293
1607 Ga0495628_0198013
1608 Ga0495630_0027301
1609 Ga0495630_0029121
1610 Ga0495630_0142109
1611 Ga0495663_0017948
1612 Ga0495666_0040519
1613 Ga0495666_0110666
1614 Ga0495652_0000006
1615 Ga0495652_0024988
1616 Ga0495665_0013808
1617 Ga0495665_0039593
1618 Ga0495640_0000002
1619 Ga0495640_0007626
1620 Ga0495640_0007854
1621 Ga0495640_0036736
1622 Ga0495640_0063367
1623 Ga0495640_0232222
1624 Ga0495586_0001019
1625 Ga0495587_0000001
1626 Ga0495587_0000718
1627 Ga0495587_0211790
1628 Ga0495598_0029042
1629 Ga0495621_0053406
1630 Ga0495645_0002525
1631 Ga0495645_0010377
1632 Ga0495645_0061883
1633 Ga0495667_0000021
1634 Ga0495667_0015887
1635 Ga0495667_0047937
1636 Ga0495667_0069839
1637 Ga0495667_0247884
1638 Ga0495656_0011244
1639 Ga0495656_0122948
1640 Ga0495668_0188938
1641 Ga0495634_0000251
1642 Ga0495634_0004679
1643 Ga0495634_0005356
1644 Ga0495634_0008363
1645 Ga0495634_0031218
1646 Ga0495634_0147046
1647 Ga0495625_0073164
1648 Ga0495635_0000001
1649 Ga0495635_0013586
1650 Ga0495635_0309483
1651 Ga0495588_0014197
1652 Ga0495657_0000486
1653 Ga0495657_0004121
1654 Ga0495657_0094272
1655 Ga0495599_0000203
1656 Ga0495599_0061678
1657 Ga0495599_0121767
1658 Ga0495623_0000058
1659 Ga0495623_0014685
1660 Ga0495623_0040238
1661 Ga0495646_0000003
1662 Ga0495646_0118020
1663 Ga0495647_0002041
1664 Ga0495647_0019408
1665 Ga0495647_0061291
1666 Ga0495647_0063946
1667 Ga0495658_0006634
1668 Ga0495658_0021666
1669 Ga0495613_0032385
1670 Ga0495613_0044368
1671 Ga0495613_0270040
1672 Ga0495624_0019722
1673 Ga0495624_0043998
1674 Ga0495624_0066538
1675 Ga0495624_0110338
1676 Ga0495624_0226103
1677 Ga0495670_0078096
1678 Ga0495670_0089661
1679 Ga0495600_0000002
1680 Ga0495600_0006243
1681 Ga0495600_0071440
1682 Ga0495581_0018810
1683 Ga0495604_0000001
1684 Ga0495604_0003884
1685 Ga0495604_0173303
1686 Ga0495674_0000018
1687 Ga0495674_0001596
1688 Ga0495674_0006703
1689 Ga0495674_0069384
1690 Ga0495672_0033481
1691 Ga0495672_0041858
1692 Ga0495676_0004556
1693 Ga0495676_0048763
1694 Ga0495676_0069526
1695 Ga0495680_0001109
1696 Ga0495680_0010419
1697 Ga0495683_0137760
1698 Ga0495675_0003039
1699 Ga0495675_0004157
1700 Ga0495675_0075237
1701 Ga0495679_040933
1702 Ga0495685_049860
1703 Ga0495684_0000010
1704 Ga0495684_0007596
1705 Ga0495684_0011645
1706 Ga0495684_0027615
1707 Ga0495684_0048735
1708 Ga0495686_0000606
1709 Ga0495593_0007996
1710 Ga0495593_0048567
1711 Ga0495593_0121493
1712 Ga0495602_0013088
1713 Ga0495602_0049699
1714 Ga0495602_0284528
1715 Ga0496100_0005463
1716 Ga0496100_0023107
1717 Ga0496100_0098803
1718 Ga0496101_0001025
1719 Ga0496101_0008677
1720 Ga0496101_0020913
1721 Ga0496101_0227973
1722 Ga0496102_0001685
1723 Ga0496102_0010694
1724 Ga0496102_0041079
1725 Ga0496102_0087737
1726 Ga0496102_0151094
1727 Ga0496103_0012080
1728 Ga0496103_0045036
1729 Ga0496103_0372135
1730 Ga0496104_0003048
1731 Ga0496104_0012586
1732 Ga0496104_0020110
1733 Ga0496104_0125825
1734 Ga0496104_0235547
1735 Ga0496104_0307706
1736 Ga0496104_0427971
1737 Ga0496104_0504321
1738 Ga0496105_0005567
1739 Ga0496105_0005922
1740 Ga0496105_0011176
