F487130
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 971 | 455 | 1942 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0000859|Ga0501035_0000859_14449_15441 |
| Length | 330 |
| Sequence | MAGLVPAIHAFIALGFSKAWMPATSAGMTAERLKQMTARIIDGKAIAAELRHKVATEVARLKTAHDIVPRLAVVLVGVNPASEVYVRSKSKAVAEIGMRSLDHRLPETASEAELLALIGRLNADPAVSGILVQLPLPPQIDAHEVIAAIDPDKDVDGFHPVNVGRLSIGLPTLPPCTPFGCIVLAKAVHASLAGLDAVVIGRSNIVGKPVAQLLLAENATVTIAHSKTRDLAAVCRRADIVVAAIGRPAFVTKGWIKPGATVIDVGINRVTDKDGKSRIVGDVAADAVEVAGALTPVPGGVGPMTIACLMLNTLRAVCLQRGLPPPDIGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 13 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 231 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 243 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 245 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 267 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 271 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 273 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 275 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 277 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 284 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 285 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 286 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 362 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 363 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 364 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 374 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 375 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 376 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 377 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 378 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 379 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 380 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 381 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 422 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 423 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 424 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 425 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 428 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 429 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 430 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 431 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 432 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 433 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 434 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 435 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 436 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 437 | 2791355199 | |||
| 438 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 439 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 440 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 441 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 442 | 2904699407 | |||
| 443 | 2906610324 | |||
| 444 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 445 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 446 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 447 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 448 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 449 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 450 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 451 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 452 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 453 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 454 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 455 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.9 |
| Metatranscriptomes | 0.52 |
| Isolates | 2.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.78 |
| Nodule | 2.27 |
| Rhizoplane | 6.49 |
| Rhizosphere | 84.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501035_0000859 | 3300049822 | Bacteria | 32391 |
| 2 | JGI24747J21853_1000169 | 3300001978 | Bacteria | 3330 |
| 3 | JGI24740J21852_10022911 | 3300001979 | Bacteria | 2141 |
| 4 | JGI24739J22299_10000897 | 3300001989 | Bacteria | 11012 |
| 5 | JGI24739J22299_10001524 | 3300001989 | Bacteria | 8748 |
| 6 | JGI24739J22299_10003887 | 3300001989 | Bacteria | 5710 |
| 7 | JGI24737J22298_10009404 | 3300001990 | Bacteria | 3253 |
| 8 | JGI24737J22298_10017120 | 3300001990 | Bacteria | 2337 |
| 9 | JGI24735J21928_10003487 | 3300002067 | Bacteria | 5356 |
| 10 | JGI24750J21931_1000745 | 3300002070 | Bacteria | 4622 |
| 11 | JGI24745J21846_1000061 | 3300002073 | Bacteria | 7701 |
| 12 | JGI24748J21848_1000185 | 3300002074 | Bacteria | 8024 |
| 13 | JGI24738J21930_10000067 | 3300002075 | Bacteria | 21834 |
| 14 | JGI24749J21850_1001798 | 3300002076 | Bacteria | 3033 |
| 15 | JGI24035J26624_1000005 | 3300002126 | Bacteria | 14770 |
| 16 | JGI24035J26624_1000190 | 3300002126 | Bacteria | 5699 |
| 17 | JGI24033J26618_1000613 | 3300002155 | Bacteria | 3427 |
| 18 | JGI24034J26672_10000951 | 3300002239 | Bacteria | 3776 |
| 19 | JGI24742J22300_10000153 | 3300002244 | Bacteria | 10167 |
| 20 | JGI25165J46597_1006892 | 3300003214 | Bacteria | 1960 |
| 21 | JGI25153J46596_10038430 | 3300003215 | Bacteria | 1508 |
| 22 | rootH2_10045331 | 3300003320 | Bacteria | 10632 |
| 23 | rootH2_10046910 | 3300003320 | Bacteria | 3741 |
| 24 | JGI25160J50197_1014601 | 3300003354 | Bacteria | 2620 |
| 25 | Ga0065712_10130182 | 3300005290 | Bacteria | 1555 |
| 26 | Ga0065715_10008690 | 3300005293 | Bacteria | 2691 |
| 27 | Ga0065707_10268785 | 3300005295 | Bacteria | 1077 |
| 28 | Ga0070676_10000332 | 3300005328 | Bacteria | 21434 |
| 29 | Ga0070676_10066999 | 3300005328 | Bacteria | 2146 |
| 30 | Ga0070676_10068867 | 3300005328 | Bacteria | 2119 |
| 31 | Ga0070683_100004171 | 3300005329 | Bacteria | 11837 |
| 32 | Ga0070690_100005079 | 3300005330 | Bacteria | 7376 |
| 33 | Ga0070690_100046391 | 3300005330 | Bacteria | 2762 |
| 34 | Ga0070670_100023341 | 3300005331 | Bacteria | 5324 |
| 35 | Ga0070677_10000258 | 3300005333 | Bacteria | 18304 |
| 36 | Ga0068869_100000510 | 3300005334 | Bacteria | 21648 |
| 37 | Ga0070666_10004570 | 3300005335 | Bacteria | 8438 |
| 38 | Ga0070666_10019282 | 3300005335 | Bacteria | 4400 |
| 39 | Ga0070680_100001476 | 3300005336 | Bacteria | 17088 |
| 40 | Ga0070680_100012038 | 3300005336 | Bacteria | 6712 |
| 41 | Ga0070682_100003255 | 3300005337 | Bacteria | 9005 |
| 42 | Ga0068868_100000148 | 3300005338 | Bacteria | 45833 |
| 43 | Ga0070660_100001314 | 3300005339 | Bacteria | 16922 |
| 44 | Ga0070660_100003272 | 3300005339 | Bacteria | 11124 |
| 45 | Ga0070689_100001783 | 3300005340 | Bacteria | 13820 |
| 46 | Ga0070689_100014799 | 3300005340 | Bacteria | 5675 |
| 47 | Ga0070691_10035255 | 3300005341 | Bacteria | 2355 |
| 48 | Ga0070687_100000318 | 3300005343 | Bacteria | 16315 |
| 49 | Ga0070687_100323504 | 3300005343 | Bacteria | 986 |
| 50 | Ga0070661_100000768 | 3300005344 | Bacteria | 23141 |
| 51 | Ga0070661_100127357 | 3300005344 | Bacteria | 1911 |
| 52 | Ga0070692_10011615 | 3300005345 | Bacteria | 4047 |
| 53 | Ga0070668_100051792 | 3300005347 | Bacteria | 3164 |
| 54 | Ga0070668_100093298 | 3300005347 | Bacteria | 2375 |
| 55 | Ga0070668_100137565 | 3300005347 | Bacteria | 1966 |
| 56 | Ga0070669_100003445 | 3300005353 | Bacteria | 11403 |
| 57 | Ga0070675_100001491 | 3300005354 | Bacteria | 17261 |
| 58 | Ga0070675_100108142 | 3300005354 | Bacteria | 2348 |
| 59 | Ga0070675_100174255 | 3300005354 | Bacteria | 1857 |
| 60 | Ga0070671_100003997 | 3300005355 | Bacteria | 11616 |
| 61 | Ga0070671_100043030 | 3300005355 | Bacteria | 3755 |
| 62 | Ga0070671_100352254 | 3300005355 | Bacteria | 1256 |
| 63 | Ga0070674_100001355 | 3300005356 | Bacteria | 12909 |
| 64 | Ga0070674_100139731 | 3300005356 | Bacteria | 1816 |
| 65 | Ga0070674_100213607 | 3300005356 | Bacteria | 1497 |
| 66 | Ga0070673_100000670 | 3300005364 | Bacteria | 18859 |
| 67 | Ga0070673_100008314 | 3300005364 | Bacteria | 6894 |
| 68 | Ga0070673_100053400 | 3300005364 | Bacteria | 3174 |
| 69 | Ga0070673_100134138 | 3300005364 | Bacteria | 2082 |
| 70 | Ga0070688_100031440 | 3300005365 | Bacteria | 3193 |
| 71 | Ga0070688_100070770 | 3300005365 | Bacteria | 2231 |
| 72 | Ga0070659_100001400 | 3300005366 | Bacteria | 17383 |
| 73 | Ga0070659_100064806 | 3300005366 | Bacteria | 2893 |
| 74 | Ga0070659_100108095 | 3300005366 | Bacteria | 2243 |
| 75 | Ga0070659_100115234 | 3300005366 | Bacteria | 2172 |
| 76 | Ga0070659_100159673 | 3300005366 | Bacteria | 1843 |
| 77 | Ga0070667_100002340 | 3300005367 | Bacteria | 16596 |
| 78 | Ga0070667_100061422 | 3300005367 | Bacteria | 3181 |
| 79 | Ga0070703_10013030 | 3300005406 | Bacteria | 2357 |
| 80 | Ga0070709_10022655 | 3300005434 | Bacteria | 3678 |
| 81 | Ga0070714_100103577 | 3300005435 | Bacteria | 2510 |
| 82 | Ga0070714_100256895 | 3300005435 | Bacteria | 1617 |
| 83 | Ga0070713_100000838 | 3300005436 | Bacteria | 19660 |
| 84 | Ga0070713_100015088 | 3300005436 | Bacteria | 5758 |
| 85 | Ga0070713_100043089 | 3300005436 | Bacteria | 3687 |
| 86 | Ga0070713_100129808 | 3300005436 | Bacteria | 2221 |
| 87 | Ga0070713_100205600 | 3300005436 | Bacteria | 1780 |
| 88 | Ga0070713_100219622 | 3300005436 | Bacteria | 1724 |
| 89 | Ga0070710_10003726 | 3300005437 | Bacteria | 7205 |
| 90 | Ga0070710_10012469 | 3300005437 | Bacteria | 4222 |
| 91 | Ga0070710_10049287 | 3300005437 | Bacteria | 2355 |
| 92 | Ga0070701_10019659 | 3300005438 | Bacteria | 3193 |
| 93 | Ga0070701_10128181 | 3300005438 | Bacteria | 1439 |
| 94 | Ga0070711_100028348 | 3300005439 | Bacteria | 3684 |
| 95 | Ga0070711_100043244 | 3300005439 | Bacteria | 3050 |
| 96 | Ga0070711_100055772 | 3300005439 | Bacteria | 2731 |
| 97 | Ga0070711_100172289 | 3300005439 | Bacteria | 1650 |
| 98 | Ga0070705_100001500 | 3300005440 | Bacteria | 12285 |
| 99 | Ga0070705_100341336 | 3300005440 | Bacteria | 1089 |
| 100 | Ga0070700_100001568 | 3300005441 | Bacteria | 11405 |
| 101 | Ga0070700_100107815 | 3300005441 | Bacteria | 1846 |
| 102 | Ga0070708_100105830 | 3300005445 | Bacteria | 2581 |
| 103 | Ga0070708_100193052 | 3300005445 | Bacteria | 1905 |
| 104 | Ga0070663_100001857 | 3300005455 | Bacteria | 11779 |
| 105 | Ga0070678_100000391 | 3300005456 | Bacteria | 20585 |
| 106 | Ga0070678_100015738 | 3300005456 | Bacteria | 4815 |
| 107 | Ga0070678_100025297 | 3300005456 | Bacteria | 3991 |
| 108 | Ga0070678_100227291 | 3300005456 | Bacteria | 1554 |
| 109 | Ga0070662_100090457 | 3300005457 | Bacteria | 2297 |
| 110 | Ga0070662_100220942 | 3300005457 | Bacteria | 1512 |
| 111 | Ga0070681_10006791 | 3300005458 | Bacteria | 11139 |
| 112 | Ga0068867_100006925 | 3300005459 | Bacteria | 8025 |
| 113 | Ga0070685_10003877 | 3300005466 | Bacteria | 7563 |
| 114 | Ga0070685_10008554 | 3300005466 | Bacteria | 5265 |
| 115 | Ga0070698_100108778 | 3300005471 | Bacteria | 2739 |
| 116 | Ga0070698_100183770 | 3300005471 | Bacteria | 2029 |
| 117 | Ga0070699_100078736 | 3300005518 | Bacteria | 2871 |
| 118 | Ga0070679_100026893 | 3300005530 | Bacteria | 5658 |
| 119 | Ga0070679_100142520 | 3300005530 | Bacteria | 2375 |
| 120 | Ga0070679_100299590 | 3300005530 | Bacteria | 1558 |
| 121 | Ga0070684_100000101 | 3300005535 | Bacteria | 55960 |
| 122 | Ga0070684_100074894 | 3300005535 | Bacteria | 2984 |
| 123 | Ga0068853_100116865 | 3300005539 | Bacteria | 2375 |
| 124 | Ga0068853_100251458 | 3300005539 | Bacteria | 1622 |
| 125 | Ga0070672_100000016 | 3300005543 | Bacteria | 71848 |
| 126 | Ga0070672_100259453 | 3300005543 | Bacteria | 1465 |
| 127 | Ga0070686_100008745 | 3300005544 | Bacteria | 5675 |
| 128 | Ga0070686_100018037 | 3300005544 | Bacteria | 4135 |
| 129 | Ga0070686_100272537 | 3300005544 | Bacteria | 1245 |
| 130 | Ga0070695_100000225 | 3300005545 | Bacteria | 27760 |
| 131 | Ga0070695_100004140 | 3300005545 | Bacteria | 8475 |
| 132 | Ga0070696_100002898 | 3300005546 | Bacteria | 11405 |
| 133 | Ga0070696_100382194 | 3300005546 | Bacteria | 1098 |
| 134 | Ga0070693_100000138 | 3300005547 | Bacteria | 32988 |
| 135 | Ga0070693_100289511 | 3300005547 | Bacteria | 1100 |
