F487136

General Info

Members Datasets Scaffolds Average Seq Length
972 765 1944 210

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1004763|Ga0055536_100476310
Length 235
Sequence MQRNTVPYRLLVLVNFESQGSLLVKTVLCYGDSLTWGTDAATGGRHAFQDRWPSVLQAALGPAVNVVAEGLGGRTTAYDDNLADCXRNGATLLPTVLHSHGPLXLVIVMLGTNDLKPIIHGTAMGARQGVKKLVSLVRFHDWGRECEAPEILIVSPPTLCETANPMTGALFRGGIEQSSMLASLYRDLADETGCGFFDAGSVAKTTPIDGVHLDAENTRAIGRGLEPIVRMMLGL

Samples

Sample ID Description Type Environment
1 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
58 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
73 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
74 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
75 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
76 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
77 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
78 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
119 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
127 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
132 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
135 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
138 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
139 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
140 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
141 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
142 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
224 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
225 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
226 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
227 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
228 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
239 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
250 2509276019 Ensifer aridi TW10 Isolate Nodule
251 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
252 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
253 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
254 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
255 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
256 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
257 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
258 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
259 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
260 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
261 2512875024
262 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
263 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
264 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
265 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
266 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
267 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
268 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
269 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
270 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
271 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
272 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
273 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
274 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
275 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
276 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
277 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
278 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
279 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
280 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
281 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
282 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
283 2516143018 Ensifer sp. BR816 Isolate Nodule
284 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
285 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
286 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
287 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
288 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
289 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
290 2519899620 Rhizobium sp. Pop5 Isolate Nodule
291 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
292 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
293 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
294 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
295 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
296 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
297 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
298 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
299 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
300 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
301 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
302 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
303 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
304 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
305 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
306 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
307 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
308 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
309 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
310 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
311 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
312 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
313 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
314 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
315 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
316 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
317 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
318 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
319 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
320 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
321 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
322 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
323 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
324 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
325 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
326 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
327 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
328 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
329 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
330 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
331 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
332 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
333 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
334 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
335 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
336 2643221557 Ensifer sp. Root558 Isolate Unclassified
337 2643221558 Rhizobium sp. Root149 Isolate Unclassified
338 2643221568 Rhizobium sp. Root564 Isolate Unclassified
339 2643221582 Rhizobium sp. Root651 Isolate Unclassified
340 2643221591 Devosia sp. Root685 Isolate Unclassified
341 2643221610 Ensifer sp. Root74 Isolate Unclassified
342 2643221618 Ensifer sp. Root231 Isolate Unclassified
343 2643221626 Ensifer sp. Root31 Isolate Unclassified
344 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
345 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
346 2643221655 Ensifer sp. Root1252 Isolate Unclassified
347 2643221659 Ensifer sp. Root127 Isolate Unclassified
348 2643221668 Ensifer sp. Root423 Isolate Unclassified
349 2643221675 Ensifer sp. Root1298 Isolate Unclassified
350 2643221680 Ensifer sp. Root1312 Isolate Unclassified
351 2643221688 Rhizobium sp. Root482 Isolate Unclassified
352 2643221693 Rhizobium sp. Root491 Isolate Unclassified
353 2643221698 Ensifer sp. Root142 Isolate Unclassified
354 2643221712 Ensifer sp. Root258 Isolate Unclassified
355 2643221718 Rhizobium sp. Root268 Isolate Unclassified
356 2643221719 Rhizobium sp. Root274 Isolate Unclassified
357 2643221723 Ensifer sp. Root278 Isolate Unclassified
358 2643221726 Ensifer sp. Root954 Isolate Unclassified
359 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
360 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
361 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
362 2718217882 Rhizobium sp. N741 Isolate Nodule
363 2718217927 Rhizobium sp. N324 Isolate Nodule
364 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
365 2718218009 Rhizobium sp. N561 Isolate Nodule
366 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
367 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
368 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
369 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
370 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
371 2718218363 Rhizobium sp. N113 Isolate Nodule
372 2718218365 Rhizobium sp. N731 Isolate Nodule
373 2718218366 Rhizobium sp. N621 Isolate Nodule
374 2718218423 Rhizobium sp. N941 Isolate Nodule
375 2721755514 Rhizobium sp. N6212 Isolate Nodule
376 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
377 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
378 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
379 2721755809 Rhizobium sp. N541 Isolate Nodule
380 2721755810 Rhizobium sp. N871 Isolate Nodule
381 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
382 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
383 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
384 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
385 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
386 2728369365 Rhizobium sp. N1341 Isolate Nodule
387 2728369397 Rhizobium sp. N1314 Isolate Nodule
388 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
389 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
390 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
391 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
392 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
393 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
394 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
395 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
396 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
397 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
398 2791355256 Rhizobium sp. M10 Isolate Nodule
399 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
400 2791355260 Rhizobium sp. L9 Isolate Nodule
401 2791355261 Rhizobium sp. J15 Isolate Nodule
402 2791355262 Rhizobium sp. M1 Isolate Nodule
403 2791355263 Rhizobium chutanense C5 Isolate Nodule
404 2791355264 Rhizobium sp. S9 Isolate Nodule
405 2791355265 Rhizobium sp. H4 Isolate Nodule
406 2791355266 Rhizobium sp. L43 Isolate Nodule
407 2791355267 Rhizobium sp. L18 Isolate Nodule
408 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
409 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
410 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
411 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
412 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
413 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
414 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
415 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
416 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
417 2802429633 Rhizobium anhuiense J3 Isolate Nodule
418 2802429634 Rhizobium anhuiense S10 Isolate Nodule
419 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
420 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
421 2802429637 Rhizobium anhuiense C15 Isolate Nodule
422 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
423 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
424 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
425 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
426 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
427 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
428 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
429 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
430 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