1741 Ga0496105_0050257
1742 Ga0496105_0060568
1743 Ga0496105_0092139
1744 Ga0496105_0129449
1745 Ga0496105_0136590
1746 Ga0496106_0010565
1747 Ga0496106_0023192
1748 Ga0496106_0051071
1749 Ga0496106_0177004
1750 Ga0496106_0286611
1751 Ga0496107_0007469
1752 Ga0496107_0015009
1753 Ga0496108_0002364
1754 Ga0496108_0029304
1755 Ga0496108_0050992
1756 Ga0496108_0079831
1757 Ga0496108_0169416
1758 Ga0496109_0001638
1759 Ga0496109_0002461
1760 Ga0496109_0011159
1761 Ga0496109_0029136
1762 Ga0496109_0051551
1763 Ga0496109_0105357
1764 Ga0496109_0373964
1765 Ga0496110_0003528
1766 Ga0496110_0011641
1767 Ga0496110_0037760
1768 Ga0496110_0144854
1769 Ga0496110_0179453
1770 Ga0496111_0003518
1771 Ga0496111_0005819
1772 Ga0496111_0017449
1773 Ga0496111_0018422
1774 Ga0496111_0027735
1775 Ga0496111_0147169
1776 Ga0496111_0265230
1777 Ga0496112_0037915
1778 Ga0496112_0039123
1779 Ga0496112_0067536
1780 Ga0496112_0122371
1781 Ga0496112_0135215
1782 Ga0496112_0154557
1783 Ga0496112_0157700
1784 Ga0496112_0355360
1785 Ga0496112_0366697
1786 Ga0496113_0000175
1787 Ga0496113_0001647
1788 Ga0496113_0030542
1789 Ga0496113_0030825
1790 Ga0496113_0337568
1791 Ga0496114_0027134
1792 Ga0496114_0057372
1793 Ga0496114_0085526
1794 Ga0496115_0023215
1795 Ga0496115_0084063
1796 Ga0496115_0159650
1797 Ga0496115_0235455
1798 Ga0496117_0022967
1799 Ga0496117_0087606
1800 Ga0496118_0027984
1801 Ga0496118_0037082
1802 Ga0496118_0048685
1803 Ga0496121_0009918
1804 Ga0496124_0006822
1805 Ga0496124_0191576
1806 Ga0496126_0035095
1807 Ga0496126_0039717
1808 Ga0501294_004642
1809 Ga0501031_0001402
1810 Ga0501033_0017562
1811 Ga0501034_0218199
1812 Ga0501036_0009279
1813 Ga0501036_0022892
1814 Ga0501038_0030524
1815 Ga0501038_0142363
1816 Ga0501039_0001656
1817 Ga0501039_0019439
1818 Ga0501040_0055715
1819 Ga0501041_0000600
1820 Ga0501041_0009888
1821 Ga0501041_0047078
1822 Ga0501042_0004577
1823 Ga0501042_0044082
1824 Ga0501043_0027712
1825 Ga0501043_0041339
1826 Ga0501046_0000126
1827 Ga0501046_0001057
1828 Ga0501046_0363357
1829 Ga0501047_0000160
1830 Ga0501047_0332725
1831 Ga0501048_0000040
1832 Ga0501048_0011924
1833 Ga0501048_0028075
1834 Ga0501048_0184491
1835 Ga0501069_0012334
1836 Ga0501070_0104679
1837 Ga0501070_0242388
1838 Ga0501071_0044976
1839 Ga0501071_0051424
1840 Ga0501071_0344170
1841 Ga0501072_0001862
1842 Ga0501072_0016678
1843 Ga0501072_0025063
1844 Ga0501072_0280682
1845 Ga0501073_0111896
1846 Ga0501074_0013084
1847 Ga0501074_0025976
1848 Ga0501075_0003996
1849 Ga0501075_0069220
1850 Ga0501076_0000348
1851 Ga0501076_0018281
1852 Ga0501076_0031097
1853 Ga0501076_0152057
1854 Ga0501225_0008565
1855 Ga0501079_0000859
1856 Ga0501079_0125204
1857 Ga0501080_0066965
1858 Ga0501081_0000131
1859 Ga0501081_0018251
1860 Ga0501081_0089723
1861 Ga0501083_0062007
1862 Ga0501272_006773
1863 Ga0501035_0379950
1864 Ga0501044_0000743
1865 Ga0501044_0139155
1866 Ga0501044_0289665
1867 Ga0501045_0004944
1868 Ga0501045_0014083
1869 Ga0501045_0018427
1870 Ga0501045_0083981
1871 nmdc:mga03683_20525_c1
1872 nmdc:mga00v17_107895_c1
1873 nmdc:mga00v17_188780_c1
