F487147

General Info

Members Datasets Scaffolds Average Seq Length
972 780 1944 294

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10057721|Ga0075433_100577216
Length 288
Sequence MATTIEGTVPFRGYRTWYQVVGGLPATGGQLPLLVVHGGPGLPHDYLEDLAGLADGERAVVFYDQLGCGKSDHPDDPALWVMDTFAGELATVREVLGLDRIHLLGHSWGGWLALEYALGRPTGLASLVLASTCASLPAFAAQTRRLKESLPPEVQQVIDWHESAGTTGDPTYVQAAMAYRTRWVCRLDPFPVHLVRSICNLSQDVYQTMQGPEWNVTGNLRLDLPVLVTSGRHDEMTPALVRPLVDGIRGAEWVVFEESAHMAMVEEPDRYRQVLQSWLSRVVEAAPA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
74 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
163 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
164 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
170 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
171 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
174 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
179 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
180 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
181 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
182 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
183 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
184 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
286 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
287 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
288 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
289 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
290 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
300 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
301 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
302 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
303 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
304 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
305 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
306 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
307 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
308 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
309 2511231022 Pseudomonas sp. GM79 Isolate Nodule
310 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
311 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
312 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
313 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
314 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
315 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
316 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
317 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
318 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
319 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
320 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
321 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
322 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
323 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
324 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
325 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
326 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
327 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
328 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
329 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
330 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
331 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
332 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
333 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
334 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
335 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
336 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
337 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
338 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
339 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
340 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
341 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
342 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
343 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
344 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
345 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
346 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
347 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
348 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
349 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
350 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
351 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
352 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
353 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
354 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
355 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
356 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
357 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
358 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
359 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
360 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
361 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
362 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
363 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
364 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
365 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
366 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
367 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
368 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
369 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
370 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
371 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
372 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
373 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
374 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
375 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
376 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
377 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
378 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
379 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
380 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
381 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
382 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
383 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
384 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
385 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
386 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
387 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
388 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
389 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
390 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
391 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
392 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
393 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
394 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
395 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
396 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
397 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
398 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
399 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
400 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
401 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
402 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
403 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
404 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
405 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
406 2643221568 Rhizobium sp. Root564 Isolate Unclassified
407 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
408 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
409 2643221688 Rhizobium sp. Root482 Isolate Unclassified
410 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
411 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
412 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
413 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
414 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
415 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
416 2718217927 Rhizobium sp. N324 Isolate Nodule
417 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
418 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
419 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
420 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
421 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
422 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
423 2718218423 Rhizobium sp. N941 Isolate Nodule
424 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
425 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
426 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
427 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
428 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
429 2721755809 Rhizobium sp. N541 Isolate Nodule
430 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
431 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
432 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
433 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
434 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
435 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
436 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
437 2738541293 Rhizobium sp. GV031 Isolate Unclassified
438 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
439 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
440 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
441 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
442 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
443 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
444 2751185800 Brucella pituitosa AA2 Isolate Unclassified
445 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
446 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
447 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
448 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
449 2791355256 Rhizobium sp. M10 Isolate Nodule
450 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
451 2791355260 Rhizobium sp. L9 Isolate Nodule
452 2791355261 Rhizobium sp. J15 Isolate Nodule
453 2791355262 Rhizobium sp. M1 Isolate Nodule
454 2791355263 Rhizobium chutanense C5 Isolate Nodule
455 2791355265 Rhizobium sp. H4 Isolate Nodule
456 2791355266 Rhizobium sp. L43 Isolate Nodule
457 2791355267 Rhizobium sp. L18 Isolate Nodule
458 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
459 2802429633 Rhizobium anhuiense J3 Isolate Nodule
460 2802429634 Rhizobium anhuiense S10 Isolate Nodule
461 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
462 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
463 2802429637 Rhizobium anhuiense C15 Isolate Nodule
464 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
465 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
466 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
467 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
468 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
469 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
470 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
471 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
472 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
473 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
474 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
475 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
476 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
477 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
478 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
479 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
480 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
481 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
482 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
483 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
484 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
485 2838048938 Rhizobium pisi 27/80 Isolate Nodule
486 2838061910 Rhizobium phaseoli L15 Isolate Nodule
487 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
488 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
489 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
490 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
491 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
492 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
493 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
494 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
495 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
496 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
497 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
498 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
499 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
500 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
501 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
502 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
503 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
504 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