| 136 | Ga0070665_100146816 | 3300005548 | Bacteria | 2361 |
| 137 | Ga0070665_100164185 | 3300005548 | Bacteria | 2223 |
| 138 | Ga0070665_100172093 | 3300005548 | Bacteria | 2167 |
| 139 | Ga0070704_100082859 | 3300005549 | Bacteria | 2366 |
| 140 | Ga0068855_100000244 | 3300005563 | Bacteria | 68503 |
| 141 | Ga0068855_100023959 | 3300005563 | Bacteria | 7308 |
| 142 | Ga0068855_100040189 | 3300005563 | Bacteria | 5552 |
| 143 | Ga0068855_100047984 | 3300005563 | Bacteria | 5042 |
| 144 | Ga0068855_100059558 | 3300005563 | Bacteria | 4467 |
| 145 | Ga0068855_100129068 | 3300005563 | Bacteria | 2888 |
| 146 | Ga0068855_100245280 | 3300005563 | Bacteria | 1999 |
| 147 | Ga0070664_100000067 | 3300005564 | Bacteria | 65201 |
| 148 | Ga0070664_100039135 | 3300005564 | Bacteria | 3994 |
| 149 | Ga0070664_100263518 | 3300005564 | Bacteria | 1551 |
| 150 | Ga0068857_100000275 | 3300005577 | Bacteria | 35176 |
| 151 | Ga0068857_100018470 | 3300005577 | Bacteria | 6116 |
| 152 | Ga0068857_100066582 | 3300005577 | Bacteria | 3205 |
| 153 | Ga0068857_100160864 | 3300005577 | Bacteria | 2037 |
| 154 | Ga0068857_100176512 | 3300005577 | Bacteria | 1943 |
| 155 | Ga0068857_100258758 | 3300005577 | Bacteria | 1597 |
| 156 | Ga0068857_100751487 | 3300005577 | Bacteria | 929 |
| 157 | Ga0068854_100002271 | 3300005578 | Bacteria | 11828 |
| 158 | Ga0068854_100162112 | 3300005578 | Bacteria | 1733 |
| 159 | Ga0068854_100420622 | 3300005578 | Bacteria | 1110 |
| 160 | Ga0068856_100001016 | 3300005614 | Bacteria | 29871 |
| 161 | Ga0068856_100069733 | 3300005614 | Bacteria | 3476 |
| 162 | Ga0068856_100103133 | 3300005614 | Bacteria | 2846 |
| 163 | Ga0068856_100120811 | 3300005614 | Bacteria | 2621 |
| 164 | Ga0070702_100000175 | 3300005615 | Bacteria | 20470 |
| 165 | Ga0070702_100125218 | 3300005615 | Bacteria | 1615 |
| 166 | Ga0068852_100000611 | 3300005616 | Bacteria | 23441 |
| 167 | Ga0068859_100002948 | 3300005617 | Bacteria | 17261 |
| 168 | Ga0068859_100124564 | 3300005617 | Bacteria | 2645 |
| 169 | Ga0068859_100179054 | 3300005617 | Bacteria | 2202 |
| 170 | Ga0068864_100000234 | 3300005618 | Bacteria | 49663 |
| 171 | Ga0068864_100021303 | 3300005618 | Bacteria | 5431 |
| 172 | Ga0068864_100025360 | 3300005618 | Bacteria | 4992 |
| 173 | Ga0068866_10002227 | 3300005718 | Bacteria | 8040 |
| 174 | Ga0068866_10021000 | 3300005718 | Bacteria | 3000 |
| 175 | Ga0068866_10097364 | 3300005718 | Bacteria | 1616 |
| 176 | Ga0068861_100036887 | 3300005719 | Bacteria | 3631 |
| 177 | Ga0068861_100044242 | 3300005719 | Bacteria | 3347 |
| 178 | Ga0068861_100099380 | 3300005719 | Bacteria | 2311 |
| 179 | Ga0068870_10000009 | 3300005840 | Bacteria | 70353 |
| 180 | Ga0068863_100001729 | 3300005841 | Bacteria | 21634 |
| 181 | Ga0068863_100142449 | 3300005841 | Bacteria | 2291 |
| 182 | Ga0068863_100533685 | 3300005841 | Bacteria | 1157 |
| 183 | Ga0068858_100001059 | 3300005842 | Bacteria | 28468 |
| 184 | Ga0068858_100138508 | 3300005842 | Bacteria | 2284 |
| 185 | Ga0068860_100003167 | 3300005843 | Bacteria | 16980 |
| 186 | Ga0068860_100105682 | 3300005843 | Bacteria | 2688 |
| 187 | Ga0068860_100377212 | 3300005843 | Bacteria | 1399 |
| 188 | Ga0068862_100019397 | 3300005844 | Bacteria | 5675 |
| 189 | Ga0068862_100039735 | 3300005844 | Bacteria | 3997 |
| 190 | Ga0068862_100500322 | 3300005844 | Bacteria | 1153 |
| 191 | Ga0081455_10011795 | 3300005937 | Bacteria | 8752 |
| 192 | Ga0081455_10075776 | 3300005937 | Bacteria | 2774 |
| 193 | Ga0081538_10149572 | 3300005981 | Bacteria | 1060 |
| 194 | Ga0081540_1004206 | 3300005983 | Bacteria | 11062 |
| 195 | Ga0081539_10018244 | 3300005985 | Bacteria | 4879 |
| 196 | Ga0070717_10004993 | 3300006028 | Bacteria | 9653 |
| 197 | Ga0070717_10099451 | 3300006028 | Bacteria | 2468 |
| 198 | Ga0075368_10010605 | 3300006042 | Bacteria | 3335 |
| 199 | Ga0075363_100082898 | 3300006048 | Bacteria | 1756 |
| 200 | Ga0075364_10142245 | 3300006051 | Bacteria | 1614 |
| 201 | Ga0070715_10017080 | 3300006163 | Bacteria | 2740 |
| 202 | Ga0070715_10026067 | 3300006163 | Bacteria | 2321 |
| 203 | Ga0070716_100003280 | 3300006173 | Bacteria | 7598 |
| 204 | Ga0070712_100004136 | 3300006175 | Bacteria | 8914 |
| 205 | Ga0070712_100023829 | 3300006175 | Bacteria | 4047 |
| 206 | Ga0070712_100031650 | 3300006175 | Bacteria | 3565 |
| 207 | Ga0070712_100039495 | 3300006175 | Bacteria | 3230 |
| 208 | Ga0070712_100132686 | 3300006175 | Bacteria | 1890 |
| 209 | Ga0075367_10013106 | 3300006178 | Bacteria | 4444 |
| 210 | Ga0075367_10091430 | 3300006178 | Bacteria | 1851 |
| 211 | Ga0075367_10153160 | 3300006178 | Bacteria | 1431 |
| 212 | Ga0075369_10061791 | 3300006186 | Bacteria | 1636 |
| 213 | Ga0075369_10150760 | 3300006186 | Bacteria | 1063 |
| 214 | Ga0097621_100006760 | 3300006237 | Bacteria | 8145 |
| 215 | Ga0075370_10034531 | 3300006353 | Bacteria | 2835 |
| 216 | Ga0075370_10146369 | 3300006353 | Bacteria | 1383 |
| 217 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 218 | Ga0068871_100014044 | 3300006358 | Bacteria | 5956 |
| 219 | Ga0068871_100053613 | 3300006358 | Bacteria | 3269 |
| 220 | Ga0068871_100108554 | 3300006358 | Bacteria | 2332 |
| 221 | Ga0075430_100072654 | 3300006846 | Bacteria | 2885 |
| 222 | Ga0075434_100095961 | 3300006871 | Bacteria | 2970 |
| 223 | Ga0075434_100147219 | 3300006871 | Bacteria | 2375 |
| 224 | Ga0068865_100000355 | 3300006881 | Bacteria | 25325 |
| 225 | Ga0068865_100005877 | 3300006881 | Bacteria | 7466 |
| 226 | Ga0068865_100357595 | 3300006881 | Bacteria | 1185 |
| 227 | Ga0075436_100006210 | 3300006914 | Bacteria | 8194 |
| 228 | Ga0075436_100007339 | 3300006914 | Bacteria | 7533 |
| 229 | Ga0097620_100002948 | 3300006931 | Bacteria | 17261 |
| 230 | Ga0097620_100124548 | 3300006931 | Bacteria | 2645 |
| 231 | Ga0097620_100179052 | 3300006931 | Bacteria | 2202 |
| 232 | Ga0075435_100099820 | 3300007076 | Bacteria | 2404 |
| 233 | Ga0105251_10017705 | 3300009011 | Bacteria | 3808 |
| 234 | Ga0105240_10004853 | 3300009093 | Bacteria | 20253 |
| 235 | Ga0105240_10022674 | 3300009093 | Bacteria | 8318 |
| 236 | Ga0105240_10087262 | 3300009093 | Bacteria | 3821 |
| 237 | Ga0105240_10185858 | 3300009093 | Bacteria | 2448 |
| 238 | Ga0105240_10519388 | 3300009093 | Bacteria | 1322 |
| 239 | Ga0105240_10559793 | 3300009093 | Bacteria | 1264 |
| 240 | Ga0111539_10141004 | 3300009094 | Bacteria | 2821 |
| 241 | Ga0111539_10329681 | 3300009094 | Bacteria | 1777 |
| 242 | Ga0105245_10000409 | 3300009098 | Bacteria | 39920 |
| 243 | Ga0105245_10152826 | 3300009098 | Bacteria | 2184 |
| 244 | Ga0105245_10512549 | 3300009098 | Bacteria | 1217 |
| 245 | Ga0105247_10004080 | 3300009101 | Bacteria | 9386 |
| 246 | Ga0105247_10009067 | 3300009101 | Bacteria | 6056 |
| 247 | Ga0105247_10038738 | 3300009101 | Bacteria | 2911 |
| 248 | Ga0105247_10091424 | 3300009101 | Bacteria | 1933 |
| 249 | Ga0105247_10266445 | 3300009101 | Bacteria | 1177 |
| 250 | Ga0105247_10348041 | 3300009101 | Bacteria | 1041 |
| 251 | Ga0105243_10004202 | 3300009148 | Bacteria | 11415 |
| 252 | Ga0105243_10130712 | 3300009148 | Bacteria | 2129 |
| 253 | Ga0105243_10543975 | 3300009148 | Bacteria | 1108 |
| 254 | Ga0105241_10000053 | 3300009174 | Bacteria | 94578 |
| 255 | Ga0105241_10010799 | 3300009174 | Bacteria | 6699 |
| 256 | Ga0105241_10060625 | 3300009174 | Bacteria | 2911 |
| 257 | Ga0105242_10011250 | 3300009176 | Bacteria | 6877 |
| 258 | Ga0105242_10044930 | 3300009176 | Bacteria | 3578 |
| 259 | Ga0105242_10221084 | 3300009176 | Bacteria | 1693 |
| 260 | Ga0105248_10000309 | 3300009177 | Bacteria | 58008 |
| 261 | Ga0105248_10038164 | 3300009177 | Bacteria | 5375 |
| 262 | Ga0105248_10116016 | 3300009177 | Bacteria | 3020 |
| 263 | Ga0105248_10176677 | 3300009177 | Bacteria | 2406 |
| 264 | Ga0105248_10256225 | 3300009177 | Bacteria | 1970 |
| 265 | Ga0105248_10424316 | 3300009177 | Bacteria | 1498 |
| 266 | Ga0105237_10044970 | 3300009545 | Bacteria | 4445 |
| 267 | Ga0105237_10112288 | 3300009545 | Bacteria | 2717 |
| 268 | Ga0105237_10151426 | 3300009545 | Bacteria | 2316 |
| 269 | Ga0105237_10176114 | 3300009545 | Bacteria | 2139 |
| 270 | Ga0105238_10027365 | 3300009551 | Bacteria | 5809 |
| 271 | Ga0105238_10111585 | 3300009551 | Bacteria | 2714 |
| 272 | Ga0105249_10003451 | 3300009553 | Bacteria | 13696 |
| 273 | Ga0105249_10231262 | 3300009553 | Bacteria | 1823 |
| 274 | Ga0105239_10007939 | 3300010375 | Bacteria | 12129 |
| 275 | Ga0105239_10011468 | 3300010375 | Bacteria | 9884 |
| 276 | Ga0105246_10002040 | 3300011119 | Bacteria | 12194 |
| 277 | Ga0157373_10040211 | 3300013100 | Bacteria | 3347 |
| 278 | Ga0157371_10008314 | 3300013102 | Bacteria | 8286 |
| 279 | Ga0157371_10266337 | 3300013102 | Bacteria | 1236 |
| 280 | Ga0157370_10058079 | 3300013104 | Bacteria | 3677 |
| 281 | Ga0157370_10161055 | 3300013104 | Bacteria | 2088 |
| 282 | Ga0157369_10005855 | 3300013105 | Bacteria | 14284 |
| 283 | Ga0157374_10000452 | 3300013296 | Bacteria | 37355 |
| 284 | Ga0157374_10026788 | 3300013296 | Bacteria | 5191 |
| 285 | Ga0157374_10065714 | 3300013296 | Bacteria | 3407 |
| 286 | Ga0157374_10333689 | 3300013296 | Bacteria | 1504 |
| 287 | Ga0157378_10000872 | 3300013297 | Bacteria | 27839 |
| 288 | Ga0157378_10062596 | 3300013297 | Bacteria | 3323 |
| 289 | Ga0157378_10365575 | 3300013297 | Bacteria | 1413 |
| 290 | Ga0157378_10394722 | 3300013297 | Bacteria | 1362 |
| 291 | Ga0163162_10000796 | 3300013306 | Bacteria | 29342 |
| 292 | Ga0157372_10008710 | 3300013307 | Bacteria | 10774 |
| 293 | Ga0157372_10054142 | 3300013307 | Bacteria | 4475 |
| 294 | Ga0157372_10124519 | 3300013307 | Bacteria | 2963 |
| 295 | Ga0157375_10004563 | 3300013308 | Bacteria | 12034 |
| 296 | Ga0157375_10109327 | 3300013308 | Bacteria | 2860 |
| 297 | Ga0157375_10625201 | 3300013308 | Bacteria | 1235 |
| 298 | Ga0163163_10191746 | 3300014325 | Bacteria | 2092 |
| 299 | Ga0157380_10015191 | 3300014326 | Bacteria | 5654 |
| 300 | Ga0157380_10309619 | 3300014326 | Bacteria | 1459 |
| 301 | Ga0157377_10000538 | 3300014745 | Bacteria | 16011 |
| 302 | Ga0157379_10004942 | 3300014968 | Bacteria | 11442 |
| 303 | Ga0157376_10002295 | 3300014969 | Bacteria | 12921 |
| 304 | Ga0157376_10356693 | 3300014969 | Bacteria | 1401 |
| 305 | Ga0163161_10000499 | 3300017792 | Bacteria | 32280 |
| 306 | Ga0163161_10303267 | 3300017792 | Bacteria | 1258 |
| 307 | Ga0206356_10556735 | 3300020070 | Bacteria | 1106 |
| 308 | Ga0206354_11444921 | 3300020081 | Bacteria | 1596 |
| 309 | Ga0206353_10552086 | 3300020082 | Bacteria | 1081 |
| 310 | Ga0206353_10987334 | 3300020082 | Bacteria | 1940 |
| 311 | Ga0213876_10005419 | 3300021384 | Bacteria | 7023 |
| 312 | Ga0209233_1020069 | 3300025261 | Bacteria | 1760 |
| 313 | Ga0207673_1000072 | 3300025290 | Bacteria | 8779 |
| 314 | Ga0209758_1000616 | 3300025297 | Bacteria | 54936 |
| 315 | Ga0207426_1000420 | 3300025302 | Bacteria | 69895 |
| 316 | Ga0207697_10000252 | 3300025315 | Bacteria | 29548 |
| 317 | Ga0207682_10000029 | 3300025893 | Bacteria | 57930 |
| 318 | Ga0207692_10006712 | 3300025898 | Bacteria | 4678 |
| 319 | Ga0207692_10075086 | 3300025898 | Bacteria | 1792 |
| 320 | Ga0207692_10261499 | 3300025898 | Bacteria | 1041 |
| 321 | Ga0207710_10001576 | 3300025900 | Bacteria | 11198 |
| 322 | Ga0207710_10002176 | 3300025900 | Bacteria | 9215 |
| 323 | Ga0207710_10164322 | 3300025900 | Bacteria | 1083 |
| 324 | Ga0207688_10000020 | 3300025901 | Bacteria | 51200 |
| 325 | Ga0207688_10093665 | 3300025901 | Bacteria | 1728 |
| 326 | Ga0207688_10308730 | 3300025901 | Bacteria | 968 |
| 327 | Ga0207680_10001555 | 3300025903 | Bacteria | 10815 |
| 328 | Ga0207680_10124811 | 3300025903 | Bacteria | 1688 |
| 329 | Ga0207680_10203482 | 3300025903 | Bacteria | 1350 |
| 330 | Ga0207647_10001753 | 3300025904 | Bacteria | 16640 |
| 331 | Ga0207645_10000108 | 3300025907 | Bacteria | 61630 |
| 332 | Ga0207645_10057516 | 3300025907 | Bacteria | 2483 |
| 333 | Ga0207643_10000044 | 3300025908 | Bacteria | 82217 |
| 334 | Ga0207654_10004211 | 3300025911 | Bacteria | 7261 |