431 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
432 2838048938 Rhizobium pisi 27/80 Isolate Nodule
433 2838061910 Rhizobium phaseoli L15 Isolate Nodule
434 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
435 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
436 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
437 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
438 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
439 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
440 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
441 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
442 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
443 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
444 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
445 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
446 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
447 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
448 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
449 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
450 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
451 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
452 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
453 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
454 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
455 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
456 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
457 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
458 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
459 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
460 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
461 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
462 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
463 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
464 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
465 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
466 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
467 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
468 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
469 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
470 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
471 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
472 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
473 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
474 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
475 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
476 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
477 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
478 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
479 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
480 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
481 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
482 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
483 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
484 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
485 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
486 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
487 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
488 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
489 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
490 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
491 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
492 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
493 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
494 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
495 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
496 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
497 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
498 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
499 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
500 2844163670 Ensifer sp. 1H6 Isolate Unclassified
501 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
502 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
503 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
504 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
505 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
506 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
507 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
508 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
509 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
510 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
511 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
512 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
513 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
514 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
515 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
516 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
517 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
518 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
519 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
520 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
521 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
522 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
523 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
524 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
525 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
526 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
527 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
528 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
529 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
530 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
531 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
532 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
533 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
534 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
535 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
536 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
537 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
538 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
539 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
540 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
541 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
542 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
543 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
544 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
545 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
546 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
547 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
548 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
549 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
550 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
551 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
552 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
553 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
554 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
555 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
556 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
557 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
558 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
559 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
560 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
561 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
562 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
563 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
564 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
565 2932401849 Devosia sp. 2618 Isolate Rhizosphere
566 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
567 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
568 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
569 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
570 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
571 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
572 2933599457 Rhizobium phaseoli M3 Isolate Nodule
573 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
574 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
575 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
576 2936381700 Rhizobium chutanense C16 Isolate Unclassified
577 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
578 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
579 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
580 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
581 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
582 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
583 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
584 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
585 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
586 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
587 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
588 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
589 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
590 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
591 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
592 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
593 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
594 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
595 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
596 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
597 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
598 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
599 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
600 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
601 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
602 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
603 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
604 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
605 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
606 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
607 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
608 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
609 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
610 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
611 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
612 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
613 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
614 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
615 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
616 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
617 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
618 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
619 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
620 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
621 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
622 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
623 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
624 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
625 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
626 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
627 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
628 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
629 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
630 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
631 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
632 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
633 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
634 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
635 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
636 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
637 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