1874 nmdc:mga0k408_12633_c1
1875 nmdc:mga0k408_2138_c1
1876 nmdc:mga0k408_23217_c1
1877 nmdc:mga06z11_104161_c1
1878 nmdc:mga06z11_148497_c1
1879 nmdc:mga07m45_64254_c1
1880 nmdc:mga07m45_97530_c1
1881 nmdc:mga05p37_132_c1
1882 nmdc:mga05p37_261301_c1
1883 nmdc:mga05p37_673219_c1
1884 nmdc:mga09592_418_c1
1885 nmdc:mga08y16_108320_c1
1886 nmdc:mga08y16_425018_c1
1887 nmdc:mga08y16_9476_c1
1888 nmdc:mga0n895_109188_c1
1889 nmdc:mga0n895_252410_c1
1890 nmdc:mga0n895_290807_c1
1891 nmdc:mga0n895_40845_c1
1892 nmdc:mga0n895_468_c1
1893 nmdc:mga0n895_93917_c1
1894 nmdc:mga0rr50_145_c1
1895 nmdc:mga0rr50_89121_c1
1896 nmdc:mga08x19_14066_c1
1897 nmdc:mga08x19_522_c1
1898 nmdc:mga0a205_11596_c1
1899 nmdc:mga0a205_54289_c1
1900 nmdc:mga0sz30_20124_c1
1901 nmdc:mga0sz30_60152_c1
1902 Ga0495601_0000001
1903 Ga0495601_0000243
1904 Ga0495601_0016790
1905 Ga0495601_0022082
1906 Ga0495601_0025060
1907 Ga0495601_0152994
1908 Ga0495601_0164211
1909 Ga0495612_0000063
1910 Ga0495612_0001332
1911 Ga0495612_0006769
1912 Ga0495612_0009391
1913 Ga0495595_0002319
1914 Ga0495595_0046083
1915 Ga0495619_0000004
1916 Ga0495619_0004170
1917 Ga0495619_0112964
1918 Ga0500578_0178410
1919 Ga0500643_063804
1920 Ga0500583_0164039
1921 Ga0500641_0003400
1922 Ga0500555_000886
1923 Ga0500595_016248
1924 Ga0500652_000023
1925 Ga0501084_0064199
1926 Ga0501084_0071132
1927 Ga0501084_0090900
1928 Ga0501084_0159463
1929 Ga0501084_0479070
1930 Ga0590071_008354
1931 Ga0501082_0000205
1932 Ga0501082_0008926
1933 Ga0501082_0025577
1934 Ga0501082_0144096
1935 Ga0530510_0000425
1936 Ga0530510_0057591
1937 2842719397
1938 2904482832
1939 2928117050
1940 2935393018
1941 2974321326
1942 2997605428

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19858

OxRdtase_C

Bacterial oxidoreductases, C-terminal

178

340

0.99

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

31

148

0.95

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

156

276

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8973 1 314
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8884 1 314
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8824 1 314
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8776 1 314
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.869 1 314
ID Description Score Start End Superfamily
af_A0A1D8PPX6_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 1 116 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9566 1 119 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 1 119 3.40.50.720
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 1 116 3.40.50.720
af_Q04869_4_115_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 1 107 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D0M678-F1-model_v4 Dehydrogenase 0.976 2 139 GO:0000166
AF-A0A3A8SX78-F1-model_v4 deleted 0.9707 54 138
AF-A0A1J5I439-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9629 1 138 GO:0000166
AF-A0A3N5KE09-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9613 1 82 GO:0000166
AF-A0A7W0GP34-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9599 1 138 GO:0000166
GO:0016491

Map