| 335 | Ga0207707_10014616 | 3300025912 | Bacteria | 6839 |
| 336 | Ga0207707_10137962 | 3300025912 | Bacteria | 2132 |
| 337 | Ga0207695_10018913 | 3300025913 | Bacteria | 7947 |
| 338 | Ga0207695_10038814 | 3300025913 | Bacteria | 5122 |
| 339 | Ga0207695_10185078 | 3300025913 | Bacteria | 2002 |
| 340 | Ga0207695_10399314 | 3300025913 | Bacteria | 1259 |
| 341 | Ga0207671_10031026 | 3300025914 | Bacteria | 3985 |
| 342 | Ga0207671_10152873 | 3300025914 | Bacteria | 1784 |
| 343 | Ga0207693_10017047 | 3300025915 | Bacteria | 5799 |
| 344 | Ga0207693_10071211 | 3300025915 | Bacteria | 2720 |
| 345 | Ga0207693_10120847 | 3300025915 | Bacteria | 2057 |
| 346 | Ga0207693_10206099 | 3300025915 | Bacteria | 1546 |
| 347 | Ga0207663_10147759 | 3300025916 | Bacteria | 1645 |
| 348 | Ga0207663_10210790 | 3300025916 | Bacteria | 1408 |
| 349 | Ga0207660_10000543 | 3300025917 | Bacteria | 25357 |
| 350 | Ga0207662_10005777 | 3300025918 | Bacteria | 6621 |
| 351 | Ga0207657_10004676 | 3300025919 | Bacteria | 14449 |
| 352 | Ga0207657_10016668 | 3300025919 | Bacteria | 7080 |
| 353 | Ga0207657_10103241 | 3300025919 | Bacteria | 2363 |
| 354 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 355 | Ga0207649_10139493 | 3300025920 | Bacteria | 1657 |
| 356 | Ga0207652_10006960 | 3300025921 | Bacteria | 9111 |
| 357 | Ga0207652_10013118 | 3300025921 | Bacteria | 6709 |
| 358 | Ga0207652_10070361 | 3300025921 | Bacteria | 3038 |
| 359 | Ga0207681_10001187 | 3300025923 | Bacteria | 16757 |
| 360 | Ga0207694_10086806 | 3300025924 | Bacteria | 2464 |
| 361 | Ga0207694_10139021 | 3300025924 | Bacteria | 1952 |
| 362 | Ga0207650_10001534 | 3300025925 | Bacteria | 16557 |
| 363 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 364 | Ga0207659_10192498 | 3300025926 | Bacteria | 1624 |
| 365 | Ga0207687_10000061 | 3300025927 | Bacteria | 84113 |
| 366 | Ga0207687_10020799 | 3300025927 | Bacteria | 4354 |
| 367 | Ga0207700_10001257 | 3300025928 | Bacteria | 14436 |
| 368 | Ga0207700_10013859 | 3300025928 | Bacteria | 5264 |
| 369 | Ga0207700_10116961 | 3300025928 | Bacteria | 2155 |
| 370 | Ga0207700_10175241 | 3300025928 | Bacteria | 1792 |
| 371 | Ga0207664_10042991 | 3300025929 | Bacteria | 3531 |
| 372 | Ga0207664_10074898 | 3300025929 | Bacteria | 2736 |
| 373 | Ga0207664_10142206 | 3300025929 | Bacteria | 2031 |
| 374 | Ga0207644_10000194 | 3300025931 | Bacteria | 43567 |
| 375 | Ga0207644_10013156 | 3300025931 | Bacteria | 5509 |
| 376 | Ga0207644_10253326 | 3300025931 | Bacteria | 1405 |
| 377 | Ga0207644_10273889 | 3300025931 | Bacteria | 1353 |
| 378 | Ga0207690_10000225 | 3300025932 | Bacteria | 42706 |
| 379 | Ga0207690_10273120 | 3300025932 | Bacteria | 1314 |
| 380 | Ga0207706_10004628 | 3300025933 | Bacteria | 12903 |
| 381 | Ga0207706_10118069 | 3300025933 | Bacteria | 2333 |
| 382 | Ga0207706_10145008 | 3300025933 | Bacteria | 2089 |
| 383 | Ga0207686_10007051 | 3300025934 | Bacteria | 6046 |
| 384 | Ga0207686_10162213 | 3300025934 | Bacteria | 1568 |
| 385 | Ga0207686_10165301 | 3300025934 | Bacteria | 1555 |
| 386 | Ga0207709_10000291 | 3300025935 | Bacteria | 56621 |
| 387 | Ga0207670_10000434 | 3300025936 | Bacteria | 23430 |
| 388 | Ga0207670_10021555 | 3300025936 | Bacteria | 3978 |
| 389 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 390 | Ga0207704_10000438 | 3300025938 | Bacteria | 18608 |
| 391 | Ga0207704_10076485 | 3300025938 | Bacteria | 2145 |
| 392 | Ga0207665_10001157 | 3300025939 | Bacteria | 17725 |
| 393 | Ga0207665_10028871 | 3300025939 | Bacteria | 3667 |
| 394 | Ga0207665_10105265 | 3300025939 | Bacteria | 1975 |
| 395 | Ga0207691_10001047 | 3300025940 | Bacteria | 27463 |
| 396 | Ga0207691_10097584 | 3300025940 | Bacteria | 2626 |
| 397 | Ga0207691_10159480 | 3300025940 | Bacteria | 1980 |
| 398 | Ga0207691_10240356 | 3300025940 | Bacteria | 1566 |
| 399 | Ga0207711_10002887 | 3300025941 | Bacteria | 15057 |
| 400 | Ga0207711_10044822 | 3300025941 | Bacteria | 3777 |
| 401 | Ga0207711_10113298 | 3300025941 | Bacteria | 2414 |
| 402 | Ga0207711_10163067 | 3300025941 | Bacteria | 2019 |
| 403 | Ga0207711_10480654 | 3300025941 | Bacteria | 1157 |
| 404 | Ga0207689_10001160 | 3300025942 | Bacteria | 25357 |
| 405 | Ga0207661_10000126 | 3300025944 | Bacteria | 48665 |
| 406 | Ga0207661_10142887 | 3300025944 | Bacteria | 2061 |
| 407 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 408 | Ga0207679_10017686 | 3300025945 | Bacteria | 4760 |
| 409 | Ga0207679_10131260 | 3300025945 | Bacteria | 2010 |
| 410 | Ga0207679_10305927 | 3300025945 | Bacteria | 1372 |
| 411 | Ga0207679_10416359 | 3300025945 | Bacteria | 1185 |
| 412 | Ga0207667_10000392 | 3300025949 | Bacteria | 59118 |
| 413 | Ga0207667_10018494 | 3300025949 | Bacteria | 7812 |
| 414 | Ga0207667_10023513 | 3300025949 | Bacteria | 6785 |
| 415 | Ga0207667_10106775 | 3300025949 | Bacteria | 2888 |
| 416 | Ga0207667_10169337 | 3300025949 | Bacteria | 2245 |
| 417 | Ga0207651_10001232 | 3300025960 | Bacteria | 11489 |
| 418 | Ga0207651_10094796 | 3300025960 | Bacteria | 2196 |
| 419 | Ga0207651_10339791 | 3300025960 | Bacteria | 1261 |
| 420 | Ga0207712_10002654 | 3300025961 | Bacteria | 11451 |
| 421 | Ga0207712_10257325 | 3300025961 | Bacteria | 1414 |
| 422 | Ga0207668_10000049 | 3300025972 | Bacteria | 99391 |
| 423 | Ga0207668_10082572 | 3300025972 | Bacteria | 2335 |
| 424 | Ga0207640_10001994 | 3300025981 | Bacteria | 11014 |
| 425 | Ga0207658_10001093 | 3300025986 | Bacteria | 21888 |
| 426 | Ga0207658_10014381 | 3300025986 | Bacteria | 5420 |
| 427 | Ga0207658_10339899 | 3300025986 | Bacteria | 1304 |
| 428 | Ga0207677_10000229 | 3300026023 | Bacteria | 44154 |
| 429 | Ga0207677_10107305 | 3300026023 | Bacteria | 2071 |
| 430 | Ga0207703_10012519 | 3300026035 | Bacteria | 6612 |
| 431 | Ga0207703_10059566 | 3300026035 | Bacteria | 3119 |
| 432 | Ga0207703_10133147 | 3300026035 | Bacteria | 2149 |
| 433 | Ga0207639_10002735 | 3300026041 | Bacteria | 11838 |
| 434 | Ga0207639_10069768 | 3300026041 | Bacteria | 2743 |
| 435 | Ga0207639_10074245 | 3300026041 | Bacteria | 2669 |
| 436 | Ga0207678_10000403 | 3300026067 | Bacteria | 39172 |
| 437 | Ga0207678_10044346 | 3300026067 | Bacteria | 3847 |
| 438 | Ga0207678_10066998 | 3300026067 | Bacteria | 3082 |
| 439 | Ga0207678_10071985 | 3300026067 | Bacteria | 2963 |
| 440 | Ga0207678_10201644 | 3300026067 | Bacteria | 1701 |
| 441 | Ga0207678_10390069 | 3300026067 | Bacteria | 1204 |
| 442 | Ga0207708_10090192 | 3300026075 | Bacteria | 2363 |
| 443 | Ga0207708_10246082 | 3300026075 | Bacteria | 1439 |
| 444 | Ga0207702_10001378 | 3300026078 | Bacteria | 24247 |
| 445 | Ga0207702_10034279 | 3300026078 | Bacteria | 4243 |
| 446 | Ga0207702_10124924 | 3300026078 | Bacteria | 2308 |
| 447 | Ga0207702_10174951 | 3300026078 | Bacteria | 1971 |
| 448 | Ga0207641_10163831 | 3300026088 | Bacteria | 2023 |
| 449 | Ga0207641_10237584 | 3300026088 | Bacteria | 1696 |
| 450 | Ga0207648_10001244 | 3300026089 | Bacteria | 28553 |
| 451 | Ga0207648_10030687 | 3300026089 | Bacteria | 4757 |
| 452 | Ga0207676_10000672 | 3300026095 | Bacteria | 27349 |
| 453 | Ga0207676_10010659 | 3300026095 | Bacteria | 6555 |
| 454 | Ga0207676_10013475 | 3300026095 | Bacteria | 5873 |
| 455 | Ga0207676_10023642 | 3300026095 | Bacteria | 4537 |
| 456 | Ga0207676_10255784 | 3300026095 | Bacteria | 1579 |
| 457 | Ga0207674_10001968 | 3300026116 | Bacteria | 26001 |
| 458 | Ga0207674_10031314 | 3300026116 | Bacteria | 5588 |
| 459 | Ga0207674_10051024 | 3300026116 | Bacteria | 4223 |
| 460 | Ga0207674_10189055 | 3300026116 | Bacteria | 2009 |
| 461 | Ga0207674_10190575 | 3300026116 | Bacteria | 2000 |
| 462 | Ga0207674_10258499 | 3300026116 | Bacteria | 1688 |
| 463 | Ga0207674_10550757 | 3300026116 | Bacteria | 1114 |
| 464 | Ga0207675_100048673 | 3300026118 | Bacteria | 3956 |
| 465 | Ga0207675_100132497 | 3300026118 | Bacteria | 2363 |
| 466 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 467 | Ga0207683_10080952 | 3300026121 | Bacteria | 2882 |
| 468 | Ga0207683_10091941 | 3300026121 | Bacteria | 2703 |
| 469 | Ga0207683_10136341 | 3300026121 | Bacteria | 2209 |
| 470 | Ga0207683_10145961 | 3300026121 | Bacteria | 2133 |
| 471 | Ga0207698_10042171 | 3300026142 | Bacteria | 3406 |
| 472 | Ga0207698_10074280 | 3300026142 | Bacteria | 2712 |
| 473 | Ga0207698_10082670 | 3300026142 | Bacteria | 2597 |
| 474 | Ga0209973_1009382 | 3300027252 | Bacteria | 1138 |
| 475 | Ga0209389_1000033 | 3300027296 | Bacteria | 131516 |
| 476 | Ga0209589_1000040 | 3300027357 | Bacteria | 126550 |
| 477 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 478 | Ga0209967_1009745 | 3300027364 | Bacteria | 1334 |
| 479 | Ga0209970_1004643 | 3300027614 | Bacteria | 2274 |
| 480 | Ga0210002_1000151 | 3300027617 | Bacteria | 10314 |
| 481 | Ga0209983_1002418 | 3300027665 | Bacteria | 4091 |
| 482 | Ga0209966_1002008 | 3300027695 | Bacteria | 3404 |
| 483 | Ga0209974_10018966 | 3300027876 | Bacteria | 2281 |
| 484 | Ga0209974_10054896 | 3300027876 | Bacteria | 1343 |
| 485 | Ga0209974_10061656 | 3300027876 | Bacteria | 1270 |
| 486 | Ga0207428_10000352 | 3300027907 | Bacteria | 59444 |
| 487 | Ga0268266_10002169 | 3300028379 | Bacteria | 21507 |
| 488 | Ga0268266_10003979 | 3300028379 | Bacteria | 14332 |
| 489 | Ga0268266_10111381 | 3300028379 | Bacteria | 2425 |
| 490 | Ga0268266_10155077 | 3300028379 | Bacteria | 2068 |
| 491 | Ga0268265_10000410 | 3300028380 | Bacteria | 45939 |
| 492 | Ga0268265_10106730 | 3300028380 | Bacteria | 2275 |
| 493 | Ga0268265_10182536 | 3300028380 | Bacteria | 1804 |
| 494 | Ga0268265_10436397 | 3300028380 | Bacteria | 1220 |
| 495 | Ga0268265_10672524 | 3300028380 | Bacteria | 997 |
| 496 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 497 | Ga0268264_10001567 | 3300028381 | Bacteria | 21210 |
| 498 | Ga0268264_10473333 | 3300028381 | Bacteria | 1217 |
| 499 | Ga0307517_10074981 | 3300028786 | Bacteria | 2974 |
| 500 | Ga0307517_10204464 | 3300028786 | Bacteria | 1228 |
| 501 | Ga0265338_10054112 | 3300028800 | Bacteria | 3583 |
| 502 | Ga0265325_10000141 | 3300031241 | Bacteria | 50291 |
| 503 | Ga0265325_10011173 | 3300031241 | Bacteria | 5167 |
| 504 | Ga0265340_10039425 | 3300031247 | Bacteria | 2331 |
| 505 | Ga0265316_10076472 | 3300031344 | Bacteria | 2572 |
| 506 | Ga0265316_10087704 | 3300031344 | Bacteria | 2377 |
| 507 | Ga0307513_10245025 | 3300031456 | Bacteria | 1594 |
| 508 | Ga0307509_10134992 | 3300031507 | Bacteria | 2415 |
| 509 | Ga0307408_100102075 | 3300031548 | Bacteria | 2187 |
| 510 | Ga0265313_10000008 | 3300031595 | Bacteria | 173405 |
| 511 | Ga0265313_10007607 | 3300031595 | Bacteria | 7354 |
| 512 | Ga0265313_10007635 | 3300031595 | Bacteria | 7334 |
| 513 | Ga0265313_10055574 | 3300031595 | Bacteria | 1875 |
| 514 | Ga0265314_10003949 | 3300031711 | Bacteria | 14062 |
| 515 | Ga0265314_10068326 | 3300031711 | Bacteria | 2389 |
| 516 | Ga0265342_10000912 | 3300031712 | Bacteria | 29335 |
| 517 | Ga0307516_10090465 | 3300031730 | Bacteria | 2889 |
| 518 | Ga0307407_10062753 | 3300031903 | Bacteria | 2178 |
| 519 | Ga0307411_10334840 | 3300032005 | Bacteria | 1228 |
| 520 | Ga0307415_100198287 | 3300032126 | Bacteria | 1590 |
| 521 | Ga0316583_10067483 | 3300032133 | Bacteria | 1252 |
| 522 | Ga0307510_10010287 | 3300033180 | Bacteria | 11113 |
| 523 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 524 | Ga0373930_0006816 | 3300034816 | Bacteria | 1946 |
| 525 | Ga0373926_0002177 | 3300035083 | Bacteria | 6173 |
| 526 | Ga0373926_0026925 | 3300035083 | Bacteria | 2013 |
| 527 | Ga0373928_0004025 | 3300035084 | Bacteria | 2805 |
| 528 | Ga0373928_0013398 | 3300035084 | Bacteria | 1646 |
| 529 | Ga0373929_0003944 | 3300035085 | Bacteria | 2658 |
| 530 | Ga0373934_0004922 | 3300035086 | Bacteria | 4945 |
| 531 | Ga0373934_0006581 | 3300035086 | Bacteria | 4310 |
| 532 | Ga0373940_0001866 | 3300035088 | Bacteria | 3956 |
| 533 | Ga0373944_0002474 | 3300035089 | Bacteria | 4696 |
| 534 | Ga0373944_0056352 | 3300035089 | Bacteria | 1250 |
| 535 | Ga0373949_0004067 | 3300035090 | Bacteria | 3387 |