638 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
639 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
640 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
641 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
642 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
643 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
644 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
645 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
646 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
647 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
648 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
649 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
650 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
651 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
652 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
653 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
654 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
655 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
656 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
657 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
658 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
659 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
660 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
661 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
662 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
663 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
664 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
665 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
666 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
667 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
668 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
669 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
670 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
671 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
672 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
673 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
674 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
675 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
676 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
677 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
678 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
679 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
680 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
681 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
682 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
683 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
684 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
685 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
686 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
687 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
688 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
689 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
690 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
691 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
692 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
693 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
694 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
695 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
696 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
697 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
698 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
699 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
700 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
701 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
702 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
703 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
704 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
705 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
706 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
707 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
708 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
709 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
710 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
711 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
712 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
713 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
714 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
715 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
716 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
717 2996893221 Rhizobium sp. R635 Isolate Nodule
718 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
719 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
720 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
721 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
722 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
723 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
724 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
725 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
726 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
727 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
728 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
729 8005275841 Rhizobium sp. N4311 Isolate Nodule
730 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
731 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
732 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
733 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
734 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
735 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
736 8005382845 Rhizobium sp. R634 Isolate Nodule
737 8005395548 Rhizobium sp. R339 Isolate Nodule
738 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
739 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
740 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
741 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
742 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
743 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
744 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
745 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
746 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
747 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
748 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
749 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
750 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
751 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
752 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
753 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
754 8018176218 Rhizobium sp. N122 Isolate Nodule
755 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
756 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
757 8024501048 Rhizobium sp. H4 Isolate Nodule
758 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
759 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
760 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
761 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
762 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
763 8056382006 Rhizobium croatiense 13T Isolate Nodule
764 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
765 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.58
Metatranscriptomes 1.03
Isolates 53.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 17.39
Nodule 42.28
Rhizoplane 2.06
Rhizosphere 21.09
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1004763 3300003781 Bacteria 6809
2 JGI24740J21852_10000001 3300001979 Bacteria 168537
3 JGI25155J39150_1000011 3300002704 Bacteria 207685
4 JGI25156J39149_1000027 3300002705 Bacteria 127396
5 JGI25156J39149_1000030 3300002705 Bacteria 126029
6 JGI25162J39368_1003868 3300002737 Bacteria 3905
7 JGI25162J39368_1003931 3300002737 Bacteria 3815
8 JGI25154J39366_1000057 3300002738 Bacteria 110584
9 JGI25157J39369_1000010 3300002741 Bacteria 207685
10 JGI25152J39213_1005408 3300002773 Bacteria 3732
11 JGI25150J39212_1003062 3300002774 Bacteria 4001
12 JGI25150J39212_1003381 3300002774 Bacteria 3741
13 JGI25150J39212_1009454 3300002774 Bacteria 1854
14 JGI25159J45721_1000006 3300002987 Bacteria 188201
15 JGI25159J45721_1000080 3300002987 Bacteria 46567
16 JGI25159J45721_1000468 3300002987 Bacteria 18607
17 JGI25151J46595_10000171 3300003187 Bacteria 84127
18 JGI25151J46595_10013598 3300003187 Bacteria 3658
19 JGI25151J46595_10058661 3300003187 Bacteria 1244
20 JGI25165J46597_1000189 3300003214 Bacteria 91790
21 JGI25165J46597_1000777 3300003214 Bacteria 24294
22 JGI25165J46597_1004418 3300003214 Bacteria 3024
23 JGI25153J46596_10006081 3300003215 Bacteria 6199
24 JGI25153J46596_10011933 3300003215 Bacteria 3801
25 JGI25153J46596_10019014 3300003215 Bacteria 2644
26 rootH2_10107759 3300003320 Bacteria 1211
27 rootL2_10234100 3300003322 Bacteria 1027
28 JGI25160J50197_1000004 3300003354 Bacteria 419797
29 JGI25160J50197_1000019 3300003354 Bacteria 233980
30 JGI25160J50197_1002267 3300003354 Bacteria 9021
31 JGI25160J50197_1007157 3300003354 Bacteria 4398
32 JGI25161J50226_1000003 3300003374 Bacteria 413345
33 JGI25161J50226_1002208 3300003374 Bacteria 5175
34 JGI25161J50226_1003651 3300003374 Bacteria 3448
35 Ga0055526_1000669 3300003771 Bacteria 26309
36 Ga0055526_1002226 3300003771 Bacteria 13285
37 Ga0055526_1013840 3300003771 Bacteria 3373
38 Ga0055524_1017701 3300003775 Bacteria 2503
39 Ga0055524_1022683 3300003775 Bacteria 2044
40 Ga0055524_1050762 3300003775 Bacteria 943
41 Ga0055536_1000212 3300003781 Bacteria 47611
42 Ga0055528_1000918 3300003790 Bacteria 19824
43 Ga0055528_1017564 3300003790 Bacteria 2474
44 Ga0055528_1023733 3300003790 Bacteria 1860
45 Ga0055530_10004584 3300003791 Bacteria 7051
46 Ga0055540_1000285 3300003792 Bacteria 45310
47 Ga0055540_1016144 3300003792 Bacteria 2138
48 Ga0055540_1019140 3300003792 Bacteria 1855
49 Ga0055531_10001165 3300003794 Bacteria 20245
50 Ga0055531_10013811 3300003794 Bacteria 3696
51 Ga0058692_1012121 3300003856 Bacteria 2054
52 Ga0058692_1031579 3300003856 Bacteria 995
53 Ga0055543_1000001 3300004625 Bacteria 419949
54 Ga0055543_1000147 3300004625 Bacteria 58621
55 Ga0055543_1000808 3300004625 Bacteria 15443
56 Ga0065165_1000049 3300005262 Bacteria 195588
57 Ga0065165_1000180 3300005262 Bacteria 111768
58 Ga0070660_100012954 3300005339 Bacteria 5966
59 Ga0070668_100357051 3300005347 Bacteria 1238
60 Ga0070669_100150907 3300005353 Bacteria 1799
61 Ga0070659_100216211 3300005366 Bacteria 1581
62 Ga0070667_100301827 3300005367 Bacteria 1442
63 Ga0070663_100151950 3300005455 Bacteria 1776
64 Ga0070663_100459110 3300005455 Bacteria 1051
65 Ga0070679_100934728 3300005530 Bacteria 811
66 Ga0070665_100008484 3300005548 Bacteria 10396
67 Ga0068855_100235237 3300005563 Bacteria 2049
68 Ga0068854_100206530 3300005578 Bacteria 1547
69 Ga0068856_100161538 3300005614 Bacteria 2251
70 Ga0068852_100380219 3300005616 Bacteria 1385
71 Ga0081540_1035601 3300005983 Bacteria 2667
72 Ga0075365_10008370 3300006038 Bacteria 5866
73 Ga0075365_10023385 3300006038 Bacteria 3886
74 Ga0075365_10404474 3300006038 Bacteria 963
75 Ga0075368_10003165 3300006042 Bacteria 5470
76 Ga0075368_10102796 3300006042 Bacteria 1174
77 Ga0075363_100248143 3300006048 Bacteria 1025
78 Ga0075362_10041093 3300006177 Bacteria 2038
79 Ga0075367_10031224 3300006178 Bacteria 3058
80 Ga0075367_10043076 3300006178 Bacteria 2643
81 Ga0075367_10234859 3300006178 Bacteria 1148
82 Ga0075369_10034815 3300006186 Bacteria 2138
83 Ga0075369_10119390 3300006186 Bacteria 1193
84 Ga0075369_10128882 3300006186 Bacteria 1148
85 Ga0075366_10003432 3300006195 Bacteria 8356
86 Ga0075366_10023755 3300006195 Bacteria 3572
87 Ga0075370_10028755 3300006353 Bacteria 3092
88 Ga0075370_10030296 3300006353 Bacteria 3018
89 Ga0079104_1000832 3300006946 Bacteria 25706
90 Ga0079104_1002992 3300006946 Bacteria 8306
91 Ga0099826_10001191 3300006948 Bacteria 15079
92 Ga0105250_10047659 3300009092 Bacteria 1718