505 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
506 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
507 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
508 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
509 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
510 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
511 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
512 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
513 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
514 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
515 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
516 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
517 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
518 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
519 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
520 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
521 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
522 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
523 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
524 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
525 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
526 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
527 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
528 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
529 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
530 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
531 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
532 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
533 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
534 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
535 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
536 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
537 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
538 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
539 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
540 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
541 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
542 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
543 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
544 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
545 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
546 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
547 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
548 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
549 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
550 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
551 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
552 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
553 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
554 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
555 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
556 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
557 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
558 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
559 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
560 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
561 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
562 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
563 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
564 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
565 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
566 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
567 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
568 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
569 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
570 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
571 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
572 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
573 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
574 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
575 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
576 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
577 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
578 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
579 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
580 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
581 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
582 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
583 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
584 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
585 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
586 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
587 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
588 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
589 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
590 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
591 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
592 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
593 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
594 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
595 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
596 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
597 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
598 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
599 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
600 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
601 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
602 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
603 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
604 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
605 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
606 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
607 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
608 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
609 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
610 2933599457 Rhizobium phaseoli M3 Isolate Nodule
611 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
612 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
613 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
614 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
615 2936381700 Rhizobium chutanense C16 Isolate Unclassified
616 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
617 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
618 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
619 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
620 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
621 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
622 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
623 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
624 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
625 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
626 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
627 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
628 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
629 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
630 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
631 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
632 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
633 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
634 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
635 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
636 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
637 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
638 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
639 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
640 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
641 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
642 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
643 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
644 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
645 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
646 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
647 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
648 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
649 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
650 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
651 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
652 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
653 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
654 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
655 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
656 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
657 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
658 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
659 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
660 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
661 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
662 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
663 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
664 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
665 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
666 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
667 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
668 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
669 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
670 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
671 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
672 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
673 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
674 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
675 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
676 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
677 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
678 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
679 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
680 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
681 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
682 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
683 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
684 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
685 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
686 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
687 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
688 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
689 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
690 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
691 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
692 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
693 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
694 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
695 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
696 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
697 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
698 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
699 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
700 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
701 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
702 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
703 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
704 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
705 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
706 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
707 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
708 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
709 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
710 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
711 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
712 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
713 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
714 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
715 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
716 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
717 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
718 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
719 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
720 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
721 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
722 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
723 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
724 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
725 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
726 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
727 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
728 2996893221 Rhizobium sp. R635 Isolate Nodule
729 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
730 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
731 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
732 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
733 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