| 536 | Ga0373951_0008754 | 3300035091 | Bacteria | 2281 |
| 537 | Ga0373951_0020349 | 3300035091 | Bacteria | 1518 |
| 538 | Ga0373952_0001062 | 3300035092 | Bacteria | 5024 |
| 539 | Ga0373923_0010862 | 3300035111 | Bacteria | 3325 |
| 540 | Ga0373923_0032130 | 3300035111 | Bacteria | 2119 |
| 541 | Ga0373923_0039425 | 3300035111 | Bacteria | 1940 |
| 542 | Ga0373932_0009450 | 3300035112 | Bacteria | 2344 |
| 543 | Ga0373936_0003212 | 3300035113 | Bacteria | 6130 |
| 544 | Ga0373936_0021839 | 3300035113 | Bacteria | 2490 |
| 545 | Ga0373939_0000706 | 3300035114 | Bacteria | 8274 |
| 546 | Ga0373939_0072659 | 3300035114 | Bacteria | 1124 |
| 547 | Ga0373941_0007982 | 3300035115 | Bacteria | 2612 |
| 548 | Ga0373941_0032927 | 3300035115 | Bacteria | 1554 |
| 549 | Ga0373945_0006425 | 3300035116 | Bacteria | 3791 |
| 550 | Ga0373953_0009788 | 3300035117 | Bacteria | 3314 |
| 551 | Ga0373954_0064983 | 3300035118 | Bacteria | 1726 |
| 552 | Ga0373956_0009825 | 3300035119 | Bacteria | 3898 |
| 553 | Ga0373956_0019299 | 3300035119 | Bacteria | 2890 |
| 554 | Ga0373943_0002977 | 3300035170 | Bacteria | 7688 |
| 555 | Ga0373946_0006715 | 3300035171 | Bacteria | 4180 |
| 556 | Ga0373946_0037007 | 3300035171 | Bacteria | 1982 |
| 557 | Ga0373946_0077953 | 3300035171 | Bacteria | 1445 |
| 558 | Ga0373955_0003281 | 3300035172 | Bacteria | 7094 |
| 559 | Ga0373955_0009848 | 3300035172 | Bacteria | 4495 |
| 560 | Ga0373955_0048173 | 3300035172 | Bacteria | 2310 |
| 561 | Ga0373961_0006819 | 3300035241 | Bacteria | 2746 |
| 562 | Ga0373961_0049321 | 3300035241 | Bacteria | 1244 |
| 563 | Ga0373961_0063469 | 3300035241 | Bacteria | 1127 |
| 564 | Ga0373962_0000258 | 3300035242 | Bacteria | 11309 |
| 565 | Ga0373962_0015271 | 3300035242 | Bacteria | 1967 |
| 566 | Ga0373924_0004203 | 3300035410 | Bacteria | 5018 |
| 567 | Ga0373931_0005613 | 3300035691 | Bacteria | 5819 |
| 568 | Ga0373931_0017116 | 3300035691 | Bacteria | 3578 |
| 569 | Ga0373935_0000046 | 3300035692 | Bacteria | 48734 |
| 570 | Ga0373935_0012931 | 3300035692 | Bacteria | 5029 |
| 571 | Ga0373935_0175368 | 3300035692 | Bacteria | 1469 |
| 572 | Ga0373927_0000209 | 3300035695 | Bacteria | 46820 |
| 573 | Ga0373927_0020410 | 3300035695 | Bacteria | 4344 |
| 574 | Ga0373927_0084080 | 3300035695 | Bacteria | 2064 |
| 575 | Ga0373927_0182326 | 3300035695 | Bacteria | 1377 |
| 576 | Ga0373927_0196592 | 3300035695 | Bacteria | 1323 |
| 577 | Ga0373927_0373028 | 3300035695 | Bacteria | 941 |
| 578 | Ga0373933_0003160 | 3300035724 | Bacteria | 9199 |
| 579 | Ga0373933_0036726 | 3300035724 | Bacteria | 2870 |
| 580 | Ga0373933_0040475 | 3300035724 | Bacteria | 2746 |
| 581 | Ga0373933_0063278 | 3300035724 | Bacteria | 2236 |
| 582 | Ga0373933_0103089 | 3300035724 | Bacteria | 1772 |
| 583 | Ga0373947_0002886 | 3300035725 | Bacteria | 10264 |
| 584 | Ga0373947_0296030 | 3300035725 | Bacteria | 1078 |
| 585 | Ga0373937_0012815 | 3300036401 | Bacteria | 7383 |
| 586 | Ga0373937_0023444 | 3300036401 | Bacteria | 5556 |
| 587 | Ga0373937_0040665 | 3300036401 | Bacteria | 4238 |
| 588 | Ga0373937_0045771 | 3300036401 | Bacteria | 3999 |
| 589 | Ga0373937_0133441 | 3300036401 | Bacteria | 2320 |
| 590 | Ga0373937_0202587 | 3300036401 | Bacteria | 1866 |
| 591 | Ga0373937_0572521 | 3300036401 | Bacteria | 1073 |
| 592 | Ga0372808_008217 | 3300036459 | Bacteria | 1443 |
| 593 | Ga0373925_0005099 | 3300037068 | Bacteria | 9835 |
| 594 | Ga0373925_0037718 | 3300037068 | Bacteria | 3569 |
| 595 | Ga0373925_0126389 | 3300037068 | Bacteria | 1990 |
| 596 | Ga0373925_0370250 | 3300037068 | Bacteria | 1165 |
| 597 | Ga0395900_0005151 | 3300037418 | Bacteria | 13732 |
| 598 | Ga0395900_0105347 | 3300037418 | Bacteria | 2897 |
| 599 | Ga0395898_0003493 | 3300037466 | Bacteria | 17565 |
| 600 | Ga0395898_0036540 | 3300037466 | Bacteria | 4877 |
| 601 | Ga0395901_0043590 | 3300038443 | Bacteria | 4653 |
| 602 | Ga0436365_0911459 | 3300039437 | Bacteria | 3343 |
| 603 | Ga0436365_1148686 | 3300039437 | Bacteria | 18630 |
| 604 | Ga0436365_1181233 | 3300039437 | Bacteria | 4977 |
| 605 | Ga0436365_1422081 | 3300039437 | Bacteria | 3254 |
| 606 | Ga0436363_0927837 | 3300039450 | Bacteria | 5750 |
| 607 | Ga0451793_1659208 | 3300041452 | Bacteria | 2586 |
| 608 | Ga0451800_1674697 | 3300041459 | Bacteria | 1001 |
| 609 | Ga0451807_0850701 | 3300041486 | Bacteria | 2875 |
| 610 | Ga0451807_1403845 | 3300041486 | Bacteria | 1097 |
| 611 | Ga0439445_0045246 | 3300042004 | Bacteria | 1177 |
| 612 | Ga0466963_0091246 | 3300044694 | Bacteria | 2075 |
| 613 | Ga0466963_0092478 | 3300044694 | Bacteria | 2061 |
| 614 | Ga0466963_0109353 | 3300044694 | Bacteria | 1896 |
| 615 | Ga0495617_053834 | 3300046452 | Bacteria | 1336 |
| 616 | Ga0495592_0000513 | 3300046454 | Bacteria | 28143 |
| 617 | Ga0495592_0008115 | 3300046454 | Bacteria | 7885 |
| 618 | Ga0495592_0169782 | 3300046454 | Bacteria | 1495 |
| 619 | Ga0495603_0000153 | 3300046455 | Bacteria | 34539 |
| 620 | Ga0495603_0035918 | 3300046455 | Bacteria | 2975 |
| 621 | Ga0495629_0007084 | 3300046459 | Bacteria | 8262 |
| 622 | Ga0495629_0033278 | 3300046459 | Bacteria | 3647 |
| 623 | Ga0495638_0028639 | 3300046460 | Bacteria | 3594 |
| 624 | Ga0495641_0008708 | 3300046461 | Bacteria | 6137 |
| 625 | Ga0495641_0094615 | 3300046461 | Bacteria | 1334 |
| 626 | Ga0495651_0025967 | 3300046462 | Bacteria | 4560 |
| 627 | Ga0495651_0027931 | 3300046462 | Bacteria | 4398 |
| 628 | Ga0495651_0204633 | 3300046462 | Bacteria | 1379 |
| 629 | Ga0495653_0000912 | 3300046463 | Bacteria | 22874 |
| 630 | Ga0495653_0019530 | 3300046463 | Bacteria | 5495 |
| 631 | Ga0495653_0026746 | 3300046463 | Bacteria | 4624 |
| 632 | Ga0495653_0095109 | 3300046463 | Bacteria | 2170 |
| 633 | Ga0495653_0105670 | 3300046463 | Bacteria | 2032 |
| 634 | Ga0495580_0000246 | 3300046472 | Bacteria | 43076 |
| 635 | Ga0495580_0026873 | 3300046472 | Bacteria | 4192 |
| 636 | Ga0495580_0098423 | 3300046472 | Bacteria | 2034 |
| 637 | Ga0495582_0000686 | 3300046473 | Bacteria | 18641 |
| 638 | Ga0495582_0033766 | 3300046473 | Bacteria | 2813 |
| 639 | Ga0495639_0000799 | 3300046475 | Bacteria | 14377 |
| 640 | Ga0495662_0029283 | 3300046476 | Bacteria | 2659 |
| 641 | Ga0495662_0043882 | 3300046476 | Bacteria | 2158 |
| 642 | Ga0495662_0074205 | 3300046476 | Bacteria | 1650 |
| 643 | Ga0495664_0015494 | 3300046477 | Bacteria | 4334 |
| 644 | Ga0495664_0051228 | 3300046477 | Bacteria | 2451 |
| 645 | Ga0495664_0073934 | 3300046477 | Bacteria | 2038 |
| 646 | Ga0495664_0085121 | 3300046477 | Bacteria | 1898 |
| 647 | Ga0495584_0006986 | 3300046491 | Bacteria | 5897 |
| 648 | Ga0495584_0103335 | 3300046491 | Bacteria | 1441 |
| 649 | Ga0495585_0004083 | 3300046492 | Bacteria | 9592 |
| 650 | Ga0495594_0000243 | 3300046499 | Bacteria | 26402 |
| 651 | Ga0495594_0057740 | 3300046499 | Bacteria | 2143 |
| 652 | Ga0495607_0038217 | 3300046501 | Bacteria | 2877 |
| 653 | Ga0495606_0232159 | 3300046507 | Bacteria | 1033 |
| 654 | Ga0495608_0008983 | 3300046511 | Bacteria | 6987 |
| 655 | Ga0495608_0022196 | 3300046511 | Bacteria | 4350 |
| 656 | Ga0495608_0281239 | 3300046511 | Bacteria | 1033 |
| 657 | Ga0495618_0002089 | 3300046514 | Bacteria | 13103 |
| 658 | Ga0495618_0104308 | 3300046514 | Bacteria | 1815 |
| 659 | Ga0495620_0019530 | 3300046515 | Bacteria | 3330 |
| 660 | Ga0495628_0011083 | 3300046516 | Bacteria | 7628 |
| 661 | Ga0495628_0034712 | 3300046516 | Bacteria | 4056 |
| 662 | Ga0495628_0054964 | 3300046516 | Bacteria | 3137 |
| 663 | Ga0495630_0062267 | 3300046517 | Bacteria | 2802 |
| 664 | Ga0495630_0123501 | 3300046517 | Bacteria | 1964 |
| 665 | Ga0495630_0565085 | 3300046517 | Bacteria | 872 |
| 666 | Ga0495632_0000006 | 3300046519 | Bacteria | 345883 |
| 667 | Ga0495632_0155594 | 3300046519 | Bacteria | 1055 |
| 668 | Ga0495637_0000784 | 3300046520 | Bacteria | 21358 |
| 669 | Ga0495643_0000021 | 3300046522 | Bacteria | 293465 |
| 670 | Ga0495644_0003549 | 3300046523 | Bacteria | 6164 |
| 671 | Ga0495648_0038726 | 3300046524 | Bacteria | 3044 |
| 672 | Ga0495648_0069726 | 3300046524 | Bacteria | 2045 |
| 673 | Ga0495663_0000008 | 3300046525 | Bacteria | 260614 |
| 674 | Ga0495663_0020493 | 3300046525 | Bacteria | 1898 |
| 675 | Ga0495666_0100331 | 3300046526 | Bacteria | 1364 |
| 676 | Ga0495652_0028963 | 3300046529 | Bacteria | 4865 |
| 677 | Ga0495652_0040789 | 3300046529 | Bacteria | 4012 |
| 678 | Ga0495652_0195762 | 3300046529 | Bacteria | 1538 |
| 679 | Ga0495665_0000341 | 3300046531 | Bacteria | 23627 |
| 680 | Ga0495665_0011091 | 3300046531 | Bacteria | 4877 |
| 681 | Ga0495665_0205783 | 3300046531 | Bacteria | 1019 |
| 682 | Ga0495640_0000521 | 3300046533 | Bacteria | 28196 |
| 683 | Ga0495640_0067780 | 3300046533 | Bacteria | 2403 |
| 684 | Ga0495640_0138997 | 3300046533 | Bacteria | 1566 |
| 685 | Ga0495640_0155157 | 3300046533 | Bacteria | 1469 |
| 686 | Ga0495586_0182752 | 3300046535 | Bacteria | 1186 |
| 687 | Ga0495587_0113466 | 3300046536 | Bacteria | 1555 |
| 688 | Ga0495587_0130609 | 3300046536 | Bacteria | 1436 |
| 689 | Ga0495598_0029638 | 3300046537 | Bacteria | 1527 |
| 690 | Ga0495609_0030375 | 3300046538 | Bacteria | 2459 |
| 691 | Ga0495645_0001151 | 3300046543 | Bacteria | 17952 |
| 692 | Ga0495645_0075566 | 3300046543 | Bacteria | 2425 |
| 693 | Ga0495645_0080582 | 3300046543 | Bacteria | 2336 |
| 694 | Ga0495622_0006107 | 3300046557 | Bacteria | 5596 |
| 695 | Ga0495622_0011002 | 3300046557 | Bacteria | 4175 |
| 696 | Ga0495633_0000247 | 3300046558 | Bacteria | 64533 |
| 697 | Ga0495633_0001265 | 3300046558 | Bacteria | 20151 |
| 698 | Ga0495633_0018376 | 3300046558 | Bacteria | 3551 |
| 699 | Ga0495667_0027764 | 3300046559 | Bacteria | 3811 |
| 700 | Ga0495667_0033180 | 3300046559 | Bacteria | 3455 |
| 701 | Ga0495667_0116845 | 3300046559 | Bacteria | 1723 |
| 702 | Ga0495656_0000297 | 3300046615 | Bacteria | 17243 |
| 703 | Ga0495656_0057004 | 3300046615 | Bacteria | 1690 |
| 704 | Ga0495656_0221867 | 3300046615 | Bacteria | 945 |
| 705 | Ga0495668_0194952 | 3300046616 | Bacteria | 1109 |
| 706 | Ga0495634_0006489 | 3300046642 | Bacteria | 8886 |
| 707 | Ga0495611_0031638 | 3300046648 | Bacteria | 2330 |
| 708 | Ga0495611_0177172 | 3300046648 | Bacteria | 996 |
| 709 | Ga0495635_0000470 | 3300046663 | Bacteria | 25525 |
| 710 | Ga0495635_0011642 | 3300046663 | Bacteria | 6164 |
| 711 | Ga0495659_0008457 | 3300046664 | Bacteria | 3275 |
| 712 | Ga0495588_0007378 | 3300046674 | Bacteria | 4999 |
| 713 | Ga0495588_0008423 | 3300046674 | Bacteria | 4732 |
| 714 | Ga0495657_0009329 | 3300046675 | Bacteria | 7447 |
| 715 | Ga0495657_0064306 | 3300046675 | Bacteria | 2417 |
| 716 | Ga0495657_0135465 | 3300046675 | Bacteria | 1539 |
| 717 | Ga0495599_0018304 | 3300046678 | Bacteria | 4365 |
| 718 | Ga0495599_0125811 | 3300046678 | Bacteria | 1593 |
| 719 | Ga0495623_0017571 | 3300046679 | Bacteria | 4620 |
| 720 | Ga0495646_0009857 | 3300046680 | Bacteria | 6070 |
| 721 | Ga0495646_0014448 | 3300046680 | Bacteria | 5021 |
| 722 | Ga0495647_0002355 | 3300046681 | Bacteria | 5935 |
| 723 | Ga0495647_0024406 | 3300046681 | Bacteria | 2201 |
| 724 | Ga0495647_0074420 | 3300046681 | Bacteria | 1365 |
| 725 | Ga0495658_0003407 | 3300046683 | Bacteria | 7873 |
| 726 | Ga0495669_0018118 | 3300046684 | Bacteria | 3025 |
| 727 | Ga0495613_0079747 | 3300046689 | Bacteria | 2380 |
| 728 | Ga0495624_0000144 | 3300046690 | Bacteria | 51509 |
| 729 | Ga0495624_0231186 | 3300046690 | Bacteria | 1120 |
| 730 | Ga0495670_0002440 | 3300046691 | Bacteria | 9182 |
| 731 | Ga0495670_0012052 | 3300046691 | Bacteria | 4254 |
| 732 | Ga0495671_0000017 | 3300046692 | Bacteria | 293465 |
| 733 | Ga0495589_0022874 | 3300046794 | Bacteria | 3187 |
| 734 | Ga0495589_0027347 | 3300046794 | Bacteria | 2884 |
| 735 | Ga0495600_0075284 | 3300046809 | Bacteria | 2204 |
| 736 | Ga0495600_0114453 | 3300046809 | Bacteria | 1756 |
| 737 | Ga0495581_0000223 | 3300047315 | Bacteria | 26718 |
| 738 | Ga0495604_0006502 | 3300047317 | Bacteria | 9261 |
| 739 | Ga0495604_0010832 | 3300047317 | Bacteria | 7242 |