93 Ga0105240_10000005 3300009093 Bacteria 702630
94 Ga0105240_10270466 3300009093 Bacteria 1957
95 Ga0105245_11142165 3300009098 Unclassified 826
96 Ga0105243_10034198 3300009148 Bacteria 3933
97 Ga0105243_10123975 3300009148 Bacteria 2183
98 Ga0105248_11525167 3300009177 Bacteria 757
99 Ga0105237_10002240 3300009545 Bacteria 24098
100 Ga0105237_10302278 3300009545 Bacteria 1603
101 Ga0105238_10196436 3300009551 Bacteria 1993
102 Ga0105238_10642096 3300009551 Bacteria 1071
103 Ga0123341_1000001 3300009765 Bacteria 314908
104 Ga0123342_1008195 3300009766 Bacteria 13325
105 Ga0105239_10000739 3300010375 Bacteria 46483
106 Ga0105239_10251284 3300010375 Bacteria 1986
107 Ga0157373_10004115 3300013100 Bacteria 10965
108 Ga0157373_10248186 3300013100 Bacteria 1259
109 Ga0157371_10000425 3300013102 Bacteria 51804
110 Ga0157371_10073366 3300013102 Bacteria 2424
111 Ga0157370_10000284 3300013104 Bacteria 64323
112 Ga0157370_10011862 3300013104 Bacteria 9090
113 Ga0157369_10126936 3300013105 Bacteria 2704
114 Ga0171463_1011 3300013249 Bacteria 230603
115 Ga0157374_10402048 3300013296 Bacteria 1366
116 Ga0157372_10235634 3300013307 Bacteria 2123
117 Ga0157375_11679000 3300013308 Bacteria 752
118 Ga0163163_10191791 3300014325 Bacteria 2092
119 Ga0182008_10177682 3300014497 Bacteria 1076
120 Ga0182006_1045497 3300015261 Bacteria 1707
121 Ga0182007_10003688 3300015262 Bacteria 7165
122 Ga0183363_1483 3300015690 Bacteria 1967
123 Ga0214544_1000265 3300021320 Bacteria 87060
124 Ga0214542_1000015 3300021321 Bacteria 227912
125 Ga0214543_1000011 3300021327 Bacteria 344093
126 Ga0214543_1000032 3300021327 Bacteria 200766
127 Ga0228711_1000012 3300022739 Bacteria 132594
128 Ga0228710_1000006 3300022740 Bacteria 209134
129 Ga0209435_100022 3300025206 Bacteria 207766
130 Ga0209436_100837 3300025208 Bacteria 12443
131 Ga0209436_110776 3300025208 Bacteria 1648
132 Ga0209672_106324 3300025228 Bacteria 1936
133 Ga0209437_100160 3300025233 Bacteria 149451
134 Ga0209437_100310 3300025233 Bacteria 65905
135 Ga0209437_107002 3300025233 Bacteria 1856
136 Ga0207425_1001734 3300025245 Bacteria 8600
137 Ga0207425_1025046 3300025245 Bacteria 1234
138 Ga0209646_1000078 3300025246 Bacteria 207766
139 Ga0209026_1000065 3300025250 Bacteria 207766
140 Ga0209677_101086 3300025253 Bacteria 12817
141 Ga0209759_1000055 3300025256 Bacteria 207766
142 Ga0209129_1000442 3300025258 Bacteria 30980
143 Ga0209129_1001721 3300025258 Bacteria 11801
144 Ga0209129_1002382 3300025258 Bacteria 9253
145 Ga0209129_1026610 3300025258 Bacteria 998
146 Ga0209233_1000168 3300025261 Bacteria 149312
147 Ga0209233_1000269 3300025261 Bacteria 74071
148 Ga0209233_1000303 3300025261 Bacteria 59138
149 Ga0209565_1047699 3300025263 Bacteria 778
150 Ga0209673_1000139 3300025273 Bacteria 157765
151 Ga0209673_1001538 3300025273 Bacteria 20946
152 Ga0209673_1001627 3300025273 Bacteria 19497
153 Ga0209673_1006715 3300025273 Bacteria 5486
154 Ga0209130_1000007 3300025284 Bacteria 591584
155 Ga0209130_1000012 3300025284 Bacteria 421329
156 Ga0209130_1004995 3300025284 Bacteria 4790
157 Ga0209676_1000399 3300025292 Bacteria 79312
158 Ga0209025_1000215 3300025294 Bacteria 138335
159 Ga0209025_1000237 3300025294 Bacteria 128553
160 Ga0209025_1000729 3300025294 Bacteria 55773
161 Ga0209025_1002310 3300025294 Bacteria 20657
162 Ga0209025_1005123 3300025294 Bacteria 10878
163 Ga0209025_1014451 3300025294 Bacteria 4851
164 Ga0209025_1078538 3300025294 Bacteria 1132
165 Ga0209564_1000140 3300025295 Bacteria 179856
166 Ga0209564_1000794 3300025295 Bacteria 43506
167 Ga0209564_1000868 3300025295 Bacteria 40261
168 Ga0209758_1000155 3300025297 Bacteria 160455
169 Ga0209758_1000545 3300025297 Bacteria 59830
170 Ga0209758_1002445 3300025297 Bacteria 18964
171 Ga0209758_1003692 3300025297 Bacteria 13607
172 Ga0209758_1007119 3300025297 Bacteria 7736
173 Ga0209758_1014857 3300025297 Bacteria 4094
174 Ga0209758_1036696 3300025297 Bacteria 1908
175 Ga0209758_1059705 3300025297 Bacteria 1267
176 Ga0209758_1083465 3300025297 Bacteria 958
177 Ga0209050_1000650 3300025298 Bacteria 53753
178 Ga0209050_1010922 3300025298 Bacteria 4391
179 Ga0209050_1014943 3300025298 Bacteria 3301
180 Ga0209256_1000557 3300025299 Bacteria 53444
181 Ga0209256_1001048 3300025299 Bacteria 32169
182 Ga0209256_1001371 3300025299 Bacteria 25602
183 Ga0209256_1007242 3300025299 Bacteria 5543
184 Ga0209256_1007384 3300025299 Bacteria 5435
185 Ga0207426_1000010 3300025302 Bacteria 796003
186 Ga0207426_1000092 3300025302 Bacteria 278907
187 Ga0207426_1000094 3300025302 Bacteria 275293
188 Ga0207426_1000111 3300025302 Bacteria 234032
189 Ga0209051_1000095 3300025303 Bacteria 167840
190 Ga0209051_1001031 3300025303 Bacteria 26450
191 Ga0209051_1001191 3300025303 Bacteria 23500
192 Ga0209051_1006458 3300025303 Bacteria 6602
193 Ga0209051_1018886 3300025303 Bacteria 3032
194 Ga0209257_1001962 3300025304 Bacteria 22185
195 Ga0209257_1007707 3300025304 Bacteria 6420
196 Ga0207705_10021095 3300025909 Bacteria 4646
197 Ga0207695_10000011 3300025913 Bacteria 910221
198 Ga0207671_10001291 3300025914 Bacteria 29425
199 Ga0207671_10287611 3300025914 Bacteria 1297
200 Ga0207657_10006448 3300025919 Bacteria 12158
201 Ga0207650_10002090 3300025925 Bacteria 13962
202 Ga0207709_10563149 3300025935 Bacteria 898
203 Ga0207667_10038250 3300025949 Bacteria 5125
204 Ga0207667_10172754 3300025949 Bacteria 2221
205 Ga0207668_10426640 3300025972 Bacteria 1126
206 Ga0207640_10220070 3300025981 Bacteria 1453
207 Ga0207678_10144595 3300026067 Bacteria 2030
208 Ga0207702_10209323 3300026078 Bacteria 1812
209 Ga0207698_10310068 3300026142 Bacteria 1473
210 Ga0209281_1000334 3300027111 Bacteria 81109
211 Ga0209281_1000361 3300027111 Bacteria 74287
212 Ga0209371_1000021 3300027312 Bacteria 555864
213 Ga0209371_1000469 3300027312 Bacteria 39757
214 Ga0209371_1001465 3300027312 Bacteria 15917
215 Ga0209282_1000073 3300027666 Bacteria 81125
216 Ga0209282_1000162 3300027666 Bacteria 38224
217 Ga0209813_10001217 3300027866 Bacteria 5751
218 Ga0268266_10130961 3300028379 Bacteria 2243
219 Ga0268266_10434555 3300028379 Bacteria 1246
220 Ga0268256_1000020 3300030500 Bacteria 557873
221 Ga0268256_1001794 3300030500 Bacteria 12086
222 Ga0268256_1003841 3300030500 Bacteria 6548
223 Ga0316181_1206806 3300030744 Bacteria 2159
224 Ga0307408_100106015 3300031548 Bacteria 2150
225 Ga0307410_10398570 3300031852 Bacteria 1111
226 Ga0307412_10345895 3300031911 Bacteria 1192
227 Ga0315914_1000008 3300031967 Bacteria 209133
228 Ga0307414_10136318 3300032004 Bacteria 1914
229 Ga0307414_10219821 3300032004 Bacteria 1559
230 Ga0307414_10274134 3300032004 Bacteria 1414
231 Ga0316593_10020672 3300032168 Bacteria 2049
232 Ga0315913_1000688 3300033430 Bacteria 32300
233 Ga0315915_1000014 3300033464 Bacteria 171068
234 Ga0439436_0017193 3300041404 Bacteria 2165
235 Ga0439436_0023978 3300041404 Bacteria 1803
236 Ga0439466_0050577 3300041411 Bacteria 1363
237 Ga0439465_0212581 3300041413 Bacteria 707
238 Ga0451787_683955 3300041441 Bacteria 2200
239 Ga0451798_0300108 3300041458 Bacteria 2479
240 Ga0451807_2418322 3300041486 Bacteria 1065
241 Ga0451833_0064250 3300041491 Bacteria 2037
242 Ga0451835_0647353 3300041492 Bacteria 858
243 Ga0451835_0901943 3300041492 Bacteria 2145
244 Ga0451837_1187235 3300041494 Bacteria 3044
245 Ga0451847_0561791 3300041503 Bacteria 2497
246 Ga0451849_1037453 3300041505 Bacteria 2407
247 Ga0451851_0414397 3300041507 Bacteria 2356
248 Ga0451843_0924608 3300041509 Bacteria 846
249 Ga0451854_18011 3300041510 Bacteria 2614
250 Ga0451855_0926363 3300041511 Bacteria 1891
251 Ga0451855_1048572 3300041511 Bacteria 1454
252 Ga0439449_0008876 3300042007 Bacteria 3813
253 Ga0439449_0092537 3300042007 Bacteria 1116
254 Ga0453684_0043135 3300044712 Bacteria 6068
255 Ga0466970_0038601 3300044765 Bacteria 2533
256 Ga0495651_0142673 3300046462 Bacteria 1735
257 Ga0495650_0051798 3300046471 Bacteria 1689
258 Ga0495650_0052948 3300046471 Bacteria 1664
259 Ga0495605_0006637 3300046474 Bacteria 6628
260 Ga0495662_0010267 3300046476 Bacteria 4590
261 Ga0495585_0045442 3300046492 Bacteria 2451
262 Ga0495585_0116137 3300046492 Bacteria 1419
263 Ga0495606_0012046 3300046507 Bacteria 6978
264 Ga0495610_0020427 3300046512 Bacteria 3677
265 Ga0495610_0051538 3300046512 Bacteria 2002
266 Ga0495618_0078536 3300046514 Bacteria 2104
267 Ga0495631_0005005 3300046518 Bacteria 6982
268 Ga0495632_0092687 3300046519 Bacteria 1430
269 Ga0495643_0001636 3300046522 Bacteria 19772
270 Ga0495648_0036465 3300046524 Bacteria 3172
271 Ga0495648_0136084 3300046524 Bacteria 1299
272 Ga0495652_0085028 3300046529 Bacteria 2601
273 Ga0495587_0156004 3300046536 Bacteria 1300
274 Ga0495633_0184279 3300046558 Bacteria 960
275 Ga0495668_0017596 3300046616 Bacteria 4142
276 Ga0495625_0021301 3300046660 Bacteria 4993
277 Ga0495625_0062702 3300046660 Bacteria 2627
278 Ga0495635_0107748 3300046663 Bacteria 1903
279 Ga0495588_0008220 3300046674 Bacteria 4779
280 Ga0495588_0116612 3300046674 Bacteria 1407
281 Ga0495588_0209919 3300046674 Bacteria 1028
282 Ga0495588_0223716 3300046674 Bacteria 993
283 Ga0495658_0162933 3300046683 Bacteria 1376
284 Ga0495624_0152084 3300046690 Bacteria 1415
285 Ga0495670_0362276 3300046691 Bacteria 781
286 Ga0495671_0060410 3300046692 Bacteria 1871
287 Ga0495649_0089127 3300046694 Bacteria 1645
288 Ga0495649_0148086 3300046694 Bacteria 1234
289 Ga0495600_0101184 3300046809 Bacteria 1878
290 Ga0495604_0065519 3300047317 Bacteria 2765
291 Ga0495636_0043896 3300047318 Bacteria 1861
292 Ga0495674_0248033 3300047319 Bacteria 1466
293 Ga0495683_0217154 3300047323 Bacteria 854
294 Ga0495687_072376 3300047443 Bacteria 1377
295 Ga0495681_0002954 3300047470 Bacteria 11989
296 Ga0495686_0085111 3300047472 Bacteria 1926
297 Ga0495686_0141430 3300047472 Bacteria 1420
298 Ga0495602_0174038 3300048088 Bacteria 1668
299 Ga0496102_0087992 3300048905 Bacteria 2871
300 Ga0496102_0217336 3300048905 Bacteria 1802
301 Ga0496104_1277347 3300048907 Bacteria 637
302 Ga0496106_0173771 3300048909 Bacteria 1708
303 Ga0496109_0697414 3300048912 Bacteria 953
304 Ga0496110_0220656 3300048913 Bacteria 1724
305 Ga0496110_1204837 3300048913 Bacteria 666
306 Ga0496111_0108377 3300048914 Bacteria 2045
307 Ga0496112_0147009 3300048915 Bacteria 2325
308 Ga0496113_0080006 3300048916 Bacteria 2502
309 Ga0496116_0000232 3300048919 Bacteria 103015
310 Ga0496116_0013781 3300048919 Bacteria 6497
311 Ga0496116_0022458 3300048919 Bacteria 4727
312 Ga0496116_0171914 3300048919 Bacteria 1173
313 Ga0496117_0000002 3300048920 Bacteria 2483758
314 Ga0496117_0000338 3300048920 Bacteria 82688
315 Ga0496117_0012662 3300048920 Bacteria 7412
316 Ga0496118_0000958 3300048921 Bacteria 45054
317 Ga0496118_0005083 3300048921 Bacteria 15142
318 Ga0496118_0031855 3300048921 Bacteria 4360
319 Ga0496118_0037278 3300048921 Bacteria 3916
320 Ga0496118_0093102 3300048921 Bacteria 2066
321 Ga0496118_0139694 3300048921 Bacteria 1538
322 Ga0496119_0004440 3300048922 Bacteria 13967
323 Ga0496119_0013141 3300048922 Bacteria 6626
324 Ga0496119_0076482 3300048922 Bacteria 1942
325 Ga0496119_0164998 3300048922 Bacteria 1174
326 Ga0496119_0238325 3300048922 Bacteria 922
327 Ga0496120_0001101 3300048923 Bacteria 35265
328 Ga0496120_0001472 3300048923 Bacteria 28063
329 Ga0496120_0013221 3300048923 Bacteria 5569
330 Ga0496120_0173579 3300048923 Bacteria 1064
331 Ga0496120_0292301 3300048923 Bacteria 749
332 Ga0496121_0000003 3300048924 Bacteria 1191431
333 Ga0496121_0002723 3300048924 Bacteria 26365
334 Ga0496121_0009248 3300048924 Bacteria 11379
335 Ga0496121_0046210 3300048924 Bacteria 3729
336 Ga0496121_0053917 3300048924 Bacteria 3364
337 Ga0496121_0193822 3300048924 Bacteria 1454
338 Ga0496121_0202138 3300048924 Bacteria 1415
339 Ga0496121_0283201 3300048924 Bacteria 1133
340 Ga0496122_0000001 3300048925 Bacteria 1827766
341 Ga0496122_0000399 3300048925 Bacteria 92476
342 Ga0496122_0009324 3300048925 Bacteria 10368
343 Ga0496122_0026091 3300048925 Bacteria 5053
344 Ga0496122_0140629 3300048925 Bacteria 1510