734 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
735 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
736 8005275841 Rhizobium sp. N4311 Isolate Nodule
737 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
738 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
739 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
740 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
741 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
742 8005395548 Rhizobium sp. R339 Isolate Nodule
743 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
744 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
745 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
746 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
747 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
748 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
749 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
750 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
751 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
752 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
753 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
754 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
755 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
756 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
757 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
758 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
759 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
760 8018176218 Rhizobium sp. N122 Isolate Nodule
761 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
762 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
763 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
764 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
765 8024501048 Rhizobium sp. H4 Isolate Nodule
766 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
767 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
768 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
769 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
770 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
771 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
772 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
773 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
774 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
775 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
776 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
777 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
778 8056382006 Rhizobium croatiense 13T Isolate Nodule
779 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere
780 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.21
Metatranscriptomes 0
Isolates 49.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.3
Nodule 34.05
Rhizoplane 4.32
Rhizosphere 35.08
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10057721 3300006852 Bacteria 3393
2 SwRhRL2b_contig_3754702 2162886007 Bacteria 11743
3 MRS1b_contig_6409452 2162886011 Bacteria 1143
4 JGI25162J39368_1000144 3300002737 Bacteria 77232
5 JGI25152J39213_1000087 3300002773 Bacteria 64368
6 JGI25150J39212_1000017 3300002774 Bacteria 150316
7 JGI25150J39212_1000093 3300002774 Bacteria 51048
8 JGI25159J45721_1001687 3300002987 Bacteria 8945
9 JGI25159J45721_1017590 3300002987 Bacteria 1471
10 JGI25151J46595_10000007 3300003187 Bacteria 411751
11 JGI25151J46595_10000525 3300003187 Bacteria 35775
12 JGI25151J46595_10001176 3300003187 Bacteria 18833
13 JGI25151J46595_10003084 3300003187 Bacteria 9396
14 JGI25165J46597_1000075 3300003214 Bacteria 181212
15 JGI25153J46596_10000604 3300003215 Bacteria 21962
16 JGI25153J46596_10001294 3300003215 Bacteria 14977
17 JGI25153J46596_10006139 3300003215 Bacteria 6159
18 JGI25153J46596_10008110 3300003215 Bacteria 5064
19 rootH2_10003773 3300003320 Bacteria 14955
20 rootL2_10003291 3300003322 Bacteria 28178
21 rootH1_10031216 3300003323 Bacteria 8906
22 rootH1_10066597 3300003323 Bacteria 5366
23 JGI25160J50197_1005886 3300003354 Bacteria 5041
24 JGI25160J50197_1017236 3300003354 Bacteria 2296
25 JGI25161J50226_1000450 3300003374 Bacteria 19075
26 JGI25161J50226_1000813 3300003374 Bacteria 11738
27 Ga0055539_1000151 3300003752 Bacteria 68013
28 Ga0055533_1000154 3300003756 Bacteria 68013
29 Ga0055532_1000165 3300003758 Bacteria 57621
30 Ga0055525_1000204 3300003759 Bacteria 68013
31 Ga0055535_1008953 3300003761 Bacteria 1760
32 Ga0055526_1004776 3300003771 Bacteria 8026
33 Ga0055526_1004873 3300003771 Bacteria 7910
34 Ga0055524_1002154 3300003775 Bacteria 10359
35 Ga0055524_1005381 3300003775 Bacteria 5723
36 Ga0055524_1012830 3300003775 Bacteria 3195
37 Ga0055528_1000501 3300003790 Bacteria 30837
38 Ga0055528_1001700 3300003790 Bacteria 12825
39 Ga0055528_1005030 3300003790 Bacteria 6244
40 Ga0055530_10000229 3300003791 Bacteria 50063
41 Ga0055540_1000240 3300003792 Bacteria 50063
42 Ga0055540_1000487 3300003792 Bacteria 30399
43 Ga0055540_1015377 3300003792 Bacteria 2231
44 Ga0055531_10036425 3300003794 Bacteria 1518
45 Ga0055541_1000101 3300003841 Bacteria 68013
46 Ga0055543_1000045 3300004625 Bacteria 115098
47 Ga0055543_1000739 3300004625 Bacteria 16547
48 Ga0065165_1002947 3300005262 Bacteria 12963
49 Ga0065165_1005055 3300005262 Bacteria 7684
50 Ga0065714_10003857 3300005288 Bacteria 9063
51 Ga0065704_10000520 3300005289 Bacteria 26272
52 Ga0065704_10004936 3300005289 Bacteria 3721
53 Ga0065704_10015702 3300005289 Bacteria 2102
54 Ga0065712_10001701 3300005290 Bacteria 5943
55 Ga0070670_100000162 3300005331 Bacteria 60681
56 Ga0070670_100004443 3300005331 Bacteria 11745
57 Ga0070670_100008174 3300005331 Bacteria 8910
58 Ga0070682_100389043 3300005337 Bacteria 1051
59 Ga0070661_100000132 3300005344 Bacteria 62286
60 Ga0070668_100210793 3300005347 Bacteria 1598
61 Ga0070669_100019731 3300005353 Bacteria 4816
62 Ga0070669_100229201 3300005353 Bacteria 1472
63 Ga0070674_100201654 3300005356 Bacteria 1537
64 Ga0070662_100001797 3300005457 Bacteria 13177
65 Ga0070706_100031215 3300005467 Bacteria 4914
66 Ga0070707_100186096 3300005468 Bacteria 2025
67 Ga0068853_100071926 3300005539 Bacteria 3013
68 Ga0068853_100109016 3300005539 Bacteria 2457
69 Ga0070696_100036258 3300005546 Bacteria 3400
70 Ga0070696_100053595 3300005546 Bacteria 2808
71 Ga0070696_100137841 3300005546 Bacteria 1780
72 Ga0070665_100095006 3300005548 Bacteria 2986
73 Ga0070664_100009020 3300005564 Bacteria 8091
74 Ga0070664_100335867 3300005564 Bacteria 1372
75 Ga0068854_100009040 3300005578 Bacteria 6420
76 Ga0068854_100066566 3300005578 Bacteria 2622
77 Ga0068856_100134285 3300005614 Bacteria 2480
78 Ga0068861_100083876 3300005719 Bacteria 2500
79 Ga0068851_10000084 3300005834 Bacteria 52007
80 Ga0081455_10279752 3300005937 Bacteria 1206
81 Ga0081538_10005439 3300005981 Bacteria 11437
82 Ga0075365_10001089 3300006038 Bacteria 11800
83 Ga0075365_10045794 3300006038 Bacteria 2871
84 Ga0075365_10295899 3300006038 Bacteria 1139
85 Ga0075363_100005396 3300006048 Bacteria 5682
86 Ga0075364_10020258 3300006051 Bacteria 4183
87 Ga0075367_10024535 3300006178 Bacteria 3402
88 Ga0075369_10003675 3300006186 Bacteria 5604
89 Ga0075369_10091069 3300006186 Bacteria 1361
90 Ga0075366_10000314 3300006195 Bacteria 21983
91 Ga0075366_10265207 3300006195 Bacteria 1049
92 Ga0075370_10015973 3300006353 Bacteria 4031
93 Ga0075431_100020334 3300006847 Bacteria 6782
94 Ga0075434_100006245 3300006871 Bacteria 10916
95 Ga0075434_100346899 3300006871 Bacteria 1506
96 Ga0075436_100208470 3300006914 Bacteria 1385
97 Ga0075435_100122555 3300007076 Bacteria 2170
98 Ga0105251_10000973 3300009011 Bacteria 25439
99 Ga0105251_10004202 3300009011 Bacteria 9962
100 Ga0105251_10007395 3300009011 Bacteria 6773
101 Ga0105244_10002541 3300009036 Bacteria 13709
102 Ga0105244_10005299 3300009036 Bacteria 8586
103 Ga0105244_10039061 3300009036 Bacteria 2472
104 Ga0105250_10000565 3300009092 Bacteria 24705
105 Ga0105250_10033184 3300009092 Bacteria 2072
106 Ga0105240_10000097 3300009093 Bacteria 179135
107 Ga0111539_10000857 3300009094 Bacteria 39667
108 Ga0111539_10605933 3300009094 Bacteria 1275
109 Ga0114129_10037407 3300009147 Bacteria 6852
110 Ga0114129_10280815 3300009147 Bacteria 2225
111 Ga0114129_10886160 3300009147 Bacteria 1132
112 Ga0105243_10024955 3300009148 Bacteria 4564
113 Ga0105243_10113683 3300009148 Bacteria 2270
114 Ga0105242_10000440 3300009176 Bacteria 33103
115 Ga0105237_10005732 3300009545 Bacteria 13950
116 Ga0105237_10006053 3300009545 Bacteria 13528
117 Ga0105238_10015173 3300009551 Bacteria 7800
118 Ga0123341_1000003 3300009765 Bacteria 172237
119 Ga0123342_1008736 3300009766 Bacteria 12555
120 Ga0123342_1039304 3300009766 Bacteria 1804
121 Ga0105239_10006934 3300010375 Bacteria 13069
122 Ga0105246_10000194 3300011119 Bacteria 30373
123 Ga0105246_10003325 3300011119 Bacteria 9733
124 Ga0157373_10020543 3300013100 Bacteria 4799
125 Ga0157371_10000948 3300013102 Bacteria 32403
126 Ga0157370_10073945 3300013104 Bacteria 3215
127 Ga0157370_10142609 3300013104 Bacteria 2232
128 Ga0157369_10017826 3300013105 Bacteria 7970
129 Ga0157369_10091512 3300013105 Bacteria 3247
130 Ga0157375_10025179 3300013308 Bacteria 5522
131 Ga0157375_10385648 3300013308 Bacteria 1568
132 Ga0182008_10007784 3300014497 Bacteria 5893
133 Ga0182008_10125801 3300014497 Bacteria 1276
134 Ga0182006_1001262 3300015261 Bacteria 15629
135 Ga0182007_10001007 3300015262 Bacteria 15441
136 Ga0182007_10006537 3300015262 Bacteria 4998
137 Ga0182005_1013218 3300015265 Bacteria 2322
138 Ga0163161_10165629 3300017792 Bacteria 1687
139 Ga0163161_10244627 3300017792 Bacteria 1396
140 Ga0209436_100004 3300025208 Bacteria 196698
141 Ga0209784_100138 3300025224 Bacteria 68249
142 Ga0209566_100179 3300025225 Bacteria 68249
143 Ga0209674_100186 3300025226 Bacteria 68249
144 Ga0209147_100195 3300025229 Bacteria 68796
145 Ga0209563_100148 3300025230 Bacteria 68249
146 Ga0209437_100131 3300025233 Bacteria 181264
147 Ga0209258_100339 3300025242 Bacteria 69328
148 Ga0207425_1000018 3300025245 Bacteria 411841
149 Ga0207425_1001189 3300025245 Bacteria 11601
150 Ga0207425_1009736 3300025245 Bacteria 2376
151 Ga0209646_1000516 3300025246 Bacteria 17290
152 Ga0209677_100137 3300025253 Bacteria 68249
153 Ga0209677_102216 3300025253 Bacteria 7544
154 Ga0209759_1007623 3300025256 Bacteria 3462
155 Ga0209129_1000026 3300025258 Bacteria 411839
156 Ga0209129_1001031 3300025258 Bacteria 16562
157 Ga0209233_1000132 3300025261 Bacteria 203971
158 Ga0209233_1000162 3300025261 Bacteria 156508
159 Ga0209455_1010914 3300025272 Bacteria 2273
160 Ga0209673_1000182 3300025273 Bacteria 127522
161 Ga0209673_1002211 3300025273 Bacteria 14191
162 Ga0209673_1003064 3300025273 Bacteria 10290
163 Ga0209673_1007133 3300025273 Bacteria 5229
164 Ga0209130_1000001 3300025284 Bacteria 831557
165 Ga0209130_1000300 3300025284 Bacteria 60286
166 Ga0209130_1014902 3300025284 Bacteria 1935
167 Ga0209675_1013505 3300025291 Bacteria 2547
168 Ga0209676_1002489 3300025292 Bacteria 12923
169 Ga0209676_1044808 3300025292 Bacteria 1209
170 Ga0209025_1000035 3300025294 Bacteria 411841
171 Ga0209025_1000082 3300025294 Bacteria 265613
172 Ga0209025_1000084 3300025294 Bacteria 263812
173 Ga0209025_1003836 3300025294 Bacteria 13686
174 Ga0209025_1016317 3300025294 Bacteria 4397
175 Ga0209564_1001848 3300025295 Bacteria 19273
176 Ga0209758_1000040 3300025297 Bacteria 411841
177 Ga0209758_1000543 3300025297 Bacteria 59880
178 Ga0209758_1001081 3300025297 Bacteria 35442
179 Ga0209758_1001082 3300025297 Bacteria 35430
180 Ga0209758_1005768 3300025297 Bacteria 9295
181 Ga0209758_1006633 3300025297 Bacteria 8194
182 Ga0209758_1016173 3300025297 Bacteria 3804
183 Ga0209758_1048406 3300025297 Bacteria 1512
184 Ga0209050_1000287 3300025298 Bacteria 106507
185 Ga0209256_1001307 3300025299 Bacteria 26756
186 Ga0209256_1002707 3300025299 Bacteria 13821
187 Ga0209256_1009033 3300025299 Bacteria 4461
188 Ga0209256_1010314 3300025299 Bacteria 3935
189 Ga0207426_1000005 3300025302 Bacteria 1037188
190 Ga0207426_1000035 3300025302 Bacteria 448327
191 Ga0207426_1000311 3300025302 Bacteria 95578
192 Ga0209051_1000070 3300025303 Bacteria 215616
193 Ga0209051_1000199 3300025303 Bacteria 106517
194 Ga0209051_1001994 3300025303 Bacteria 15623
195 Ga0209051_1009545 3300025303 Bacteria 4991
196 Ga0209257_1003511 3300025304 Bacteria 13342
197 Ga0209257_1006081 3300025304 Bacteria 8020
198 Ga0209257_1023979 3300025304 Bacteria 2126
199 Ga0207656_10000034 3300025321 Bacteria 66750
200 Ga0207696_1000063 3300025711 Bacteria 239123
201 Ga0207655_1000006 3300025728 Bacteria 861092
202 Ga0207655_1001435 3300025728 Bacteria 22098
203 Ga0207655_1003383 3300025728 Bacteria 11914
204 Ga0207713_1000872 3300025735 Bacteria 27580
205 Ga0207713_1002294 3300025735 Bacteria 14082
206 Ga0207713_1019275 3300025735 Bacteria 3344
207 Ga0207707_10117418 3300025912 Bacteria 2326
208 Ga0207695_10000187 3300025913 Bacteria 179183
209 Ga0207671_10000079 3300025914 Bacteria 149692
210 Ga0207671_10000784 3300025914 Bacteria 40283
211 Ga0207649_10000002 3300025920 Bacteria 498633
212 Ga0207646_10179258 3300025922 Bacteria 1913
213 Ga0207681_10002018 3300025923 Bacteria 13042
214 Ga0207681_10006063 3300025923 Bacteria 7414
215 Ga0207681_10068387 3300025923 Bacteria 2467
216 Ga0207694_10191747 3300025924 Bacteria 1660
217 Ga0207650_10000154 3300025925 Bacteria 82912
218 Ga0207650_10000684 3300025925 Bacteria 26647
219 Ga0207650_10007516 3300025925 Bacteria 7432
220 Ga0207706_10001646 3300025933 Bacteria 22112
221 Ga0207686_10009678 3300025934 Bacteria 5236
222 Ga0207709_10067715 3300025935 Bacteria 2254
223 Ga0207709_10122294 3300025935 Bacteria 1759
224 Ga0207704_10176369 3300025938 Bacteria 1539
225 Ga0207679_10000006 3300025945 Bacteria 498868
226 Ga0207679_10202605 3300025945 Bacteria 1659
227 Ga0207640_10034496 3300025981 Bacteria 3158
228 Ga0207640_10043175 3300025981 Bacteria 2880
229 Ga0207640_10430796 3300025981 Bacteria 1082
230 Ga0207658_10115183 3300025986 Bacteria 2133
231 Ga0207639_10041124 3300026041 Bacteria 3456
232 Ga0207639_10088029 3300026041 Bacteria 2477
233 Ga0207639_10490792 3300026041 Bacteria 1121
234 Ga0207678_10214030 3300026067 Bacteria 1649
235 Ga0207702_10373845 3300026078 Bacteria 1369
236 Ga0207702_10410343 3300026078 Bacteria 1308
237 Ga0207675_100003793 3300026118 Bacteria 14722
238 Ga0209281_1000141 3300027111 Bacteria 175634
239 Ga0209371_1006037 3300027312 Bacteria 4617
240 Ga0207428_10000053 3300027907 Bacteria 175238
241 Ga0268265_10053530 3300028380 Bacteria 3058
242 Ga0307515_10000029 3300028794 Bacteria 365410
243 Ga0307515_10003876 3300028794 Bacteria 31241
244 Ga0307515_10011732 3300028794 Bacteria 16582
245 Ga0268256_1006018 3300030500 Bacteria 4617
246 Ga0316181_1107564 3300030744 Bacteria 5999
247 Ga0307513_10000259 3300031456 Bacteria 76155
248 Ga0307513_10098659 3300031456 Bacteria 2952
249 Ga0307513_10190115 3300031456 Bacteria 1905
250 Ga0307408_100020630 3300031548 Bacteria 4451
251 Ga0307516_10314623 3300031730 Bacteria 1238
252 Ga0307405_10000428 3300031731 Bacteria 15741
253 Ga0307413_10024282 3300031824 Bacteria 3302
254 Ga0307410_10166628 3300031852 Bacteria 1656
255 Ga0307407_10085576 3300031903 Bacteria 1918
256 Ga0307412_10001421 3300031911 Bacteria 13339
257 Ga0307409_100036664 3300031995 Bacteria 3607
258 Ga0307416_100105827 3300032002 Bacteria 2464
259 Ga0307416_100353257 3300032002 Bacteria 1489
260 Ga0307416_100493515 3300032002 Bacteria 1287
261 Ga0307411_10055812 3300032005 Bacteria 2600
262 Ga0307415_100010381 3300032126 Bacteria 5273
263 Ga0316584_0366820 3300036712 Bacteria 1031
264 Ga0395898_0067790 3300037466 Bacteria 3454
265 Ga0395905_0034039 3300037471 Bacteria 4784
266 Ga0395901_0005143 3300038443 Bacteria 13206
267 Ga0400483_140709 3300039062 Bacteria 14444
268 Ga0400483_274668 3300039062 Bacteria 6397
269 Ga0439436_0003510 3300041404 Bacteria 4767
270 Ga0439438_000804 3300041405 Bacteria 14024
271 Ga0439447_006388 3300041407 Bacteria 3833
272 Ga0439466_0001830 3300041411 Bacteria 8338
273 Ga0439465_0004127 3300041413 Bacteria 4727
274 Ga0439465_0009269 3300041413 Bacteria 3102
275 Ga0439465_0054017 3300041413 Bacteria 1321
276 Ga0451798_0208875 3300041458 Bacteria 1301
277 Ga0451833_1093313 3300041491 Bacteria 2988
278 Ga0451837_0109501 3300041494 Bacteria 3578
279 Ga0451839_1218978 3300041496 Bacteria 3446
280 Ga0451841_0040778 3300041498 Bacteria 1653
281 Ga0451845_0462619 3300041501 Bacteria 1076
282 Ga0451849_0485518 3300041505 Bacteria 1356
283 Ga0451851_0421752 3300041507 Bacteria 1541
284 Ga0451855_0219103 3300041511 Bacteria 1235
285 Ga0451853_0251760 3300041512 Bacteria 1948
286 Ga0439431_0005475 3300041997 Bacteria 2804
287 Ga0439432_001792 3300042006 Bacteria 8046
288 Ga0439432_001919 3300042006 Bacteria 7853
289 Ga0439451_000063 3300042009 Bacteria 19874
290 Ga0439452_010488 3300042010 Bacteria 2692
291 Ga0439456_000020 3300042013 Bacteria 60976
292 Ga0450911_000287 3300042115 Bacteria 18551
293 Ga0450919_000393 3300042121 Bacteria 5307
294 Ga0450920_024532 3300042122 Bacteria 1172
295 Ga0450903_000746 3300042138 Bacteria 6404
296 Ga0450906_001439 3300042145 Bacteria 5182
297 Ga0450907_016462 3300042146 Bacteria 1234
298 Ga0450909_000079 3300042185 Bacteria 8864
299 Ga0466963_0013723 3300044694 Bacteria 4983
300 Ga0466960_0001264 3300044901 Bacteria 9161
301 Ga0451576_0162146 3300045051 Bacteria 2334
302 Ga0451576_0169878 3300045051 Bacteria 2276
303 Ga0466958_0037647 3300045836 Bacteria 2899
304 Ga0466967_0319267 3300045976 Bacteria 1497
305 Ga0495617_000126 3300046452 Bacteria 50425
306 Ga0495592_0096392 3300046454 Bacteria 2114
307 Ga0495590_0000259 3300046457 Bacteria 28903
308 Ga0495638_0000120 3300046460 Bacteria 127382
309 Ga0495638_0004264 3300046460 Bacteria 10875
310 Ga0495638_0011436 3300046460 Bacteria 6115
311 Ga0495650_0001726 3300046471 Bacteria 20009
312 Ga0495580_0056217 3300046472 Bacteria 2772
313 Ga0495605_0002084 3300046474 Bacteria 12577
314 Ga0495605_0003178 3300046474 Bacteria 9873
315 Ga0495605_0016357 3300046474 Bacteria 4015
316 Ga0495662_0007062 3300046476 Bacteria 5577
317 Ga0495584_0000541 3300046491 Bacteria 25637
318 Ga0495585_0093002 3300046492 Bacteria 1622
319 Ga0495607_0000344 3300046501 Bacteria 48079
320 Ga0495607_0000634 3300046501 Bacteria 34119
321 Ga0495607_0002322 3300046501 Bacteria 15588
322 Ga0495607_0010393 3300046501 Bacteria 6259
323 Ga0495607_0054966 3300046501 Bacteria 2292
324 Ga0495583_0001840 3300046506 Bacteria 19799
325 Ga0495583_0018173 3300046506 Bacteria 3709
326 Ga0495583_0020427 3300046506 Bacteria 3432
327 Ga0495583_0044699 3300046506 Bacteria 2053
328 Ga0495606_0037706 3300046507 Bacteria 3279
329 Ga0495606_0133806 3300046507 Bacteria 1471
330 Ga0495610_0027856 3300046512 Bacteria 2996
331 Ga0495610_0052968 3300046512 Bacteria 1968
332 Ga0495610_0077361 3300046512 Bacteria 1536
333 Ga0495616_0001672 3300046513 Bacteria 15148
334 Ga0495620_0011472 3300046515 Bacteria 4622
335 Ga0495620_0023682 3300046515 Bacteria 2931
336 Ga0495631_0010208 3300046518 Bacteria 4657
337 Ga0495632_0000698 3300046519 Bacteria 30511
338 Ga0495632_0003194 3300046519 Bacteria 11804
339 Ga0495632_0005281 3300046519 Bacteria 8579
340 Ga0495632_0008220 3300046519 Bacteria 6438
341 Ga0495637_0011398 3300046520 Bacteria 4272
342 Ga0495643_0004466 3300046522 Bacteria 9770
343 Ga0495643_0009358 3300046522 Bacteria 6093
344 Ga0495643_0023480 3300046522 Bacteria 3506
345 Ga0495648_0030724 3300046524 Bacteria 3547
346 Ga0495642_0000247 3300046528 Bacteria 30419
347 Ga0495654_0001276 3300046530 Bacteria 17680
348 Ga0495654_0006494 3300046530 Bacteria 6639
349 Ga0495654_0063147 3300046530 Bacteria 1774
350 Ga0495609_0002286 3300046538 Bacteria 11931
351 Ga0495609_0092087 3300046538 Bacteria 1318
352 Ga0495597_0042162 3300046542 Bacteria 2036
353 Ga0495622_0068275 3300046557 Bacteria 1642
354 Ga0495633_0034232 3300046558 Bacteria 2444
355 Ga0495633_0052187 3300046558 Bacteria 1927
356 Ga0495668_0006710 3300046616 Bacteria 7497
357 Ga0495668_0042162 3300046616 Bacteria 2541
358 Ga0495611_0003176 3300046648 Bacteria 7277
359 Ga0495625_0031212 3300046660 Bacteria 3965
360 Ga0495625_0036037 3300046660 Bacteria 3640
361 Ga0495625_0045964 3300046660 Bacteria 3153
362 Ga0495659_0035533 3300046664 Bacteria 1757
363 Ga0495661_0000926 3300046665 Bacteria 26760
364 Ga0495661_0002886 3300046665 Bacteria 13006
365 Ga0495670_0000057 3300046691 Bacteria 54709
366 Ga0495649_0000153 3300046694 Bacteria 60597
367 Ga0495649_0080699 3300046694 Bacteria 1740
368 Ga0495589_0000057 3300046794 Bacteria 108136
369 Ga0495589_0152434 3300046794 Bacteria 1103
370 Ga0495660_0003453 3300046810 Bacteria 9762
371 Ga0495660_0118521 3300046810 Bacteria 1342
372 Ga0495636_0001971 3300047318 Bacteria 7865
373 Ga0495672_0001002 3300047320 Bacteria 29119
374 Ga0495672_0075473 3300047320 Bacteria 1896
375 Ga0495687_000432 3300047443 Bacteria 51756
376 Ga0495685_002554 3300047447 Bacteria 5720
377 Ga0495673_0010554 3300047469 Bacteria 5013
378 Ga0495681_0029559 3300047470 Bacteria 2803
379 Ga0495681_0054962 3300047470 Bacteria 1859
380 Ga0495686_0009124 3300047472 Bacteria 7187
381 Ga0495626_0000626 3300048091 Bacteria 34453
382 Ga0496101_0010159 3300048904 Bacteria 6210
383 Ga0496105_0153805 3300048908 Bacteria 1890
384 Ga0496106_0000806 3300048909 Bacteria 22724
385 Ga0496106_0043911 3300048909 Bacteria 3355
386 Ga0496109_0462649 3300048912 Bacteria 1198
387 Ga0496111_0087925 3300048914 Bacteria 2275
388 Ga0496111_0137484 3300048914 Bacteria 1810
389 Ga0496113_0139080 3300048916 Bacteria 1910
390 Ga0496116_0000049 3300048919 Bacteria 314452
391 Ga0496116_0006317 3300048919 Bacteria 10781
392 Ga0496117_0001805 3300048920 Bacteria 29093
393 Ga0496117_0026899 3300048920 Bacteria 4492
394 Ga0496117_0088813 3300048920 Bacteria 1998
395 Ga0496118_0222858 3300048921 Bacteria 1096
396 Ga0496119_0000147 3300048922 Bacteria 98899
397 Ga0496119_0071624 3300048922 Bacteria 2028
398 Ga0496120_0031039 3300048923 Bacteria 3241
399 Ga0496121_0097525 3300048924 Bacteria 2277
400 Ga0496122_0000137 3300048925 Bacteria 170016
401 Ga0496122_0002390 3300048925 Bacteria 26829
402 Ga0496122_0015666 3300048925 Bacteria 7231
403 Ga0496122_0022317 3300048925 Bacteria 5631
404 Ga0496122_0034805 3300048925 Bacteria 4112
405 Ga0496122_0044250 3300048925 Bacteria 3477
406 Ga0496123_0000022 3300048926 Bacteria 361832
407 Ga0496123_0002146 3300048926 Bacteria 25206
408 Ga0496123_0008160 3300048926 Bacteria 9659
409 Ga0496123_0012560 3300048926 Bacteria 7209
410 Ga0496123_0014576 3300048926 Bacteria 6505
411 Ga0496123_0043877 3300048926 Bacteria 3064
412 Ga0496124_0001807 3300048927 Bacteria 29648
413 Ga0496124_0003713 3300048927 Bacteria 18423
414 Ga0496124_0022940 3300048927 Bacteria 5710
415 Ga0496124_0028250 3300048927 Bacteria 5021
416 Ga0496124_0037204 3300048927 Bacteria 4235
417 Ga0496124_0045105 3300048927 Bacteria 3780
418 Ga0496124_0060309 3300048927 Bacteria 3182
419 Ga0496125_0000143 3300048928 Bacteria 156688
420 Ga0496125_0000264 3300048928 Bacteria 108134
421 Ga0496125_0000774 3300048928 Bacteria 52227
422 Ga0496125_0001930 3300048928 Bacteria 28338
423 Ga0496125_0002881 3300048928 Bacteria 21656
424 Ga0496125_0003847 3300048928 Bacteria 17804
425 Ga0496125_0030421 3300048928 Bacteria 4831
426 Ga0496126_0000081 3300048929 Bacteria 218818
427 Ga0495678_000585 3300049459 Bacteria 34385
428 Ga0501033_0134972 3300049570 Unclassified 1786
429 Ga0501038_0354409 3300049574 Bacteria 1142
430 Ga0501040_0061713 3300049576 Bacteria 2578
431 Ga0501041_0017938 3300049577 Bacteria 4213
432 Ga0501041_0090665 3300049577 Bacteria 1887
433 Ga0501042_0043739 3300049578 Bacteria 3189
434 Ga0501048_0092922 3300049582 Unclassified 2128
435 Ga0501068_0069138 3300049584 Unclassified 2153
436 Ga0501070_0278098 3300049586 Bacteria 1366
437 Ga0501072_0059587 3300049588 Bacteria 3010
438 Ga0501074_0192238 3300049590 Bacteria 1455
439 Ga0501075_0011676 3300049591 Bacteria 6223
440 Ga0501076_0068859 3300049592 Bacteria 2827
441 Ga0501079_0003288 3300049741 Bacteria 11844
442 Ga0501080_0032207 3300049742 Bacteria 4888
443 Ga0501080_0117457 3300049742 Bacteria 2466
444 Ga0501081_0004940 3300049743 Bacteria 8573
445 Ga0501081_0106405 3300049743 Bacteria 1988
446 Ga0501083_0103059 3300049744 Bacteria 1881
447 Ga0501045_0031311 3300049824 Bacteria 3853
448 nmdc:mga03683_4451_c1 3300050489 Bacteria 4651
449 nmdc:mga03n38_5211_c1 3300050490 Bacteria 4402
450 nmdc:mga00v17_189067_c1 3300050491 Bacteria 1329
451 nmdc:mga0yw44_18736_c1 3300050492 Bacteria 3799
452 nmdc:mga0yw44_26771_c1 3300050492 Bacteria 3298
453 nmdc:mga0k408_9994_c1 3300050493 Bacteria 5123
454 nmdc:mga06z11_8982_c1 3300050494 Bacteria 4195
455 nmdc:mga07m45_24765_c1 3300050496 Bacteria 3289
456 nmdc:mga07m45_8115_c1 3300050496 Bacteria 5382
457 nmdc:mga07m45_84774_c1 3300050496 Bacteria 1811
458 nmdc:mga05p37_207334_c1 3300050507 Bacteria 2370
459 nmdc:mga05p37_61681_c1 3300050507 Bacteria 4615
460 nmdc:mga06r32_33183_c1 3300050510 Unclassified 4861
461 nmdc:mga08y16_292253_c1 3300050511 Bacteria 1680
462 nmdc:mga08y16_395_c1 3300050511 Bacteria 39889
463 nmdc:mga0n895_54383_c1 3300050512 Bacteria 3938
464 nmdc:mga0a205_43424_c3 3300050515 Bacteria 1289
465 nmdc:mga0sz30_4360_c1 3300050516 Bacteria 5109
466 Ga0500610_0043546 3300053079 Bacteria 2326
467 Ga0500578_0056889 3300053086 Bacteria 2500
468 Ga0500556_0000065 3300053104 Bacteria 106261
469 Ga0500556_0004759 3300053104 Bacteria 3851
470 Ga0500594_0011673 3300053118 Bacteria 2054
471 Ga0500618_003428 3300053125 Bacteria 5433
472 Ga0500618_003947 3300053125 Bacteria 4913
473 Ga0500658_0000607 3300053134 Bacteria 14856
474 Ga0500559_0004585 3300053136 Bacteria 6534
475 Ga0500568_0000004 3300053139 Bacteria 621666
476 Ga0500568_0000070 3300053139 Bacteria 99663
477 Ga0500568_0000101 3300053139 Bacteria 78689
478 Ga0500568_0028278 3300053139 Bacteria 2338
479 Ga0500616_0000473 3300053153 Bacteria 52175
480 Ga0500616_0013319 3300053153 Bacteria 4781
481 Ga0500616_0039954 3300053153 Bacteria 2526
482 Ga0500616_0099542 3300053153 Bacteria 1424
483 Ga0500645_002411 3300053730 Bacteria 8375
484 Ga0501084_0016794 3300054114 Bacteria 6082
485 Ga0501082_0009434 3300060353 Bacteria 8400
486 Ga0501082_0081142 3300060353 Bacteria 2799
487 Ga0466962_0020934 3300061719 Bacteria 3143
488 Ga0530510_0144507 3300061734 Bacteria 1754
489 2509139599 2508501127 Bacteria 7037543
490 2509386179 2509276021 Bacteria 7634384
491 2509441732 2509276033 Bacteria 7180565
492 2510137582 2510065019 Bacteria 6903379
493 2510303665 2510065057 Bacteria 6649661
494 2510843094 2510461069 Bacteria 5505000
495 2510893527 2510461076 Bacteria 8618824
496 2511135479 2510917022 Bacteria 6504556
497 2511186770 2510917028 Bacteria 6185411
498 2511199752 2510917030 Bacteria 7460662
499 2511364842 2511231022 Bacteria 6719296
500 2511502960 2511231052 Bacteria 6974333
501 2511822776 2511231156 Bacteria 6845832
502 2512534223 2512047086 Bacteria 6850303
503 2513571901 2513237084 Bacteria 7231967
504 2513576056 2513237085 Bacteria 7695351
505 2513585287 2513237086 Bacteria 7265287
506 2513617131 2513237091 Bacteria 6900273
507 2513635862 2513237093 Bacteria 7545552
508 2513712698 2513237103 Bacteria 7647401
509 2513882872 2513237140 Bacteria 7076289
510 2513902900 2513237143 Bacteria 6664116
511 2513908056 2513237144 Bacteria 7530820
512 2513927836 2513237146 Bacteria 7166346
513 2513999736 2513237159 Bacteria 6810126
514 2514019022 2513237162 Bacteria 7468464
515 2514423237 2513237305 Bacteria 7293571
516 2515109420 2515075009 Bacteria 7288508
517 2515610367 2515154107 Bacteria 6795637
518 2515633463 2515154113 Bacteria 7807172
519 2515641662 2515154114 Bacteria 7848616
520 2515660499 2515154116 Bacteria 7552979
521 2515742521 2515154134 Bacteria 7220242
522 2516894365 2516653046 Bacteria 6989037
523 2517042289 2516653077 Bacteria 7555578
524 2517081515 2516653085 Bacteria 7346596
525 2517099527 2517093000 Bacteria 7412387
526 2517411726 2517287029 Bacteria 6905599
527 2523467506 2523231067 Bacteria 5230452
528 2530650082 2529292951 Bacteria 6916614
529 2551679833 2551306084 Bacteria 8942552
530 2551685976 2551306085 Bacteria 7347181
531 2551694553 2551306086 Bacteria 6843938
532 2551698071 2551306087 Bacteria 7351905
533 2551710437 2551306089 Bacteria 7162724
534 2551711855 2551306089 Bacteria 7162724
535 2551715711 2551306090 Bacteria 7953713
536 2551726323 2551306091 Bacteria 7086830
537 2551733209 2551306092 Bacteria 6992595
538 2551740293 2551306093 Bacteria 7064773
539 2551746383 2551306093 Bacteria 7064773
540 2585221484 2582581298 Bacteria 7315509
541 2585230825 2582581299 Bacteria 6518058
542 2585269238 2582581306 Bacteria 6450535
543 2585276467 2582581307 Bacteria 6597605
544 2585277846 2582581308 Bacteria 7413247
545 2585328663 2582581315 Bacteria 7318924
546 2585336249 2582581316 Bacteria 7774528
547 2585390766 2582581865 Bacteria 6644329
548 2585395120 2582581866 Bacteria 6859583
549 2585401871 2582581867 Bacteria 7184437
550 2585528591 2585427526 Bacteria 7258840
551 2585533288 2585427527 Bacteria 7273426
552 2585539410 2585427528 Bacteria 6842387
553 2585544346 2585427529 Bacteria 7395659
554 2585555712 2585427530 Bacteria 7383882
555 2585562930 2585427531 Bacteria 6992870
556 2585820285 2585427590 Bacteria 6824633
557 2585837364 2585427593 Bacteria 7141551
558 2585901698 2585427608 Bacteria 6544331
559 2585908575 2585427609 Bacteria 6667127
560 2587983995 2585428125 Bacteria 6662905
561 2597862914 2597489888 Bacteria 6179543
562 2597868715 2597489889 Bacteria 6297495
563 2599396486 2599185167 Bacteria 6353609
564 2599416731 2599185170 Bacteria 7295545
565 2599453457 2599185179 Bacteria 6611171
566 2599507515 2599185189 Bacteria 5862825
567 2599514738 2599185190 Bacteria 6285678
568 2599517279 2599185191 Bacteria 6297582
569 2599613680 2599185212 Bacteria 6765997
570 2599719691 2599185236 Bacteria 6875203
571 2599772112 2599185248 Bacteria 6696816
572 2599883048 2599185288 Bacteria 6666191
573 2599888135 2599185289 Bacteria 6778765
574 2599893997 2599185290 Bacteria 6289611
575 2599900152 2599185291 Bacteria 6775623
576 2599951725 2599185303 Bacteria 6512725
577 2599962404 2599185305 Bacteria 6748700
578 2599965034 2599185306 Bacteria 6637356
579 2599976242 2599185308 Bacteria 6621546
580 2600006716 2599185313 Bacteria 6658188
581 2600010378 2599185314 Bacteria 6621749
582 2600018537 2599185315 Bacteria 6771107
583 2600023834 2599185316 Bacteria 6320029
584 2600031962 2599185317 Bacteria 6435722
585 2600037177 2599185318 Bacteria 6961590
586 2600044072 2599185319 Bacteria 6637840
587 2600053056 2599185321 Bacteria 6764560
588 2600060622 2599185322 Bacteria 6763055
589 2600067651 2599185323 Bacteria 6688755
590 2600071374 2599185324 Bacteria 6590677
591 2600077884 2599185325 Bacteria 6324919
592 2600359891 2600254930 Bacteria 6431253
593 2601691436 2600255296 Bacteria 5784754
594 2616294483 2615840624 Bacteria 6557588
595 2616309232 2615840626 Bacteria 7921970
596 2616552274 2615840698 Bacteria 7319877
597 2621301013 2619619299 Bacteria 6649820
598 2643854672 2643221568 Bacteria 5187270
599 2643870932 2643221571 Bacteria 6228673
600 2644284048 2643221650 Bacteria 7029547
601 2644494084 2643221688 Bacteria 5260751
602 2644625188 2643221713 Bacteria 6554480
603 2671092463 2667528170 Bacteria 6786960
604 2671115542 2667528174 Bacteria 6435400
605 2671128176 2667528176 Bacteria 6724917
606 2677896755 2675903420 Bacteria 6247433
607 2678261280 2675903515 Bacteria 6580491
608 2719389004 2718217927 Bacteria 6972593
609 2719668507 2718217997 Bacteria 6740740
610 2720489200 2718218199 Bacteria 6740745
611 2720609890 2718218232 Bacteria 6720332
612 2720617315 2718218233 Bacteria 6662049
613 2720628457 2718218235 Bacteria 6630699
614 2720772410 2718218269 Bacteria 6906114
615 2721402680 2718218423 Bacteria 6438183
616 2723029839 2721755556 Bacteria 6745503
617 2723247734 2721755607 Bacteria 5841722
618 2723564208 2721755684 Bacteria 6859907
619 2723570106 2721755685 Bacteria 6704835
620 2723574955 2721755686 Bacteria 7343952
621 2724034746 2721755809 Bacteria 6438790
622 2724092439 2721755819 Bacteria 6906405
623 2724101653 2721755822 Bacteria 6726041
624 2724112814 2721755823 Bacteria 6752556
625 2725949766 2724679232 Bacteria 7646494
626 2730110372 2728369352 Bacteria 6745171
627 2738670363 2738541265 Bacteria 6594665
628 2738748756 2738541282 Bacteria 6593925
629 2738799750 2738541293 Bacteria 7065685
630 2738809641 2738541294 Bacteria 6925949
631 2738857798 2738541303 Bacteria 6591772
632 2738897001 2738541309 Bacteria 6926455
633 2739033868 2738541333 Bacteria 7106503
634 2739347947 2738543031 Bacteria 5769731
635 2745006597 2744054620 Bacteria 6551379
636 2753360929 2751185800 Bacteria 5467370
637 2766064948 2765235942 Bacteria 7445910
638 2776268618 2775506902 Bacteria 6208009
639 2776285301 2775506904 Bacteria 5954060
640 2791924187 2791354903 Bacteria 4937680
641 2793297748 2791355256 Bacteria 6798008
642 2793312931 2791355259 Bacteria 7254731
643 2793322561 2791355260 Bacteria 6598818
644 2793329333 2791355261 Bacteria 6661293
645 2793336518 2791355262 Bacteria 6774204
646 2793343765 2791355263 Bacteria 6872478
647 2793356278 2791355265 Bacteria 6539969
648 2793359868 2791355266 Bacteria 7116587
649 2793368520 2791355267 Bacteria 7222458
650 2805928521 2802429605 Bacteria 6875453
651 2806045800 2802429633 Bacteria 7341974
652 2806053372 2802429634 Bacteria 7083200
653 2806061086 2802429635 Bacteria 7650140
654 2806066259 2802429636 Bacteria 7597525
655 2806073161 2802429637 Bacteria 7067217
656 2807408417 2806310737 Bacteria 5751088
657 2807456731 2806310745 Bacteria 5742165
658 2808858874 2808606361 Bacteria 6136259
659 2808938964 2808606378 Bacteria 6177535
660 2808967378 2808606383 Bacteria 6138645
661 2808975784 2808606385 Bacteria 6711065
662 2808990578 2808606388 Bacteria 6706662
663 2809002209 2808606389 Bacteria 6138126
664 2817489684 2816332298 Bacteria 6852809
665 2819611808 2818991448 Bacteria 6772224
666 2819641923 2818991453 Bacteria 7181617
667 2819682915 2818991461 Bacteria 7026071
668 2825653983 2825651385 Bacteria 6715909
669 2834029560 2834028612 Bacteria 6354979
670 2837654088 2837651117 Bacteria 3772164
671 2837679069 2837678835 Bacteria 5252418
672 2838016285 2838016132 Bacteria 6577831
673 2838024744 2838022645 Bacteria 6494267
674 2838030408 2838029111 Bacteria 6603031
675 2838036842 2838035591 Bacteria 7166484
676 2838046856 2838042994 Bacteria 6046894
677 2838049601 2838048938 Bacteria 6044578
678 2838065342 2838061910 Bacteria 6794874
679 2838068812 2838068647 Bacteria 6208656
680 2838662122 2838661181 Bacteria 7385261
681 2838668883 2838668709 Bacteria 6671819
682 2838685655 2838680041 Bacteria 6545511
683 2838688009 2838686498 Bacteria 7807632
684 2838700441 2838694306 Bacteria 6853137
685 2838701457 2838701080 Bacteria 6669771
686 2838713696 2838707686 Bacteria 6619912
687 2838732187 2838729681 Bacteria 7400765
688 2838745394 2838742623 Bacteria 7396178
689 2839994517 2839993093 Bacteria 5512535
690 2840768764 2840764183 Bacteria 6358399
691 2841851750 2841851746 Bacteria 7532261
692 2841869602 2841864319 Bacteria 6742987
693 2842082867 2842077413 Bacteria 6508645
694 2842116053 2842110456 Bacteria 7656360
695 2842123985 2842118031 Bacteria 7033875
696 2842146478 2842146304 Bacteria 5957337
697 2842159175 2842156927 Bacteria 6894975
698 2842166070 2842163707 Bacteria 6916235
699 2842182789 2842180545 Bacteria 6888678
700 2842194131 2842192696 Bacteria 6147454
701 2842200151 2842198810 Bacteria 6608673
702 2842222781 2842217011 Bacteria 7497767
703 2842233153 2842229732 Bacteria 7475766
704 2842243099 2842237096 Bacteria 6620661
705 2842247570 2842243621 Bacteria 7421798
706 2842251292 2842250916 Bacteria 6579627
707 2842261341 2842257432 Bacteria 7401195
708 2842265150 2842264693 Bacteria 6472963
709 2842273043 2842271015 Bacteria 7807131
710 2842288132 2842285085 Bacteria 6011953
711 2842297182 2842291075 Bacteria 7076806
712 2842309478 2842304105 Bacteria 7023636
713 2842315791 2842311132 Bacteria 6616990
714 2842319540 2842317721 Bacteria 6793725
715 2842346078 2842341865 Bacteria 7003929
716 2842367901 2842363717 Bacteria 6844742
717 2842376512 2842370503 Bacteria 7038661
718 2842383569 2842377471 Bacteria 7140707
719 2842390742 2842384541 Bacteria 7057858
720 2842399391 2842395702 Bacteria 6780583
721 2842405398 2842402390 Bacteria 6681310
722 2842411845 2842409023 Bacteria 6687331
723 2842418628 2842415677 Bacteria 6596907
724 2842422958 2842422224 Bacteria 6239196
725 2842428797 2842428310 Bacteria 6767288
726 2842435410 2842434925 Bacteria 6502746
727 2842441727 2842441272 Bacteria 6769273
728 2842448229 2842447887 Bacteria 6754142
729 2842463221 2842462802 Bacteria 6588055
730 2842469741 2842469257 Bacteria 6752936
731 2842477312 2842475841 Bacteria 6603183
732 2842490890 2842489311 Bacteria 6620893
733 2842498697 2842495871 Bacteria 6820686
734 2842504109 2842502639 Bacteria 6604161
735 2842525667 2842521101 Bacteria 6569494
736 2842831726 2842826826 Bacteria 5974129
737 2842842219 2842837860 Bacteria 6066181
738 2844461413 2844454524 Bacteria 7952546
739 2844533771 2844533157 Bacteria 7517899
740 2852393130 2852387548 Bacteria 8025568
741 2852614923 2852612431 Bacteria 6885235
742 2852669891 2852667396 Bacteria 6885555
743 2855827000 2855825444 Bacteria 6785811
744 2855842396 2855839649 Bacteria 7135830
745 2856347221 2856342000 Bacteria 7176905
746 2857522589 2857516855 Bacteria 7787325
747 2858803212 2858800743 Bacteria 6603254
748 2860869555 2860867994 Bacteria 5645326
749 2882639223 2882632389 Bacteria 8154593
750 2883294994 2883291878 Bacteria 5894118
751 2883356532 2883354860 Bacteria 5865246
752 2885318729 2885312484 Bacteria 6415165
753 2888348712 2888343758 Bacteria 6611049
754 2908448480 2908446538 Bacteria 6829095
755 2912966732 2912963787 Bacteria 5646108
756 2913037571 2913036834 Bacteria 6704877
757 2915991007 2915986958 Bacteria 6739310
758 2915996683 2915993759 Bacteria 7016183
759 2916005093 2916000859 Bacteria 6865702
760 2916013427 2916007675 Bacteria 6898660
761 2916016949 2916014648 Bacteria 6946486
762 2916028206 2916021584 Bacteria 6854472
763 2916029279 2916028427 Bacteria 6748433
764 2916038345 2916035215 Bacteria 6755766
765 2916044909 2916041962 Bacteria 6820487
766 2916049263 2916048683 Bacteria 6543552
767 2916058216 2916055098 Bacteria 6758838
768 2916076298 2916068649 Bacteria 6943657
769 2916083129 2916076590 Bacteria 6596108
770 2919103620 2919100787 Bacteria 7710546
771 2919169006 2919166419 Bacteria 4952238
772 2919451611 2919450847 Bacteria 5631160
773 2921202122 2921201388 Bacteria 6926299
774 2921213317 2921208531 Bacteria 6745326
775 2921242318 2921237296 Bacteria 6876710
776 2921247742 2921244191 Bacteria 6568419
777 2921260122 2921257292 Bacteria 6808382
778 2921266117 2921263974 Bacteria 6864552
779 2921288353 2921282425 Bacteria 6826397
780 2921289569 2921289301 Bacteria 7316391
781 2921298705 2921296804 Bacteria 7176999
782 2923560519 2923556063 Bacteria 6793593
783 2923591551 2923586266 Bacteria 6565975
784 2924148267 2924144063 Bacteria 6883928
785 2924152107 2924150972 Bacteria 7169444
786 2924164043 2924158325 Bacteria 7188855
787 2924168681 2924165586 Bacteria 7260590
788 2924175347 2924172951 Bacteria 6749356
789 2924183831 2924179722 Bacteria 6843264
790 2924189968 2924186466 Bacteria 6876637
791 2924193743 2924193448 Bacteria 6955718
792 2924214046 2924207177 Bacteria 6917007
793 2924220638 2924214083 Bacteria 7080103
794 2924221798 2924221636 Bacteria 7113495
795 2924232430 2924228884 Bacteria 6633132
796 2924759727 2924754689 Bacteria 6774424
797 2929191534 2929189879 Bacteria 5930554
798 2931371563 2931369376 Bacteria 6847892
799 2931392623 2931390751 Bacteria 6273349
800 2933575923 2933570622 Bacteria 7023390
801 2933592270 2933586486 Bacteria 7667493
802 2933599480 2933599457 Bacteria 5858799
803 2935900305 2935894831 Bacteria 6620579
804 2935906509 2935901341 Bacteria 7341747
805 2936373575 2936367885 Bacteria 7324495
806 2936378357 2936375103 Bacteria 6652732
807 2936386630 2936381700 Bacteria 7006523
808 2937000020 2936996657 Bacteria 6298727
809 2937007020 2937002841 Bacteria 6934057
810 2937015489 2937009748 Bacteria 6746052
811 2937018209 2937016420 Bacteria 6782579
812 2937026738 2937023124 Bacteria 6815156
813 2937047845 2937042894 Bacteria 6741576
814 2937052376 2937049772 Bacteria 6757901
815 2937062205 2937056579 Bacteria 7107896
816 2937067620 2937063883 Bacteria 7199456
817 2937071434 2937071275 Bacteria 6984483
818 2937093428 2937091812 Bacteria 6979387
819 2937102280 2937098957 Bacteria 7249374
820 2937111378 2937106411 Bacteria 6947143
821 2937114861 2937113482 Bacteria 6505872
822 2937123665 2937119839 Bacteria 6597547
823 2937129357 2937126314 Bacteria 6771275
824 2937838702 2937836603 Bacteria 6811263
825 2945929036 2945928738 Bacteria 6053221
826 2945962169 2945961074 Bacteria 7342064
827 2946011254 2946006987 Bacteria 6705746
828 2946029812 2946027586 Bacteria 6049274
829 2947236384 2947233263 Bacteria 6439278
830 2957386118 2957382221 Bacteria 6737050
831 2957392097 2957388812 Bacteria 6778072
832 2957398469 2957395598 Bacteria 6822399
833 2957406299 2957402308 Bacteria 6741770
834 2957409052 2957408893 Bacteria 6558585
835 2957421257 2957415311 Bacteria 6991633
836 2957429958 2957422303 Bacteria 7172205
837 2957436815 2957430029 Bacteria 7022557
838 2957451683 2957450854 Bacteria 6765715
839 2957459070 2957457609 Bacteria 6967680
840 2957468371 2957464669 Bacteria 6568877
841 2957472266 2957471148 Bacteria 6797643
842 2957481135 2957478035 Bacteria 6756658
843 2957487576 2957484790 Bacteria 6703082
844 2957495306 2957491536 Bacteria 6695180
845 2957498685 2957498199 Bacteria 7126688
846 2957508687 2957505466 Bacteria 7253085
847 2960585348 2960584000 Bacteria 6864594
848 2960598811 2960597568 Bacteria 6550735
849 2960608302 2960603979 Bacteria 6898737
850 2960617217 2960610863 Bacteria 6691244
851 2960628111 2960624210 Bacteria 6875384
852 2960638985 2960637947 Bacteria 7296468
853 2960650122 2960645483 Bacteria 7211087
854 2960671531 2960667422 Bacteria 6763020
855 2960677407 2960674078 Bacteria 6609048
856 2960692378 2960687367 Bacteria 6535474
857 2964612976 2964607997 Bacteria 7101408
858 2964620436 2964615318 Bacteria 6809089
859 2964622379 2964621998 Bacteria 6834995
860 2964629976 2964628898 Bacteria 7083044
861 2964638215 2964636051 Bacteria 7091832
862 2964647276 2964643177 Bacteria 6820887
863 2964652300 2964649959 Bacteria 6675118
864 2964657765 2964656573 Bacteria 7100150
865 2964670846 2964663802 Bacteria 7019362
866 2964673662 2964670856 Bacteria 6851364
867 2964681826 2964678106 Bacteria 6792020
868 2964688197 2964685014 Bacteria 6839111
869 2964697669 2964691889 Bacteria 6802758
870 2964702993 2964698721 Bacteria 6765331
871 2964712436 2964705432 Bacteria 7114648
872 2964717474 2964712639 Bacteria 6695970
873 2964720071 2964719344 Bacteria 7286602
874 2967670858 2967664464 Bacteria 6948836
875 2967674415 2967671571 Bacteria 7021409
876 2967685938 2967678726 Bacteria 7264382
877 2967696194 2967693043 Bacteria 6804451
878 2967705649 2967699805 Bacteria 6854538
879 2967710070 2967706974 Bacteria 7186053
880 2967720044 2967714385 Bacteria 7000047
881 2967724858 2967721400 Bacteria 7073753
882 2967735352 2967735183 Bacteria 6827012
883 2967746839 2967742019 Bacteria 6794534
884 2967752407 2967748971 Bacteria 6733771
885 2967758873 2967755722 Bacteria 6814706
886 2967769237 2967762386 Bacteria 6923502
887 2967776392 2967775926 Bacteria 6738189
888 2970022213 2970019648 Bacteria 7072033
889 2970040567 2970033650 Bacteria 7118744
890 2970043466 2970040964 Bacteria 6731123
891 2970050576 2970047711 Bacteria 7088379
892 2970058440 2970054988 Bacteria 6611507
893 2970067050 2970061556 Bacteria 7099761
894 2970075750 2970068827 Bacteria 7123112
895 2970079151 2970076120 Bacteria 6697332
896 2970083459 2970082768 Bacteria 6183754
897 2970090069 2970088815 Bacteria 6933825
898 2970100388 2970095765 Bacteria 6936963
899 2970108899 2970102677 Bacteria 6812532
900 2970112728 2970109326 Bacteria 6863976
901 2970121313 2970116247 Bacteria 6501857
902 2970134369 2970129317 Bacteria 6806560
903 2970141276 2970136068 Bacteria 7207982
904 2970152751 2970149975 Bacteria 6779706
905 2970157902 2970156795 Bacteria 7168044
906 2970166758 2970164137 Bacteria 6861252
907 2970173417 2970170962 Bacteria 6876229
908 2970183075 2970177841 Bacteria 6768001
909 2970187721 2970184632 Bacteria 7054431
910 2970195098 2970191845 Bacteria 7032787
911 2970527934 2970524798 Bacteria 6840927
912 2970547616 2970540015 Bacteria 6977556
913 2977522555 2977516862 Bacteria 6940108
914 2977541039 2977537788 Bacteria 6929320
915 2977556919 2977551784 Bacteria 7125765
916 2977564005 2977558990 Bacteria 6863948
917 2977567197 2977565890 Bacteria 6901543
918 2977576083 2977572785 Bacteria 6763888
919 2977579782 2977579622 Bacteria 6772100
920 2996895718 2996893221 Bacteria 5823108
921 3005451303 3005445848 Bacteria 6906074
922 3007422873 3007419365 Bacteria 7026924
923 639645722 639633055 Bacteria 7751309
924 648735874 648276728 Bacteria 6968865
925 8001847527 8001845381 Bacteria 5804942
926 8003994937 8003992118 Bacteria 7266902
927 8004401304 8004395343 Bacteria 6620908
928 8005276423 8005275841 Bacteria 6929066
929 8005288654 8005282627 Bacteria 6675747
930 8005290152 8005289223 Bacteria 6634003
931 8005302139 8005301065 Bacteria 6614431
932 8005311589 8005307578 Bacteria 7395396
933 8005382500 8005376324 Bacteria 6590079
934 8005397827 8005395548 Bacteria 6806915
935 8005431889 8005430974 Bacteria 6689030
936 8005466429 8005460587 Bacteria 7157962
937 8005487858 8005484373 Bacteria 6297373
938 8005502707 8005497431 Bacteria 6477605
939 8005558769 8005556819 Bacteria 6908598
940 8005563740 8005563573 Bacteria 7153261
941 8005576521 8005570704 Bacteria 6957481
942 8005623914 8005619151 Bacteria 7030230
943 8005629178 8005626139 Bacteria 6534237
944 8005647510 8005645114 Bacteria 6950293
945 8005674136 8005668836 Bacteria 6953162
946 8005684188 8005682033 Bacteria 6726518
947 8005692938 8005688590 Bacteria 6610080
948 8005700471 8005695170 Bacteria 6912330
949 8018129123 8018127388 Bacteria 7351159
950 8018150560 8018150411 Bacteria 5549903
951 8018164123 8018163183 Bacteria 7277977
952 8018177440 8018176218 Bacteria 6896178
953 8019770629 8019769354 Bacteria 6924660
954 8023686118 8023680758 Bacteria 7729763
955 8024486538 8024479707 Bacteria 6954785
956 8024493088 8024486573 Bacteria 6540512
957 8024501824 8024501048 Bacteria 6427847
958 8054289708 8054285046 Bacteria 6919322
959 8054351987 8054347763 Bacteria 5901107
960 8054505137 8054503363 Bacteria 6101651
961 8055621824 8055617313 Bacteria 7548464
962 8055819659 8055817908 Bacteria 6609162
963 8056117892 8056115690 Bacteria 5527654
964 8056123410 8056120720 Bacteria 5758328
965 8056133465 8056131705 Bacteria 6107031
966 8056149738 8056148874 Bacteria 6479865
967 8056158990 8056155041 Bacteria 6486948
968 8056164878 8056161164 Bacteria 6106669
969 8056376326 8056375014 Bacteria 7006639
970 8056383710 8056382006 Bacteria 6408074
971 8057803037 8057798959 Bacteria 6713499
972 8057876941 8057874678 Bacteria 7494653
973 Ga0075433_10057721
974 SwRhRL2b_contig_3754702
975 MRS1b_contig_6409452
976 JGI25162J39368_1000144
977 JGI25152J39213_1000087
978 JGI25150J39212_1000017
979 JGI25150J39212_1000093
980 JGI25159J45721_1001687
981 JGI25159J45721_1017590
982 JGI25151J46595_10000007
983 JGI25151J46595_10000525
984 JGI25151J46595_10001176
985 JGI25151J46595_10003084
986 JGI25165J46597_1000075
987 JGI25153J46596_10000604
988 JGI25153J46596_10001294
989 JGI25153J46596_10006139
990 JGI25153J46596_10008110
991 rootH2_10003773
992 rootL2_10003291
993 rootH1_10031216
994 rootH1_10066597
995 JGI25160J50197_1005886
996 JGI25160J50197_1017236
997 JGI25161J50226_1000450
998 JGI25161J50226_1000813
999 Ga0055539_1000151
1000 Ga0055533_1000154
1001 Ga0055532_1000165
1002 Ga0055525_1000204
1003 Ga0055535_1008953
1004 Ga0055526_1004776
1005 Ga0055526_1004873
1006 Ga0055524_1002154
1007 Ga0055524_1005381
1008 Ga0055524_1012830
1009 Ga0055528_1000501
1010 Ga0055528_1001700
1011 Ga0055528_1005030
1012 Ga0055530_10000229
1013 Ga0055540_1000240
1014 Ga0055540_1000487
1015 Ga0055540_1015377
1016 Ga0055531_10036425
1017 Ga0055541_1000101
1018 Ga0055543_1000045
1019 Ga0055543_1000739
1020 Ga0065165_1002947
1021 Ga0065165_1005055
1022 Ga0065714_10003857
1023 Ga0065704_10000520
1024 Ga0065704_10004936
1025 Ga0065704_10015702
1026 Ga0065712_10001701
1027 Ga0070670_100000162
1028 Ga0070670_100004443
1029 Ga0070670_100008174
1030 Ga0070682_100389043
1031 Ga0070661_100000132
1032 Ga0070668_100210793
1033 Ga0070669_100019731
1034 Ga0070669_100229201
1035 Ga0070674_100201654
1036 Ga0070662_100001797
1037 Ga0070706_100031215
1038 Ga0070707_100186096
1039 Ga0068853_100071926
1040 Ga0068853_100109016
1041 Ga0070696_100036258
1042 Ga0070696_100053595
1043 Ga0070696_100137841
1044 Ga0070665_100095006
1045 Ga0070664_100009020
1046 Ga0070664_100335867
1047 Ga0068854_100009040
1048 Ga0068854_100066566
1049 Ga0068856_100134285
1050 Ga0068861_100083876
1051 Ga0068851_10000084
1052 Ga0081455_10279752
1053 Ga0081538_10005439
1054 Ga0075365_10001089
1055 Ga0075365_10045794
1056 Ga0075365_10295899
1057 Ga0075363_100005396
1058 Ga0075364_10020258
1059 Ga0075367_10024535
1060 Ga0075369_10003675
1061 Ga0075369_10091069
1062 Ga0075366_10000314
1063 Ga0075366_10265207
1064 Ga0075370_10015973
1065 Ga0075431_100020334
1066 Ga0075434_100006245
1067 Ga0075434_100346899
1068 Ga0075436_100208470
1069 Ga0075435_100122555
1070 Ga0105251_10000973
1071 Ga0105251_10004202
1072 Ga0105251_10007395
1073 Ga0105244_10002541
1074 Ga0105244_10005299
1075 Ga0105244_10039061
1076 Ga0105250_10000565
1077 Ga0105250_10033184
1078 Ga0105240_10000097
1079 Ga0111539_10000857
1080 Ga0111539_10605933
1081 Ga0114129_10037407
1082 Ga0114129_10280815
1083 Ga0114129_10886160
1084 Ga0105243_10024955
1085 Ga0105243_10113683
1086 Ga0105242_10000440
1087 Ga0105237_10005732
1088 Ga0105237_10006053
1089 Ga0105238_10015173
1090 Ga0123341_1000003
1091 Ga0123342_1008736
1092 Ga0123342_1039304
1093 Ga0105239_10006934
1094 Ga0105246_10000194
1095 Ga0105246_10003325
1096 Ga0157373_10020543
1097 Ga0157371_10000948
1098 Ga0157370_10073945
1099 Ga0157370_10142609
1100 Ga0157369_10017826
1101 Ga0157369_10091512
1102 Ga0157375_10025179
1103 Ga0157375_10385648
1104 Ga0182008_10007784
1105 Ga0182008_10125801
1106 Ga0182006_1001262
1107 Ga0182007_10001007
1108 Ga0182007_10006537
1109 Ga0182005_1013218
1110 Ga0163161_10165629
1111 Ga0163161_10244627
1112 Ga0209436_100004
1113 Ga0209784_100138
1114 Ga0209566_100179
1115 Ga0209674_100186
1116 Ga0209147_100195
1117 Ga0209563_100148
1118 Ga0209437_100131
1119 Ga0209258_100339
1120 Ga0207425_1000018
1121 Ga0207425_1001189
1122 Ga0207425_1009736
1123 Ga0209646_1000516
1124 Ga0209677_100137
1125 Ga0209677_102216
1126 Ga0209759_1007623
1127 Ga0209129_1000026
1128 Ga0209129_1001031
1129 Ga0209233_1000132
1130 Ga0209233_1000162
1131 Ga0209455_1010914
1132 Ga0209673_1000182
1133 Ga0209673_1002211
1134 Ga0209673_1003064
1135 Ga0209673_1007133
1136 Ga0209130_1000001
1137 Ga0209130_1000300
1138 Ga0209130_1014902
1139 Ga0209675_1013505
1140 Ga0209676_1002489
1141 Ga0209676_1044808
1142 Ga0209025_1000035
1143 Ga0209025_1000082
1144 Ga0209025_1000084
1145 Ga0209025_1003836
1146 Ga0209025_1016317
1147 Ga0209564_1001848
1148 Ga0209758_1000040
1149 Ga0209758_1000543
1150 Ga0209758_1001081
1151 Ga0209758_1001082
1152 Ga0209758_1005768
1153 Ga0209758_1006633
1154 Ga0209758_1016173
1155 Ga0209758_1048406
1156 Ga0209050_1000287
1157 Ga0209256_1001307
1158 Ga0209256_1002707
1159 Ga0209256_1009033
1160 Ga0209256_1010314
1161 Ga0207426_1000005
1162 Ga0207426_1000035
1163 Ga0207426_1000311
1164 Ga0209051_1000070
1165 Ga0209051_1000199
1166 Ga0209051_1001994
1167 Ga0209051_1009545
1168 Ga0209257_1003511
1169 Ga0209257_1006081
1170 Ga0209257_1023979
1171 Ga0207656_10000034
1172 Ga0207696_1000063
1173 Ga0207655_1000006
1174 Ga0207655_1001435
1175 Ga0207655_1003383
1176 Ga0207713_1000872
1177 Ga0207713_1002294
1178 Ga0207713_1019275
1179 Ga0207707_10117418
1180 Ga0207695_10000187
1181 Ga0207671_10000079
1182 Ga0207671_10000784
1183 Ga0207649_10000002
1184 Ga0207646_10179258
1185 Ga0207681_10002018
1186 Ga0207681_10006063
1187 Ga0207681_10068387
1188 Ga0207694_10191747
1189 Ga0207650_10000154
1190 Ga0207650_10000684
1191 Ga0207650_10007516
1192 Ga0207706_10001646
1193 Ga0207686_10009678
1194 Ga0207709_10067715
1195 Ga0207709_10122294
1196 Ga0207704_10176369
1197 Ga0207679_10000006
1198 Ga0207679_10202605
1199 Ga0207640_10034496
1200 Ga0207640_10043175
1201 Ga0207640_10430796
1202 Ga0207658_10115183
1203 Ga0207639_10041124
1204 Ga0207639_10088029
1205 Ga0207639_10490792
1206 Ga0207678_10214030
1207 Ga0207702_10373845
1208 Ga0207702_10410343
1209 Ga0207675_100003793
1210 Ga0209281_1000141
1211 Ga0209371_1006037
1212 Ga0207428_10000053
1213 Ga0268265_10053530
1214 Ga0307515_10000029
1215 Ga0307515_10003876
1216 Ga0307515_10011732
1217 Ga0268256_1006018
1218 Ga0316181_1107564
1219 Ga0307513_10000259
1220 Ga0307513_10098659
1221 Ga0307513_10190115
1222 Ga0307408_100020630
1223 Ga0307516_10314623
1224 Ga0307405_10000428
1225 Ga0307413_10024282
1226 Ga0307410_10166628
1227 Ga0307407_10085576
1228 Ga0307412_10001421
1229 Ga0307409_100036664
1230 Ga0307416_100105827
1231 Ga0307416_100353257
1232 Ga0307416_100493515
1233 Ga0307411_10055812
1234 Ga0307415_100010381
1235 Ga0316584_0366820
1236 Ga0395898_0067790
1237 Ga0395905_0034039
1238 Ga0395901_0005143
1239 Ga0400483_140709
1240 Ga0400483_274668
1241 Ga0439436_0003510
1242 Ga0439438_000804
1243 Ga0439447_006388
1244 Ga0439466_0001830
1245 Ga0439465_0004127
1246 Ga0439465_0009269
1247 Ga0439465_0054017
1248 Ga0451798_0208875
1249 Ga0451833_1093313
1250 Ga0451837_0109501
1251 Ga0451839_1218978
1252 Ga0451841_0040778
1253 Ga0451845_0462619
1254 Ga0451849_0485518
1255 Ga0451851_0421752
1256 Ga0451855_0219103
1257 Ga0451853_0251760
1258 Ga0439431_0005475
1259 Ga0439432_001792
1260 Ga0439432_001919
1261 Ga0439451_000063
1262 Ga0439452_010488
1263 Ga0439456_000020
1264 Ga0450911_000287
1265 Ga0450919_000393
1266 Ga0450920_024532
1267 Ga0450903_000746
1268 Ga0450906_001439
1269 Ga0450907_016462
1270 Ga0450909_000079
1271 Ga0466963_0013723
1272 Ga0466960_0001264
1273 Ga0451576_0162146
1274 Ga0451576_0169878
1275 Ga0466958_0037647
1276 Ga0466967_0319267
1277 Ga0495617_000126
1278 Ga0495592_0096392
1279 Ga0495590_0000259
1280 Ga0495638_0000120
1281 Ga0495638_0004264
1282 Ga0495638_0011436
1283 Ga0495650_0001726
1284 Ga0495580_0056217
1285 Ga0495605_0002084
1286 Ga0495605_0003178
1287 Ga0495605_0016357
1288 Ga0495662_0007062
1289 Ga0495584_0000541
1290 Ga0495585_0093002
1291 Ga0495607_0000344
1292 Ga0495607_0000634
1293 Ga0495607_0002322
1294 Ga0495607_0010393
1295 Ga0495607_0054966
1296 Ga0495583_0001840
1297 Ga0495583_0018173
1298 Ga0495583_0020427
1299 Ga0495583_0044699
1300 Ga0495606_0037706
1301 Ga0495606_0133806
1302 Ga0495610_0027856
1303 Ga0495610_0052968
1304 Ga0495610_0077361
1305 Ga0495616_0001672
1306 Ga0495620_0011472
1307 Ga0495620_0023682
1308 Ga0495631_0010208
1309 Ga0495632_0000698
1310 Ga0495632_0003194
1311 Ga0495632_0005281
1312 Ga0495632_0008220
1313 Ga0495637_0011398
1314 Ga0495643_0004466
1315 Ga0495643_0009358
1316 Ga0495643_0023480
1317 Ga0495648_0030724
1318 Ga0495642_0000247
1319 Ga0495654_0001276
1320 Ga0495654_0006494
1321 Ga0495654_0063147
1322 Ga0495609_0002286
1323 Ga0495609_0092087
1324 Ga0495597_0042162
1325 Ga0495622_0068275
1326 Ga0495633_0034232
1327 Ga0495633_0052187
1328 Ga0495668_0006710
1329 Ga0495668_0042162
1330 Ga0495611_0003176
1331 Ga0495625_0031212
1332 Ga0495625_0036037
1333 Ga0495625_0045964
1334 Ga0495659_0035533
1335 Ga0495661_0000926
1336 Ga0495661_0002886
1337 Ga0495670_0000057
1338 Ga0495649_0000153
1339 Ga0495649_0080699
1340 Ga0495589_0000057
1341 Ga0495589_0152434
1342 Ga0495660_0003453
1343 Ga0495660_0118521
1344 Ga0495636_0001971
1345 Ga0495672_0001002
1346 Ga0495672_0075473
1347 Ga0495687_000432
1348 Ga0495685_002554
1349 Ga0495673_0010554
1350 Ga0495681_0029559
1351 Ga0495681_0054962
1352 Ga0495686_0009124
1353 Ga0495626_0000626
1354 Ga0496101_0010159
1355 Ga0496105_0153805
1356 Ga0496106_0000806
1357 Ga0496106_0043911
1358 Ga0496109_0462649
1359 Ga0496111_0087925
1360 Ga0496111_0137484
1361 Ga0496113_0139080
1362 Ga0496116_0000049
1363 Ga0496116_0006317
1364 Ga0496117_0001805
1365 Ga0496117_0026899
1366 Ga0496117_0088813
1367 Ga0496118_0222858
1368 Ga0496119_0000147
1369 Ga0496119_0071624
1370 Ga0496120_0031039
1371 Ga0496121_0097525
1372 Ga0496122_0000137
1373 Ga0496122_0002390
1374 Ga0496122_0015666
1375 Ga0496122_0022317
1376 Ga0496122_0034805
1377 Ga0496122_0044250
1378 Ga0496123_0000022
1379 Ga0496123_0002146
1380 Ga0496123_0008160
1381 Ga0496123_0012560
1382 Ga0496123_0014576
1383 Ga0496123_0043877
1384 Ga0496124_0001807
1385 Ga0496124_0003713
1386 Ga0496124_0022940
1387 Ga0496124_0028250
1388 Ga0496124_0037204
1389 Ga0496124_0045105
1390 Ga0496124_0060309
1391 Ga0496125_0000143
1392 Ga0496125_0000264
1393 Ga0496125_0000774
1394 Ga0496125_0001930
1395 Ga0496125_0002881
1396 Ga0496125_0003847
1397 Ga0496125_0030421
1398 Ga0496126_0000081
1399 Ga0495678_000585
1400 Ga0501033_0134972
1401 Ga0501038_0354409
1402 Ga0501040_0061713
1403 Ga0501041_0017938
1404 Ga0501041_0090665
1405 Ga0501042_0043739
1406 Ga0501048_0092922
1407 Ga0501068_0069138
1408 Ga0501070_0278098
1409 Ga0501072_0059587
1410 Ga0501074_0192238
1411 Ga0501075_0011676
1412 Ga0501076_0068859
1413 Ga0501079_0003288
1414 Ga0501080_0032207
1415 Ga0501080_0117457
1416 Ga0501081_0004940
1417 Ga0501081_0106405
1418 Ga0501083_0103059
1419 Ga0501045_0031311
1420 nmdc:mga03683_4451_c1
1421 nmdc:mga03n38_5211_c1
1422 nmdc:mga00v17_189067_c1
1423 nmdc:mga0yw44_18736_c1
1424 nmdc:mga0yw44_26771_c1
1425 nmdc:mga0k408_9994_c1
1426 nmdc:mga06z11_8982_c1
1427 nmdc:mga07m45_24765_c1
1428 nmdc:mga07m45_8115_c1
1429 nmdc:mga07m45_84774_c1
1430 nmdc:mga05p37_207334_c1
1431 nmdc:mga05p37_61681_c1
1432 nmdc:mga06r32_33183_c1
1433 nmdc:mga08y16_292253_c1
1434 nmdc:mga08y16_395_c1
1435 nmdc:mga0n895_54383_c1
1436 nmdc:mga0a205_43424_c3
1437 nmdc:mga0sz30_4360_c1
1438 Ga0500610_0043546
1439 Ga0500578_0056889
1440 Ga0500556_0000065
1441 Ga0500556_0004759
1442 Ga0500594_0011673
1443 Ga0500618_003428
1444 Ga0500618_003947
1445 Ga0500658_0000607
1446 Ga0500559_0004585
1447 Ga0500568_0000004
1448 Ga0500568_0000070
1449 Ga0500568_0000101
1450 Ga0500568_0028278
1451 Ga0500616_0000473
1452 Ga0500616_0013319
1453 Ga0500616_0039954
1454 Ga0500616_0099542
1455 Ga0500645_002411
1456 Ga0501084_0016794
1457 Ga0501082_0009434
1458 Ga0501082_0081142
1459 Ga0466962_0020934
1460 Ga0530510_0144507
1461 2509139599
1462 2509386179
1463 2509441732
1464 2510137582
1465 2510303665
1466 2510843094
1467 2510893527
1468 2511135479
1469 2511186770
1470 2511199752
1471 2511364842
1472 2511502960
1473 2511822776
1474 2512534223
1475 2513571901
1476 2513576056
1477 2513585287
1478 2513617131
1479 2513635862
1480 2513712698
1481 2513882872
1482 2513902900
1483 2513908056
1484 2513927836
1485 2513999736
1486 2514019022
1487 2514423237
1488 2515109420
1489 2515610367
1490 2515633463
1491 2515641662
1492 2515660499
1493 2515742521
1494 2516894365
1495 2517042289
1496 2517081515
1497 2517099527
1498 2517411726
1499 2523467506
1500 2530650082
1501 2551679833
1502 2551685976
1503 2551694553
1504 2551698071
1505 2551710437
1506 2551711855
1507 2551715711
1508 2551726323
1509 2551733209
1510 2551740293
1511 2551746383
1512 2585221484
1513 2585230825
1514 2585269238
1515 2585276467
1516 2585277846
1517 2585328663
1518 2585336249
1519 2585390766
1520 2585395120
1521 2585401871
1522 2585528591
1523 2585533288
1524 2585539410
1525 2585544346
1526 2585555712
1527 2585562930
1528 2585820285
1529 2585837364
1530 2585901698
1531 2585908575
1532 2587983995
1533 2597862914
1534 2597868715
1535 2599396486
1536 2599416731
1537 2599453457
1538 2599507515
1539 2599514738
1540 2599517279
1541 2599613680
1542 2599719691
1543 2599772112
1544 2599883048
1545 2599888135
1546 2599893997
1547 2599900152
1548 2599951725
1549 2599962404
1550 2599965034
1551 2599976242
1552 2600006716
1553 2600010378
1554 2600018537
1555 2600023834
1556 2600031962
1557 2600037177
1558 2600044072
1559 2600053056
1560 2600060622
1561 2600067651
1562 2600071374
1563 2600077884
1564 2600359891
1565 2601691436
1566 2616294483
1567 2616309232
1568 2616552274
1569 2621301013
1570 2643854672
1571 2643870932
1572 2644284048
1573 2644494084
1574 2644625188
1575 2671092463
1576 2671115542
1577 2671128176
1578 2677896755
1579 2678261280
1580 2719389004
1581 2719668507
1582 2720489200
1583 2720609890
1584 2720617315
1585 2720628457
1586 2720772410
1587 2721402680
1588 2723029839
1589 2723247734
1590 2723564208
1591 2723570106
1592 2723574955
1593 2724034746
1594 2724092439
1595 2724101653
1596 2724112814
1597 2725949766
1598 2730110372
1599 2738670363
1600 2738748756
1601 2738799750
1602 2738809641
1603 2738857798
1604 2738897001
1605 2739033868
1606 2739347947
1607 2745006597
1608 2753360929
1609 2766064948
1610 2776268618
1611 2776285301
1612 2791924187
1613 2793297748
1614 2793312931
1615 2793322561
1616 2793329333
1617 2793336518
1618 2793343765
1619 2793356278
1620 2793359868
1621 2793368520
1622 2805928521
1623 2806045800
1624 2806053372
1625 2806061086
1626 2806066259
1627 2806073161
1628 2807408417
1629 2807456731
1630 2808858874
1631 2808938964
1632 2808967378
1633 2808975784
1634 2808990578
1635 2809002209
1636 2817489684
1637 2819611808
1638 2819641923
1639 2819682915
1640 2825653983
1641 2834029560
1642 2837654088
1643 2837679069
1644 2838016285
1645 2838024744
1646 2838030408
1647 2838036842
1648 2838046856
1649 2838049601
1650 2838065342
1651 2838068812
1652 2838662122
1653 2838668883
1654 2838685655
1655 2838688009
1656 2838700441
1657 2838701457
1658 2838713696
1659 2838732187
1660 2838745394
1661 2839994517
1662 2840768764
1663 2841851750
1664 2841869602
1665 2842082867
1666 2842116053
1667 2842123985
1668 2842146478
1669 2842159175
1670 2842166070
1671 2842182789
1672 2842194131
1673 2842200151
1674 2842222781
1675 2842233153
1676 2842243099
1677 2842247570
1678 2842251292
1679 2842261341
1680 2842265150
1681 2842273043
1682 2842288132
1683 2842297182
1684 2842309478
1685 2842315791
1686 2842319540
1687 2842346078
1688 2842367901
1689 2842376512
1690 2842383569
1691 2842390742
1692 2842399391
1693 2842405398
1694 2842411845
1695 2842418628
1696 2842422958
1697 2842428797
1698 2842435410
1699 2842441727
1700 2842448229
1701 2842463221
1702 2842469741
1703 2842477312
1704 2842490890
1705 2842498697
1706 2842504109
1707 2842525667
1708 2842831726
1709 2842842219
1710 2844461413
1711 2844533771
1712 2852393130
1713 2852614923
1714 2852669891
1715 2855827000
1716 2855842396
1717 2856347221
1718 2857522589
1719 2858803212
1720 2860869555
1721 2882639223
1722 2883294994
1723 2883356532
1724 2885318729
1725 2888348712
1726 2908448480
1727 2912966732
1728 2913037571
1729 2915991007
1730 2915996683
1731 2916005093
1732 2916013427
1733 2916016949
1734 2916028206
1735 2916029279
1736 2916038345
1737 2916044909
1738 2916049263
1739 2916058216
1740 2916076298
1741 2916083129
1742 2919103620
1743 2919169006
1744 2919451611
1745 2921202122
1746 2921213317
1747 2921242318
1748 2921247742
1749 2921260122
1750 2921266117
1751 2921288353
1752 2921289569
1753 2921298705
1754 2923560519
1755 2923591551
1756 2924148267
1757 2924152107
1758 2924164043
1759 2924168681
1760 2924175347
1761 2924183831
1762 2924189968
1763 2924193743
1764 2924214046
1765 2924220638
1766 2924221798
1767 2924232430
1768 2924759727
1769 2929191534
1770 2931371563
1771 2931392623
1772 2933575923
1773 2933592270
1774 2933599480
1775 2935900305
1776 2935906509
1777 2936373575
1778 2936378357
1779 2936386630
1780 2937000020
1781 2937007020
1782 2937015489
1783 2937018209
1784 2937026738
1785 2937047845
1786 2937052376
1787 2937062205
1788 2937067620
1789 2937071434
1790 2937093428
1791 2937102280
1792 2937111378
1793 2937114861
1794 2937123665
1795 2937129357
1796 2937838702
1797 2945929036
1798 2945962169
1799 2946011254
1800 2946029812
1801 2947236384
1802 2957386118
1803 2957392097
1804 2957398469
1805 2957406299
1806 2957409052
1807 2957421257
1808 2957429958
1809 2957436815
1810 2957451683
1811 2957459070
1812 2957468371
1813 2957472266
1814 2957481135
1815 2957487576
1816 2957495306
1817 2957498685
1818 2957508687
1819 2960585348
1820 2960598811
1821 2960608302
1822 2960617217
1823 2960628111
1824 2960638985
1825 2960650122
1826 2960671531
1827 2960677407
1828 2960692378
1829 2964612976
1830 2964620436
1831 2964622379
1832 2964629976
1833 2964638215
1834 2964647276
1835 2964652300
1836 2964657765
1837 2964670846
1838 2964673662
1839 2964681826
1840 2964688197
1841 2964697669
1842 2964702993
1843 2964712436
1844 2964717474
1845 2964720071
1846 2967670858
1847 2967674415
1848 2967685938
1849 2967696194
1850 2967705649
1851 2967710070
1852 2967720044
1853 2967724858
1854 2967735352
1855 2967746839
1856 2967752407
1857 2967758873
1858 2967769237
1859 2967776392
1860 2970022213
1861 2970040567
1862 2970043466
1863 2970050576
1864 2970058440
1865 2970067050
1866 2970075750
1867 2970079151
1868 2970083459
1869 2970090069
1870 2970100388
1871 2970108899
1872 2970112728
1873 2970121313
1874 2970134369
1875 2970141276
1876 2970152751
1877 2970157902
1878 2970166758
1879 2970173417
1880 2970183075
1881 2970187721
1882 2970195098
1883 2970527934
1884 2970547616
1885 2977522555
1886 2977541039
1887 2977556919
1888 2977564005
1889 2977567197
1890 2977576083
1891 2977579782
1892 2996895718
1893 3005451303
1894 3007422873
1895 639645722
1896 648735874
1897 8001847527
1898 8003994937
1899 8004401304
1900 8005276423
1901 8005288654
1902 8005290152
1903 8005302139
1904 8005311589
1905 8005382500
1906 8005397827
1907 8005431889
1908 8005466429
1909 8005487858
1910 8005502707
1911 8005558769
1912 8005563740
1913 8005576521
1914 8005623914
1915 8005629178
1916 8005647510
1917 8005674136
1918 8005684188
1919 8005692938
1920 8005700471
1921 8018129123
1922 8018150560
1923 8018164123
1924 8018177440
1925 8019770629
1926 8023686118
1927 8024486538
1928 8024493088
1929 8024501824
1930 8054289708
1931 8054351987
1932 8054505137
1933 8055621824
1934 8055819659
1935 8056117892
1936 8056123410
1937 8056133465
1938 8056149738
1939 8056158990
1940 8056164878
1941 8056376326
1942 8056383710
1943 8057803037
1944 8057876941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

32

268

0.89

PF12146

Hydrolase_4

Serine aminopeptidase, S33

30

269

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

33

274

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.9579 8 294
1xrp-assembly1.cif.gz_A crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly 0.9544 10 294
1xrr-assembly1.cif.gz_A crystal structure of active site f1-mutant e245q soaked with peptide pro-pro 0.9537 10 294
7a6g-assembly1.cif.gz_A structural characterization of l-proline amide hydrolase from pseudomonas syringae 0.9512 10 293
1mtz-assembly1.cif.gz_A crystal structure of the tricorn interacting factor f1 0.9459 10 294
ID Description Score Start End Superfamily
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9649 16 294 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9591 8 293 3.40.50.1820
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9582 16 294 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9544 10 294 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9353 10 294 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A519SZ51-F1-model_v4 Alpha/beta fold hydrolase 0.9638 21 291 GO:0006508
GO:0008233
GO:0016020
AF-Q5H3E8-F1-model_v4 Proline imino-peptidase 0.9635 10 291 GO:0006508
GO:0008233
AF-A0A2S8MC16-F1-model_v4 deleted 0.9633 65 294
AF-A0A7Y0B0M8-F1-model_v4 Proline iminopeptidase-family hydrolase 0.9606 10 294 GO:0006508
GO:0008233
AF-A0A536IBX7-F1-model_v4 Alpha/beta fold hydrolase 0.9593 10 295 GO:0004177
GO:0006508
GO:0016020

Map