| 740 | Ga0495604_0028443 | 3300047317 | Bacteria | 4447 |
| 741 | Ga0495674_0000700 | 3300047319 | Bacteria | 31695 |
| 742 | Ga0495674_0050715 | 3300047319 | Bacteria | 3661 |
| 743 | Ga0495676_0012616 | 3300047321 | Bacteria | 7606 |
| 744 | Ga0495676_0052101 | 3300047321 | Bacteria | 3269 |
| 745 | Ga0495676_0088961 | 3300047321 | Bacteria | 2314 |
| 746 | Ga0495680_0133466 | 3300047322 | Bacteria | 1822 |
| 747 | Ga0495673_0045725 | 3300047469 | Bacteria | 1944 |
| 748 | Ga0495681_0054630 | 3300047470 | Bacteria | 1865 |
| 749 | Ga0495684_0008189 | 3300047471 | Bacteria | 8090 |
| 750 | Ga0495684_0019592 | 3300047471 | Bacteria | 5213 |
| 751 | Ga0495684_0070264 | 3300047471 | Bacteria | 2662 |
| 752 | Ga0495686_0154635 | 3300047472 | Bacteria | 1344 |
| 753 | Ga0495593_0000007 | 3300047673 | Bacteria | 87657 |
| 754 | Ga0495593_0053018 | 3300047673 | Bacteria | 2141 |
| 755 | Ga0495593_0109969 | 3300047673 | Bacteria | 1408 |
| 756 | Ga0495602_0046224 | 3300048088 | Bacteria | 3934 |
| 757 | Ga0495602_0064510 | 3300048088 | Bacteria | 3166 |
| 758 | Ga0495602_0262997 | 3300048088 | Bacteria | 1279 |
| 759 | Ga0495614_0064488 | 3300048089 | Bacteria | 1575 |
| 760 | Ga0496100_0001439 | 3300048903 | Bacteria | 11651 |
| 761 | Ga0496100_0042849 | 3300048903 | Bacteria | 2892 |
| 762 | Ga0496101_0000171 | 3300048904 | Bacteria | 53757 |
| 763 | Ga0496101_0014780 | 3300048904 | Bacteria | 5251 |
| 764 | Ga0496101_0067795 | 3300048904 | Bacteria | 2606 |
| 765 | Ga0496101_0097188 | 3300048904 | Bacteria | 2199 |
| 766 | Ga0496101_0106117 | 3300048904 | Bacteria | 2109 |
| 767 | Ga0496101_0198928 | 3300048904 | Bacteria | 1548 |
| 768 | Ga0496102_0004728 | 3300048905 | Bacteria | 11530 |
| 769 | Ga0496102_0062018 | 3300048905 | Bacteria | 3423 |
| 770 | Ga0496102_0072433 | 3300048905 | Bacteria | 3166 |
| 771 | Ga0496102_0170807 | 3300048905 | Bacteria | 2047 |
| 772 | Ga0496103_0001994 | 3300048906 | Bacteria | 13160 |
| 773 | Ga0496103_0033981 | 3300048906 | Bacteria | 3117 |
| 774 | Ga0496103_0051430 | 3300048906 | Bacteria | 2550 |
| 775 | Ga0496103_0130948 | 3300048906 | Bacteria | 1602 |
| 776 | Ga0496104_0000067 | 3300048907 | Bacteria | 108556 |
| 777 | Ga0496104_0086181 | 3300048907 | Bacteria | 2998 |
| 778 | Ga0496104_0226813 | 3300048907 | Bacteria | 1780 |
| 779 | Ga0496104_0255365 | 3300048907 | Bacteria | 1665 |
| 780 | Ga0496104_0313519 | 3300048907 | Bacteria | 1481 |
| 781 | Ga0496104_0324287 | 3300048907 | Bacteria | 1453 |
| 782 | Ga0496105_0000130 | 3300048908 | Bacteria | 50576 |
| 783 | Ga0496105_0016996 | 3300048908 | Bacteria | 5822 |
| 784 | Ga0496105_0086060 | 3300048908 | Bacteria | 2597 |
| 785 | Ga0496106_0000581 | 3300048909 | Bacteria | 26118 |
| 786 | Ga0496106_0031601 | 3300048909 | Bacteria | 3946 |
| 787 | Ga0496106_0107536 | 3300048909 | Bacteria | 2169 |
| 788 | Ga0496106_0145671 | 3300048909 | Bacteria | 1865 |
| 789 | Ga0496107_0000224 | 3300048910 | Bacteria | 29999 |
| 790 | Ga0496107_0016922 | 3300048910 | Bacteria | 5126 |
| 791 | Ga0496108_0000547 | 3300048911 | Bacteria | 29390 |
| 792 | Ga0496108_0031606 | 3300048911 | Bacteria | 4393 |
| 793 | Ga0496108_0051587 | 3300048911 | Bacteria | 3446 |
| 794 | Ga0496108_0071071 | 3300048911 | Bacteria | 2936 |
| 795 | Ga0496108_0153649 | 3300048911 | Bacteria | 1986 |
| 796 | Ga0496109_0000384 | 3300048912 | Bacteria | 40091 |
| 797 | Ga0496109_0014332 | 3300048912 | Bacteria | 6898 |
| 798 | Ga0496109_0045791 | 3300048912 | Bacteria | 3971 |
| 799 | Ga0496109_0173137 | 3300048912 | Bacteria | 2025 |
| 800 | Ga0496109_0449569 | 3300048912 | Bacteria | 1217 |
| 801 | Ga0496109_0605465 | 3300048912 | Bacteria | 1032 |
| 802 | Ga0496110_0008712 | 3300048913 | Bacteria | 8169 |
| 803 | Ga0496110_0018951 | 3300048913 | Bacteria | 5782 |
| 804 | Ga0496110_0101203 | 3300048913 | Bacteria | 2583 |
| 805 | Ga0496111_0005888 | 3300048914 | Bacteria | 7904 |
| 806 | Ga0496111_0081880 | 3300048914 | Bacteria | 2357 |
| 807 | Ga0496111_0227857 | 3300048914 | Bacteria | 1384 |
| 808 | Ga0496112_0087114 | 3300048915 | Bacteria | 3090 |
| 809 | Ga0496112_0095365 | 3300048915 | Bacteria | 2945 |
| 810 | Ga0496112_0226817 | 3300048915 | Bacteria | 1823 |
| 811 | Ga0496113_0122603 | 3300048916 | Bacteria | 2033 |
| 812 | Ga0496114_0004538 | 3300048917 | Bacteria | 10780 |
| 813 | Ga0496114_0009885 | 3300048917 | Bacteria | 7582 |
| 814 | Ga0496114_0027436 | 3300048917 | Bacteria | 4665 |
| 815 | Ga0496114_0061841 | 3300048917 | Bacteria | 3133 |
| 816 | Ga0496114_0346705 | 3300048917 | Bacteria | 1313 |
| 817 | Ga0496115_0000826 | 3300048918 | Bacteria | 22686 |
| 818 | Ga0496115_0115152 | 3300048918 | Bacteria | 2210 |
| 819 | Ga0496117_0053499 | 3300048920 | Bacteria | 2836 |
| 820 | Ga0496118_0027463 | 3300048921 | Bacteria | 4816 |
| 821 | Ga0496119_0048946 | 3300048922 | Bacteria | 2617 |
| 822 | Ga0496121_0003211 | 3300048924 | Bacteria | 23523 |
| 823 | Ga0496121_0039220 | 3300048924 | Bacteria | 4179 |
| 824 | Ga0496121_0046169 | 3300048924 | Bacteria | 3731 |
| 825 | Ga0496121_0048197 | 3300048924 | Bacteria | 3627 |
| 826 | Ga0496121_0161441 | 3300048924 | Bacteria | 1638 |
| 827 | Ga0496121_0247341 | 3300048924 | Bacteria | 1239 |
| 828 | Ga0496125_0019978 | 3300048928 | Bacteria | 6298 |
| 829 | Ga0496125_0108084 | 3300048928 | Bacteria | 2025 |
| 830 | Ga0496125_0116572 | 3300048928 | Bacteria | 1918 |
| 831 | Ga0496126_0027170 | 3300048929 | Bacteria | 5471 |
| 832 | Ga0496126_0030950 | 3300048929 | Bacteria | 5062 |
| 833 | Ga0496126_0040378 | 3300048929 | Bacteria | 4325 |
| 834 | Ga0496126_0060648 | 3300048929 | Bacteria | 3401 |
| 835 | Ga0496126_0157417 | 3300048929 | Bacteria | 1943 |
| 836 | Ga0495678_079984 | 3300049459 | Bacteria | 1176 |
| 837 | Ga0495682_0105118 | 3300049460 | Bacteria | 1012 |
| 838 | Ga0501031_0004917 | 3300049568 | Bacteria | 8682 |
| 839 | Ga0501031_0013835 | 3300049568 | Bacteria | 5257 |
| 840 | Ga0501032_0152192 | 3300049569 | Bacteria | 1520 |
| 841 | Ga0501032_0177883 | 3300049569 | Bacteria | 1393 |
| 842 | Ga0501033_0018842 | 3300049570 | Bacteria | 5219 |
| 843 | Ga0501034_0000374 | 3300049571 | Bacteria | 76280 |
| 844 | Ga0501034_0044836 | 3300049571 | Bacteria | 4470 |
| 845 | Ga0501034_0082021 | 3300049571 | Bacteria | 3227 |
| 846 | Ga0501034_0213838 | 3300049571 | Bacteria | 1882 |
| 847 | Ga0501037_0042826 | 3300049573 | Bacteria | 3327 |
| 848 | Ga0501037_0050928 | 3300049573 | Bacteria | 3029 |
| 849 | Ga0501037_0156941 | 3300049573 | Bacteria | 1623 |
| 850 | Ga0501037_0180327 | 3300049573 | Bacteria | 1498 |
| 851 | Ga0501038_0008546 | 3300049574 | Bacteria | 9402 |
| 852 | Ga0501038_0027921 | 3300049574 | Bacteria | 5015 |
| 853 | Ga0501038_0056927 | 3300049574 | Bacteria | 3357 |
| 854 | Ga0501038_0076965 | 3300049574 | Bacteria | 2817 |
| 855 | Ga0501039_0066565 | 3300049575 | Bacteria | 2796 |
| 856 | Ga0501039_0085658 | 3300049575 | Bacteria | 2454 |
| 857 | Ga0501042_0000540 | 3300049578 | Bacteria | 19832 |
| 858 | Ga0501043_0064916 | 3300049579 | Bacteria | 2866 |
| 859 | Ga0501047_0026583 | 3300049581 | Bacteria | 5569 |
| 860 | Ga0501047_0131910 | 3300049581 | Bacteria | 2378 |
| 861 | Ga0501047_0211521 | 3300049581 | Bacteria | 1798 |
| 862 | Ga0501047_0337754 | 3300049581 | Bacteria | 1344 |
| 863 | Ga0501048_0004376 | 3300049582 | Bacteria | 10754 |
| 864 | Ga0501048_0028790 | 3300049582 | Bacteria | 4032 |
| 865 | Ga0501067_0016188 | 3300049583 | Bacteria | 4121 |
| 866 | Ga0501067_0113207 | 3300049583 | Bacteria | 1509 |
| 867 | Ga0501068_0003581 | 3300049584 | Bacteria | 8390 |
| 868 | Ga0501068_0060938 | 3300049584 | Bacteria | 2291 |
| 869 | Ga0501070_0011451 | 3300049586 | Bacteria | 7494 |
| 870 | Ga0501070_0048479 | 3300049586 | Bacteria | 3528 |
| 871 | Ga0501070_0054294 | 3300049586 | Bacteria | 3323 |
| 872 | Ga0501070_0097039 | 3300049586 | Bacteria | 2438 |
| 873 | Ga0501070_0109225 | 3300049586 | Bacteria | 2285 |
| 874 | Ga0501070_0207521 | 3300049586 | Bacteria | 1609 |
| 875 | Ga0501070_0446074 | 3300049586 | Bacteria | 1043 |
| 876 | Ga0501071_0005036 | 3300049587 | Bacteria | 8452 |
| 877 | Ga0501071_0038623 | 3300049587 | Bacteria | 3412 |
| 878 | Ga0501071_0083933 | 3300049587 | Bacteria | 2334 |
| 879 | Ga0501073_0030477 | 3300049589 | Bacteria | 3851 |
| 880 | Ga0501073_0052182 | 3300049589 | Bacteria | 2863 |
| 881 | Ga0501074_0091026 | 3300049590 | Bacteria | 2184 |
| 882 | Ga0501074_0100324 | 3300049590 | Bacteria | 2072 |
| 883 | Ga0501077_0204245 | 3300049593 | Bacteria | 1255 |
| 884 | Ga0501079_0004156 | 3300049741 | Bacteria | 10725 |
| 885 | Ga0501079_0201545 | 3300049741 | Bacteria | 1554 |
| 886 | Ga0501080_0028227 | 3300049742 | Bacteria | 5218 |
| 887 | Ga0501080_0113590 | 3300049742 | Bacteria | 2511 |
| 888 | Ga0501080_0266947 | 3300049742 | Bacteria | 1558 |
| 889 | Ga0501083_0009046 | 3300049744 | Bacteria | 7032 |
| 890 | Ga0501083_0081573 | 3300049744 | Bacteria | 2144 |
| 891 | Ga0501083_0098641 | 3300049744 | Bacteria | 1927 |
| 892 | Ga0501083_0147005 | 3300049744 | Bacteria | 1543 |
| 893 | Ga0501035_0148087 | 3300049822 | Bacteria | 2038 |
| 894 | Ga0501044_0128910 | 3300049823 | Bacteria | 2525 |
| 895 | Ga0501044_0210315 | 3300049823 | Bacteria | 1899 |
| 896 | Ga0501044_0321533 | 3300049823 | Bacteria | 1471 |
| 897 | Ga0501044_0406915 | 3300049823 | Bacteria | 1272 |
| 898 | Ga0501045_0028721 | 3300049824 | Bacteria | 4013 |
| 899 | Ga0501045_0239732 | 3300049824 | Bacteria | 1350 |
| 900 | nmdc:mga03683_132339_c1 | 3300050489 | Bacteria | 1116 |
| 901 | nmdc:mga03683_25287_c1 | 3300050489 | Bacteria | 2330 |
| 902 | nmdc:mga03n38_63288_c1 | 3300050490 | Bacteria | 1690 |
| 903 | nmdc:mga0yw44_141276_c1 | 3300050492 | Bacteria | 1565 |
| 904 | nmdc:mga06z11_12623_c1 | 3300050494 | Bacteria | 3680 |
| 905 | nmdc:mga04h51_8061_c1 | 3300050495 | Bacteria | 2806 |
| 906 | nmdc:mga0qj67_43999_c1 | 3300050509 | Bacteria | 3517 |
| 907 | nmdc:mga08y16_203714_c1 | 3300050511 | Bacteria | 2050 |
| 908 | nmdc:mga08y16_257184_c1 | 3300050511 | Bacteria | 1804 |
| 909 | nmdc:mga0n895_165280_c1 | 3300050512 | Bacteria | 2245 |
| 910 | nmdc:mga0n895_744324_c1 | 3300050512 | Bacteria | 974 |
| 911 | nmdc:mga0rr50_258245_c1 | 3300050513 | Bacteria | 1449 |
| 912 | nmdc:mga08x19_180973_c1 | 3300050514 | Bacteria | 1439 |
| 913 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 914 | nmdc:mga08x19_88601_c1 | 3300050514 | Bacteria | 2040 |
| 915 | Ga0495601_0000237 | 3300053077 | Bacteria | 29469 |
| 916 | Ga0495601_0003203 | 3300053077 | Bacteria | 9363 |
| 917 | Ga0495601_0011542 | 3300053077 | Bacteria | 5291 |
| 918 | Ga0495601_0019726 | 3300053077 | Bacteria | 4115 |
| 919 | Ga0495612_0000563 | 3300053078 | Bacteria | 14886 |
| 920 | Ga0495612_0003858 | 3300053078 | Bacteria | 6224 |
| 921 | Ga0495612_0011052 | 3300053078 | Bacteria | 3644 |
| 922 | Ga0495612_0025831 | 3300053078 | Bacteria | 2359 |
| 923 | Ga0495612_0029435 | 3300053078 | Bacteria | 2212 |
| 924 | Ga0495655_0021718 | 3300053083 | Bacteria | 1457 |
| 925 | Ga0495595_0006203 | 3300053084 | Bacteria | 4864 |
| 926 | Ga0495595_0008416 | 3300053084 | Bacteria | 4231 |
| 927 | Ga0495595_0022604 | 3300053084 | Bacteria | 2761 |
| 928 | Ga0495595_0232034 | 3300053084 | Bacteria | 922 |
| 929 | Ga0495619_0000343 | 3300053085 | Bacteria | 32522 |
| 930 | Ga0495619_0006532 | 3300053085 | Bacteria | 7381 |
| 931 | Ga0495619_0006775 | 3300053085 | Bacteria | 7246 |
| 932 | Ga0495619_0279132 | 3300053085 | Bacteria | 1157 |
| 933 | Ga0500595_001229 | 3300053119 | Bacteria | 14141 |
| 934 | Ga0500577_0016765 | 3300053142 | Bacteria | 2318 |
| 935 | Ga0500577_0079634 | 3300053142 | Bacteria | 1303 |
| 936 | Ga0500588_0041124 | 3300053146 | Bacteria | 1393 |
| 937 | Ga0500589_096076 | 3300053147 | Bacteria | 1295 |
| 938 | Ga0501084_0153751 | 3300054114 | Bacteria | 1940 |
| 939 | Ga0501084_0259381 | 3300054114 | Bacteria | 1467 |
| 940 | Ga0501082_0049053 | 3300060353 | Bacteria | 3640 |
| 941 | Ga0501082_0049262 | 3300060353 | Bacteria | 3632 |