345 Ga0496122_0291642 3300048925 Bacteria 885
346 Ga0496122_0299305 3300048925 Bacteria 868
347 Ga0496122_0368383 3300048925 Bacteria 742
348 Ga0496123_0000001 3300048926 Bacteria 1831497
349 Ga0496123_0001759 3300048926 Bacteria 28592
350 Ga0496123_0025956 3300048926 Bacteria 4402
351 Ga0496123_0056604 3300048926 Bacteria 2561
352 Ga0496123_0070337 3300048926 Bacteria 2190
353 Ga0496123_0197324 3300048926 Bacteria 1035
354 Ga0496124_0001394 3300048927 Bacteria 36257
355 Ga0496124_0027061 3300048927 Bacteria 5158
356 Ga0496124_0071220 3300048927 Bacteria 2882
357 Ga0496124_0073107 3300048927 Bacteria 2837
358 Ga0496124_0101086 3300048927 Bacteria 2336
359 Ga0496124_0210535 3300048927 Bacteria 1471
360 Ga0496124_0373924 3300048927 Bacteria 999
361 Ga0496124_0396564 3300048927 Bacteria 959
362 Ga0496125_0000141 3300048928 Bacteria 158991
363 Ga0496125_0000989 3300048928 Bacteria 44313
364 Ga0496125_0002068 3300048928 Bacteria 27088
365 Ga0496125_0093239 3300048928 Bacteria 2248
366 Ga0496125_0115140 3300048928 Bacteria 1934
367 Ga0496125_0136535 3300048928 Bacteria 1714
368 Ga0496125_0337826 3300048928 Bacteria 905
369 Ga0496125_0377329 3300048928 Bacteria 837
370 Ga0496126_0000703 3300048929 Bacteria 61100
371 Ga0496126_0018803 3300048929 Bacteria 6831
372 Ga0496126_0074846 3300048929 Bacteria 3007
373 Ga0496126_0262210 3300048929 Bacteria 1436
374 Ga0495678_023285 3300049459 Bacteria 2696
375 Ga0501032_0092923 3300049569 Bacteria 2001
376 Ga0501033_0289383 3300049570 Bacteria 1155
377 Ga0501034_0082531 3300049571 Bacteria 3216
378 Ga0501034_0245138 3300049571 Unclassified 1737
379 Ga0501034_0248244 3300049571 Bacteria 1724
380 Ga0501034_0305178 3300049571 Bacteria 1527
381 Ga0501034_0381433 3300049571 Bacteria 1334
382 Ga0501037_0130527 3300049573 Bacteria 1802
383 Ga0501039_0104638 3300049575 Bacteria 2210
384 Ga0501043_0058978 3300049579 Bacteria 3012
385 Ga0501043_0134859 3300049579 Bacteria 1934
386 Ga0501047_0127598 3300049581 Bacteria 2424
387 Ga0501047_0178878 3300049581 Bacteria 1988
388 Ga0501068_0084874 3300049584 Bacteria 1948
389 Ga0501080_0808586 3300049742 Bacteria 822
390 Ga0501083_0214826 3300049744 Bacteria 1253
391 Ga0501083_0237864 3300049744 Bacteria 1186
392 Ga0501280_003684 3300049776 Bacteria 2326
393 Ga0501035_0088681 3300049822 Bacteria 2725
394 Ga0501035_0135517 3300049822 Bacteria 2144
395 Ga0501035_0355651 3300049822 Unclassified 1225
396 Ga0501035_0488721 3300049822 Bacteria 1014
397 Ga0501044_0025368 3300049823 Bacteria 6283
398 Ga0501044_0281232 3300049823 Bacteria 1597
399 Ga0501044_0298636 3300049823 Bacteria 1540
400 Ga0501044_0552013 3300049823 Bacteria 1049
401 Ga0501045_0223164 3300049824 Bacteria 1403
402 nmdc:mga03n38_234612_c1 3300050490 Bacteria 963
403 nmdc:mga00v17_117_c1 3300050491 Bacteria 46572
404 nmdc:mga00v17_1328_c1 3300050491 Bacteria 12961
405 nmdc:mga00v17_3753_c1 3300050491 Bacteria 7841
406 nmdc:mga0yw44_140529_c1 3300050492 Bacteria 1569
407 nmdc:mga0yw44_14903_c1 3300050492 Bacteria 4146
408 nmdc:mga0yw44_1493_c1 3300050492 Bacteria 9321
409 nmdc:mga06z11_217280_c1 3300050494 Bacteria 1116
410 nmdc:mga06z11_4555_c1 3300050494 Bacteria 5462
411 nmdc:mga07m45_107523_c1 3300050496 Bacteria 1605
412 nmdc:mga07m45_348314_c1 3300050496 Bacteria 861
413 nmdc:mga0sz30_196_c1 3300050516 Bacteria 22574
414 nmdc:mga0sz30_73596_c1 3300050516 Bacteria 1473
415 Ga0495601_0044605 3300053077 Bacteria 2787
416 Ga0495619_0052175 3300053085 Bacteria 2703
417 Ga0500578_0191486 3300053086 Bacteria 1255
418 Ga0500556_0093769 3300053104 Bacteria 1149
419 Ga0500560_013552 3300053107 Bacteria 2147
420 Ga0500560_045004 3300053107 Bacteria 1398
421 Ga0500569_031180 3300053109 Bacteria 1497
422 Ga0500569_037056 3300053109 Bacteria 1407
423 Ga0500572_008833 3300053111 Bacteria 2366
424 Ga0500594_0136261 3300053118 Bacteria 781
425 Ga0500607_096785 3300053121 Bacteria 1474
426 Ga0500614_045158 3300053123 Bacteria 1136
427 Ga0500658_0001009 3300053134 Bacteria 11474
428 Ga0500561_0000454 3300053137 Bacteria 6670
429 Ga0500568_0026676 3300053139 Bacteria 2422
430 Ga0500568_0057782 3300053139 Bacteria 1509
431 Ga0500590_008460 3300053148 Bacteria 5138
432 Ga0500604_0003652 3300053151 Bacteria 4135
433 Ga0500616_0000417 3300053153 Bacteria 57047
434 Ga0500616_0003179 3300053153 Bacteria 12786
435 Ga0500616_0012969 3300053153 Bacteria 4855
436 Ga0500622_0005692 3300053156 Bacteria 7407
437 Ga0500624_000439 3300053157 Bacteria 12586
438 Ga0500627_0061459 3300053158 Bacteria 1653
439 Ga0500633_0021357 3300053160 Bacteria 1967
440 Ga0500634_0000006 3300053161 Bacteria 171639
441 Ga0500634_0001243 3300053161 Bacteria 9665
442 Ga0500636_0000001 3300053177 Bacteria 324086
443 Ga0500636_0000065 3300053177 Bacteria 51565
444 Ga0500636_0015810 3300053177 Bacteria 4447
445 Ga0587082_028915 3300059504 Bacteria 954
446 Ga0587083_0002058 3300059505 Bacteria 2427
447 Ga0587090_000053 3300059510 Bacteria 6235
448 Ga0587068_004523 3300059641 Bacteria 1844
449 Ga0587068_008441 3300059641 Bacteria 1493
450 Ga0587072_004750 3300059643 Bacteria 1995
451 Ga0587076_014471 3300059645 Bacteria 1215
452 Ga0587079_001746 3300059647 Bacteria 2522
453 Ga0466962_0019993 3300061719 Bacteria 3218
454 2509107876 2508501122 Bacteria 6292184
455 2509376273 2509276019 Bacteria 6802256
456 2509387064 2509276021 Bacteria 7634384
457 2509442560 2509276033 Bacteria 7180565
458 2510132898 2510065019 Bacteria 6903379
459 2510307039 2510065057 Bacteria 6649661
460 2510894270 2510461076 Bacteria 8618824
461 2510899295 2510461076 Bacteria 8618824
462 2511133703 2510917022 Bacteria 6504556
463 2511173010 2510917026 Bacteria 7046020
464 2511198262 2510917030 Bacteria 7460662
465 2511501356 2511231052 Bacteria 6974333
466 2512532777 2512047086 Bacteria 6850303
467 2512958382 2512875024 Bacteria 7195110
468 2512971892 2512875026 Bacteria 6861065
469 2513570014 2513237084 Bacteria 7231967
470 2513575270 2513237085 Bacteria 7695351
471 2513587767 2513237086 Bacteria 7265287
472 2513606294 2513237089 Bacteria 6553624
473 2513617812 2513237091 Bacteria 6900273
474 2513633042 2513237093 Bacteria 7545552
475 2513710237 2513237103 Bacteria 7647401
476 2513887203 2513237140 Bacteria 7076289
477 2513906292 2513237143 Bacteria 6664116
478 2513909784 2513237144 Bacteria 7530820
479 2513926553 2513237146 Bacteria 7166346
480 2513987434 2513237156 Bacteria 6402557
481 2514005443 2513237160 Bacteria 6650282
482 2514019893 2513237162 Bacteria 7468464
483 2515111850 2515075009 Bacteria 7288508
484 2515611504 2515154107 Bacteria 6795637
485 2515633635 2515154113 Bacteria 7807172
486 2515642179 2515154114 Bacteria 7848616
487 2515656233 2515154116 Bacteria 7552979
488 2515738968 2515154134 Bacteria 7220242
489 2516209231 2516143018 Bacteria 6951533
490 2516892635 2516653046 Bacteria 6989037
491 2517035568 2516653077 Bacteria 7555578
492 2517076027 2516653085 Bacteria 7346596
493 2517094767 2517093000 Bacteria 7412387
494 2517406395 2517287029 Bacteria 6905599
495 2517569450 2517487022 Bacteria 7227575
496 2520376183 2519899620 Bacteria 6499161
497 2524452864 2524023207 Bacteria 6813453
498 2524460385 2524023209 Bacteria 6679728
499 2530645151 2529292951 Bacteria 6916614
500 2537874655 2537561587 Bacteria 5425293
501 2551682268 2551306084 Bacteria 8942552
502 2551684591 2551306085 Bacteria 7347181
503 2551695997 2551306086 Bacteria 6843938
504 2551701110 2551306087 Bacteria 7351905
505 2551708971 2551306089 Bacteria 7162724
506 2551719098 2551306090 Bacteria 7953713
507 2551728221 2551306091 Bacteria 7086830
508 2551746284 2551306093 Bacteria 7064773
509 2554247499 2554235003 Bacteria 5877155
510 2558863141 2558860100 Bacteria 8458965
511 2559294630 2558860242 Bacteria 5568029
512 2561466549 2558860983 Bacteria 4133860
513 2585169538 2582581283 Bacteria 6030556
514 2585225886 2582581298 Bacteria 7315509
515 2585270593 2582581307 Bacteria 6597605
516 2585276938 2582581308 Bacteria 7413247
517 2585324059 2582581315 Bacteria 7318924
518 2585389434 2582581865 Bacteria 6644329
519 2585393956 2582581866 Bacteria 6859583
520 2585528169 2585427526 Bacteria 7258840
521 2585534756 2585427527 Bacteria 7273426
522 2585540377 2585427528 Bacteria 6842387
523 2585546846 2585427529 Bacteria 7395659
524 2585551798 2585427530 Bacteria 7383882
525 2585558298 2585427531 Bacteria 6992870
526 2585838576 2585427593 Bacteria 7141551
527 2585897691 2585427608 Bacteria 6544331
528 2585904714 2585427609 Bacteria 6667127
529 2585995654 2585427633 Bacteria 6413184
530 2587980170 2585428125 Bacteria 6662905
531 2599418016 2599185170 Bacteria 7295545
532 2599602222 2599185210 Bacteria 5624189
533 2599721205 2599185236 Bacteria 6875203
534 2600192312 2599185352 Bacteria 7228948
535 2601608351 2600255279 Bacteria 5605316
536 2601745125 2600255308 Bacteria 5611129
537 2616292801 2615840624 Bacteria 6557588
538 2616308311 2615840626 Bacteria 7921970
539 2616556628 2615840698 Bacteria 7319877
540 2617381664 2617270742 Bacteria 6808054
541 2643794100 2643221555 Bacteria 3749717
542 2643808393 2643221557 Bacteria 7184309
543 2643814294 2643221558 Bacteria 5460675
544 2643857643 2643221568 Bacteria 5187270
545 2643919134 2643221582 Bacteria 5804683
546 2643963361 2643221591 Bacteria 4397626
547 2644066513 2643221610 Bacteria 7480339
548 2644109545 2643221618 Bacteria 7717186
549 2644145229 2643221626 Bacteria 8069654
550 2644207620 2643221637 Bacteria 5345260
551 2644300399 2643221653 Bacteria 4569637
552 2644307810 2643221655 Bacteria 7722067
553 2644332586 2643221659 Bacteria 7890716
554 2644378102 2643221668 Bacteria 7306521
555 2644415274 2643221675 Bacteria 7473456
556 2644450325 2643221680 Bacteria 7473610
557 2644494728 2643221688 Bacteria 5260751
558 2644518385 2643221693 Bacteria 5513853
559 2644544332 2643221698 Bacteria 7756764
560 2644613899 2643221712 Bacteria 7729434
561 2644654573 2643221718 Bacteria 5345506
562 2644658623 2643221719 Bacteria 4568197
563 2644677888 2643221723 Bacteria 7095460
564 2644687877 2643221726 Bacteria 7455827
565 2657683721 2657244999 Bacteria 5946535
566 2671115708 2667528174 Bacteria 6435400
567 2692316449 2690316117 Bacteria 6800650
568 2719180789 2718217882 Bacteria 6556348
569 2719385428 2718217927 Bacteria 6972593
570 2719665255 2718217997 Bacteria 6740740
571 2719731538 2718218009 Bacteria 6478651
572 2720491675 2718218199 Bacteria 6740745
573 2720612929 2718218232 Bacteria 6720332
574 2720619789 2718218233 Bacteria 6662049
575 2720631220 2718218235 Bacteria 6630699
576 2720774947 2718218269 Bacteria 6906114
577 2721146883 2718218363 Bacteria 6524337
578 2721158410 2718218365 Bacteria 6274507
579 2721163762 2718218366 Bacteria 6425255
580 2721399177 2718218423 Bacteria 6438183
581 2722839932 2721755514 Bacteria 6424414
582 2723026583 2721755556 Bacteria 6745503
583 2723560187 2721755684 Bacteria 6859907
584 2723566767 2721755685 Bacteria 6704835
585 2724037990 2721755809 Bacteria 6438790
586 2724044294 2721755810 Bacteria 6479005
587 2724089554 2721755819 Bacteria 6906405
588 2724104032 2721755822 Bacteria 6726041
589 2724109847 2721755823 Bacteria 6752556
590 2725950375 2724679232 Bacteria 7646494
591 2730107519 2728369352 Bacteria 6745171
592 2730164026 2728369365 Bacteria 6555560
593 2730298042 2728369397 Bacteria 6274511
594 2738945505 2738541317 Bacteria 5340176
595 2739038302 2738541333 Bacteria 7106503
596 2766067903 2765235942 Bacteria 7445910
597 2776913325 2775507049 Bacteria 6284736
598 2778176451 2775507266 Bacteria 7392367
599 2792581213 2791355082 Bacteria 5973319
600 2792623219 2791355091 Bacteria 6135441
601 2792626983 2791355092 Bacteria 6248105
602 2792642480 2791355094 Bacteria 7011481
603 2793279461 2791355253 Bacteria 5171699
604 2793297179 2791355256 Bacteria 6798008
605 2793313858 2791355259 Bacteria 7254731
606 2793321233 2791355260 Bacteria 6598818
607 2793331924 2791355261 Bacteria 6661293
608 2793337371 2791355262 Bacteria 6774204
609 2793343041 2791355263 Bacteria 6872478
610 2793347753 2791355264 Bacteria 6429314
611 2793352282 2791355265 Bacteria 6539969
612 2793360370 2791355266 Bacteria 7116587