| 942 | Ga0501082_0547648 | 3300060353 | Bacteria | 1012 |
| 943 | Ga0466962_0161774 | 3300061719 | Bacteria | 1088 |
| 944 | 2513718143 | 2513237104 | Bacteria | 10034502 |
| 945 | 2513863320 | 2513237137 | Bacteria | 9558895 |
| 946 | 2513922584 | 2513237145 | Bacteria | 8979722 |
| 947 | 2517888934 | 2517572143 | Bacteria | 9484767 |
| 948 | 2524466953 | 2524023210 | Bacteria | 9029266 |
| 949 | 2524537367 | 2524023228 | Bacteria | 10118060 |
| 950 | 2643758171 | 2643221547 | Bacteria | 4740017 |
| 951 | 2723841718 | 2721755755 | Bacteria | 8322773 |
| 952 | 2744955300 | 2744054611 | Bacteria | 5611514 |
| 953 | 2793080847 | |||
| 954 | 2876808980 | 2876808645 | Bacteria | 8824342 |
| 955 | 2879113420 | 2879110137 | Bacteria | 8907982 |
| 956 | 2881668106 | 2881665667 | Bacteria | 8175609 |
| 957 | 2885390396 | 2885383462 | Bacteria | 9473874 |
| 958 | 2904708538 | |||
| 959 | 2906613985 | |||
| 960 | 2908747539 | 2908739725 | Bacteria | 8628932 |
| 961 | 2922392503 | 2922386360 | Bacteria | 7017218 |
| 962 | 2935637048 | 2935630451 | Bacteria | 8169952 |
| 963 | 2941513685 | 2941507105 | Bacteria | 8166816 |
| 964 | 2941521648 | 2941515067 | Bacteria | 8166720 |
| 965 | 2941529403 | 2941523033 | Bacteria | 8169134 |
| 966 | 8006936119 | 8006933436 | Bacteria | 10410654 |
| 967 | 8006967536 | 8006964411 | Bacteria | 8966052 |
| 968 | 8006976046 | 8006973647 | Bacteria | 10679141 |
| 969 | 8006990999 | 8006984368 | Bacteria | 9651211 |
| 970 | 8056687156 | 8056681323 | Bacteria | 8472857 |
| 971 | 8056691034 | 8056689827 | Bacteria | 6712655 |
| 972 | Ga0501035_0000859 | |||
| 973 | JGI24747J21853_1000169 | |||
| 974 | JGI24740J21852_10022911 | |||
| 975 | JGI24739J22299_10000897 | |||
| 976 | JGI24739J22299_10001524 | |||
| 977 | JGI24739J22299_10003887 | |||
| 978 | JGI24737J22298_10009404 | |||
| 979 | JGI24737J22298_10017120 | |||
| 980 | JGI24735J21928_10003487 | |||
| 981 | JGI24750J21931_1000745 | |||
| 982 | JGI24745J21846_1000061 | |||
| 983 | JGI24748J21848_1000185 | |||
| 984 | JGI24738J21930_10000067 | |||
| 985 | JGI24749J21850_1001798 | |||
| 986 | JGI24035J26624_1000005 | |||
| 987 | JGI24035J26624_1000190 | |||
| 988 | JGI24033J26618_1000613 | |||
| 989 | JGI24034J26672_10000951 | |||
| 990 | JGI24742J22300_10000153 | |||
| 991 | JGI25165J46597_1006892 | |||
| 992 | JGI25153J46596_10038430 | |||
| 993 | rootH2_10045331 | |||
| 994 | rootH2_10046910 | |||
| 995 | JGI25160J50197_1014601 | |||
| 996 | Ga0065712_10130182 | |||
| 997 | Ga0065715_10008690 | |||
| 998 | Ga0065707_10268785 | |||
| 999 | Ga0070676_10000332 | |||
| 1000 | Ga0070676_10066999 | |||
| 1001 | Ga0070676_10068867 | |||
| 1002 | Ga0070683_100004171 | |||
| 1003 | Ga0070690_100005079 | |||
| 1004 | Ga0070690_100046391 | |||
| 1005 | Ga0070670_100023341 | |||
| 1006 | Ga0070677_10000258 | |||
| 1007 | Ga0068869_100000510 | |||
| 1008 | Ga0070666_10004570 | |||
| 1009 | Ga0070666_10019282 | |||
| 1010 | Ga0070680_100001476 | |||
| 1011 | Ga0070680_100012038 | |||
| 1012 | Ga0070682_100003255 | |||
| 1013 | Ga0068868_100000148 | |||
| 1014 | Ga0070660_100001314 | |||
| 1015 | Ga0070660_100003272 | |||
| 1016 | Ga0070689_100001783 | |||
| 1017 | Ga0070689_100014799 | |||
| 1018 | Ga0070691_10035255 | |||
| 1019 | Ga0070687_100000318 | |||
| 1020 | Ga0070687_100323504 | |||
| 1021 | Ga0070661_100000768 | |||
| 1022 | Ga0070661_100127357 | |||
| 1023 | Ga0070692_10011615 | |||
| 1024 | Ga0070668_100051792 | |||
| 1025 | Ga0070668_100093298 | |||
| 1026 | Ga0070668_100137565 | |||
| 1027 | Ga0070669_100003445 | |||
| 1028 | Ga0070675_100001491 | |||
| 1029 | Ga0070675_100108142 | |||
| 1030 | Ga0070675_100174255 | |||
| 1031 | Ga0070671_100003997 | |||
| 1032 | Ga0070671_100043030 | |||
| 1033 | Ga0070671_100352254 | |||
| 1034 | Ga0070674_100001355 | |||
| 1035 | Ga0070674_100139731 | |||
| 1036 | Ga0070674_100213607 | |||
| 1037 | Ga0070673_100000670 | |||
| 1038 | Ga0070673_100008314 | |||
| 1039 | Ga0070673_100053400 | |||
| 1040 | Ga0070673_100134138 | |||
| 1041 | Ga0070688_100031440 | |||
| 1042 | Ga0070688_100070770 | |||
| 1043 | Ga0070659_100001400 | |||
| 1044 | Ga0070659_100064806 | |||
| 1045 | Ga0070659_100108095 | |||
| 1046 | Ga0070659_100115234 | |||
| 1047 | Ga0070659_100159673 | |||
| 1048 | Ga0070667_100002340 | |||
| 1049 | Ga0070667_100061422 | |||
| 1050 | Ga0070703_10013030 | |||
| 1051 | Ga0070709_10022655 | |||
| 1052 | Ga0070714_100103577 | |||
| 1053 | Ga0070714_100256895 | |||
| 1054 | Ga0070713_100000838 | |||
| 1055 | Ga0070713_100015088 | |||
| 1056 | Ga0070713_100043089 | |||
| 1057 | Ga0070713_100129808 | |||
| 1058 | Ga0070713_100205600 | |||
| 1059 | Ga0070713_100219622 | |||
| 1060 | Ga0070710_10003726 | |||
| 1061 | Ga0070710_10012469 | |||
| 1062 | Ga0070710_10049287 | |||
| 1063 | Ga0070701_10019659 | |||
| 1064 | Ga0070701_10128181 | |||
| 1065 | Ga0070711_100028348 | |||
| 1066 | Ga0070711_100043244 | |||
| 1067 | Ga0070711_100055772 | |||
| 1068 | Ga0070711_100172289 | |||
| 1069 | Ga0070705_100001500 | |||
| 1070 | Ga0070705_100341336 | |||
| 1071 | Ga0070700_100001568 | |||
| 1072 | Ga0070700_100107815 | |||
| 1073 | Ga0070708_100105830 | |||
| 1074 | Ga0070708_100193052 | |||
| 1075 | Ga0070663_100001857 | |||
| 1076 | Ga0070678_100000391 | |||
| 1077 | Ga0070678_100015738 | |||
| 1078 | Ga0070678_100025297 | |||
| 1079 | Ga0070678_100227291 | |||
| 1080 | Ga0070662_100090457 | |||
| 1081 | Ga0070662_100220942 | |||
| 1082 | Ga0070681_10006791 | |||
| 1083 | Ga0068867_100006925 | |||
| 1084 | Ga0070685_10003877 | |||
| 1085 | Ga0070685_10008554 | |||
| 1086 | Ga0070698_100108778 | |||
| 1087 | Ga0070698_100183770 | |||
| 1088 | Ga0070699_100078736 | |||
| 1089 | Ga0070679_100026893 | |||
| 1090 | Ga0070679_100142520 | |||
| 1091 | Ga0070679_100299590 | |||
| 1092 | Ga0070684_100000101 | |||
| 1093 | Ga0070684_100074894 | |||
| 1094 | Ga0068853_100116865 | |||
| 1095 | Ga0068853_100251458 | |||
| 1096 | Ga0070672_100000016 | |||
| 1097 | Ga0070672_100259453 | |||
| 1098 | Ga0070686_100008745 | |||
| 1099 | Ga0070686_100018037 | |||
| 1100 | Ga0070686_100272537 | |||
| 1101 | Ga0070695_100000225 | |||
| 1102 | Ga0070695_100004140 | |||
| 1103 | Ga0070696_100002898 | |||
| 1104 | Ga0070696_100382194 | |||
| 1105 | Ga0070693_100000138 | |||
| 1106 | Ga0070693_100289511 | |||
| 1107 | Ga0070665_100146816 | |||
| 1108 | Ga0070665_100164185 | |||
| 1109 | Ga0070665_100172093 | |||
| 1110 | Ga0070704_100082859 | |||
| 1111 | Ga0068855_100000244 | |||
| 1112 | Ga0068855_100023959 | |||
| 1113 | Ga0068855_100040189 | |||
| 1114 | Ga0068855_100047984 | |||
| 1115 | Ga0068855_100059558 | |||
| 1116 | Ga0068855_100129068 | |||
| 1117 | Ga0068855_100245280 | |||
| 1118 | Ga0070664_100000067 | |||
| 1119 | Ga0070664_100039135 | |||
| 1120 | Ga0070664_100263518 | |||
| 1121 | Ga0068857_100000275 | |||
| 1122 | Ga0068857_100018470 | |||
| 1123 | Ga0068857_100066582 | |||
| 1124 | Ga0068857_100160864 | |||
| 1125 | Ga0068857_100176512 | |||
| 1126 | Ga0068857_100258758 | |||
| 1127 | Ga0068857_100751487 | |||
| 1128 | Ga0068854_100002271 | |||
| 1129 | Ga0068854_100162112 | |||
| 1130 | Ga0068854_100420622 | |||
| 1131 | Ga0068856_100001016 | |||
| 1132 | Ga0068856_100069733 | |||
| 1133 | Ga0068856_100103133 | |||
| 1134 | Ga0068856_100120811 | |||
| 1135 | Ga0070702_100000175 | |||
| 1136 | Ga0070702_100125218 | |||
| 1137 | Ga0068852_100000611 | |||
| 1138 | Ga0068859_100002948 | |||
| 1139 | Ga0068859_100124564 | |||
| 1140 | Ga0068859_100179054 | |||
| 1141 | Ga0068864_100000234 | |||
| 1142 | Ga0068864_100021303 | |||
| 1143 | Ga0068864_100025360 | |||
| 1144 | Ga0068866_10002227 | |||
| 1145 | Ga0068866_10021000 | |||
| 1146 | Ga0068866_10097364 | |||
| 1147 | Ga0068861_100036887 | |||
| 1148 | Ga0068861_100044242 | |||
| 1149 | Ga0068861_100099380 | |||
| 1150 | Ga0068870_10000009 | |||
| 1151 | Ga0068863_100001729 | |||
| 1152 | Ga0068863_100142449 | |||
| 1153 | Ga0068863_100533685 | |||
| 1154 | Ga0068858_100001059 | |||
| 1155 | Ga0068858_100138508 | |||
| 1156 | Ga0068860_100003167 | |||
| 1157 | Ga0068860_100105682 | |||
| 1158 | Ga0068860_100377212 | |||
| 1159 | Ga0068862_100019397 | |||
| 1160 | Ga0068862_100039735 | |||
| 1161 | Ga0068862_100500322 | |||
| 1162 | Ga0081455_10011795 | |||
| 1163 | Ga0081455_10075776 | |||
| 1164 | Ga0081538_10149572 | |||
| 1165 | Ga0081540_1004206 | |||
| 1166 | Ga0081539_10018244 | |||
| 1167 | Ga0070717_10004993 | |||
| 1168 | Ga0070717_10099451 | |||
| 1169 | Ga0075368_10010605 | |||
| 1170 | Ga0075363_100082898 | |||
| 1171 | Ga0075364_10142245 | |||
| 1172 | Ga0070715_10017080 | |||
| 1173 | Ga0070715_10026067 | |||
| 1174 | Ga0070716_100003280 | |||
| 1175 | Ga0070712_100004136 | |||
| 1176 | Ga0070712_100023829 | |||
| 1177 | Ga0070712_100031650 | |||
| 1178 | Ga0070712_100039495 | |||
| 1179 | Ga0070712_100132686 | |||
| 1180 | Ga0075367_10013106 | |||
| 1181 | Ga0075367_10091430 | |||
| 1182 | Ga0075367_10153160 | |||
| 1183 | Ga0075369_10061791 | |||
| 1184 | Ga0075369_10150760 | |||
| 1185 | Ga0097621_100006760 | |||
| 1186 | Ga0075370_10034531 | |||
| 1187 | Ga0075370_10146369 | |||
| 1188 | Ga0068871_100000012 | |||
| 1189 | Ga0068871_100014044 | |||
| 1190 | Ga0068871_100053613 | |||
| 1191 | Ga0068871_100108554 | |||
| 1192 | Ga0075430_100072654 | |||
| 1193 | Ga0075434_100095961 | |||
| 1194 | Ga0075434_100147219 | |||
| 1195 | Ga0068865_100000355 | |||
| 1196 | Ga0068865_100005877 | |||
| 1197 | Ga0068865_100357595 | |||
| 1198 | Ga0075436_100006210 | |||
| 1199 | Ga0075436_100007339 | |||
| 1200 | Ga0097620_100002948 | |||
| 1201 | Ga0097620_100124548 | |||
| 1202 | Ga0097620_100179052 | |||
| 1203 | Ga0075435_100099820 | |||
| 1204 | Ga0105251_10017705 | |||
| 1205 | Ga0105240_10004853 | |||
| 1206 | Ga0105240_10022674 | |||
| 1207 | Ga0105240_10087262 | |||
| 1208 | Ga0105240_10185858 | |||
| 1209 | Ga0105240_10519388 | |||
| 1210 | Ga0105240_10559793 | |||
| 1211 | Ga0111539_10141004 | |||
| 1212 | Ga0111539_10329681 | |||
| 1213 | Ga0105245_10000409 | |||
| 1214 | Ga0105245_10152826 | |||
| 1215 | Ga0105245_10512549 | |||
| 1216 | Ga0105247_10004080 | |||
| 1217 | Ga0105247_10009067 | |||
| 1218 | Ga0105247_10038738 | |||
| 1219 | Ga0105247_10091424 | |||
| 1220 | Ga0105247_10266445 | |||
| 1221 | Ga0105247_10348041 | |||
| 1222 | Ga0105243_10004202 | |||
| 1223 | Ga0105243_10130712 | |||
| 1224 | Ga0105243_10543975 | |||
| 1225 | Ga0105241_10000053 | |||
| 1226 | Ga0105241_10010799 | |||
| 1227 | Ga0105241_10060625 | |||
| 1228 | Ga0105242_10011250 | |||
| 1229 | Ga0105242_10044930 | |||
| 1230 | Ga0105242_10221084 | |||
| 1231 | Ga0105248_10000309 | |||
| 1232 | Ga0105248_10038164 | |||
| 1233 | Ga0105248_10116016 | |||
| 1234 | Ga0105248_10176677 | |||
| 1235 | Ga0105248_10256225 | |||
| 1236 | Ga0105248_10424316 | |||
| 1237 | Ga0105237_10044970 | |||
| 1238 | Ga0105237_10112288 | |||
| 1239 | Ga0105237_10151426 | |||
| 1240 | Ga0105237_10176114 | |||
| 1241 | Ga0105238_10027365 | |||
| 1242 | Ga0105238_10111585 | |||
| 1243 | Ga0105249_10003451 | |||
| 1244 | Ga0105249_10231262 | |||
| 1245 | Ga0105239_10007939 | |||
| 1246 | Ga0105239_10011468 | |||
| 1247 | Ga0105246_10002040 | |||
| 1248 | Ga0157373_10040211 | |||
| 1249 | Ga0157371_10008314 | |||
| 1250 | Ga0157371_10266337 | |||
| 1251 | Ga0157370_10058079 | |||
| 1252 | Ga0157370_10161055 | |||
| 1253 | Ga0157369_10005855 | |||
| 1254 | Ga0157374_10000452 | |||
| 1255 | Ga0157374_10026788 | |||
| 1256 | Ga0157374_10065714 | |||
| 1257 | Ga0157374_10333689 | |||
| 1258 | Ga0157378_10000872 | |||
| 1259 | Ga0157378_10062596 | |||
| 1260 | Ga0157378_10365575 | |||
| 1261 | Ga0157378_10394722 | |||
| 1262 | Ga0163162_10000796 | |||
| 1263 | Ga0157372_10008710 | |||
| 1264 | Ga0157372_10054142 | |||
| 1265 | Ga0157372_10124519 | |||
| 1266 | Ga0157375_10004563 | |||
| 1267 | Ga0157375_10109327 | |||
| 1268 | Ga0157375_10625201 | |||
| 1269 | Ga0163163_10191746 | |||
| 1270 | Ga0157380_10015191 | |||
| 1271 | Ga0157380_10309619 | |||
| 1272 | Ga0157377_10000538 | |||
| 1273 | Ga0157379_10004942 | |||
| 1274 | Ga0157376_10002295 | |||
| 1275 | Ga0157376_10356693 | |||
| 1276 | Ga0163161_10000499 | |||
| 1277 | Ga0163161_10303267 | |||
| 1278 | Ga0206356_10556735 | |||
| 1279 | Ga0206354_11444921 | |||
| 1280 | Ga0206353_10552086 | |||
| 1281 | Ga0206353_10987334 | |||
| 1282 | Ga0213876_10005419 | |||
| 1283 | Ga0209233_1020069 | |||
| 1284 | Ga0207673_1000072 | |||
| 1285 | Ga0209758_1000616 | |||
| 1286 | Ga0207426_1000420 | |||
| 1287 | Ga0207697_10000252 | |||
| 1288 | Ga0207682_10000029 | |||
| 1289 | Ga0207692_10006712 | |||
| 1290 | Ga0207692_10075086 | |||
| 1291 | Ga0207692_10261499 | |||
| 1292 | Ga0207710_10001576 | |||
| 1293 | Ga0207710_10002176 | |||
| 1294 | Ga0207710_10164322 | |||
| 1295 | Ga0207688_10000020 | |||
| 1296 | Ga0207688_10093665 | |||
| 1297 | Ga0207688_10308730 | |||
| 1298 | Ga0207680_10001555 | |||
| 1299 | Ga0207680_10124811 | |||
| 1300 | Ga0207680_10203482 | |||
| 1301 | Ga0207647_10001753 | |||
| 1302 | Ga0207645_10000108 | |||
| 1303 | Ga0207645_10057516 | |||
| 1304 | Ga0207643_10000044 | |||
| 1305 | Ga0207654_10004211 | |||
| 1306 | Ga0207707_10014616 | |||
| 1307 | Ga0207707_10137962 | |||
| 1308 | Ga0207695_10018913 | |||
| 1309 | Ga0207695_10038814 | |||
| 1310 | Ga0207695_10185078 | |||
| 1311 | Ga0207695_10399314 | |||
| 1312 | Ga0207671_10031026 | |||
| 1313 | Ga0207671_10152873 | |||
| 1314 | Ga0207693_10017047 | |||
| 1315 | Ga0207693_10071211 | |||
| 1316 | Ga0207693_10120847 | |||
| 1317 | Ga0207693_10206099 | |||
| 1318 | Ga0207663_10147759 | |||
| 1319 | Ga0207663_10210790 | |||
| 1320 | Ga0207660_10000543 | |||
| 1321 | Ga0207662_10005777 | |||
| 1322 | Ga0207657_10004676 | |||
| 1323 | Ga0207657_10016668 | |||
| 1324 | Ga0207657_10103241 | |||
| 1325 | Ga0207649_10000057 | |||
| 1326 | Ga0207649_10139493 | |||
| 1327 | Ga0207652_10006960 | |||
| 1328 | Ga0207652_10013118 | |||
| 1329 | Ga0207652_10070361 | |||
| 1330 | Ga0207681_10001187 | |||
| 1331 | Ga0207694_10086806 | |||
| 1332 | Ga0207694_10139021 | |||
| 1333 | Ga0207650_10001534 | |||
| 1334 | Ga0207659_10000028 | |||
| 1335 | Ga0207659_10192498 | |||
| 1336 | Ga0207687_10000061 | |||
| 1337 | Ga0207687_10020799 | |||
| 1338 | Ga0207700_10001257 | |||
| 1339 | Ga0207700_10013859 | |||
| 1340 | Ga0207700_10116961 | |||
| 1341 | Ga0207700_10175241 | |||
| 1342 | Ga0207664_10042991 | |||
| 1343 | Ga0207664_10074898 | |||
| 1344 | Ga0207664_10142206 | |||
| 1345 | Ga0207644_10000194 | |||
| 1346 | Ga0207644_10013156 | |||
| 1347 | Ga0207644_10253326 | |||
| 1348 | Ga0207644_10273889 | |||
| 1349 | Ga0207690_10000225 | |||
| 1350 | Ga0207690_10273120 | |||
| 1351 | Ga0207706_10004628 | |||
| 1352 | Ga0207706_10118069 | |||
| 1353 | Ga0207706_10145008 | |||
| 1354 | Ga0207686_10007051 | |||
| 1355 | Ga0207686_10162213 | |||
| 1356 | Ga0207686_10165301 | |||
| 1357 | Ga0207709_10000291 | |||
| 1358 | Ga0207670_10000434 | |||
| 1359 | Ga0207670_10021555 | |||
| 1360 | Ga0207669_10000019 | |||
| 1361 | Ga0207704_10000438 | |||
| 1362 | Ga0207704_10076485 | |||
| 1363 | Ga0207665_10001157 | |||
| 1364 | Ga0207665_10028871 | |||
| 1365 | Ga0207665_10105265 | |||
| 1366 | Ga0207691_10001047 | |||
| 1367 | Ga0207691_10097584 | |||
| 1368 | Ga0207691_10159480 | |||
| 1369 | Ga0207691_10240356 | |||
| 1370 | Ga0207711_10002887 | |||
| 1371 | Ga0207711_10044822 | |||
| 1372 | Ga0207711_10113298 | |||
| 1373 | Ga0207711_10163067 | |||
| 1374 | Ga0207711_10480654 | |||
| 1375 | Ga0207689_10001160 | |||
| 1376 | Ga0207661_10000126 | |||
| 1377 | Ga0207661_10142887 | |||
| 1378 | Ga0207679_10000026 | |||
| 1379 | Ga0207679_10017686 | |||
| 1380 | Ga0207679_10131260 | |||
| 1381 | Ga0207679_10305927 | |||
| 1382 | Ga0207679_10416359 | |||
| 1383 | Ga0207667_10000392 | |||
| 1384 | Ga0207667_10018494 | |||
| 1385 | Ga0207667_10023513 | |||
| 1386 | Ga0207667_10106775 | |||
| 1387 | Ga0207667_10169337 | |||
| 1388 | Ga0207651_10001232 | |||
| 1389 | Ga0207651_10094796 | |||
| 1390 | Ga0207651_10339791 | |||
| 1391 | Ga0207712_10002654 | |||
| 1392 | Ga0207712_10257325 | |||
| 1393 | Ga0207668_10000049 | |||
| 1394 | Ga0207668_10082572 | |||
| 1395 | Ga0207640_10001994 | |||
| 1396 | Ga0207658_10001093 | |||
| 1397 | Ga0207658_10014381 | |||
| 1398 | Ga0207658_10339899 | |||
| 1399 | Ga0207677_10000229 | |||
| 1400 | Ga0207677_10107305 | |||
| 1401 | Ga0207703_10012519 | |||
| 1402 | Ga0207703_10059566 | |||
| 1403 | Ga0207703_10133147 | |||
| 1404 | Ga0207639_10002735 | |||
| 1405 | Ga0207639_10069768 | |||
| 1406 | Ga0207639_10074245 | |||
| 1407 | Ga0207678_10000403 | |||
| 1408 | Ga0207678_10044346 | |||
| 1409 | Ga0207678_10066998 | |||
| 1410 | Ga0207678_10071985 | |||
| 1411 | Ga0207678_10201644 | |||
| 1412 | Ga0207678_10390069 | |||
| 1413 | Ga0207708_10090192 | |||
| 1414 | Ga0207708_10246082 | |||
| 1415 | Ga0207702_10001378 | |||
| 1416 | Ga0207702_10034279 | |||
| 1417 | Ga0207702_10124924 | |||
| 1418 | Ga0207702_10174951 | |||
| 1419 | Ga0207641_10163831 | |||
| 1420 | Ga0207641_10237584 | |||
| 1421 | Ga0207648_10001244 | |||
| 1422 | Ga0207648_10030687 | |||
| 1423 | Ga0207676_10000672 | |||
| 1424 | Ga0207676_10010659 | |||
| 1425 | Ga0207676_10013475 | |||
| 1426 | Ga0207676_10023642 | |||
| 1427 | Ga0207676_10255784 | |||
| 1428 | Ga0207674_10001968 | |||
| 1429 | Ga0207674_10031314 | |||
| 1430 | Ga0207674_10051024 | |||
| 1431 | Ga0207674_10189055 | |||
| 1432 | Ga0207674_10190575 | |||
| 1433 | Ga0207674_10258499 | |||
| 1434 | Ga0207674_10550757 | |||
| 1435 | Ga0207675_100048673 | |||
| 1436 | Ga0207675_100132497 | |||
| 1437 | Ga0207683_10000034 | |||
| 1438 | Ga0207683_10080952 | |||
| 1439 | Ga0207683_10091941 | |||
| 1440 | Ga0207683_10136341 | |||
| 1441 | Ga0207683_10145961 | |||
| 1442 | Ga0207698_10042171 | |||
| 1443 | Ga0207698_10074280 | |||
| 1444 | Ga0207698_10082670 | |||
| 1445 | Ga0209973_1009382 | |||
| 1446 | Ga0209389_1000033 | |||
| 1447 | Ga0209589_1000040 | |||
| 1448 | Ga0209489_100045 | |||
| 1449 | Ga0209967_1009745 | |||
| 1450 | Ga0209970_1004643 | |||
| 1451 | Ga0210002_1000151 | |||
| 1452 | Ga0209983_1002418 | |||
| 1453 | Ga0209966_1002008 | |||
| 1454 | Ga0209974_10018966 | |||
| 1455 | Ga0209974_10054896 | |||
| 1456 | Ga0209974_10061656 | |||
| 1457 | Ga0207428_10000352 | |||
| 1458 | Ga0268266_10002169 | |||
| 1459 | Ga0268266_10003979 | |||
| 1460 | Ga0268266_10111381 | |||
| 1461 | Ga0268266_10155077 | |||
| 1462 | Ga0268265_10000410 | |||
| 1463 | Ga0268265_10106730 | |||
| 1464 | Ga0268265_10182536 | |||
| 1465 | Ga0268265_10436397 | |||
| 1466 | Ga0268265_10672524 | |||
| 1467 | Ga0268264_10000062 | |||
| 1468 | Ga0268264_10001567 | |||
| 1469 | Ga0268264_10473333 | |||
| 1470 | Ga0307517_10074981 | |||
| 1471 | Ga0307517_10204464 | |||
| 1472 | Ga0265338_10054112 | |||
| 1473 | Ga0265325_10000141 | |||
| 1474 | Ga0265325_10011173 | |||
| 1475 | Ga0265340_10039425 | |||
| 1476 | Ga0265316_10076472 | |||
| 1477 | Ga0265316_10087704 | |||
| 1478 | Ga0307513_10245025 | |||
| 1479 | Ga0307509_10134992 | |||
| 1480 | Ga0307408_100102075 | |||
| 1481 | Ga0265313_10000008 | |||
| 1482 | Ga0265313_10007607 | |||
| 1483 | Ga0265313_10007635 | |||
| 1484 | Ga0265313_10055574 | |||
| 1485 | Ga0265314_10003949 | |||
| 1486 | Ga0265314_10068326 | |||
| 1487 | Ga0265342_10000912 | |||
| 1488 | Ga0307516_10090465 | |||
| 1489 | Ga0307407_10062753 | |||
| 1490 | Ga0307411_10334840 | |||
| 1491 | Ga0307415_100198287 | |||
| 1492 | Ga0316583_10067483 | |||
| 1493 | Ga0307510_10010287 | |||
| 1494 | Ga0315911_1000008 | |||
| 1495 | Ga0373930_0006816 | |||
| 1496 | Ga0373926_0002177 | |||
| 1497 | Ga0373926_0026925 | |||
| 1498 | Ga0373928_0004025 | |||
| 1499 | Ga0373928_0013398 | |||
| 1500 | Ga0373929_0003944 | |||
| 1501 | Ga0373934_0004922 | |||
| 1502 | Ga0373934_0006581 | |||
| 1503 | Ga0373940_0001866 | |||
| 1504 | Ga0373944_0002474 | |||
| 1505 | Ga0373944_0056352 | |||
| 1506 | Ga0373949_0004067 | |||
| 1507 | Ga0373951_0008754 | |||
| 1508 | Ga0373951_0020349 | |||
| 1509 | Ga0373952_0001062 | |||
| 1510 | Ga0373923_0010862 | |||
| 1511 | Ga0373923_0032130 | |||
| 1512 | Ga0373923_0039425 | |||
| 1513 | Ga0373932_0009450 | |||
| 1514 | Ga0373936_0003212 | |||
| 1515 | Ga0373936_0021839 | |||
| 1516 | Ga0373939_0000706 | |||
| 1517 | Ga0373939_0072659 | |||
| 1518 | Ga0373941_0007982 | |||
| 1519 | Ga0373941_0032927 | |||
| 1520 | Ga0373945_0006425 | |||
| 1521 | Ga0373953_0009788 | |||
| 1522 | Ga0373954_0064983 | |||
| 1523 | Ga0373956_0009825 | |||
| 1524 | Ga0373956_0019299 | |||
| 1525 | Ga0373943_0002977 | |||
| 1526 | Ga0373946_0006715 | |||
| 1527 | Ga0373946_0037007 | |||
| 1528 | Ga0373946_0077953 | |||
| 1529 | Ga0373955_0003281 | |||
| 1530 | Ga0373955_0009848 | |||
| 1531 | Ga0373955_0048173 | |||
| 1532 | Ga0373961_0006819 | |||
| 1533 | Ga0373961_0049321 | |||
| 1534 | Ga0373961_0063469 | |||
| 1535 | Ga0373962_0000258 | |||
| 1536 | Ga0373962_0015271 | |||
| 1537 | Ga0373924_0004203 | |||
| 1538 | Ga0373931_0005613 | |||
| 1539 | Ga0373931_0017116 | |||
| 1540 | Ga0373935_0000046 | |||
| 1541 | Ga0373935_0012931 | |||
| 1542 | Ga0373935_0175368 | |||
| 1543 | Ga0373927_0000209 | |||
| 1544 | Ga0373927_0020410 | |||
| 1545 | Ga0373927_0084080 | |||
| 1546 | Ga0373927_0182326 | |||
| 1547 | Ga0373927_0196592 | |||
| 1548 | Ga0373927_0373028 | |||
| 1549 | Ga0373933_0003160 | |||
| 1550 | Ga0373933_0036726 | |||
| 1551 | Ga0373933_0040475 | |||
| 1552 | Ga0373933_0063278 | |||
| 1553 | Ga0373933_0103089 | |||
| 1554 | Ga0373947_0002886 | |||
| 1555 | Ga0373947_0296030 | |||
| 1556 | Ga0373937_0012815 | |||
| 1557 | Ga0373937_0023444 | |||
| 1558 | Ga0373937_0040665 | |||
| 1559 | Ga0373937_0045771 | |||
| 1560 | Ga0373937_0133441 | |||
| 1561 | Ga0373937_0202587 | |||
| 1562 | Ga0373937_0572521 | |||
| 1563 | Ga0372808_008217 | |||
| 1564 | Ga0373925_0005099 | |||
| 1565 | Ga0373925_0037718 | |||
| 1566 | Ga0373925_0126389 | |||
| 1567 | Ga0373925_0370250 | |||
| 1568 | Ga0395900_0005151 | |||
| 1569 | Ga0395900_0105347 | |||
| 1570 | Ga0395898_0003493 | |||
| 1571 | Ga0395898_0036540 | |||
| 1572 | Ga0395901_0043590 | |||
| 1573 | Ga0436365_0911459 | |||
| 1574 | Ga0436365_1148686 | |||
| 1575 | Ga0436365_1181233 | |||
| 1576 | Ga0436365_1422081 | |||
| 1577 | Ga0436363_0927837 | |||
| 1578 | Ga0451793_1659208 | |||
| 1579 | Ga0451800_1674697 | |||
| 1580 | Ga0451807_0850701 | |||
| 1581 | Ga0451807_1403845 | |||
| 1582 | Ga0439445_0045246 | |||
| 1583 | Ga0466963_0091246 | |||
| 1584 | Ga0466963_0092478 | |||
| 1585 | Ga0466963_0109353 | |||
| 1586 | Ga0495617_053834 | |||
| 1587 | Ga0495592_0000513 | |||
| 1588 | Ga0495592_0008115 | |||
| 1589 | Ga0495592_0169782 | |||
| 1590 | Ga0495603_0000153 | |||
| 1591 | Ga0495603_0035918 | |||
| 1592 | Ga0495629_0007084 | |||
| 1593 | Ga0495629_0033278 | |||
| 1594 | Ga0495638_0028639 | |||
| 1595 | Ga0495641_0008708 | |||
| 1596 | Ga0495641_0094615 | |||
| 1597 | Ga0495651_0025967 | |||
| 1598 | Ga0495651_0027931 | |||
| 1599 | Ga0495651_0204633 | |||
| 1600 | Ga0495653_0000912 | |||
| 1601 | Ga0495653_0019530 | |||
| 1602 | Ga0495653_0026746 | |||
| 1603 | Ga0495653_0095109 | |||
| 1604 | Ga0495653_0105670 | |||
| 1605 | Ga0495580_0000246 | |||
| 1606 | Ga0495580_0026873 | |||
| 1607 | Ga0495580_0098423 | |||
| 1608 | Ga0495582_0000686 | |||
| 1609 | Ga0495582_0033766 | |||
| 1610 | Ga0495639_0000799 | |||
| 1611 | Ga0495662_0029283 | |||
| 1612 | Ga0495662_0043882 | |||
| 1613 | Ga0495662_0074205 | |||
| 1614 | Ga0495664_0015494 | |||
| 1615 | Ga0495664_0051228 | |||
| 1616 | Ga0495664_0073934 | |||
| 1617 | Ga0495664_0085121 | |||
| 1618 | Ga0495584_0006986 | |||
| 1619 | Ga0495584_0103335 | |||
| 1620 | Ga0495585_0004083 | |||
| 1621 | Ga0495594_0000243 | |||
| 1622 | Ga0495594_0057740 | |||
| 1623 | Ga0495607_0038217 | |||
| 1624 | Ga0495606_0232159 | |||
| 1625 | Ga0495608_0008983 | |||
| 1626 | Ga0495608_0022196 | |||
| 1627 | Ga0495608_0281239 | |||
| 1628 | Ga0495618_0002089 | |||
| 1629 | Ga0495618_0104308 | |||
| 1630 | Ga0495620_0019530 | |||
| 1631 | Ga0495628_0011083 | |||
| 1632 | Ga0495628_0034712 | |||
| 1633 | Ga0495628_0054964 | |||