613 2793366423 2791355267 Bacteria 7222458
614 2802718888 2802428858 Bacteria 6636079
615 2802726498 2802428859 Bacteria 6667919
616 2802733791 2802428860 Bacteria 6525526
617 2802738397 2802428861 Bacteria 6534206
618 2802744729 2802428862 Bacteria 6633353
619 2802751065 2802428863 Bacteria 6410669
620 2804751842 2802429268 Bacteria 6094027
621 2805927610 2802429605 Bacteria 6875453
622 2805936085 2802429606 Bacteria 6346811
623 2806045522 2802429633 Bacteria 7341974
624 2806051673 2802429634 Bacteria 7083200
625 2806061717 2802429635 Bacteria 7650140
626 2806067898 2802429636 Bacteria 7597525
627 2806072749 2802429637 Bacteria 7067217
628 2808985594 2808606387 Bacteria 5697198
629 2819241981 2818991272 Bacteria 4622173
630 2819560003 2818991439 Bacteria 6907412
631 2819610435 2818991448 Bacteria 6772224
632 2819638174 2818991453 Bacteria 7181617
633 2838018783 2838016132 Bacteria 6577831
634 2838025511 2838022645 Bacteria 6494267
635 2838034628 2838029111 Bacteria 6603031
636 2838040954 2838035591 Bacteria 7166484
637 2838043090 2838042994 Bacteria 6046894
638 2838052145 2838048938 Bacteria 6044578
639 2838067939 2838061910 Bacteria 6794874
640 2838071351 2838068647 Bacteria 6208656
641 2838079310 2838074704 Bacteria 6785777
642 2838666200 2838661181 Bacteria 7385261
643 2838670052 2838668709 Bacteria 6671819
644 2838676421 2838675328 Bacteria 4909118
645 2838689100 2838686498 Bacteria 7807632
646 2838702424 2838701080 Bacteria 6669771
647 2838715304 2838714209 Bacteria 5525906
648 2838720896 2838719591 Bacteria 5523910
649 2838726062 2838724970 Bacteria 4908691
650 2838730435 2838729681 Bacteria 7400765
651 2838743376 2838742623 Bacteria 7396178
652 2841847825 2841846520 Bacteria 5345850
653 2841854937 2841851746 Bacteria 7532261
654 2841859637 2841859092 Bacteria 5436171
655 2841864934 2841864319 Bacteria 6742987
656 2842110914 2842110456 Bacteria 7656360
657 2842126145 2842124991 Bacteria 5346824
658 2842131315 2842130223 Bacteria 4909145
659 2842147031 2842146304 Bacteria 5957337
660 2842153515 2842152218 Bacteria 4908957
661 2842157799 2842156927 Bacteria 6894975
662 2842165012 2842163707 Bacteria 6916235
663 2842171547 2842170452 Bacteria 5525737
664 2842177135 2842175837 Bacteria 4908771
665 2842180617 2842180545 Bacteria 6888678
666 2842188412 2842187318 Bacteria 5524014
667 2842197028 2842192696 Bacteria 6147454
668 2842201080 2842198810 Bacteria 6608673
669 2842206431 2842205361 Bacteria 6340321
670 2842212723 2842211629 Bacteria 5523832
671 2842220594 2842217011 Bacteria 7497767
672 2842225658 2842224351 Bacteria 5524473
673 2842236234 2842229732 Bacteria 7475766
674 2842244554 2842243621 Bacteria 7421798
675 2842252096 2842250916 Bacteria 6579627
676 2842258367 2842257432 Bacteria 7401195
677 2842267543 2842264693 Bacteria 6472963
678 2842273120 2842271015 Bacteria 7807131
679 2842279888 2842278818 Bacteria 6340002
680 2842287517 2842285085 Bacteria 6011953
681 2842301862 2842298080 Bacteria 6123127
682 2842309398 2842304105 Bacteria 7023636
683 2842315407 2842311132 Bacteria 6616990
684 2842318277 2842317721 Bacteria 6793725
685 2842347150 2842341865 Bacteria 7003929
686 2842362340 2842357229 Bacteria 6485165
687 2842366760 2842363717 Bacteria 6844742
688 2842399515 2842395702 Bacteria 6780583
689 2842404954 2842402390 Bacteria 6681310
690 2842411536 2842409023 Bacteria 6687331
691 2842418013 2842415677 Bacteria 6596907
692 2842424992 2842422224 Bacteria 6239196
693 2842431879 2842428310 Bacteria 6767288
694 2842437992 2842434925 Bacteria 6502746
695 2842444806 2842441272 Bacteria 6769273
696 2842451722 2842447887 Bacteria 6754142
697 2842465817 2842462802 Bacteria 6588055
698 2842472609 2842469257 Bacteria 6752936
699 2842481375 2842475841 Bacteria 6603183
700 2842487158 2842482326 Bacteria 7212537
701 2842492742 2842489311 Bacteria 6620893
702 2842496548 2842495871 Bacteria 6820686
703 2842508275 2842502639 Bacteria 6604161
704 2842510187 2842509118 Bacteria 6850950
705 2842516422 2842515876 Bacteria 5436280
706 2844170422 2844163670 Bacteria 7266046
707 2844459546 2844454524 Bacteria 7952546
708 2844540463 2844533157 Bacteria 7517899
709 2847418484 2847417321 Bacteria 6913799
710 2848993462 2848992105 Bacteria 6810864
711 2850080787 2850079185 Bacteria 6848280
712 2852389594 2852387548 Bacteria 8025568
713 2855825448 2855825444 Bacteria 6785811
714 2855840825 2855839649 Bacteria 7135830
715 2855873353 2855872281 Bacteria 6964271
716 2857523692 2857516855 Bacteria 7787325
717 2858801370 2858800743 Bacteria 6603254
718 2891051569 2891048133 Bacteria 4447501
719 2891374341 2891373044 Bacteria 5202277
720 2896386976 2896384573 Bacteria 7700774
721 2899795520 2899792073 Bacteria 4926588
722 2899850219 2899845264 Bacteria 5672268
723 2913300389 2913295892 Bacteria 6333755
724 2913310211 2913308742 Bacteria 5350706
725 2915985190 2915980308 Bacteria 6624279
726 2915987817 2915986958 Bacteria 6739310
727 2915997469 2915993759 Bacteria 7016183
728 2916002634 2916000859 Bacteria 6865702
729 2916002637 2916000859 Bacteria 6865702
730 2916014439 2916007675 Bacteria 6898660
731 2916016607 2916014648 Bacteria 6946486
732 2916028363 2916021584 Bacteria 6854472
733 2916034863 2916028427 Bacteria 6748433
734 2916041158 2916035215 Bacteria 6755766
735 2916046287 2916041962 Bacteria 6820487
736 2916051085 2916048683 Bacteria 6543552
737 2916060624 2916055098 Bacteria 6758838
738 2916067403 2916061851 Bacteria 6737736
739 2916082838 2916076590 Bacteria 6596108
740 2919107785 2919100787 Bacteria 7710546
741 2919115397 2919114240 Bacteria 5700270
742 2919167823 2919166419 Bacteria 4952238
743 2919175339 2919171160 Bacteria 6499771
744 2919409762 2919408235 Bacteria 6149349
745 2920765561 2920760137 Bacteria 7427611
746 2920824197 2920822456 Bacteria 6897201
747 2921207802 2921201388 Bacteria 6926299
748 2921210924 2921208531 Bacteria 6745326
749 2921243774 2921237296 Bacteria 6876710
750 2921250342 2921244191 Bacteria 6568419
751 2921253053 2921250672 Bacteria 6677771
752 2921260457 2921257292 Bacteria 6808382
753 2921270433 2921263974 Bacteria 6864552
754 2921289142 2921282425 Bacteria 6826397
755 2921293510 2921289301 Bacteria 7316391
756 2921302422 2921296804 Bacteria 7176999
757 2924147577 2924144063 Bacteria 6883928
758 2924156417 2924150972 Bacteria 7169444
759 2924165131 2924158325 Bacteria 7188855
760 2924172844 2924165586 Bacteria 7260590
761 2924179333 2924172951 Bacteria 6749356
762 2924181422 2924179722 Bacteria 6843264
763 2924192758 2924186466 Bacteria 6876637
764 2924197859 2924193448 Bacteria 6955718
765 2924206423 2924200457 Bacteria 6757188
766 2924211555 2924207177 Bacteria 6917007
767 2924223896 2924221636 Bacteria 7113495
768 2924234683 2924228884 Bacteria 6633132
769 2926756447 2926754445 Bacteria 5964435
770 2926760692 2926760298 Bacteria 5505990
771 2929140620 2929138655 Bacteria 5810547
772 2932403371 2932401849 Bacteria 4262978
773 2933008159 2933006813 Bacteria 4912075
774 2933012938 2933011516 Bacteria 5439334
775 2933019236 2933016740 Bacteria 6355406
776 2933575828 2933570622 Bacteria 7023390
777 2933586939 2933586486 Bacteria 7667493
778 2933595457 2933594066 Bacteria 5594265
779 2933602150 2933599457 Bacteria 5858799
780 2935904847 2935901341 Bacteria 7341747
781 2936373142 2936367885 Bacteria 7324495
782 2936381287 2936375103 Bacteria 6652732
783 2936384558 2936381700 Bacteria 7006523
784 2936997716 2936996657 Bacteria 6298727
785 2937007273 2937002841 Bacteria 6934057
786 2937012421 2937009748 Bacteria 6746052
787 2937023051 2937016420 Bacteria 6782579
788 2937029198 2937023124 Bacteria 6815156
789 2937031165 2937029754 Bacteria 6424026
790 2937040888 2937036028 Bacteria 6846469
791 2937049699 2937042894 Bacteria 6741576
792 2937050095 2937049772 Bacteria 6757901
793 2937059655 2937056579 Bacteria 7107896
794 2937071217 2937063883 Bacteria 7199456
795 2937073332 2937071275 Bacteria 6984483
796 2937079960 2937078374 Bacteria 6610289
797 2937088700 2937084907 Bacteria 6618516
798 2937092265 2937091812 Bacteria 6979387
799 2937105855 2937098957 Bacteria 7249374
800 2937113115 2937106411 Bacteria 6947143
801 2937117263 2937113482 Bacteria 6505872
802 2937125332 2937119839 Bacteria 6597547
803 2937130398 2937126314 Bacteria 6771275
804 2941499844 2941499720 Bacteria 7599444
805 2957380859 2957375807 Bacteria 6425588
806 2957388035 2957382221 Bacteria 6737050
807 2957394226 2957388812 Bacteria 6778072
808 2957399344 2957395598 Bacteria 6822399
809 2957407890 2957402308 Bacteria 6741770
810 2957412580 2957408893 Bacteria 6558585
811 2957416731 2957415311 Bacteria 6991633
812 2957426911 2957422303 Bacteria 7172205
813 2957436762 2957430029 Bacteria 7022557
814 2957440322 2957437181 Bacteria 6568994
815 2957450049 2957443900 Bacteria 6869977
816 2957451925 2957450854 Bacteria 6765715
817 2957464643 2957457609 Bacteria 6967680
818 2957470642 2957464669 Bacteria 6568877
819 2957472786 2957471148 Bacteria 6797643
820 2957483519 2957478035 Bacteria 6756658
821 2957491526 2957484790 Bacteria 6703082
822 2957494973 2957491536 Bacteria 6695180
823 2957505082 2957498199 Bacteria 7126688
824 2957505869 2957505466 Bacteria 7253085
825 2960590894 2960584000 Bacteria 6864594
826 2960596126 2960591022 Bacteria 6622873
827 2960602826 2960597568 Bacteria 6550735
828 2960607256 2960603979 Bacteria 6898737
829 2960614990 2960610863 Bacteria 6691244
830 2960623199 2960617483 Bacteria 6727748
831 2960628859 2960624210 Bacteria 6875384
832 2960634645 2960631154 Bacteria 6732508
833 2960641120 2960637947 Bacteria 7296468
834 2960652693 2960645483 Bacteria 7211087
835 2960653114 2960652885 Bacteria 7083688
836 2960666723 2960660292 Bacteria 7041660
837 2960673345 2960667422 Bacteria 6763020
838 2960680464 2960674078 Bacteria 6609048
839 2960686822 2960680706 Bacteria 6624464
840 2960693808 2960687367 Bacteria 6535474
841 2960699772 2960693952 Bacteria 6749742
842 2964611129 2964607997 Bacteria 7101408
843 2964620750 2964615318 Bacteria 6809089
844 2964628864 2964621998 Bacteria 6834995
845 2964635913 2964628898 Bacteria 7083044
846 2964637907 2964636051 Bacteria 7091832
847 2964649133 2964643177 Bacteria 6820887
848 2964655798 2964649959 Bacteria 6675118
849 2964660223 2964656573 Bacteria 7100150
850 2964666196 2964663802 Bacteria 7019362
851 2964678099 2964670856 Bacteria 6851364
852 2964682825 2964678106 Bacteria 6792020
853 2964685361 2964685014 Bacteria 6839111
854 2964698650 2964691889 Bacteria 6802758
855 2964702091 2964698721 Bacteria 6765331
856 2964706591 2964705432 Bacteria 7114648
857 2964717862 2964712639 Bacteria 6695970
858 2964719611 2964719344 Bacteria 7286602
859 2967668625 2967664464 Bacteria 6948836
860 2967674546 2967671571 Bacteria 7021409
861 2967685652 2967678726 Bacteria 7264382
862 2967688769 2967686174 Bacteria 6678622
863 2967699151 2967693043 Bacteria 6804451
864 2967700008 2967699805 Bacteria 6854538
865 2967714359 2967706974 Bacteria 7186053
866 2967720563 2967714385 Bacteria 7000047
867 2967728176 2967721400 Bacteria 7073753
868 2967734263 2967728569 Bacteria 6641507
869 2967741299 2967735183 Bacteria 6827012
870 2967744964 2967742019 Bacteria 6794534
871 2967753391 2967748971 Bacteria 6733771
872 2967757994 2967755722 Bacteria 6814706
873 2967769188 2967762386 Bacteria 6923502
874 2967775288 2967769361 Bacteria 6587838
875 2967782818 2967775926 Bacteria 6738189
876 2970026403 2970019648 Bacteria 7072033
877 2970032700 2970026789 Bacteria 6785236
878 2970038239 2970033650 Bacteria 7118744
879 2970042551 2970040964 Bacteria 6731123
880 2970054883 2970047711 Bacteria 7088379
881 2970060868 2970054988 Bacteria 6611507
882 2970061929 2970061556 Bacteria 7099761
883 2970075935 2970068827 Bacteria 7123112
884 2970081109 2970076120 Bacteria 6697332
885 2970084826 2970082768 Bacteria 6183754
886 2970095266 2970088815 Bacteria 6933825
887 2970097478 2970095765 Bacteria 6936963
888 2970103649 2970102677 Bacteria 6812532
889 2970112193 2970109326 Bacteria 6863976
890 2970121817 2970116247 Bacteria 6501857
891 2970127063 2970122695 Bacteria 6625855
892 2970135116 2970129317 Bacteria 6806560
893 2970136585 2970136068 Bacteria 7207982
894 2970145556 2970143518 Bacteria 6446480
895 2970155279 2970149975 Bacteria 6779706
896 2970159166 2970156795 Bacteria 7168044
897 2970168134 2970164137 Bacteria 6861252
898 2970174816 2970170962 Bacteria 6876229
899 2970181741 2970177841 Bacteria 6768001
900 2970187955 2970184632 Bacteria 7054431
901 2970193550 2970191845 Bacteria 7032787
902 2977520711 2977516862 Bacteria 6940108
903 2977524734 2977523885 Bacteria 6960446
904 2977533823 2977530762 Bacteria 6951399
905 2977542203 2977537788 Bacteria 6929320
906 2977547245 2977544691 Bacteria 6875412
907 2977557418 2977551784 Bacteria 7125765
908 2977565864 2977558990 Bacteria 6863948
909 2977571976 2977565890 Bacteria 6901543
910 2977579114 2977572785 Bacteria 6763888
911 2977585319 2977579622 Bacteria 6772100
912 2978974272 2978969890 Bacteria 5400756
913 2979094031 2979089926 Bacteria 5670289
914 2979098587 2979095461 Bacteria 5669583
915 2979106062 2979100975 Bacteria 5423623
916 2984512148 2984509177 Bacteria 5274802
917 2984521491 2984518228 Bacteria 5277463
918 2984540785 2984537506 Bacteria 5277481
919 2984589614 2984587000 Bacteria 5263363
920 2984603052 2984601300 Bacteria 5455244
921 2989778743 2989776772 Bacteria 4843317
922 2995393378 2995392953 Bacteria 4539380
923 2996341804 2996336353 Bacteria 5511628
924 2996897179 2996893221 Bacteria 5823108
925 3005409657 3005409236 Bacteria 7188837
926 3005420373 3005416602 Bacteria 7064308
927 3005447236 3005445848 Bacteria 6906074
928 639648128 639633055 Bacteria 7751309
929 643825491 643692032 Bacteria 6891900
930 648740122 648276728 Bacteria 6968865
931 650739834 650716007 Bacteria 5573770
932 8003570886 8003570095 Bacteria 5747666
933 8003993323 8003992118 Bacteria 7266902
934 8004000579 8003999396 Bacteria 7063185
935 8005250682 8005246636 Bacteria 4933972
936 8005280199 8005275841 Bacteria 6929066
937 8005288267 8005282627 Bacteria 6675747
938 8005294789 8005289223 Bacteria 6634003
939 8005307049 8005301065 Bacteria 6614431
940 8005314565 8005307578 Bacteria 7395396
941 8005317324 8005314921 Bacteria 7072929
942 8005378777 8005376324 Bacteria 6590079
943 8005385029 8005382845 Bacteria 6732062
944 8005397046 8005395548 Bacteria 6806915
945 8005436118 8005430974 Bacteria 6689030
946 8005462510 8005460587 Bacteria 7157962
947 8005486610 8005484373 Bacteria 6297373
948 8005499889 8005497431 Bacteria 6477605
949 8005558120 8005556819 Bacteria 6908598
950 8005569298 8005563573 Bacteria 7153261
951 8005575424 8005570704 Bacteria 6957481
952 8005621256 8005619151 Bacteria 7030230
953 8005631443 8005626139 Bacteria 6534237
954 8005646246 8005645114 Bacteria 6950293
955 8005671307 8005668836 Bacteria 6953162
956 8005686381 8005682033 Bacteria 6726518
957 8005694963 8005688590 Bacteria 6610080
958 8005696163 8005695170 Bacteria 6912330
959 8018129550 8018127388 Bacteria 7351159
960 8018168091 8018163183 Bacteria 7277977
961 8018180261 8018176218 Bacteria 6896178
962 8023680965 8023680758 Bacteria 7729763
963 8024485741 8024479707 Bacteria 6954785
964 8024505206 8024501048 Bacteria 6427847
965 8046770320 8046767195 Bacteria 7547379
966 8049294376 8049293176 Bacteria 6128433
967 8054462478 8054460903 Bacteria 4872905
968 8054560803 8054558443 Bacteria 5204801
969 8056380135 8056375014 Bacteria 7006639
970 8056387561 8056382006 Bacteria 6408074
971 8057578249 8057575449 Bacteria 7367519
972 8057875505 8057874678 Bacteria 7494653
973 Ga0055536_1004763
974 JGI24740J21852_10000001
975 JGI25155J39150_1000011
976 JGI25156J39149_1000027
977 JGI25156J39149_1000030
978 JGI25162J39368_1003868
979 JGI25162J39368_1003931
980 JGI25154J39366_1000057
981 JGI25157J39369_1000010
982 JGI25152J39213_1005408
983 JGI25150J39212_1003062
984 JGI25150J39212_1003381
985 JGI25150J39212_1009454
986 JGI25159J45721_1000006
987 JGI25159J45721_1000080
988 JGI25159J45721_1000468
989 JGI25151J46595_10000171
990 JGI25151J46595_10013598
991 JGI25151J46595_10058661
992 JGI25165J46597_1000189
993 JGI25165J46597_1000777
994 JGI25165J46597_1004418
995 JGI25153J46596_10006081
996 JGI25153J46596_10011933
997 JGI25153J46596_10019014
998 rootH2_10107759
999 rootL2_10234100
1000 JGI25160J50197_1000004
1001 JGI25160J50197_1000019
1002 JGI25160J50197_1002267
1003 JGI25160J50197_1007157
1004 JGI25161J50226_1000003
1005 JGI25161J50226_1002208
1006 JGI25161J50226_1003651
1007 Ga0055526_1000669
1008 Ga0055526_1002226
1009 Ga0055526_1013840
1010 Ga0055524_1017701
1011 Ga0055524_1022683
1012 Ga0055524_1050762
1013 Ga0055536_1000212
1014 Ga0055528_1000918
1015 Ga0055528_1017564
1016 Ga0055528_1023733
1017 Ga0055530_10004584
1018 Ga0055540_1000285
1019 Ga0055540_1016144
1020 Ga0055540_1019140
1021 Ga0055531_10001165
1022 Ga0055531_10013811
1023 Ga0058692_1012121
1024 Ga0058692_1031579
1025 Ga0055543_1000001
1026 Ga0055543_1000147
1027 Ga0055543_1000808
1028 Ga0065165_1000049
1029 Ga0065165_1000180
1030 Ga0070660_100012954
1031 Ga0070668_100357051
1032 Ga0070669_100150907
1033 Ga0070659_100216211
1034 Ga0070667_100301827
1035 Ga0070663_100151950
1036 Ga0070663_100459110
1037 Ga0070679_100934728
1038 Ga0070665_100008484
1039 Ga0068855_100235237
1040 Ga0068854_100206530
1041 Ga0068856_100161538
1042 Ga0068852_100380219
1043 Ga0081540_1035601
1044 Ga0075365_10008370
1045 Ga0075365_10023385
1046 Ga0075365_10404474
1047 Ga0075368_10003165
1048 Ga0075368_10102796
1049 Ga0075363_100248143
1050 Ga0075362_10041093
1051 Ga0075367_10031224
1052 Ga0075367_10043076
1053 Ga0075367_10234859
1054 Ga0075369_10034815
1055 Ga0075369_10119390
1056 Ga0075369_10128882
1057 Ga0075366_10003432
1058 Ga0075366_10023755
1059 Ga0075370_10028755
1060 Ga0075370_10030296
1061 Ga0079104_1000832
1062 Ga0079104_1002992
1063 Ga0099826_10001191
1064 Ga0105250_10047659
1065 Ga0105240_10000005
1066 Ga0105240_10270466
1067 Ga0105245_11142165
1068 Ga0105243_10034198
1069 Ga0105243_10123975
1070 Ga0105248_11525167
1071 Ga0105237_10002240
1072 Ga0105237_10302278
1073 Ga0105238_10196436
1074 Ga0105238_10642096
1075 Ga0123341_1000001
1076 Ga0123342_1008195
1077 Ga0105239_10000739
1078 Ga0105239_10251284
1079 Ga0157373_10004115
1080 Ga0157373_10248186
1081 Ga0157371_10000425
1082 Ga0157371_10073366
1083 Ga0157370_10000284
1084 Ga0157370_10011862
1085 Ga0157369_10126936
1086 Ga0171463_1011
1087 Ga0157374_10402048
1088 Ga0157372_10235634
1089 Ga0157375_11679000
1090 Ga0163163_10191791
1091 Ga0182008_10177682
1092 Ga0182006_1045497
1093 Ga0182007_10003688
1094 Ga0183363_1483
1095 Ga0214544_1000265
1096 Ga0214542_1000015
1097 Ga0214543_1000011
1098 Ga0214543_1000032
1099 Ga0228711_1000012
1100 Ga0228710_1000006
1101 Ga0209435_100022
1102 Ga0209436_100837
1103 Ga0209436_110776
1104 Ga0209672_106324
1105 Ga0209437_100160
1106 Ga0209437_100310
1107 Ga0209437_107002
1108 Ga0207425_1001734
1109 Ga0207425_1025046
1110 Ga0209646_1000078
1111 Ga0209026_1000065
1112 Ga0209677_101086
1113 Ga0209759_1000055
1114 Ga0209129_1000442
1115 Ga0209129_1001721
1116 Ga0209129_1002382
1117 Ga0209129_1026610
1118 Ga0209233_1000168
1119 Ga0209233_1000269
1120 Ga0209233_1000303
1121 Ga0209565_1047699
1122 Ga0209673_1000139
1123 Ga0209673_1001538
1124 Ga0209673_1001627
1125 Ga0209673_1006715
1126 Ga0209130_1000007
1127 Ga0209130_1000012
1128 Ga0209130_1004995
1129 Ga0209676_1000399
1130 Ga0209025_1000215
1131 Ga0209025_1000237
1132 Ga0209025_1000729
1133 Ga0209025_1002310
1134 Ga0209025_1005123
1135 Ga0209025_1014451
1136 Ga0209025_1078538
1137 Ga0209564_1000140
1138 Ga0209564_1000794
1139 Ga0209564_1000868
1140 Ga0209758_1000155
1141 Ga0209758_1000545
1142 Ga0209758_1002445
1143 Ga0209758_1003692
1144 Ga0209758_1007119
1145 Ga0209758_1014857
1146 Ga0209758_1036696
1147 Ga0209758_1059705
1148 Ga0209758_1083465
1149 Ga0209050_1000650
1150 Ga0209050_1010922
1151 Ga0209050_1014943
1152 Ga0209256_1000557
1153 Ga0209256_1001048
1154 Ga0209256_1001371
1155 Ga0209256_1007242
1156 Ga0209256_1007384
1157 Ga0207426_1000010
1158 Ga0207426_1000092
1159 Ga0207426_1000094
1160 Ga0207426_1000111
1161 Ga0209051_1000095
1162 Ga0209051_1001031
1163 Ga0209051_1001191
1164 Ga0209051_1006458
1165 Ga0209051_1018886
1166 Ga0209257_1001962
1167 Ga0209257_1007707
1168 Ga0207705_10021095
1169 Ga0207695_10000011
1170 Ga0207671_10001291
1171 Ga0207671_10287611
1172 Ga0207657_10006448
1173 Ga0207650_10002090
1174 Ga0207709_10563149
1175 Ga0207667_10038250
1176 Ga0207667_10172754
1177 Ga0207668_10426640
1178 Ga0207640_10220070
1179 Ga0207678_10144595
1180 Ga0207702_10209323
1181 Ga0207698_10310068
1182 Ga0209281_1000334
1183 Ga0209281_1000361
1184 Ga0209371_1000021
1185 Ga0209371_1000469
1186 Ga0209371_1001465
1187 Ga0209282_1000073
1188 Ga0209282_1000162
1189 Ga0209813_10001217
1190 Ga0268266_10130961
1191 Ga0268266_10434555
1192 Ga0268256_1000020
1193 Ga0268256_1001794
1194 Ga0268256_1003841
1195 Ga0316181_1206806
1196 Ga0307408_100106015
1197 Ga0307410_10398570
1198 Ga0307412_10345895
1199 Ga0315914_1000008
1200 Ga0307414_10136318
1201 Ga0307414_10219821
1202 Ga0307414_10274134
1203 Ga0316593_10020672
1204 Ga0315913_1000688
1205 Ga0315915_1000014
1206 Ga0439436_0017193
1207 Ga0439436_0023978
1208 Ga0439466_0050577
1209 Ga0439465_0212581
1210 Ga0451787_683955
1211 Ga0451798_0300108
1212 Ga0451807_2418322
1213 Ga0451833_0064250
1214 Ga0451835_0647353
1215 Ga0451835_0901943
1216 Ga0451837_1187235
1217 Ga0451847_0561791
1218 Ga0451849_1037453
1219 Ga0451851_0414397
1220 Ga0451843_0924608
1221 Ga0451854_18011
1222 Ga0451855_0926363
1223 Ga0451855_1048572
1224 Ga0439449_0008876
1225 Ga0439449_0092537
1226 Ga0453684_0043135
1227 Ga0466970_0038601
1228 Ga0495651_0142673
1229 Ga0495650_0051798
1230 Ga0495650_0052948
1231 Ga0495605_0006637
1232 Ga0495662_0010267
1233 Ga0495585_0045442
1234 Ga0495585_0116137
1235 Ga0495606_0012046
1236 Ga0495610_0020427
1237 Ga0495610_0051538
1238 Ga0495618_0078536
1239 Ga0495631_0005005
1240 Ga0495632_0092687
1241 Ga0495643_0001636
1242 Ga0495648_0036465
1243 Ga0495648_0136084
1244 Ga0495652_0085028
1245 Ga0495587_0156004
1246 Ga0495633_0184279
1247 Ga0495668_0017596
1248 Ga0495625_0021301
1249 Ga0495625_0062702
1250 Ga0495635_0107748
1251 Ga0495588_0008220
1252 Ga0495588_0116612
1253 Ga0495588_0209919
1254 Ga0495588_0223716
1255 Ga0495658_0162933
1256 Ga0495624_0152084
1257 Ga0495670_0362276
1258 Ga0495671_0060410
1259 Ga0495649_0089127
1260 Ga0495649_0148086
1261 Ga0495600_0101184
1262 Ga0495604_0065519
1263 Ga0495636_0043896
1264 Ga0495674_0248033
1265 Ga0495683_0217154
1266 Ga0495687_072376
1267 Ga0495681_0002954
1268 Ga0495686_0085111
1269 Ga0495686_0141430
1270 Ga0495602_0174038
1271 Ga0496102_0087992
1272 Ga0496102_0217336
1273 Ga0496104_1277347
1274 Ga0496106_0173771
1275 Ga0496109_0697414
1276 Ga0496110_0220656
1277 Ga0496110_1204837
1278 Ga0496111_0108377
1279 Ga0496112_0147009
1280 Ga0496113_0080006
1281 Ga0496116_0000232
1282 Ga0496116_0013781
1283 Ga0496116_0022458
1284 Ga0496116_0171914
1285 Ga0496117_0000002
1286 Ga0496117_0000338
1287 Ga0496117_0012662
1288 Ga0496118_0000958
1289 Ga0496118_0005083
1290 Ga0496118_0031855
1291 Ga0496118_0037278
1292 Ga0496118_0093102
1293 Ga0496118_0139694
1294 Ga0496119_0004440
1295 Ga0496119_0013141
1296 Ga0496119_0076482
1297 Ga0496119_0164998
1298 Ga0496119_0238325
1299 Ga0496120_0001101
1300 Ga0496120_0001472
1301 Ga0496120_0013221
1302 Ga0496120_0173579
1303 Ga0496120_0292301
1304 Ga0496121_0000003
1305 Ga0496121_0002723
1306 Ga0496121_0009248
1307 Ga0496121_0046210
1308 Ga0496121_0053917
1309 Ga0496121_0193822
1310 Ga0496121_0202138
1311 Ga0496121_0283201
1312 Ga0496122_0000001
1313 Ga0496122_0000399
1314 Ga0496122_0009324
1315 Ga0496122_0026091
1316 Ga0496122_0140629
1317 Ga0496122_0291642
1318 Ga0496122_0299305
1319 Ga0496122_0368383
1320 Ga0496123_0000001
1321 Ga0496123_0001759
1322 Ga0496123_0025956
1323 Ga0496123_0056604
1324 Ga0496123_0070337
1325 Ga0496123_0197324
1326 Ga0496124_0001394
1327 Ga0496124_0027061
1328 Ga0496124_0071220
1329 Ga0496124_0073107
1330 Ga0496124_0101086
1331 Ga0496124_0210535
1332 Ga0496124_0373924
1333 Ga0496124_0396564
1334 Ga0496125_0000141
1335 Ga0496125_0000989
1336 Ga0496125_0002068
1337 Ga0496125_0093239
1338 Ga0496125_0115140
1339 Ga0496125_0136535
1340 Ga0496125_0337826
1341 Ga0496125_0377329
1342 Ga0496126_0000703
1343 Ga0496126_0018803
1344 Ga0496126_0074846
1345 Ga0496126_0262210
1346 Ga0495678_023285
1347 Ga0501032_0092923
1348 Ga0501033_0289383
1349 Ga0501034_0082531
1350 Ga0501034_0245138
1351 Ga0501034_0248244
1352 Ga0501034_0305178
1353 Ga0501034_0381433
1354 Ga0501037_0130527
1355 Ga0501039_0104638
1356 Ga0501043_0058978
1357 Ga0501043_0134859
1358 Ga0501047_0127598
1359 Ga0501047_0178878
1360 Ga0501068_0084874
1361 Ga0501080_0808586
1362 Ga0501083_0214826
1363 Ga0501083_0237864
1364 Ga0501280_003684
1365 Ga0501035_0088681
1366 Ga0501035_0135517
1367 Ga0501035_0355651
1368 Ga0501035_0488721
1369 Ga0501044_0025368
1370 Ga0501044_0281232
1371 Ga0501044_0298636
1372 Ga0501044_0552013
1373 Ga0501045_0223164
1374 nmdc:mga03n38_234612_c1
1375 nmdc:mga00v17_117_c1
1376 nmdc:mga00v17_1328_c1
1377 nmdc:mga00v17_3753_c1
1378 nmdc:mga0yw44_140529_c1
1379 nmdc:mga0yw44_14903_c1
1380 nmdc:mga0yw44_1493_c1
1381 nmdc:mga06z11_217280_c1
1382 nmdc:mga06z11_4555_c1
1383 nmdc:mga07m45_107523_c1
1384 nmdc:mga07m45_348314_c1
1385 nmdc:mga0sz30_196_c1
1386 nmdc:mga0sz30_73596_c1
1387 Ga0495601_0044605
1388 Ga0495619_0052175
1389 Ga0500578_0191486
1390 Ga0500556_0093769
1391 Ga0500560_013552
1392 Ga0500560_045004
1393 Ga0500569_031180
1394 Ga0500569_037056
1395 Ga0500572_008833
1396 Ga0500594_0136261
1397 Ga0500607_096785
1398 Ga0500614_045158
1399 Ga0500658_0001009
1400 Ga0500561_0000454
1401 Ga0500568_0026676
1402 Ga0500568_0057782
1403 Ga0500590_008460
1404 Ga0500604_0003652
1405 Ga0500616_0000417
1406 Ga0500616_0003179
1407 Ga0500616_0012969
1408 Ga0500622_0005692
1409 Ga0500624_000439
1410 Ga0500627_0061459
1411 Ga0500633_0021357
1412 Ga0500634_0000006
1413 Ga0500634_0001243
1414 Ga0500636_0000001
1415 Ga0500636_0000065
1416 Ga0500636_0015810
1417 Ga0587082_028915
1418 Ga0587083_0002058
1419 Ga0587090_000053
1420 Ga0587068_004523
1421 Ga0587068_008441
1422 Ga0587072_004750
1423 Ga0587076_014471
1424 Ga0587079_001746
1425 Ga0466962_0019993
1426 2509107876
1427 2509376273
1428 2509387064
1429 2509442560
1430 2510132898
1431 2510307039
1432 2510894270
1433 2510899295
1434 2511133703
1435 2511173010
1436 2511198262
1437 2511501356
1438 2512532777
1439 2512958382
1440 2512971892
1441 2513570014
1442 2513575270
1443 2513587767
1444 2513606294
1445 2513617812
1446 2513633042
1447 2513710237
1448 2513887203
1449 2513906292
1450 2513909784
1451 2513926553
1452 2513987434
1453 2514005443
1454 2514019893
1455 2515111850
1456 2515611504
1457 2515633635
1458 2515642179
1459 2515656233
1460 2515738968
1461 2516209231
1462 2516892635
1463 2517035568
1464 2517076027
1465 2517094767
1466 2517406395
1467 2517569450
1468 2520376183
1469 2524452864
1470 2524460385
1471 2530645151
1472 2537874655
1473 2551682268
1474 2551684591
1475 2551695997
1476 2551701110
1477 2551708971
1478 2551719098
1479 2551728221
1480 2551746284
1481 2554247499
1482 2558863141
1483 2559294630
1484 2561466549
1485 2585169538
1486 2585225886
1487 2585270593
1488 2585276938
1489 2585324059
1490 2585389434
1491 2585393956
1492 2585528169
1493 2585534756
1494 2585540377
1495 2585546846
1496 2585551798
1497 2585558298
1498 2585838576
1499 2585897691
1500 2585904714
1501 2585995654
1502 2587980170
1503 2599418016
1504 2599602222
1505 2599721205
1506 2600192312
1507 2601608351
1508 2601745125
1509 2616292801
1510 2616308311
1511 2616556628
1512 2617381664
1513 2643794100
1514 2643808393
1515 2643814294
1516 2643857643
1517 2643919134
1518 2643963361
1519 2644066513
1520 2644109545
1521 2644145229
1522 2644207620
1523 2644300399
1524 2644307810
1525 2644332586
1526 2644378102
1527 2644415274
1528 2644450325
1529 2644494728
1530 2644518385
1531 2644544332
1532 2644613899
1533 2644654573
1534 2644658623
1535 2644677888
1536 2644687877
1537 2657683721
1538 2671115708
1539 2692316449
1540 2719180789
1541 2719385428
1542 2719665255
1543 2719731538
1544 2720491675
1545 2720612929
1546 2720619789
1547 2720631220
1548 2720774947
1549 2721146883
1550 2721158410
1551 2721163762
1552 2721399177
1553 2722839932
1554 2723026583
1555 2723560187
1556 2723566767
1557 2724037990
1558 2724044294
1559 2724089554
1560 2724104032
1561 2724109847
1562 2725950375
1563 2730107519
1564 2730164026
1565 2730298042
1566 2738945505
1567 2739038302
1568 2766067903
1569 2776913325
1570 2778176451
1571 2792581213
1572 2792623219
1573 2792626983
1574 2792642480
1575 2793279461
1576 2793297179
1577 2793313858
1578 2793321233
1579 2793331924
1580 2793337371
1581 2793343041
1582 2793347753
1583 2793352282
1584 2793360370
1585 2793366423
1586 2802718888
1587 2802726498
1588 2802733791
1589 2802738397
1590 2802744729
1591 2802751065
1592 2804751842
1593 2805927610
1594 2805936085
1595 2806045522
1596 2806051673
1597 2806061717
1598 2806067898
1599 2806072749
1600 2808985594
1601 2819241981
1602 2819560003
1603 2819610435
1604 2819638174
1605 2838018783
1606 2838025511
1607 2838034628
1608 2838040954
1609 2838043090
1610 2838052145
1611 2838067939
1612 2838071351
1613 2838079310
1614 2838666200
1615 2838670052
1616 2838676421
1617 2838689100
1618 2838702424
1619 2838715304
1620 2838720896
1621 2838726062
1622 2838730435
1623 2838743376
1624 2841847825
1625 2841854937
1626 2841859637
1627 2841864934
1628 2842110914
1629 2842126145
1630 2842131315
1631 2842147031
1632 2842153515
1633 2842157799
1634 2842165012
1635 2842171547
1636 2842177135
1637 2842180617
1638 2842188412
1639 2842197028
1640 2842201080
1641 2842206431
1642 2842212723
1643 2842220594
1644 2842225658
1645 2842236234
1646 2842244554
1647 2842252096
1648 2842258367
1649 2842267543
1650 2842273120
1651 2842279888
1652 2842287517
1653 2842301862
1654 2842309398
1655 2842315407
1656 2842318277
1657 2842347150
1658 2842362340
1659 2842366760
1660 2842399515
1661 2842404954
1662 2842411536
1663 2842418013
1664 2842424992
1665 2842431879
1666 2842437992
1667 2842444806
1668 2842451722
1669 2842465817
1670 2842472609
1671 2842481375
1672 2842487158
1673 2842492742
1674 2842496548
1675 2842508275
1676 2842510187
1677 2842516422
1678 2844170422
1679 2844459546
1680 2844540463
1681 2847418484
1682 2848993462
1683 2850080787
1684 2852389594
1685 2855825448
1686 2855840825
1687 2855873353
1688 2857523692
1689 2858801370
1690 2891051569
1691 2891374341
1692 2896386976
1693 2899795520
1694 2899850219
1695 2913300389
1696 2913310211
1697 2915985190
1698 2915987817
1699 2915997469
1700 2916002634
1701 2916002637
1702 2916014439
1703 2916016607
1704 2916028363
1705 2916034863
1706 2916041158
1707 2916046287
1708 2916051085
1709 2916060624
1710 2916067403
1711 2916082838
1712 2919107785
1713 2919115397
1714 2919167823
1715 2919175339
1716 2919409762
1717 2920765561
1718 2920824197
1719 2921207802
1720 2921210924
1721 2921243774
1722 2921250342
1723 2921253053
1724 2921260457
1725 2921270433
1726 2921289142
1727 2921293510
1728 2921302422
1729 2924147577
1730 2924156417
1731 2924165131
1732 2924172844
1733 2924179333
1734 2924181422
1735 2924192758
1736 2924197859
1737 2924206423
1738 2924211555
1739 2924223896
1740 2924234683
1741 2926756447
1742 2926760692
1743 2929140620
1744 2932403371
1745 2933008159
1746 2933012938
1747 2933019236
1748 2933575828
1749 2933586939
1750 2933595457
1751 2933602150
1752 2935904847
1753 2936373142
1754 2936381287
1755 2936384558
1756 2936997716
1757 2937007273
1758 2937012421
1759 2937023051
1760 2937029198
1761 2937031165
1762 2937040888
1763 2937049699
1764 2937050095
1765 2937059655
1766 2937071217
1767 2937073332
1768 2937079960
1769 2937088700
1770 2937092265
1771 2937105855
1772 2937113115
1773 2937117263
1774 2937125332
1775 2937130398
1776 2941499844
1777 2957380859
1778 2957388035
1779 2957394226
1780 2957399344
1781 2957407890
1782 2957412580
1783 2957416731
1784 2957426911
1785 2957436762
1786 2957440322
1787 2957450049
1788 2957451925
1789 2957464643
1790 2957470642
1791 2957472786
1792 2957483519
1793 2957491526
1794 2957494973
1795 2957505082
1796 2957505869
1797 2960590894
1798 2960596126
1799 2960602826
1800 2960607256
1801 2960614990
1802 2960623199
1803 2960628859
1804 2960634645
1805 2960641120
1806 2960652693
1807 2960653114
1808 2960666723
1809 2960673345
1810 2960680464
1811 2960686822
1812 2960693808
1813 2960699772
1814 2964611129
1815 2964620750
1816 2964628864
1817 2964635913
1818 2964637907
1819 2964649133
1820 2964655798
1821 2964660223
1822 2964666196
1823 2964678099
1824 2964682825
1825 2964685361
1826 2964698650
1827 2964702091
1828 2964706591
1829 2964717862
1830 2964719611
1831 2967668625
1832 2967674546
1833 2967685652
1834 2967688769
1835 2967699151
1836 2967700008
1837 2967714359
1838 2967720563
1839 2967728176
1840 2967734263
1841 2967741299
1842 2967744964
1843 2967753391
1844 2967757994
1845 2967769188
1846 2967775288
1847 2967782818
1848 2970026403
1849 2970032700
1850 2970038239
1851 2970042551
1852 2970054883
1853 2970060868
1854 2970061929
1855 2970075935
1856 2970081109
1857 2970084826
1858 2970095266
1859 2970097478
1860 2970103649
1861 2970112193
1862 2970121817
1863 2970127063
1864 2970135116
1865 2970136585
1866 2970145556
1867 2970155279
1868 2970159166
1869 2970168134
1870 2970174816
1871 2970181741
1872 2970187955
1873 2970193550
1874 2977520711
1875 2977524734
1876 2977533823
1877 2977542203
1878 2977547245
1879 2977557418
1880 2977565864
1881 2977571976
1882 2977579114
1883 2977585319
1884 2978974272
1885 2979094031
1886 2979098587
1887 2979106062
1888 2984512148
1889 2984521491
1890 2984540785
1891 2984589614
1892 2984603052
1893 2989778743
1894 2995393378
1895 2996341804
1896 2996897179
1897 3005409657
1898 3005420373
1899 3005447236
1900 639648128
1901 643825491
1902 648740122
1903 650739834
1904 8003570886
1905 8003993323
1906 8004000579
1907 8005250682
1908 8005280199
1909 8005288267
1910 8005294789
1911 8005307049
1912 8005314565
1913 8005317324
1914 8005378777
1915 8005385029
1916 8005397046
1917 8005436118
1918 8005462510
1919 8005486610
1920 8005499889
1921 8005558120
1922 8005569298
1923 8005575424
1924 8005621256
1925 8005631443
1926 8005646246
1927 8005671307
1928 8005686381
1929 8005694963
1930 8005696163
1931 8018129550
1932 8018168091
1933 8018180261
1934 8023680965
1935 8024485741
1936 8024505206
1937 8046770320
1938 8049294376
1939 8054462478
1940 8054560803
1941 8056380135
1942 8056387561
1943 8057578249
1944 8057875505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

27

225

0.82

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

29

220

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tx1-assembly1.cif.gz_A the crystal structure of carbohydrate acetylesterase family member from sinorhizobium meliloti 0.9911 2 213
2q0q-assembly1.cif.gz_G structure of the native m. smegmatis aryl esterase 0.9522 2 210
5hoe-assembly1.cif.gz_A crystal structrue of est24, a carbohydrate acetylesterase from sinorhizobium meliloti 0.9503 2 210
3dci-assembly1.cif.gz_A the structure of a putative arylesterase from agrobacterium tumefaciens str. c58 0.9493 2 210
7bxb-assembly1.cif.gz_D crystal structure of ca_00311 0.948 1 213
ID Description Score Start End Superfamily
4tx1C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9917 2 213 3.40.50.1110
3dciC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9486 3 210 3.40.50.1110
3dciC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9394 3 210 3.40.50.1110
2q0qE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9283 2 210 3.40.50.1110
2q0qE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9155 2 210 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A3S3C800-F1-model_v4 Arylesterase 1.005 2 53 GO:0052689
AF-A0A529VZP1-F1-model_v4 Arylesterase 0.9975 127 213 GO:0052689
AF-A0A435WXR2-F1-model_v4 Arylesterase 0.9949 135 213 GO:0052689
AF-A0A3S2BJX9-F1-model_v4 Arylesterase 0.9942 2 112 GO:0052689
AF-A0A434FPX6-F1-model_v4 Arylesterase 0.9942 110 213 GO:0052689

Map