| 1634 | Ga0495630_0062267 | |||
| 1635 | Ga0495630_0123501 | |||
| 1636 | Ga0495630_0565085 | |||
| 1637 | Ga0495632_0000006 | |||
| 1638 | Ga0495632_0155594 | |||
| 1639 | Ga0495637_0000784 | |||
| 1640 | Ga0495643_0000021 | |||
| 1641 | Ga0495644_0003549 | |||
| 1642 | Ga0495648_0038726 | |||
| 1643 | Ga0495648_0069726 | |||
| 1644 | Ga0495663_0000008 | |||
| 1645 | Ga0495663_0020493 | |||
| 1646 | Ga0495666_0100331 | |||
| 1647 | Ga0495652_0028963 | |||
| 1648 | Ga0495652_0040789 | |||
| 1649 | Ga0495652_0195762 | |||
| 1650 | Ga0495665_0000341 | |||
| 1651 | Ga0495665_0011091 | |||
| 1652 | Ga0495665_0205783 | |||
| 1653 | Ga0495640_0000521 | |||
| 1654 | Ga0495640_0067780 | |||
| 1655 | Ga0495640_0138997 | |||
| 1656 | Ga0495640_0155157 | |||
| 1657 | Ga0495586_0182752 | |||
| 1658 | Ga0495587_0113466 | |||
| 1659 | Ga0495587_0130609 | |||
| 1660 | Ga0495598_0029638 | |||
| 1661 | Ga0495609_0030375 | |||
| 1662 | Ga0495645_0001151 | |||
| 1663 | Ga0495645_0075566 | |||
| 1664 | Ga0495645_0080582 | |||
| 1665 | Ga0495622_0006107 | |||
| 1666 | Ga0495622_0011002 | |||
| 1667 | Ga0495633_0000247 | |||
| 1668 | Ga0495633_0001265 | |||
| 1669 | Ga0495633_0018376 | |||
| 1670 | Ga0495667_0027764 | |||
| 1671 | Ga0495667_0033180 | |||
| 1672 | Ga0495667_0116845 | |||
| 1673 | Ga0495656_0000297 | |||
| 1674 | Ga0495656_0057004 | |||
| 1675 | Ga0495656_0221867 | |||
| 1676 | Ga0495668_0194952 | |||
| 1677 | Ga0495634_0006489 | |||
| 1678 | Ga0495611_0031638 | |||
| 1679 | Ga0495611_0177172 | |||
| 1680 | Ga0495635_0000470 | |||
| 1681 | Ga0495635_0011642 | |||
| 1682 | Ga0495659_0008457 | |||
| 1683 | Ga0495588_0007378 | |||
| 1684 | Ga0495588_0008423 | |||
| 1685 | Ga0495657_0009329 | |||
| 1686 | Ga0495657_0064306 | |||
| 1687 | Ga0495657_0135465 | |||
| 1688 | Ga0495599_0018304 | |||
| 1689 | Ga0495599_0125811 | |||
| 1690 | Ga0495623_0017571 | |||
| 1691 | Ga0495646_0009857 | |||
| 1692 | Ga0495646_0014448 | |||
| 1693 | Ga0495647_0002355 | |||
| 1694 | Ga0495647_0024406 | |||
| 1695 | Ga0495647_0074420 | |||
| 1696 | Ga0495658_0003407 | |||
| 1697 | Ga0495669_0018118 | |||
| 1698 | Ga0495613_0079747 | |||
| 1699 | Ga0495624_0000144 | |||
| 1700 | Ga0495624_0231186 | |||
| 1701 | Ga0495670_0002440 | |||
| 1702 | Ga0495670_0012052 | |||
| 1703 | Ga0495671_0000017 | |||
| 1704 | Ga0495589_0022874 | |||
| 1705 | Ga0495589_0027347 | |||
| 1706 | Ga0495600_0075284 | |||
| 1707 | Ga0495600_0114453 | |||
| 1708 | Ga0495581_0000223 | |||
| 1709 | Ga0495604_0006502 | |||
| 1710 | Ga0495604_0010832 | |||
| 1711 | Ga0495604_0028443 | |||
| 1712 | Ga0495674_0000700 | |||
| 1713 | Ga0495674_0050715 | |||
| 1714 | Ga0495676_0012616 | |||
| 1715 | Ga0495676_0052101 | |||
| 1716 | Ga0495676_0088961 | |||
| 1717 | Ga0495680_0133466 | |||
| 1718 | Ga0495673_0045725 | |||
| 1719 | Ga0495681_0054630 | |||
| 1720 | Ga0495684_0008189 | |||
| 1721 | Ga0495684_0019592 | |||
| 1722 | Ga0495684_0070264 | |||
| 1723 | Ga0495686_0154635 | |||
| 1724 | Ga0495593_0000007 | |||
| 1725 | Ga0495593_0053018 | |||
| 1726 | Ga0495593_0109969 | |||
| 1727 | Ga0495602_0046224 | |||
| 1728 | Ga0495602_0064510 | |||
| 1729 | Ga0495602_0262997 | |||
| 1730 | Ga0495614_0064488 | |||
| 1731 | Ga0496100_0001439 | |||
| 1732 | Ga0496100_0042849 | |||
| 1733 | Ga0496101_0000171 | |||
| 1734 | Ga0496101_0014780 | |||
| 1735 | Ga0496101_0067795 | |||
| 1736 | Ga0496101_0097188 | |||
| 1737 | Ga0496101_0106117 | |||
| 1738 | Ga0496101_0198928 | |||
| 1739 | Ga0496102_0004728 | |||
| 1740 | Ga0496102_0062018 | |||
| 1741 | Ga0496102_0072433 | |||
| 1742 | Ga0496102_0170807 | |||
| 1743 | Ga0496103_0001994 | |||
| 1744 | Ga0496103_0033981 | |||
| 1745 | Ga0496103_0051430 | |||
| 1746 | Ga0496103_0130948 | |||
| 1747 | Ga0496104_0000067 | |||
| 1748 | Ga0496104_0086181 | |||
| 1749 | Ga0496104_0226813 | |||
| 1750 | Ga0496104_0255365 | |||
| 1751 | Ga0496104_0313519 | |||
| 1752 | Ga0496104_0324287 | |||
| 1753 | Ga0496105_0000130 | |||
| 1754 | Ga0496105_0016996 | |||
| 1755 | Ga0496105_0086060 | |||
| 1756 | Ga0496106_0000581 | |||
| 1757 | Ga0496106_0031601 | |||
| 1758 | Ga0496106_0107536 | |||
| 1759 | Ga0496106_0145671 | |||
| 1760 | Ga0496107_0000224 | |||
| 1761 | Ga0496107_0016922 | |||
| 1762 | Ga0496108_0000547 | |||
| 1763 | Ga0496108_0031606 | |||
| 1764 | Ga0496108_0051587 | |||
| 1765 | Ga0496108_0071071 | |||
| 1766 | Ga0496108_0153649 | |||
| 1767 | Ga0496109_0000384 | |||
| 1768 | Ga0496109_0014332 | |||
| 1769 | Ga0496109_0045791 | |||
| 1770 | Ga0496109_0173137 | |||
| 1771 | Ga0496109_0449569 | |||
| 1772 | Ga0496109_0605465 | |||
| 1773 | Ga0496110_0008712 | |||
| 1774 | Ga0496110_0018951 | |||
| 1775 | Ga0496110_0101203 | |||
| 1776 | Ga0496111_0005888 | |||
| 1777 | Ga0496111_0081880 | |||
| 1778 | Ga0496111_0227857 | |||
| 1779 | Ga0496112_0087114 | |||
| 1780 | Ga0496112_0095365 | |||
| 1781 | Ga0496112_0226817 | |||
| 1782 | Ga0496113_0122603 | |||
| 1783 | Ga0496114_0004538 | |||
| 1784 | Ga0496114_0009885 | |||
| 1785 | Ga0496114_0027436 | |||
| 1786 | Ga0496114_0061841 | |||
| 1787 | Ga0496114_0346705 | |||
| 1788 | Ga0496115_0000826 | |||
| 1789 | Ga0496115_0115152 | |||
| 1790 | Ga0496117_0053499 | |||
| 1791 | Ga0496118_0027463 | |||
| 1792 | Ga0496119_0048946 | |||
| 1793 | Ga0496121_0003211 | |||
| 1794 | Ga0496121_0039220 | |||
| 1795 | Ga0496121_0046169 | |||
| 1796 | Ga0496121_0048197 | |||
| 1797 | Ga0496121_0161441 | |||
| 1798 | Ga0496121_0247341 | |||
| 1799 | Ga0496125_0019978 | |||
| 1800 | Ga0496125_0108084 | |||
| 1801 | Ga0496125_0116572 | |||
| 1802 | Ga0496126_0027170 | |||
| 1803 | Ga0496126_0030950 | |||
| 1804 | Ga0496126_0040378 | |||
| 1805 | Ga0496126_0060648 | |||
| 1806 | Ga0496126_0157417 | |||
| 1807 | Ga0495678_079984 | |||
| 1808 | Ga0495682_0105118 | |||
| 1809 | Ga0501031_0004917 | |||
| 1810 | Ga0501031_0013835 | |||
| 1811 | Ga0501032_0152192 | |||
| 1812 | Ga0501032_0177883 | |||
| 1813 | Ga0501033_0018842 | |||
| 1814 | Ga0501034_0000374 | |||
| 1815 | Ga0501034_0044836 | |||
| 1816 | Ga0501034_0082021 | |||
| 1817 | Ga0501034_0213838 | |||
| 1818 | Ga0501037_0042826 | |||
| 1819 | Ga0501037_0050928 | |||
| 1820 | Ga0501037_0156941 | |||
| 1821 | Ga0501037_0180327 | |||
| 1822 | Ga0501038_0008546 | |||
| 1823 | Ga0501038_0027921 | |||
| 1824 | Ga0501038_0056927 | |||
| 1825 | Ga0501038_0076965 | |||
| 1826 | Ga0501039_0066565 | |||
| 1827 | Ga0501039_0085658 | |||
| 1828 | Ga0501042_0000540 | |||
| 1829 | Ga0501043_0064916 | |||
| 1830 | Ga0501047_0026583 | |||
| 1831 | Ga0501047_0131910 | |||
| 1832 | Ga0501047_0211521 | |||
| 1833 | Ga0501047_0337754 | |||
| 1834 | Ga0501048_0004376 | |||
| 1835 | Ga0501048_0028790 | |||
| 1836 | Ga0501067_0016188 | |||
| 1837 | Ga0501067_0113207 | |||
| 1838 | Ga0501068_0003581 | |||
| 1839 | Ga0501068_0060938 | |||
| 1840 | Ga0501070_0011451 | |||
| 1841 | Ga0501070_0048479 | |||
| 1842 | Ga0501070_0054294 | |||
| 1843 | Ga0501070_0097039 | |||
| 1844 | Ga0501070_0109225 | |||
| 1845 | Ga0501070_0207521 | |||
| 1846 | Ga0501070_0446074 | |||
| 1847 | Ga0501071_0005036 | |||
| 1848 | Ga0501071_0038623 | |||
| 1849 | Ga0501071_0083933 | |||
| 1850 | Ga0501073_0030477 | |||
| 1851 | Ga0501073_0052182 | |||
| 1852 | Ga0501074_0091026 | |||
| 1853 | Ga0501074_0100324 | |||
| 1854 | Ga0501077_0204245 | |||
| 1855 | Ga0501079_0004156 | |||
| 1856 | Ga0501079_0201545 | |||
| 1857 | Ga0501080_0028227 | |||
| 1858 | Ga0501080_0113590 | |||
| 1859 | Ga0501080_0266947 | |||
| 1860 | Ga0501083_0009046 | |||
| 1861 | Ga0501083_0081573 | |||
| 1862 | Ga0501083_0098641 | |||
| 1863 | Ga0501083_0147005 | |||
| 1864 | Ga0501035_0148087 | |||
| 1865 | Ga0501044_0128910 | |||
| 1866 | Ga0501044_0210315 | |||
| 1867 | Ga0501044_0321533 | |||
| 1868 | Ga0501044_0406915 | |||
| 1869 | Ga0501045_0028721 | |||
| 1870 | Ga0501045_0239732 | |||
| 1871 | nmdc:mga03683_132339_c1 | |||
| 1872 | nmdc:mga03683_25287_c1 | |||
| 1873 | nmdc:mga03n38_63288_c1 | |||
| 1874 | nmdc:mga0yw44_141276_c1 | |||
| 1875 | nmdc:mga06z11_12623_c1 | |||
| 1876 | nmdc:mga04h51_8061_c1 | |||
| 1877 | nmdc:mga0qj67_43999_c1 | |||
| 1878 | nmdc:mga08y16_203714_c1 | |||
| 1879 | nmdc:mga08y16_257184_c1 | |||
| 1880 | nmdc:mga0n895_165280_c1 | |||
| 1881 | nmdc:mga0n895_744324_c1 | |||
| 1882 | nmdc:mga0rr50_258245_c1 | |||
| 1883 | nmdc:mga08x19_180973_c1 | |||
| 1884 | nmdc:mga08x19_18_c1 | |||
| 1885 | nmdc:mga08x19_88601_c1 | |||
| 1886 | Ga0495601_0000237 | |||
| 1887 | Ga0495601_0003203 | |||
| 1888 | Ga0495601_0011542 | |||
| 1889 | Ga0495601_0019726 | |||
| 1890 | Ga0495612_0000563 | |||
| 1891 | Ga0495612_0003858 | |||
| 1892 | Ga0495612_0011052 | |||
| 1893 | Ga0495612_0025831 | |||
| 1894 | Ga0495612_0029435 | |||
| 1895 | Ga0495655_0021718 | |||
| 1896 | Ga0495595_0006203 | |||
| 1897 | Ga0495595_0008416 | |||
| 1898 | Ga0495595_0022604 | |||
| 1899 | Ga0495595_0232034 | |||
| 1900 | Ga0495619_0000343 | |||
| 1901 | Ga0495619_0006532 | |||
| 1902 | Ga0495619_0006775 | |||
| 1903 | Ga0495619_0279132 | |||
| 1904 | Ga0500595_001229 | |||
| 1905 | Ga0500577_0016765 | |||
| 1906 | Ga0500577_0079634 | |||
| 1907 | Ga0500588_0041124 | |||
| 1908 | Ga0500589_096076 | |||
| 1909 | Ga0501084_0153751 | |||
| 1910 | Ga0501084_0259381 | |||
| 1911 | Ga0501082_0049053 | |||
| 1912 | Ga0501082_0049262 | |||
| 1913 | Ga0501082_0547648 | |||
| 1914 | Ga0466962_0161774 | |||
| 1915 | 2513718143 | |||
| 1916 | 2513863320 | |||
| 1917 | 2513922584 | |||
| 1918 | 2517888934 | |||
| 1919 | 2524466953 | |||
| 1920 | 2524537367 | |||
| 1921 | 2643758171 | |||
| 1922 | 2723841718 | |||
| 1923 | 2744955300 | |||
| 1924 | 2793080847 | |||
| 1925 | 2876808980 | |||
| 1926 | 2879113420 | |||
| 1927 | 2881668106 | |||
| 1928 | 2885390396 | |||
| 1929 | 2904708538 | |||
| 1930 | 2906613985 | |||
| 1931 | 2908747539 | |||
| 1932 | 2922392503 | |||
| 1933 | 2935637048 | |||
| 1934 | 2941513685 | |||
| 1935 | 2941521648 | |||
| 1936 | 2941529403 | |||
| 1937 | 8006936119 | |||
| 1938 | 8006967536 | |||
| 1939 | 8006976046 | |||
| 1940 | 8006990999 | |||
| 1941 | 8056687156 | |||
| 1942 | 8056691034 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF02882
THF_DHG_CYH_C
Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
159
321
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a5o-assembly2.cif.gz_D | crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) | 0.9799 | 2 | 283 |
| 3l07-assembly1.cif.gz_A | methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. | 0.9758 | 2 | 286 |
| 3l07-assembly1.cif.gz_A | methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. | 0.969 | 2 | 286 |
| 4a26-assembly1.cif.gz_A | the crystal structure of leishmania major n5,n10- methylenetetrahydrofolate dehydrogenase/cyclohydrolase | 0.967 | 2 | 290 |
| 6v6y-assembly1.cif.gz_A-2 | crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) | 0.9662 | 1 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9975 | 34 | 114 | 3.40.50.10860 |
| af_A0A0R0F3H3_60_174_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9948 | 13 | 125 | 3.40.50.10860 |
| af_K7KYI8_1_78_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9897 | 27 | 103 | 3.40.50.720 |
| 3l07A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9888 | 32 | 115 | 3.40.50.10860 |
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9854 | 34 | 114 | 3.40.50.10860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382NA53-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.9996 | 1 | 110 |
GO:0004477
GO:0004488 GO:0005829 GO:0035999 |
| AF-J6DD83-F1-model_v4 | Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.9954 | 1 | 116 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A3R7R7X4-F1-model_v4 | Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] | 0.9945 | 1 | 290 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A418NSJ9-F1-model_v4 | Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] | 0.9942 | 3 | 288 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A1Y3G7C1-F1-model_v4 | Methenyltetrahydrofolate cyclohydrolase | 0.9932 | 1 | 201 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |