F487148
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 972 | 485 | 888 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10557269|Ga0105243_105572692 |
| Length | 138 |
| Sequence | MKEQGKIFLGFAVFILAMAITYGIWTSKSDIGFEAAGTTALVLAFGLCAMIGYYLAFTARRVDSGAGDNPEAEVADDAGELGFFAPHSWQPLALAIGGALAFCGVIFGWWLLWWSLPIILIGLYGWVFEFYRGEDQNQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 6 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 7 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 8 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 9 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 10 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 11 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 12 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 13 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 14 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 15 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 16 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 17 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 18 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 19 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 20 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 21 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 22 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 23 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 24 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 25 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 26 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 27 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 28 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 29 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 30 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 31 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 32 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 33 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 34 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 35 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 36 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 37 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 38 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 39 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 40 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 41 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 42 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 43 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 44 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 45 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 46 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 47 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 48 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 49 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 50 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 51 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 52 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 53 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 54 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 55 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 56 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 57 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 58 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 59 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 60 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 61 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 62 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 63 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 64 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 65 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 66 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 67 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 68 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 69 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 70 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 71 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 72 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 73 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 74 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 78 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 114 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 115 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 117 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 118 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 130 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 157 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 203 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 205 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 206 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 207 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 211 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 256 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 257 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 258 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 262 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 263 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 264 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 265 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 268 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 269 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 270 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 271 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 272 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 273 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 274 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 275 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 276 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 277 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 278 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 279 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 280 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 281 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 282 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 283 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 284 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 285 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 286 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 287 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 288 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 289 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 290 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 291 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 292 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 293 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 294 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 295 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 296 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 297 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 298 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 299 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 300 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 409 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 438 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 439 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 440 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 444 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 448 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 450 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 451 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 452 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 463 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 464 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 465 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 466 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 469 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 470 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 471 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 472 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 473 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 474 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 475 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 476 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 477 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 478 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 479 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 480 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 481 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 482 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 483 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 484 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 485 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.33 |
| Metatranscriptomes | 1.03 |
| Isolates | 8.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.16 |
| Nodule | 0.31 |
| Rhizoplane | 5.14 |
| Rhizosphere | 84.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10027731 | 3300001989 | Bacteria | 1977 |
| 2 | JGI24737J22298_10042112 | 3300001990 | Bacteria | 1400 |
| 3 | JGI24735J21928_10026388 | 3300002067 | Bacteria | 1746 |
| 4 | rootL2_10071834 | 3300003322 | Bacteria | 1547 |
| 5 | rootH1_10005189 | 3300003323 | Bacteria | 3055 |
| 6 | Ga0006562J51391_1053590 | 3300003578 | Bacteria | 820 |
| 7 | Ga0070683_100232527 | 3300005329 | Bacteria | 1752 |
| 8 | Ga0070690_100157618 | 3300005330 | Bacteria | 1553 |
| 9 | Ga0070666_10782452 | 3300005335 | Bacteria | 702 |
| 10 | Ga0068868_100096697 | 3300005338 | Bacteria | 2386 |
| 11 | Ga0070691_10121304 | 3300005341 | Bacteria | 1317 |
| 12 | Ga0070674_100815649 | 3300005356 | Bacteria | 807 |
| 13 | Ga0070714_100415010 | 3300005435 | Bacteria | 1274 |
| 14 | Ga0070714_101168693 | 3300005435 | Bacteria | 750 |
| 15 | Ga0070713_101329880 | 3300005436 | Bacteria | 696 |
| 16 | Ga0070713_101566211 | 3300005436 | Bacteria | 639 |
| 17 | Ga0070710_10063880 | 3300005437 | Bacteria | 2104 |
| 18 | Ga0070710_10070403 | 3300005437 | Bacteria | 2014 |
| 19 | Ga0070710_10156338 | 3300005437 | Bacteria | 1410 |
| 20 | Ga0070701_10193181 | 3300005438 | Bacteria | 1199 |
| 21 | Ga0070711_100682644 | 3300005439 | Bacteria | 863 |
| 22 | Ga0070711_100745177 | 3300005439 | Bacteria | 827 |
| 23 | Ga0070705_100539722 | 3300005440 | Bacteria | 892 |
| 24 | Ga0070705_101339695 | 3300005440 | Bacteria | 595 |
| 25 | Ga0070700_100734676 | 3300005441 | Bacteria | 788 |
| 26 | Ga0070694_100270047 | 3300005444 | Bacteria | 1293 |
| 27 | Ga0070708_100773111 | 3300005445 | Bacteria | 903 |
| 28 | Ga0070663_100285765 | 3300005455 | Bacteria | 1316 |
| 29 | Ga0070663_101060980 | 3300005455 | Bacteria | 707 |
| 30 | Ga0070678_100472609 | 3300005456 | Bacteria | 1102 |
| 31 | Ga0070681_10748763 | 3300005458 | Bacteria | 894 |
| 32 | Ga0070707_100250493 | 3300005468 | Bacteria | 1724 |
| 33 | Ga0070707_101001633 | 3300005468 | Bacteria | 801 |
| 34 | Ga0070698_101818939 | 3300005471 | Bacteria | 562 |
| 35 | Ga0070699_100980870 | 3300005518 | Bacteria | 775 |
| 36 | Ga0070679_100373511 | 3300005530 | Bacteria | 1373 |
| 37 | Ga0070697_101284011 | 3300005536 | Bacteria | 653 |
| 38 | Ga0068853_100048731 | 3300005539 | Bacteria | 3640 |
| 39 | Ga0068853_100688180 | 3300005539 | Bacteria | 975 |
| 40 | Ga0068853_101611655 | 3300005539 | Bacteria | 629 |
| 41 | Ga0070686_101096939 | 3300005544 | Bacteria | 657 |
| 42 | Ga0070695_100218855 | 3300005545 | Bacteria | 1371 |
| 43 | Ga0070696_101077107 | 3300005546 | Bacteria | 675 |
| 44 | Ga0070693_100638548 | 3300005547 | Bacteria | 773 |
| 45 | Ga0070665_100521721 | 3300005548 | Bacteria | 1199 |
| 46 | Ga0070665_100654524 | 3300005548 | Bacteria | 1064 |
| 47 | Ga0070665_101837875 | 3300005548 | Bacteria | 612 |
| 48 | Ga0070665_101914105 | 3300005548 | Bacteria | 599 |
| 49 | Ga0070704_100515381 | 3300005549 | Bacteria | 1040 |
| 50 | Ga0068855_100256677 | 3300005563 | Bacteria | 1949 |
| 51 | Ga0068857_100552564 | 3300005577 | Bacteria | 1085 |
| 52 | Ga0068854_101474545 | 3300005578 | Bacteria | 617 |
| 53 | Ga0068856_100199674 | 3300005614 | Bacteria | 2014 |
| 54 | Ga0068856_100220181 | 3300005614 | Bacteria | 1913 |
| 55 | Ga0068856_100314133 | 3300005614 | Bacteria | 1584 |
| 56 | Ga0068856_100710313 | 3300005614 | Bacteria | 1025 |
| 57 | Ga0068852_101175869 | 3300005616 | Bacteria | 788 |
| 58 | Ga0068859_100581934 | 3300005617 | Bacteria | 1213 |
| 59 | Ga0068864_100185388 | 3300005618 | Bacteria | 1904 |
| 60 | Ga0068864_100395102 | 3300005618 | Bacteria | 1313 |
| 61 | Ga0068863_101399911 | 3300005841 | Bacteria | 707 |
| 62 | Ga0068858_100168938 | 3300005842 | Bacteria | 2062 |
| 63 | Ga0068860_100169169 | 3300005843 | Bacteria | 2110 |
| 64 | Ga0081455_10004015 | 3300005937 | Bacteria | 16691 |
| 65 | Ga0081455_10272060 | 3300005937 | Bacteria | 1228 |
| 66 | Ga0070717_10145929 | 3300006028 | Bacteria | 2044 |
| 67 | Ga0070717_10152638 | 3300006028 | Bacteria | 1999 |
| 68 | Ga0070717_10416878 | 3300006028 | Bacteria | 1208 |
| 69 | Ga0070717_10431826 | 3300006028 | Bacteria | 1185 |
| 70 | Ga0070717_10605855 | 3300006028 | Bacteria | 994 |
| 71 | Ga0070717_11551942 | 3300006028 | Bacteria | 600 |
| 72 | Ga0075368_10004269 | 3300006042 | Bacteria | 4826 |
| 73 | Ga0075363_100293472 | 3300006048 | Bacteria | 942 |
| 74 | Ga0070715_10136968 | 3300006163 | Bacteria | 1185 |
| 75 | Ga0070716_100021613 | 3300006173 | Bacteria | 3393 |
| 76 | Ga0070716_100116385 | 3300006173 | Bacteria | 1666 |
| 77 | Ga0070716_100998583 | 3300006173 | Bacteria | 662 |
| 78 | Ga0070712_100175413 | 3300006175 | Bacteria | 1666 |
| 79 | Ga0070712_101735317 | 3300006175 | Bacteria | 546 |
| 80 | Ga0075367_10001041 | 3300006178 | Bacteria | 11439 |
| 81 | Ga0097621_100035028 | 3300006237 | Bacteria | 4009 |
| 82 | Ga0075370_10301153 | 3300006353 | Bacteria | 953 |
| 83 | Ga0068871_100549517 | 3300006358 | Bacteria | 1046 |
| 84 | Ga0075433_10228262 | 3300006852 | Bacteria | 1654 |
| 85 | Ga0075434_100303322 | 3300006871 | Bacteria | 1617 |
| 86 | Ga0075436_100341639 | 3300006914 | Bacteria | 1078 |
| 87 | Ga0097620_100581946 | 3300006931 | Bacteria | 1213 |
| 88 | Ga0099826_10026285 | 3300006948 | Bacteria | 4296 |
| 89 | Ga0075435_100328982 | 3300007076 | Bacteria | 1308 |
| 90 | Ga0075435_100479819 | 3300007076 | Bacteria | 1074 |
| 91 | Ga0105251_10128141 | 3300009011 | Bacteria | 1151 |
| 92 | Ga0105244_10346535 | 3300009036 | Bacteria | 685 |
| 93 | Ga0105250_10005086 | 3300009092 | Bacteria | 5942 |
| 94 | Ga0105245_10205700 | 3300009098 | Bacteria | 1892 |
| 95 | Ga0105245_11536281 | 3300009098 | Bacteria | 717 |
| 96 | Ga0105247_10041300 | 3300009101 | Bacteria | 2823 |
| 97 | Ga0105247_10172002 | 3300009101 | Bacteria | 1441 |
| 98 | Ga0105247_11405408 | 3300009101 | Bacteria | 565 |
| 99 | Ga0114129_10419267 | 3300009147 | Bacteria | 1761 |
| 100 | Ga0105243_10107336 | 3300009148 | Bacteria | 2328 |
| 101 | Ga0105243_10557269 | 3300009148 | Bacteria | 1096 |
| 102 | Ga0105241_10969262 | 3300009174 | Bacteria | 794 |
| 103 | Ga0105241_12052820 | 3300009174 | Bacteria | 564 |
| 104 | Ga0105248_10082744 | 3300009177 | Bacteria | 3610 |
| 105 | Ga0105238_10063263 | 3300009551 | Bacteria | 3700 |
| 106 | Ga0105238_12642113 | 3300009551 | Bacteria | 538 |
| 107 | Ga0105239_10877518 | 3300010375 | Bacteria | 1029 |
| 108 | Ga0105239_10972158 | 3300010375 | Bacteria | 976 |
| 109 | Ga0105246_10120144 | 3300011119 | Bacteria | 1946 |
| 110 | Ga0157373_10369307 | 3300013100 | Bacteria | 1025 |
| 111 | Ga0157370_10246205 | 3300013104 | Bacteria | 1654 |
| 112 | Ga0157369_10243976 | 3300013105 | Bacteria | 1876 |
| 113 | Ga0157369_10718912 | 3300013105 | Bacteria | 1028 |
| 114 | Ga0157374_10029298 | 3300013296 | Bacteria | 4983 |
| 115 | Ga0157378_11055785 | 3300013297 | Bacteria | 848 |
| 116 | Ga0163162_10473298 | 3300013306 | Bacteria | 1384 |
| 117 | Ga0163162_10832576 | 3300013306 | Bacteria | 1039 |
| 118 | Ga0157372_10165322 | 3300013307 | Bacteria | 2558 |
| 119 | Ga0157372_10496678 | 3300013307 | Bacteria | 1423 |
| 120 | Ga0157372_10600373 | 3300013307 | Bacteria | 1283 |
| 121 | Ga0157375_10911352 | 3300013308 | Bacteria | 1022 |
| 122 | Ga0163163_10374178 | 3300014325 | Bacteria | 1482 |
| 123 | Ga0163163_10887502 | 3300014325 | Bacteria | 955 |
| 124 | Ga0182008_10001919 | 3300014497 | Bacteria | 13438 |
| 125 | Ga0157379_10408996 | 3300014968 | Bacteria | 1248 |
| 126 | Ga0157376_10438083 | 3300014969 | Bacteria | 1272 |
| 127 | Ga0157376_10611808 | 3300014969 | Bacteria | 1086 |
| 128 | Ga0157376_11472922 | 3300014969 | Bacteria | 713 |
| 129 | Ga0182007_10000425 | 3300015262 | Bacteria | 25802 |
| 130 | Ga0183367_1007 | 3300015688 | Bacteria | 498079 |
| 131 | Ga0206353_11194541 | 3300020082 | Bacteria | 897 |
| 132 | Ga0154015_1326935 | 3300020610 | Bacteria | 836 |
| 133 | Ga0224712_10214579 | 3300022467 | Bacteria | 879 |
| 134 | Ga0256743_101862 | 3300023436 | Bacteria | 1262 |
| 135 | Ga0207426_1038873 | 3300025302 | Bacteria | 1495 |
| 136 | Ga0207426_1040298 | 3300025302 | Bacteria | 1456 |
| 137 | Ga0209051_1087522 | 3300025303 | Bacteria | 877 |
| 138 | Ga0207713_1010515 | 3300025735 | Bacteria | 5115 |
| 139 | Ga0207713_1159922 | 3300025735 | Bacteria | 719 |
| 140 | Ga0207692_10035420 | 3300025898 | Bacteria | 2425 |
| 141 | Ga0207692_10130107 | 3300025898 | Bacteria | 1420 |
| 142 | Ga0207710_10139366 | 3300025900 | Bacteria | 1170 |
| 143 | Ga0207680_10350480 | 3300025903 | Bacteria | 1037 |
| 144 | Ga0207647_10149420 | 3300025904 | Bacteria | 1366 |
| 145 | Ga0207685_10000617 | 3300025905 | Bacteria | 6239 |
| 146 | Ga0207685_10021217 | 3300025905 | Bacteria | 2173 |
| 147 | Ga0207699_10016013 | 3300025906 | Bacteria | 3911 |
| 148 | Ga0207699_10050003 | 3300025906 | Bacteria | 2463 |
| 149 | Ga0207699_10080229 | 3300025906 | Bacteria | 2021 |
| 150 | Ga0207707_10638188 | 3300025912 | Bacteria | 898 |
| 151 | Ga0207707_10839142 | 3300025912 | Bacteria | 763 |
| 152 | Ga0207693_10305562 | 3300025915 | Bacteria | 1246 |
| 153 | Ga0207693_10670823 | 3300025915 | Bacteria | 804 |
| 154 | Ga0207663_10042260 | 3300025916 | Bacteria | 2784 |
| 155 | Ga0207663_10468322 | 3300025916 | Bacteria | 974 |
| 156 | Ga0207652_10217722 | 3300025921 | Bacteria | 1720 |
| 157 | Ga0207646_10343557 | 3300025922 | Bacteria | 1348 |
| 158 | Ga0207646_10821819 | 3300025922 | Bacteria | 827 |
| 159 | Ga0207694_10074643 | 3300025924 | Bacteria | 2654 |
| 160 | Ga0207687_10291719 | 3300025927 | Bacteria | 1311 |
| 161 | Ga0207700_10040668 | 3300025928 | Bacteria | 3395 |
| 162 | Ga0207700_10177676 | 3300025928 | Bacteria | 1780 |
| 163 | Ga0207700_10362385 | 3300025928 | Bacteria | 1264 |
| 164 | Ga0207700_10370502 | 3300025928 | Bacteria | 1250 |
| 165 | Ga0207700_11615974 | 3300025928 | Bacteria | 573 |
| 166 | Ga0207664_10002431 | 3300025929 | Bacteria | 12319 |
| 167 | Ga0207664_10293459 | 3300025929 | Bacteria | 1429 |
| 168 | Ga0207706_11594896 | 3300025933 | Bacteria | 529 |
| 169 | Ga0207709_10277773 | 3300025935 | Bacteria | 1236 |
| 170 | Ga0207669_10580090 | 3300025937 | Bacteria | 909 |
| 171 | Ga0207665_10005691 | 3300025939 | Bacteria | 8302 |
| 172 | Ga0207665_10069009 | 3300025939 | Bacteria | 2409 |
| 173 | Ga0207665_10107304 | 3300025939 | Bacteria | 1958 |
| 174 | Ga0207691_11519283 | 3300025940 | Bacteria | 547 |
| 175 | Ga0207711_10033686 | 3300025941 | Bacteria | 4336 |
| 176 | Ga0207711_11466409 | 3300025941 | Bacteria | 625 |
| 177 | Ga0207679_10319438 | 3300025945 | Bacteria | 1344 |
| 178 | Ga0207667_10259757 | 3300025949 | Bacteria | 1776 |
| 179 | Ga0207667_10595109 | 3300025949 | Bacteria | 1116 |
| 180 | Ga0207703_10197920 | 3300026035 | Bacteria | 1784 |
| 181 | Ga0207639_10030736 | 3300026041 | Bacteria | 3941 |
| 182 | Ga0207639_10621962 | 3300026041 | Bacteria | 997 |
| 183 | Ga0207678_10540379 | 3300026067 | Bacteria | 1019 |
| 184 | Ga0207678_10961883 | 3300026067 | Bacteria | 755 |
| 185 | Ga0207708_11233702 | 3300026075 | Bacteria | 654 |
| 186 | Ga0207702_10172594 | 3300026078 | Bacteria | 1984 |
| 187 | Ga0207702_10516387 | 3300026078 | Bacteria | 1166 |
| 188 | Ga0207702_10851324 | 3300026078 | Bacteria | 902 |
| 189 | Ga0207641_12570403 | 3300026088 | Bacteria | 507 |
| 190 | Ga0207676_10113816 | 3300026095 | Bacteria | 2269 |
| 191 | Ga0207674_10416833 | 3300026116 | Bacteria | 1297 |
| 192 | Ga0207683_10735870 | 3300026121 | Bacteria | 915 |
| 193 | Ga0207698_10727885 | 3300026142 | Bacteria | 989 |
| 194 | Ga0209371_1010314 | 3300027312 | Bacteria | 2887 |
| 195 | Ga0209371_1076947 | 3300027312 | Bacteria | 582 |
| 196 | Ga0209813_10021207 | 3300027866 | Bacteria | 1824 |
| 197 | Ga0268266_10656977 | 3300028379 | Bacteria | 1009 |
| 198 | Ga0268266_11959708 | 3300028379 | Bacteria | 559 |
| 199 | Ga0268264_10188299 | 3300028381 | Bacteria | 1879 |
| 200 | Ga0268264_11875096 | 3300028381 | Bacteria | 609 |
| 201 | Ga0307515_10051203 | 3300028794 | Bacteria | 6165 |
| 202 | Ga0307515_10062832 | 3300028794 | Bacteria | 5234 |
| 203 | Ga0310981_1085041 | 3300029285 | Bacteria | 1267 |
| 204 | Ga0268256_1008374 | 3300030500 | Bacteria | 3548 |
| 205 | Ga0268256_1060897 | 3300030500 | Bacteria | 758 |
| 206 | Ga0307511_10018496 | 3300030521 | Bacteria | 6650 |
| 207 | Ga0307511_10056944 | 3300030521 | Bacteria | 3047 |
| 208 | Ga0307512_10025397 | 3300030522 | Bacteria | 5249 |
| 209 | Ga0307512_10058758 | 3300030522 | Bacteria | 2991 |
| 210 | Ga0307512_10065236 | 3300030522 | Bacteria | 2763 |
| 211 | Ga0316180_1060732 | 3300030736 | Bacteria | 979 |
| 212 | Ga0307513_10009259 | 3300031456 | Bacteria | 12465 |
| 213 | Ga0307513_10161317 | 3300031456 | Bacteria | 2134 |
| 214 | Ga0307509_10343363 | 3300031507 | Bacteria | 1219 |
| 215 | Ga0307408_101825482 | 3300031548 | Bacteria | 582 |
| 216 | Ga0307508_10002091 | 3300031616 | Bacteria | 21502 |
| 217 | Ga0307508_10043552 | 3300031616 | Bacteria | 4020 |
| 218 | Ga0307508_10338976 | 3300031616 | Bacteria | 1095 |
| 219 | Ga0307508_10571558 | 3300031616 | Bacteria | 730 |
| 220 | Ga0307514_10014518 | 3300031649 | Bacteria | 6516 |
| 221 | Ga0307514_10067194 | 3300031649 | Bacteria | 2706 |
| 222 | Ga0307514_10201513 | 3300031649 | Bacteria | 1250 |
| 223 | Ga0307514_10371278 | 3300031649 | Bacteria | 749 |
| 224 | Ga0307516_10016056 | 3300031730 | Bacteria | 7851 |
| 225 | Ga0307516_10037709 | 3300031730 | Bacteria | 4829 |
| 226 | Ga0307516_10151570 | 3300031730 | Bacteria | 2078 |
| 227 | Ga0307518_10192527 | 3300031838 | Bacteria | 1364 |
| 228 | Ga0307518_10243780 | 3300031838 | Bacteria | 1149 |
| 229 | Ga0307518_10351766 | 3300031838 | Bacteria | 857 |
| 230 | Ga0307410_10529789 | 3300031852 | Bacteria | 973 |
| 231 | Ga0307409_100242907 | 3300031995 | Bacteria | 1641 |
| 232 | Ga0307416_100426561 | 3300032002 | Bacteria | 1372 |
| 233 | Ga0307507_10028139 | 3300033179 | Bacteria | 5998 |
| 234 | Ga0307507_10076087 | 3300033179 | Bacteria | 2997 |
| 235 | Ga0307510_10052729 | 3300033180 | Bacteria | 4283 |
| 236 | Ga0307510_10084655 | 3300033180 | Bacteria | 3052 |
| 237 | Ga0307510_10183090 | 3300033180 | Bacteria | 1655 |
| 238 | Ga0373958_0019233 | 3300034819 | Bacteria | 1246 |
| 239 | Ga0373958_0099970 | 3300034819 | Bacteria | 679 |
| 240 | Ga0373938_0222684 | 3300034957 | Bacteria | 530 |
| 241 | Ga0373928_0086852 | 3300035084 | Bacteria | 797 |
| 242 | Ga0373934_0020715 | 3300035086 | Bacteria | 2529 |
| 243 | Ga0373940_0001079 | 3300035088 | Bacteria | 4728 |
| 244 | Ga0373944_0035080 | 3300035089 | Bacteria | 1527 |
| 245 | Ga0373944_0037257 | 3300035089 | Bacteria | 1489 |
| 246 | Ga0373949_0247144 | 3300035090 | Bacteria | 551 |
| 247 | Ga0373923_0058642 | 3300035111 | Bacteria | 1630 |
| 248 | Ga0373923_0100581 | 3300035111 | Bacteria | 1274 |
| 249 | Ga0373923_0695930 | 3300035111 | Bacteria | 504 |
| 250 | Ga0373932_0121483 | 3300035112 | Bacteria | 871 |
| 251 | Ga0373936_0043708 | 3300035113 | Bacteria | 1801 |
| 252 | Ga0373939_0023720 | 3300035114 | Bacteria | 1703 |
| 253 | Ga0373953_0078809 | 3300035117 | Bacteria | 1367 |
| 254 | Ga0373954_0053801 | 3300035118 | Bacteria | 1893 |
| 255 | Ga0373954_0181928 | 3300035118 | Bacteria | 1031 |
| 256 | Ga0373956_0142941 | 3300035119 | Bacteria | 1124 |
| 257 | Ga0373957_0009130 | 3300035120 | Bacteria | 3236 |
| 258 | Ga0373957_0013939 | 3300035120 | Bacteria | 2739 |
| 259 | Ga0373957_0092862 | 3300035120 | Bacteria | 1201 |
| 260 | Ga0373943_0035744 | 3300035170 | Bacteria | 2376 |
| 261 | Ga0373943_0112152 | 3300035170 | Bacteria | 1439 |
| 262 | Ga0373943_0251485 | 3300035170 | Bacteria | 993 |
| 263 | Ga0373946_0038220 | 3300035171 | Bacteria | 1954 |
| 264 | Ga0373946_0489242 | 3300035171 | Bacteria | 630 |
| 265 | Ga0373955_0075849 | 3300035172 | Bacteria | 1890 |
| 266 | Ga0373955_0413585 | 3300035172 | Bacteria | 820 |
| 267 | Ga0373942_0046238 | 3300035207 | Bacteria | 1205 |
| 268 | Ga0373961_0004920 | 3300035241 | Bacteria | 3210 |
| 269 | Ga0373962_0102583 | 3300035242 | Bacteria | 894 |
| 270 | Ga0373924_0005316 | 3300035410 | Bacteria | 4553 |
| 271 | Ga0373924_0071649 | 3300035410 | Bacteria | 1463 |
| 272 | Ga0373924_0140211 | 3300035410 | Bacteria | 1055 |
| 273 | Ga0373931_0004178 | 3300035691 | Bacteria | 6567 |
| 274 | Ga0373931_0908804 | 3300035691 | Bacteria | 592 |
| 275 | Ga0373935_0237812 | 3300035692 | Bacteria | 1270 |
| 276 | Ga0373927_0269358 | 3300035695 | Bacteria | 1120 |
| 277 | Ga0373933_0012460 | 3300035724 | Bacteria | 4695 |
| 278 | Ga0373933_0035789 | 3300035724 | Bacteria | 2902 |
| 279 | Ga0373947_0318801 | 3300035725 | Bacteria | 1039 |
| 280 | Ga0373947_0385115 | 3300035725 | Bacteria | 944 |
| 281 | Ga0373947_0933184 | 3300035725 | Bacteria | 592 |
| 282 | Ga0373937_0008597 | 3300036401 | Bacteria | 8866 |
| 283 | Ga0373937_0104649 | 3300036401 | Bacteria | 2629 |
| 284 | Ga0373937_0267986 | 3300036401 | Bacteria | 1611 |
| 285 | Ga0372808_013077 | 3300036459 | Bacteria | 1181 |
| 286 | Ga0373925_0003887 | 3300037068 | Bacteria | 11421 |
| 287 | Ga0373925_0035736 | 3300037068 | Bacteria | 3667 |
| 288 | Ga0373925_0176576 | 3300037068 | Bacteria | 1688 |
| 289 | Ga0373925_0572838 | 3300037068 | Bacteria | 929 |
| 290 | Ga0373925_0636822 | 3300037068 | Bacteria | 878 |
| 291 | Ga0373925_0812223 | 3300037068 | Bacteria | 771 |
| 292 | Ga0395900_0037246 | 3300037418 | Bacteria | 5017 |
| 293 | Ga0395898_0010509 | 3300037466 | Bacteria | 9674 |
| 294 | Ga0395898_0155358 | 3300037466 | Bacteria | 2188 |
| 295 | Ga0395905_0807630 | 3300037471 | Bacteria | 841 |
| 296 | Ga0436364_1320712 | 3300037853 | Bacteria | 3195 |
| 297 | Ga0395901_0645693 | 3300038443 | Bacteria | 1062 |
| 298 | Ga0436365_0264669 | 3300039437 | Bacteria | 583 |
| 299 | Ga0439436_0000684 | 3300041404 | Bacteria | 9110 |
| 300 | Ga0439436_0023985 | 3300041404 | Bacteria | 1802 |
| 301 | Ga0439439_0004438 | 3300041406 | Bacteria | 3164 |
| 302 | Ga0439461_0128202 | 3300041410 | Bacteria | 640 |
| 303 | Ga0451795_1608725 | 3300041456 | Bacteria | 719 |
| 304 | Ga0451802_0184255 | 3300041460 | Bacteria | 736 |
| 305 | Ga0451802_1590620 | 3300041460 | Bacteria | 507 |
| 306 | Ga0451807_1437455 | 3300041486 | Bacteria | 547 |
| 307 | Ga0451833_0559030 | 3300041491 | Bacteria | 882 |
| 308 | Ga0451835_0505362 | 3300041492 | Bacteria | 1092 |
| 309 | Ga0451837_0893633 | 3300041494 | Bacteria | 1878 |
| 310 | Ga0451849_0857728 | 3300041505 | Bacteria | 898 |
| 311 | Ga0451855_0456396 | 3300041511 | Bacteria | 536 |
| 312 | Ga0451853_1170256 | 3300041512 | Bacteria | 3624 |
| 313 | Ga0451853_1793210 | 3300041512 | Bacteria | 565 |
| 314 | Ga0451853_3846188 | 3300041512 | Bacteria | 1748 |
| 315 | Ga0439433_0003511 | 3300041999 | Bacteria | 3370 |
| 316 | Ga0439433_0009175 | 3300041999 | Bacteria | 2153 |
| 317 | Ga0439448_0008287 | 3300042005 | Bacteria | 3038 |
| 318 | Ga0439448_0151261 | 3300042005 | Bacteria | 805 |
| 319 | Ga0439449_0000137 | 3300042007 | Bacteria | 24720 |
| 320 | Ga0439454_007571 | 3300042011 | Bacteria | 1364 |
| 321 | Ga0439455_0000547 | 3300042012 | Bacteria | 5312 |
| 322 | Ga0439457_000086 | 3300042014 | Bacteria | 21124 |
| 323 | Ga0439457_001245 | 3300042014 | Bacteria | 7652 |
| 324 | Ga0439462_0001927 | 3300042015 | Bacteria | 4731 |
| 325 | Ga0439463_109550 | 3300042016 | Bacteria | 713 |
| 326 | Ga0450920_011782 | 3300042122 | Bacteria | 1633 |
| 327 | Ga0450890_012694 | 3300042127 | Bacteria | 1095 |
| 328 | Ga0450891_025705 | 3300042129 | Bacteria | 594 |
| 329 | Ga0450894_000248 | 3300042131 | Bacteria | 9682 |
| 330 | Ga0450894_025227 | 3300042131 | Bacteria | 814 |
| 331 | Ga0450896_016078 | 3300042133 | Bacteria | 1073 |
| 332 | Ga0450898_001289 | 3300042134 | Bacteria | 3267 |
| 333 | Ga0450899_000065 | 3300042135 | Bacteria | 8675 |
| 334 | Ga0450900_011926 | 3300042136 | Bacteria | 1135 |
| 335 | Ga0450900_055118 | 3300042136 | Bacteria | 614 |
| 336 | Ga0450902_059245 | 3300042137 | Bacteria | 661 |
| 337 | Ga0450903_000221 | 3300042138 | Bacteria | 12729 |
| 338 | Ga0450903_005187 | 3300042138 | Bacteria | 2187 |
| 339 | Ga0450906_005432 | 3300042145 | Bacteria | 2619 |
| 340 | Ga0439458_0002329 | 3300042157 | Bacteria | 4656 |
| 341 | Ga0450908_005929 | 3300042184 | Bacteria | 2333 |
| 342 | Ga0466969_0003967 | 3300044656 | Bacteria | 7858 |
| 343 | Ga0466972_0000586 | 3300044658 | Bacteria | 17695 |
| 344 | Ga0466972_0059584 | 3300044658 | Bacteria | 1832 |
| 345 | Ga0466972_0076241 | 3300044658 | Bacteria | 1597 |
| 346 | Ga0466965_0040477 | 3300044683 | Bacteria | 2294 |
| 347 | Ga0466965_0165588 | 3300044683 | Bacteria | 1161 |
| 348 | Ga0466965_0700579 | 3300044683 | Bacteria | 581 |
| 349 | Ga0466966_0001630 | 3300044684 | Bacteria | 14467 |
| 350 | Ga0466966_0016908 | 3300044684 | Bacteria | 4821 |
| 351 | Ga0466966_0031052 | 3300044684 | Bacteria | 3464 |
| 352 | Ga0466961_0030602 | 3300044693 | Bacteria | 3459 |
| 353 | Ga0466961_0047105 | 3300044693 | Bacteria | 2757 |
| 354 | Ga0466961_0058538 | 3300044693 | Bacteria | 2451 |
| 355 | Ga0466961_0146856 | 3300044693 | Bacteria | 1474 |
| 356 | Ga0466963_0216315 | 3300044694 | Bacteria | 1341 |
| 357 | Ga0466971_0011446 | 3300044719 | Bacteria | 3886 |
| 358 | Ga0466971_0043028 | 3300044719 | Bacteria | 2030 |
| 359 | Ga0466971_0101053 | 3300044719 | Bacteria | 1325 |
| 360 | Ga0466971_0642434 | 3300044719 | Bacteria | 531 |
| 361 | Ga0466968_0102081 | 3300044735 | Bacteria | 1281 |
| 362 | Ga0466970_0190797 | 3300044765 | Bacteria | 1138 |
| 363 | Ga0466957_0341484 | 3300044842 | Bacteria | 1014 |
| 364 | Ga0466960_0001090 | 3300044901 | Bacteria | 9756 |
| 365 | Ga0466959_0073199 | 3300045049 | Bacteria | 2479 |
| 366 | Ga0466959_0128681 | 3300045049 | Bacteria | 1795 |
| 367 | Ga0466958_0232159 | 3300045836 | Bacteria | 1178 |
| 368 | Ga0466967_1098385 | 3300045976 | Bacteria | 792 |
| 369 | Ga0466967_1522486 | 3300045976 | Bacteria | 666 |
| 370 | Ga0495617_006263 | 3300046452 | Bacteria | 4181 |
| 371 | Ga0495627_099965 | 3300046453 | Bacteria | 828 |
| 372 | Ga0495592_0003676 | 3300046454 | Bacteria | 11051 |
| 373 | Ga0495592_0011647 | 3300046454 | Bacteria | 6660 |
| 374 | Ga0495592_0012279 | 3300046454 | Bacteria | 6501 |
| 375 | Ga0495592_0021014 | 3300046454 | Bacteria | 4963 |
| 376 | Ga0495592_0025661 | 3300046454 | Bacteria | 4472 |
| 377 | Ga0495603_0010502 | 3300046455 | Bacteria | 5610 |
| 378 | Ga0495603_0012292 | 3300046455 | Bacteria | 5181 |
| 379 | Ga0495603_0019429 | 3300046455 | Bacteria | 4111 |
| 380 | Ga0495603_0026012 | 3300046455 | Bacteria | 3538 |
| 381 | Ga0495603_0099555 | 3300046455 | Bacteria | 1697 |
| 382 | Ga0495603_0126898 | 3300046455 | Bacteria | 1486 |
| 383 | Ga0495603_0328122 | 3300046455 | Bacteria | 878 |
| 384 | Ga0495590_0136685 | 3300046457 | Bacteria | 883 |
| 385 | Ga0495629_0018737 | 3300046459 | Bacteria | 4948 |
| 386 | Ga0495629_0056356 | 3300046459 | Bacteria | 2748 |
| 387 | Ga0495629_0060769 | 3300046459 | Bacteria | 2640 |
| 388 | Ga0495629_0062319 | 3300046459 | Bacteria | 2605 |
| 389 | Ga0495629_0099100 | 3300046459 | Bacteria | 2033 |
| 390 | Ga0495629_0105292 | 3300046459 | Bacteria | 1967 |
| 391 | Ga0495629_0122125 | 3300046459 | Bacteria | 1814 |
| 392 | Ga0495629_0123116 | 3300046459 | Bacteria | 1806 |
| 393 | Ga0495629_0146099 | 3300046459 | Bacteria | 1644 |
| 394 | Ga0495629_0147699 | 3300046459 | Bacteria | 1634 |
| 395 | Ga0495638_0315325 | 3300046460 | Bacteria | 837 |
| 396 | Ga0495641_0013023 | 3300046461 | Bacteria | 4604 |
| 397 | Ga0495651_0001751 | 3300046462 | Bacteria | 16745 |
| 398 | Ga0495651_0004593 | 3300046462 | Bacteria | 10556 |
| 399 | Ga0495651_0008099 | 3300046462 | Bacteria | 8056 |
| 400 | Ga0495651_0039883 | 3300046462 | Bacteria | 3653 |
| 401 | Ga0495651_0258242 | 3300046462 | Bacteria | 1186 |
| 402 | Ga0495651_0327337 | 3300046462 | Bacteria | 1019 |
| 403 | Ga0495651_0443265 | 3300046462 | Bacteria | 840 |
| 404 | Ga0495653_0098376 | 3300046463 | Bacteria | 2124 |
| 405 | Ga0495653_0408537 | 3300046463 | Bacteria | 861 |
| 406 | Ga0495653_0603440 | 3300046463 | Bacteria | 674 |
| 407 | Ga0495653_0668693 | 3300046463 | Bacteria | 633 |
| 408 | Ga0495580_0057492 | 3300046472 | Bacteria | 2737 |
| 409 | Ga0495580_0211751 | 3300046472 | Bacteria | 1333 |
| 410 | Ga0495582_0068408 | 3300046473 | Bacteria | 1962 |
| 411 | Ga0495582_0614406 | 3300046473 | Bacteria | 629 |
| 412 | Ga0495605_0003162 | 3300046474 | Bacteria | 9895 |
| 413 | Ga0495639_0005142 | 3300046475 | Bacteria | 5620 |
| 414 | Ga0495639_0562663 | 3300046475 | Bacteria | 585 |
| 415 | Ga0495662_0031746 | 3300046476 | Bacteria | 2551 |
| 416 | Ga0495662_0037224 | 3300046476 | Bacteria | 2349 |
| 417 | Ga0495662_0096022 | 3300046476 | Bacteria | 1448 |
| 418 | Ga0495662_0148741 | 3300046476 | Bacteria | 1153 |
| 419 | Ga0495662_0224819 | 3300046476 | Bacteria | 925 |
| 420 | Ga0495664_0000982 | 3300046477 | Bacteria | 14656 |
| 421 | Ga0495664_0007816 | 3300046477 | Bacteria | 5951 |
| 422 | Ga0495664_0046058 | 3300046477 | Bacteria | 2587 |
| 423 | Ga0495664_0051469 | 3300046477 | Bacteria | 2445 |
| 424 | Ga0495664_0087080 | 3300046477 | Bacteria | 1876 |
| 425 | Ga0495584_0081850 | 3300046491 | Bacteria | 1625 |
| 426 | Ga0495585_0022673 | 3300046492 | Bacteria | 3603 |
| 427 | Ga0495594_0000785 | 3300046499 | Bacteria | 16363 |
| 428 | Ga0495594_0005538 | 3300046499 | Bacteria | 6486 |
| 429 | Ga0495594_0055352 | 3300046499 | Bacteria | 2187 |
| 430 | Ga0495594_0164135 | 3300046499 | Bacteria | 1263 |
| 431 | Ga0495594_0245011 | 3300046499 | Bacteria | 1021 |
| 432 | Ga0495594_0507841 | 3300046499 | Bacteria | 684 |
| 433 | Ga0495594_0544064 | 3300046499 | Bacteria | 659 |
| 434 | Ga0495596_0116317 | 3300046500 | Bacteria | 1038 |
| 435 | Ga0495607_0009891 | 3300046501 | Bacteria | 6430 |
| 436 | Ga0495583_0017174 | 3300046506 | Bacteria | 3854 |
| 437 | Ga0495606_0029411 | 3300046507 | Bacteria | 3857 |
| 438 | Ga0495608_0014967 | 3300046511 | Bacteria | 5383 |
| 439 | Ga0495608_0017719 | 3300046511 | Bacteria | 4924 |
| 440 | Ga0495608_0031694 | 3300046511 | Bacteria | 3572 |
| 441 | Ga0495608_0831771 | 3300046511 | Bacteria | 543 |
| 442 | Ga0495610_0077293 | 3300046512 | Bacteria | 1537 |
| 443 | Ga0495616_0006389 | 3300046513 | Bacteria | 7136 |
| 444 | Ga0495618_0039491 | 3300046514 | Bacteria | 2967 |
| 445 | Ga0495618_0107401 | 3300046514 | Bacteria | 1787 |
| 446 | Ga0495618_0162245 | 3300046514 | Bacteria | 1424 |
| 447 | Ga0495618_0225666 | 3300046514 | Bacteria | 1180 |
| 448 | Ga0495618_0289725 | 3300046514 | Bacteria | 1019 |
| 449 | Ga0495620_0035511 | 3300046515 | Bacteria | 2239 |
| 450 | Ga0495620_0107619 | 3300046515 | Bacteria | 1107 |
| 451 | Ga0495628_0038949 | 3300046516 | Bacteria | 3803 |
| 452 | Ga0495628_0114002 | 3300046516 | Bacteria | 2077 |
| 453 | Ga0495628_0154639 | 3300046516 | Bacteria | 1745 |
| 454 | Ga0495628_0227746 | 3300046516 | Bacteria | 1398 |
| 455 | Ga0495630_0012111 | 3300046517 | Bacteria | 6253 |
| 456 | Ga0495630_0058843 | 3300046517 | Bacteria | 2881 |
| 457 | Ga0495630_0134639 | 3300046517 | Bacteria | 1877 |
| 458 | Ga0495630_0216798 | 3300046517 | Bacteria | 1461 |
| 459 | Ga0495631_0057317 | 3300046518 | Bacteria | 1695 |
| 460 | Ga0495632_0132482 | 3300046519 | Bacteria | 1159 |
| 461 | Ga0495637_0016191 | 3300046520 | Bacteria | 3488 |
| 462 | Ga0495643_0001474 | 3300046522 | Bacteria | 21493 |
| 463 | Ga0495644_0210247 | 3300046523 | Bacteria | 751 |
| 464 | Ga0495644_0235585 | 3300046523 | Bacteria | 709 |
| 465 | Ga0495666_0055757 | 3300046526 | Bacteria | 1893 |
| 466 | Ga0495666_0068813 | 3300046526 | Bacteria | 1685 |
| 467 | Ga0495666_0384319 | 3300046526 | Bacteria | 631 |
| 468 | Ga0495652_0004599 | 3300046529 | Bacteria | 13155 |
| 469 | Ga0495652_0007058 | 3300046529 | Bacteria | 10376 |
| 470 | Ga0495652_0022098 | 3300046529 | Bacteria | 5649 |
| 471 | Ga0495652_0076268 | 3300046529 | Bacteria | 2781 |
| 472 | Ga0495652_0116035 | 3300046529 | Bacteria | 2144 |
| 473 | Ga0495652_0149665 | 3300046529 | Bacteria | 1825 |
| 474 | Ga0495652_0189384 | 3300046529 | Bacteria | 1571 |
| 475 | Ga0495652_0335179 | 3300046529 | Bacteria | 1088 |
| 476 | Ga0495652_0377366 | 3300046529 | Bacteria | 1009 |
| 477 | Ga0495654_0005542 | 3300046530 | Bacteria | 7315 |
| 478 | Ga0495665_0109325 | 3300046531 | Bacteria | 1450 |
| 479 | Ga0495665_0478440 | 3300046531 | Bacteria | 628 |
| 480 | Ga0495640_0010606 | 3300046533 | Bacteria | 7108 |
| 481 | Ga0495640_0014287 | 3300046533 | Bacteria | 6014 |
| 482 | Ga0495640_0035507 | 3300046533 | Bacteria | 3528 |
| 483 | Ga0495640_0038056 | 3300046533 | Bacteria | 3386 |
| 484 | Ga0495640_0115085 | 3300046533 | Bacteria | 1753 |
| 485 | Ga0495640_0241278 | 3300046533 | Bacteria | 1134 |
| 486 | Ga0495586_0105937 | 3300046535 | Bacteria | 1563 |
| 487 | Ga0495586_0319506 | 3300046535 | Bacteria | 890 |
| 488 | Ga0495587_0000971 | 3300046536 | Bacteria | 18796 |
| 489 | Ga0495587_0007439 | 3300046536 | Bacteria | 7090 |
| 490 | Ga0495587_0008065 | 3300046536 | Bacteria | 6791 |
| 491 | Ga0495587_0063365 | 3300046536 | Bacteria | 2162 |
| 492 | Ga0495587_0423938 | 3300046536 | Bacteria | 738 |
| 493 | Ga0495609_0006829 | 3300046538 | Bacteria | 5768 |
| 494 | Ga0495609_0137205 | 3300046538 | Bacteria | 1045 |
| 495 | Ga0495597_0033225 | 3300046542 | Bacteria | 2337 |
| 496 | Ga0495645_0088163 | 3300046543 | Bacteria | 2220 |
| 497 | Ga0495645_0108753 | 3300046543 | Bacteria | 1963 |
| 498 | Ga0495645_0115562 | 3300046543 | Bacteria | 1895 |
| 499 | Ga0495645_0161733 | 3300046543 | Bacteria | 1547 |
| 500 | Ga0495645_0262773 | 3300046543 | Bacteria | 1142 |
| 501 | Ga0495645_0345696 | 3300046543 | Bacteria | 959 |
| 502 | Ga0495622_0017176 | 3300046557 | Bacteria | 3368 |
| 503 | Ga0495622_0022160 | 3300046557 | Bacteria | 2960 |
| 504 | Ga0495622_0030211 | 3300046557 | Bacteria | 2532 |
| 505 | Ga0495633_0011818 | 3300046558 | Bacteria | 4681 |
| 506 | Ga0495633_0309358 | 3300046558 | Bacteria | 717 |
| 507 | Ga0495667_0000874 | 3300046559 | Bacteria | 19477 |
| 508 | Ga0495667_0080239 | 3300046559 | Bacteria | 2121 |
| 509 | Ga0495667_0099233 | 3300046559 | Bacteria | 1885 |
| 510 | Ga0495667_0202979 | 3300046559 | Bacteria | 1268 |
| 511 | Ga0495667_0405671 | 3300046559 | Bacteria | 858 |
| 512 | Ga0495656_0034061 | 3300046615 | Bacteria | 2083 |
| 513 | Ga0495668_0004207 | 3300046616 | Bacteria | 10376 |
| 514 | Ga0495668_0597230 | 3300046616 | Bacteria | 610 |
| 515 | Ga0495634_0002168 | 3300046642 | Bacteria | 16508 |
| 516 | Ga0495634_0023741 | 3300046642 | Bacteria | 4308 |
| 517 | Ga0495634_0096457 | 3300046642 | Bacteria | 1914 |
| 518 | Ga0495634_0181205 | 3300046642 | Bacteria | 1318 |
| 519 | Ga0495634_0260768 | 3300046642 | Bacteria | 1057 |
| 520 | Ga0495634_0280187 | 3300046642 | Bacteria | 1013 |
| 521 | Ga0495634_0588898 | 3300046642 | Bacteria | 646 |
| 522 | Ga0495611_0009341 | 3300046648 | Bacteria | 4143 |
| 523 | Ga0495611_0074377 | 3300046648 | Bacteria | 1556 |
| 524 | Ga0495611_0323614 | 3300046648 | Bacteria | 709 |
| 525 | Ga0495625_0073344 | 3300046660 | Bacteria | 2399 |
| 526 | Ga0495625_0110897 | 3300046660 | Bacteria | 1875 |
| 527 | Ga0495625_0147263 | 3300046660 | Bacteria | 1585 |
| 528 | Ga0495625_0201159 | 3300046660 | Bacteria | 1314 |
| 529 | Ga0495625_0414327 | 3300046660 | Bacteria | 839 |
| 530 | Ga0495635_0001572 | 3300046663 | Bacteria | 15329 |
| 531 | Ga0495635_0010278 | 3300046663 | Bacteria | 6544 |
| 532 | Ga0495635_0037557 | 3300046663 | Bacteria | 3353 |
| 533 | Ga0495635_0140134 | 3300046663 | Bacteria | 1647 |
| 534 | Ga0495635_0217987 | 3300046663 | Bacteria | 1291 |
| 535 | Ga0495635_1056134 | 3300046663 | Bacteria | 515 |
| 536 | Ga0495659_0048127 | 3300046664 | Bacteria | 1544 |
| 537 | Ga0495661_0041276 | 3300046665 | Bacteria | 2855 |
| 538 | Ga0495661_0153711 | 3300046665 | Bacteria | 1241 |
| 539 | Ga0495588_0013464 | 3300046674 | Bacteria | 3898 |
| 540 | Ga0495588_0028011 | 3300046674 | Bacteria | 2818 |
| 541 | Ga0495588_0063593 | 3300046674 | Bacteria | 1913 |
| 542 | Ga0495588_0071193 | 3300046674 | Bacteria | 1808 |
| 543 | Ga0495588_0332117 | 3300046674 | Bacteria | 799 |
| 544 | Ga0495657_0010270 | 3300046675 | Bacteria | 7047 |
| 545 | Ga0495657_0014880 | 3300046675 | Bacteria | 5707 |
| 546 | Ga0495657_0019959 | 3300046675 | Bacteria | 4827 |
| 547 | Ga0495657_0021076 | 3300046675 | Bacteria | 4680 |
| 548 | Ga0495657_0056113 | 3300046675 | Bacteria | 2625 |
| 549 | Ga0495657_0087213 | 3300046675 | Bacteria | 2008 |
| 550 | Ga0495657_0517831 | 3300046675 | Bacteria | 694 |
| 551 | Ga0495599_0015242 | 3300046678 | Bacteria | 4767 |
| 552 | Ga0495599_0025198 | 3300046678 | Bacteria | 3722 |
| 553 | Ga0495599_0026500 | 3300046678 | Bacteria | 3633 |
| 554 | Ga0495599_0137333 | 3300046678 | Bacteria | 1517 |
| 555 | Ga0495623_0031400 | 3300046679 | Bacteria | 3415 |
| 556 | Ga0495623_0034303 | 3300046679 | Bacteria | 3255 |
| 557 | Ga0495623_0065181 | 3300046679 | Bacteria | 2278 |
| 558 | Ga0495623_0105459 | 3300046679 | Bacteria | 1713 |
| 559 | Ga0495623_0107473 | 3300046679 | Bacteria | 1694 |
| 560 | Ga0495623_0698019 | 3300046679 | Bacteria | 520 |
| 561 | Ga0495646_0047289 | 3300046680 | Bacteria | 2619 |
| 562 | Ga0495646_0047994 | 3300046680 | Bacteria | 2596 |
| 563 | Ga0495646_0108644 | 3300046680 | Bacteria | 1581 |
| 564 | Ga0495646_0237112 | 3300046680 | Bacteria | 981 |
| 565 | Ga0495647_0027655 | 3300046681 | Bacteria | 2085 |
| 566 | Ga0495647_0075628 | 3300046681 | Bacteria | 1356 |
| 567 | Ga0495658_0064629 | 3300046683 | Bacteria | 2108 |
| 568 | Ga0495658_0130813 | 3300046683 | Bacteria | 1527 |
| 569 | Ga0495613_0001401 | 3300046689 | Bacteria | 18364 |
| 570 | Ga0495613_0010252 | 3300046689 | Bacteria | 6961 |
| 571 | Ga0495613_0077307 | 3300046689 | Bacteria | 2421 |
| 572 | Ga0495613_0097743 | 3300046689 | Bacteria | 2121 |
| 573 | Ga0495613_0102531 | 3300046689 | Bacteria | 2066 |
| 574 | Ga0495613_0157302 | 3300046689 | Bacteria | 1618 |
| 575 | Ga0495624_0068630 | 3300046690 | Bacteria | 2209 |
| 576 | Ga0495624_0085813 | 3300046690 | Bacteria | 1944 |
| 577 | Ga0495624_0132334 | 3300046690 | Bacteria | 1529 |
| 578 | Ga0495624_0379456 | 3300046690 | Bacteria | 849 |
| 579 | Ga0495671_0150419 | 3300046692 | Bacteria | 1133 |
| 580 | Ga0495671_0273986 | 3300046692 | Bacteria | 813 |
| 581 | Ga0495671_0401508 | 3300046692 | Bacteria | 656 |
| 582 | Ga0495649_0096671 | 3300046694 | Bacteria | 1571 |
| 583 | Ga0495649_0193731 | 3300046694 | Bacteria | 1057 |
| 584 | Ga0495649_0327196 | 3300046694 | Bacteria | 777 |
| 585 | Ga0495589_0014878 | 3300046794 | Bacteria | 4002 |
| 586 | Ga0495589_0025261 | 3300046794 | Bacteria | 3015 |
| 587 | Ga0495589_0107837 | 3300046794 | Bacteria | 1345 |
| 588 | Ga0495600_0000608 | 3300046809 | Bacteria | 18481 |
| 589 | Ga0495600_0017894 | 3300046809 | Bacteria | 4510 |
| 590 | Ga0495600_0142036 | 3300046809 | Bacteria | 1557 |
| 591 | Ga0495600_0153973 | 3300046809 | Bacteria | 1487 |
| 592 | Ga0495600_0324118 | 3300046809 | Bacteria | 968 |
| 593 | Ga0495600_0393451 | 3300046809 | Bacteria | 863 |
| 594 | Ga0495660_0047021 | 3300046810 | Bacteria | 2364 |
| 595 | Ga0495581_0010139 | 3300047315 | Bacteria | 5453 |
| 596 | Ga0495581_0042806 | 3300047315 | Bacteria | 2620 |
| 597 | Ga0495581_0081713 | 3300047315 | Bacteria | 1871 |
| 598 | Ga0495581_0138433 | 3300047315 | Bacteria | 1419 |
| 599 | Ga0495581_0211011 | 3300047315 | Bacteria | 1135 |
| 600 | Ga0495581_0316673 | 3300047315 | Bacteria | 911 |
| 601 | Ga0495604_0003209 | 3300047317 | Bacteria | 13065 |
| 602 | Ga0495604_0008150 | 3300047317 | Bacteria | 8294 |
| 603 | Ga0495604_0009632 | 3300047317 | Bacteria | 7640 |
| 604 | Ga0495604_0042455 | 3300047317 | Bacteria | 3564 |
| 605 | Ga0495604_0061583 | 3300047317 | Bacteria | 2869 |
| 606 | Ga0495604_0081264 | 3300047317 | Bacteria | 2426 |
| 607 | Ga0495604_0564827 | 3300047317 | Bacteria | 732 |
| 608 | Ga0495636_0007858 | 3300047318 | Bacteria | 4198 |
| 609 | Ga0495636_0011299 | 3300047318 | Bacteria | 3533 |
| 610 | Ga0495636_0028303 | 3300047318 | Bacteria | 2285 |
| 611 | Ga0495636_0044515 | 3300047318 | Bacteria | 1848 |
| 612 | Ga0495636_0112676 | 3300047318 | Bacteria | 1198 |
| 613 | Ga0495674_0003520 | 3300047319 | Bacteria | 15244 |
| 614 | Ga0495674_0010300 | 3300047319 | Bacteria | 8851 |
| 615 | Ga0495674_0120696 | 3300047319 | Bacteria | 2214 |
| 616 | Ga0495674_0146574 | 3300047319 | Bacteria | 1981 |
| 617 | Ga0495674_0195350 | 3300047319 | Bacteria | 1680 |
| 618 | Ga0495674_0247568 | 3300047319 | Bacteria | 1467 |
| 619 | Ga0495672_0069255 | 3300047320 | Bacteria | 2004 |
| 620 | Ga0495676_0014968 | 3300047321 | Bacteria | 6922 |
| 621 | Ga0495676_0018421 | 3300047321 | Bacteria | 6154 |
| 622 | Ga0495676_0038934 | 3300047321 | Bacteria | 3944 |
| 623 | Ga0495676_0046083 | 3300047321 | Bacteria | 3543 |
| 624 | Ga0495676_0140359 | 3300047321 | Bacteria | 1732 |
| 625 | Ga0495676_0176177 | 3300047321 | Bacteria | 1501 |
| 626 | Ga0495676_0707702 | 3300047321 | Bacteria | 651 |
| 627 | Ga0495676_1030334 | 3300047321 | Bacteria | 524 |
| 628 | Ga0495680_0001885 | 3300047322 | Bacteria | 22031 |
| 629 | Ga0495680_0026400 | 3300047322 | Bacteria | 4787 |
| 630 | Ga0495680_0064591 | 3300047322 | Bacteria | 2806 |
| 631 | Ga0495680_0075219 | 3300047322 | Bacteria | 2562 |
| 632 | Ga0495683_0065758 | 3300047323 | Bacteria | 1787 |
| 633 | Ga0495687_017227 | 3300047443 | Bacteria | 3611 |
| 634 | Ga0495687_068270 | 3300047443 | Bacteria | 1435 |
| 635 | Ga0495687_130088 | 3300047443 | Bacteria | 892 |
| 636 | Ga0495687_194059 | 3300047443 | Bacteria | 651 |
| 637 | Ga0495675_0019097 | 3300047444 | Bacteria | 4354 |
| 638 | Ga0495675_0034800 | 3300047444 | Bacteria | 3216 |
| 639 | Ga0495675_0037771 | 3300047444 | Bacteria | 3075 |
| 640 | Ga0495675_0054126 | 3300047444 | Bacteria | 2547 |
| 641 | Ga0495675_0087256 | 3300047444 | Bacteria | 1960 |
| 642 | Ga0495675_0104000 | 3300047444 | Bacteria | 1775 |
| 643 | Ga0495675_0118855 | 3300047444 | Bacteria | 1646 |
| 644 | Ga0495675_0160521 | 3300047444 | Bacteria | 1384 |
| 645 | Ga0495675_0628417 | 3300047444 | Bacteria | 607 |
| 646 | Ga0495677_0200632 | 3300047445 | Bacteria | 775 |
| 647 | Ga0495679_124801 | 3300047446 | Bacteria | 701 |
| 648 | Ga0495685_003724 | 3300047447 | Bacteria | 4881 |
| 649 | Ga0495685_008069 | 3300047447 | Bacteria | 3487 |
| 650 | Ga0495685_014983 | 3300047447 | Bacteria | 2639 |
| 651 | Ga0495685_028643 | 3300047447 | Bacteria | 1916 |
| 652 | Ga0495685_031441 | 3300047447 | Bacteria | 1824 |
| 653 | Ga0495685_039951 | 3300047447 | Bacteria | 1605 |
| 654 | Ga0495685_057602 | 3300047447 | Bacteria | 1312 |
| 655 | Ga0495681_0013335 | 3300047470 | Bacteria | 4775 |
| 656 | Ga0495681_0163757 | 3300047470 | Bacteria | 924 |
| 657 | Ga0495684_0008904 | 3300047471 | Bacteria | 7755 |
| 658 | Ga0495684_0012338 | 3300047471 | Bacteria | 6591 |
| 659 | Ga0495684_0056193 | 3300047471 | Bacteria | 3001 |
| 660 | Ga0495684_0072549 | 3300047471 | Bacteria | 2615 |
| 661 | Ga0495684_0148003 | 3300047471 | Bacteria | 1757 |
| 662 | Ga0495684_0233778 | 3300047471 | Bacteria | 1343 |
| 663 | Ga0495686_0041878 | 3300047472 | Bacteria | 2914 |
| 664 | Ga0495593_0028253 | 3300047673 | Bacteria | 3081 |
| 665 | Ga0495593_0048248 | 3300047673 | Bacteria | 2263 |
| 666 | Ga0495593_0094638 | 3300047673 | Bacteria | 1536 |
| 667 | Ga0495593_0537526 | 3300047673 | Bacteria | 586 |
| 668 | Ga0495593_0572064 | 3300047673 | Bacteria | 567 |
| 669 | Ga0495602_0026894 | 3300048088 | Bacteria | 5540 |
| 670 | Ga0495602_0072862 | 3300048088 | Bacteria | 2926 |
| 671 | Ga0495602_0076786 | 3300048088 | Bacteria | 2829 |
| 672 | Ga0495602_0088568 | 3300048088 | Bacteria | 2576 |
| 673 | Ga0495602_0134846 | 3300048088 | Bacteria | 1963 |
| 674 | Ga0495602_0647174 | 3300048088 | Bacteria | 722 |
| 675 | Ga0495614_0020793 | 3300048089 | Bacteria | 2836 |
| 676 | Ga0495614_0023309 | 3300048089 | Bacteria | 2670 |
| 677 | Ga0495614_0033404 | 3300048089 | Bacteria | 2213 |
| 678 | Ga0495614_0076837 | 3300048089 | Bacteria | 1443 |
| 679 | Ga0495614_0103977 | 3300048089 | Bacteria | 1243 |
| 680 | Ga0495614_0251233 | 3300048089 | Bacteria | 809 |
| 681 | Ga0495626_0005908 | 3300048091 | Bacteria | 7046 |
| 682 | Ga0496100_0253128 | 3300048903 | Bacteria | 1303 |
| 683 | Ga0496100_0358053 | 3300048903 | Bacteria | 1103 |
| 684 | Ga0496100_0702744 | 3300048903 | Bacteria | 789 |
| 685 | Ga0496100_1134469 | 3300048903 | Bacteria | 616 |
| 686 | Ga0496101_0107467 | 3300048904 | Bacteria | 2096 |
| 687 | Ga0496101_0132337 | 3300048904 | Bacteria | 1895 |
| 688 | Ga0496101_0284848 | 3300048904 | Bacteria | 1292 |
| 689 | Ga0496102_0058401 | 3300048905 | Bacteria | 3525 |
| 690 | Ga0496102_0210403 | 3300048905 | Bacteria | 1834 |
| 691 | Ga0496102_0495841 | 3300048905 | Bacteria | 1143 |
| 692 | Ga0496102_1454266 | 3300048905 | Bacteria | 604 |
| 693 | Ga0496103_0236902 | 3300048906 | Bacteria | 1174 |
| 694 | Ga0496104_0011442 | 3300048907 | Bacteria | 7949 |
| 695 | Ga0496104_0015675 | 3300048907 | Bacteria | 6874 |
| 696 | Ga0496104_0093665 | 3300048907 | Bacteria | 2873 |
| 697 | Ga0496105_0003685 | 3300048908 | Bacteria | 11404 |
| 698 | Ga0496105_0006593 | 3300048908 | Bacteria | 8938 |
| 699 | Ga0496105_0093819 | 3300048908 | Bacteria | 2478 |
| 700 | Ga0496105_1018356 | 3300048908 | Bacteria | 619 |
| 701 | Ga0496106_0446778 | 3300048909 | Bacteria | 1039 |
| 702 | Ga0496106_0644613 | 3300048909 | Bacteria | 847 |
| 703 | Ga0496106_0765174 | 3300048909 | Bacteria | 767 |
| 704 | Ga0496107_0327601 | 3300048910 | Bacteria | 1140 |
| 705 | Ga0496108_0026910 | 3300048911 | Bacteria | 4746 |
| 706 | Ga0496108_0097924 | 3300048911 | Bacteria | 2499 |
| 707 | Ga0496108_0169951 | 3300048911 | Bacteria | 1886 |
| 708 | Ga0496108_0474173 | 3300048911 | Bacteria | 1093 |
| 709 | Ga0496109_0007106 | 3300048912 | Bacteria | 9452 |
| 710 | Ga0496109_0098430 | 3300048912 | Bacteria | 2711 |
| 711 | Ga0496109_0212314 | 3300048912 | Bacteria | 1820 |
| 712 | Ga0496109_0239622 | 3300048912 | Bacteria | 1707 |
| 713 | Ga0496110_0484661 | 3300048913 | Bacteria | 1126 |
| 714 | Ga0496110_0826360 | 3300048913 | Bacteria | 831 |
| 715 | Ga0496111_0314994 | 3300048914 | Bacteria | 1159 |
| 716 | Ga0496111_1047920 | 3300048914 | Bacteria | 583 |
| 717 | Ga0496112_0035310 | 3300048915 | Bacteria | 4869 |
| 718 | Ga0496112_0172894 | 3300048915 | Bacteria | 2125 |
| 719 | Ga0496112_0374359 | 3300048915 | Bacteria | 1365 |
| 720 | Ga0496113_0032644 | 3300048916 | Bacteria | 3784 |
| 721 | Ga0496113_0071570 | 3300048916 | Bacteria | 2637 |
| 722 | Ga0496113_0080300 | 3300048916 | Bacteria | 2498 |
| 723 | Ga0496114_0008917 | 3300048917 | Bacteria | 7952 |
| 724 | Ga0496114_0593475 | 3300048917 | Bacteria | 977 |
| 725 | Ga0496115_0011366 | 3300048918 | Bacteria | 6671 |
| 726 | Ga0496115_0776246 | 3300048918 | Bacteria | 747 |
| 727 | Ga0496126_1171235 | 3300048929 | Bacteria | 567 |
| 728 | Ga0495678_033991 | 3300049459 | Bacteria | 2101 |
| 729 | Ga0495682_0180797 | 3300049460 | Bacteria | 749 |
| 730 | Ga0501311_096093 | 3300049527 | Bacteria | 520 |
| 731 | Ga0501318_000189 | 3300049534 | Bacteria | 3222 |
| 732 | Ga0501323_001026 | 3300049539 | Bacteria | 2337 |
| 733 | Ga0501031_0026414 | 3300049568 | Bacteria | 3785 |
| 734 | Ga0501031_0559393 | 3300049568 | Bacteria | 736 |
| 735 | Ga0501032_0000349 | 3300049569 | Bacteria | 38615 |
| 736 | Ga0501032_0069477 | 3300049569 | Bacteria | 2350 |
| 737 | Ga0501032_0310780 | 3300049569 | Bacteria | 1018 |
| 738 | Ga0501032_0346450 | 3300049569 | Bacteria | 957 |
| 739 | Ga0501032_0722891 | 3300049569 | Bacteria | 631 |
| 740 | Ga0501033_0001339 | 3300049570 | Bacteria | 21893 |
| 741 | Ga0501033_0009633 | 3300049570 | Bacteria | 7432 |
| 742 | Ga0501033_0243176 | 3300049570 | Bacteria | 1276 |
| 743 | Ga0501033_0356168 | 3300049570 | Bacteria | 1024 |
| 744 | Ga0501033_0455258 | 3300049570 | Bacteria | 888 |
| 745 | Ga0501033_0839767 | 3300049570 | Bacteria | 619 |
| 746 | Ga0501034_0004152 | 3300049571 | Bacteria | 16221 |
| 747 | Ga0501034_0035276 | 3300049571 | Bacteria | 5071 |
| 748 | Ga0501034_0202166 | 3300049571 | Bacteria | 1944 |
| 749 | Ga0501034_0552735 | 3300049571 | Bacteria | 1060 |
| 750 | Ga0501034_0564858 | 3300049571 | Bacteria | 1046 |
| 751 | Ga0501034_0613390 | 3300049571 | Bacteria | 992 |
| 752 | Ga0501034_1237624 | 3300049571 | Bacteria | 624 |
| 753 | Ga0501034_1264609 | 3300049571 | Bacteria | 615 |
| 754 | Ga0501036_0006306 | 3300049572 | Bacteria | 9624 |
| 755 | Ga0501036_0060167 | 3300049572 | Bacteria | 3217 |
| 756 | Ga0501036_0068833 | 3300049572 | Bacteria | 2995 |
| 757 | Ga0501036_0086095 | 3300049572 | Bacteria | 2656 |
| 758 | Ga0501036_0130138 | 3300049572 | Bacteria | 2125 |
| 759 | Ga0501036_0211188 | 3300049572 | Bacteria | 1631 |
| 760 | Ga0501037_0002432 | 3300049573 | Bacteria | 13465 |
| 761 | Ga0501037_0014083 | 3300049573 | Bacteria | 5891 |
| 762 | Ga0501037_0052437 | 3300049573 | Bacteria | 2983 |
| 763 | Ga0501037_0567526 | 3300049573 | Bacteria | 764 |
| 764 | Ga0501037_0988702 | 3300049573 | Bacteria | 548 |
| 765 | Ga0501038_0043175 | 3300049574 | Bacteria | 3921 |
| 766 | Ga0501038_0049772 | 3300049574 | Bacteria | 3622 |
| 767 | Ga0501038_0057499 | 3300049574 | Bacteria | 3339 |
| 768 | Ga0501038_0069712 | 3300049574 | Bacteria | 2986 |
| 769 | Ga0501038_0298198 | 3300049574 | Bacteria | 1265 |
| 770 | Ga0501038_0368899 | 3300049574 | Bacteria | 1115 |
| 771 | Ga0501038_1035449 | 3300049574 | Bacteria | 601 |
| 772 | Ga0501039_0022674 | 3300049575 | Bacteria | 4817 |
| 773 | Ga0501039_0038335 | 3300049575 | Bacteria | 3701 |
| 774 | Ga0501039_0125698 | 3300049575 | Bacteria | 2011 |
| 775 | Ga0501039_0351286 | 3300049575 | Bacteria | 1159 |
| 776 | Ga0501040_0067123 | 3300049576 | Bacteria | 2471 |
| 777 | Ga0501041_0001346 | 3300049577 | Bacteria | 13537 |
| 778 | Ga0501042_0032462 | 3300049578 | Bacteria | 3697 |
| 779 | Ga0501042_0048306 | 3300049578 | Bacteria | 3034 |
| 780 | Ga0501043_0003089 | 3300049579 | Bacteria | 13812 |
| 781 | Ga0501043_0006539 | 3300049579 | Bacteria | 9351 |
| 782 | Ga0501043_0048534 | 3300049579 | Bacteria | 3337 |
| 783 | Ga0501043_0074611 | 3300049579 | Bacteria | 2664 |
| 784 | Ga0501043_0223916 | 3300049579 | Bacteria | 1454 |
| 785 | Ga0501043_0797401 | 3300049579 | Bacteria | 683 |
| 786 | Ga0501046_0068069 | 3300049580 | Bacteria | 2771 |
| 787 | Ga0501046_0076664 | 3300049580 | Bacteria | 2589 |
| 788 | Ga0501046_0826353 | 3300049580 | Bacteria | 648 |
| 789 | Ga0501047_0000309 | 3300049581 | Bacteria | 56264 |
| 790 | Ga0501047_0042376 | 3300049581 | Bacteria | 4399 |
| 791 | Ga0501047_0091888 | 3300049581 | Bacteria | 2913 |
| 792 | Ga0501047_0105413 | 3300049581 | Bacteria | 2699 |
| 793 | Ga0501047_0169900 | 3300049581 | Bacteria | 2049 |
| 794 | Ga0501047_0177716 | 3300049581 | Bacteria | 1996 |
| 795 | Ga0501047_0205439 | 3300049581 | Bacteria | 1829 |
| 796 | Ga0501047_0448019 | 3300049581 | Bacteria | 1120 |
| 797 | Ga0501047_0532151 | 3300049581 | Bacteria | 1000 |
| 798 | Ga0501047_1018267 | 3300049581 | Bacteria | 641 |
| 799 | Ga0501048_0002495 | 3300049582 | Bacteria | 14051 |
| 800 | Ga0501048_0017248 | 3300049582 | Bacteria | 5320 |
| 801 | Ga0501048_0430340 | 3300049582 | Bacteria | 944 |
| 802 | Ga0501067_0646671 | 3300049583 | Bacteria | 593 |
| 803 | Ga0501067_0679780 | 3300049583 | Bacteria | 578 |
| 804 | Ga0501068_0005639 | 3300049584 | Bacteria | 6857 |
| 805 | Ga0501068_0746242 | 3300049584 | Bacteria | 641 |
| 806 | Ga0501069_0003348 | 3300049585 | Bacteria | 8229 |
| 807 | Ga0501069_0290303 | 3300049585 | Bacteria | 958 |
| 808 | Ga0501070_0012774 | 3300049586 | Bacteria | 7080 |
| 809 | Ga0501070_0415375 | 3300049586 | Bacteria | 1087 |
| 810 | Ga0501070_0423887 | 3300049586 | Bacteria | 1074 |
| 811 | Ga0501070_0714758 | 3300049586 | Bacteria | 791 |
| 812 | Ga0501070_1006935 | 3300049586 | Bacteria | 646 |
| 813 | Ga0501072_0021693 | 3300049588 | Bacteria | 4981 |
| 814 | Ga0501073_0005694 | 3300049589 | Bacteria | 9320 |
| 815 | Ga0501073_0312185 | 3300049589 | Bacteria | 1085 |
| 816 | Ga0501074_0003000 | 3300049590 | Bacteria | 11873 |
| 817 | Ga0501074_0046313 | 3300049590 | Bacteria | 3144 |
| 818 | Ga0501075_0261223 | 3300049591 | Bacteria | 1320 |
| 819 | Ga0501202_092090 | 3300049652 | Bacteria | 727 |
| 820 | Ga0501224_044829 | 3300049664 | Bacteria | 672 |
| 821 | Ga0501235_032051 | 3300049669 | Bacteria | 1188 |
| 822 | Ga0501079_1132531 | 3300049741 | Bacteria | 616 |
| 823 | Ga0501080_0477851 | 3300049742 | Bacteria | 1115 |
| 824 | Ga0501080_1218819 | 3300049742 | Bacteria | 646 |
| 825 | Ga0501083_0002475 | 3300049744 | Bacteria | 12663 |
| 826 | Ga0501282_017244 | 3300049778 | Bacteria | 787 |
| 827 | Ga0501035_0000922 | 3300049822 | Bacteria | 31150 |
| 828 | Ga0501035_0005042 | 3300049822 | Bacteria | 12507 |
| 829 | Ga0501035_0010143 | 3300049822 | Bacteria | 8742 |
| 830 | Ga0501035_0038843 | 3300049822 | Bacteria | 4309 |
| 831 | Ga0501035_0102652 | 3300049822 | Bacteria | 2508 |
| 832 | Ga0501035_0290273 | 3300049822 | Bacteria | 1380 |
| 833 | Ga0501035_0330293 | 3300049822 | Bacteria | 1279 |
| 834 | Ga0501035_0361878 | 3300049822 | Bacteria | 1212 |
| 835 | Ga0501035_1005156 | 3300049822 | Bacteria | 655 |
| 836 | Ga0501035_1044827 | 3300049822 | Bacteria | 640 |
| 837 | Ga0501044_0002906 | 3300049823 | Bacteria | 19500 |
| 838 | Ga0501044_0007526 | 3300049823 | Bacteria | 11978 |
| 839 | Ga0501044_0011335 | 3300049823 | Bacteria | 9658 |
| 840 | Ga0501044_0014904 | 3300049823 | Bacteria | 8380 |
| 841 | Ga0501044_0087413 | 3300049823 | Bacteria | 3148 |
| 842 | Ga0501044_0149727 | 3300049823 | Bacteria | 2317 |
| 843 | Ga0501044_0167174 | 3300049823 | Bacteria | 2173 |
| 844 | Ga0501044_0216255 | 3300049823 | Bacteria | 1868 |
| 845 | Ga0501044_0324772 | 3300049823 | Bacteria | 1462 |
| 846 | Ga0501044_0407519 | 3300049823 | Bacteria | 1271 |
| 847 | Ga0501044_0509746 | 3300049823 | Bacteria | 1103 |
| 848 | Ga0501044_1155847 | 3300049823 | Bacteria | 642 |
| 849 | Ga0501044_1192379 | 3300049823 | Bacteria | 629 |
| 850 | Ga0501044_1626955 | 3300049823 | Bacteria | 511 |
| 851 | Ga0501045_0147786 | 3300049824 | Bacteria | 1748 |
| 852 | nmdc:mga03n38_26447_c1 | 3300050490 | Bacteria | 2396 |
| 853 | nmdc:mga03n38_35383_c1 | 3300050490 | Bacteria | 2139 |
| 854 | nmdc:mga03n38_90224_c1 | 3300050490 | Bacteria | 1457 |
| 855 | nmdc:mga0yw44_45338_c1 | 3300050492 | Bacteria | 2635 |
| 856 | nmdc:mga06z11_1574_c1 | 3300050494 | Bacteria | 8493 |
| 857 | nmdc:mga04h51_59290_c1 | 3300050495 | Bacteria | 1308 |
| 858 | nmdc:mga07m45_290091_c1 | 3300050496 | Bacteria | 952 |
| 859 | nmdc:mga07m45_55352_c2 | 3300050496 | Bacteria | 1862 |
| 860 | nmdc:mga05p37_444118_c2 | 3300050507 | Bacteria | 1117 |
| 861 | nmdc:mga0n895_242638_c1 | 3300050512 | Bacteria | 1829 |
| 862 | nmdc:mga0rr50_448446_c1 | 3300050513 | Bacteria | 1094 |
| 863 | nmdc:mga0rr50_508850_c1 | 3300050513 | Bacteria | 1024 |
| 864 | nmdc:mga0rr50_918139_c1 | 3300050513 | Bacteria | 746 |
| 865 | nmdc:mga08x19_74811_c1 | 3300050514 | Bacteria | 2213 |
| 866 | nmdc:mga0a205_398235_c1 | 3300050515 | Bacteria | 1241 |
| 867 | Ga0495601_0031633 | 3300053077 | Bacteria | 3289 |
| 868 | Ga0495601_0416963 | 3300053077 | Bacteria | 870 |
| 869 | Ga0495601_0468132 | 3300053077 | Bacteria | 814 |
| 870 | Ga0495612_0073855 | 3300053078 | Bacteria | 1425 |
| 871 | Ga0495655_0028259 | 3300053083 | Bacteria | 1338 |
| 872 | Ga0495595_0014625 | 3300053084 | Bacteria | 3333 |
| 873 | Ga0495595_0022285 | 3300053084 | Bacteria | 2779 |
| 874 | Ga0495595_0029865 | 3300053084 | Bacteria | 2442 |
| 875 | Ga0495619_0012686 | 3300053085 | Bacteria | 5305 |
| 876 | Ga0495619_0016508 | 3300053085 | Bacteria | 4675 |
| 877 | Ga0495619_0153739 | 3300053085 | Bacteria | 1587 |
| 878 | Ga0495619_0352830 | 3300053085 | Bacteria | 1018 |
| 879 | Ga0500640_018388 | 3300053095 | Bacteria | 2979 |
| 880 | Ga0500572_020073 | 3300053111 | Bacteria | 1754 |
| 881 | Ga0500614_003947 | 3300053123 | Bacteria | 3166 |
| 882 | Ga0500573_0064507 | 3300053140 | Bacteria | 2095 |
| 883 | Ga0500573_0182924 | 3300053140 | Bacteria | 1125 |
| 884 | Ga0501084_0323501 | 3300054114 | Bacteria | 1302 |
| 885 | Ga0501082_0884263 | 3300060353 | Bacteria | 782 |
| 886 | Ga0466962_0000908 | 3300061719 | Bacteria | 13429 |
| 887 | Ga0466962_0150123 | 3300061719 | Bacteria | 1130 |
| 888 | Ga0466962_0340479 | 3300061719 | Bacteria | 746 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10071834 | rootL2_100718342 | 112 |
| 2 | 3300027312 | Ga0209371_1076947 | Ga0209371_10769471 | 113 |
| 3 | 3300030500 | Ga0268256_1060897 | Ga0268256_10608972 | 113 |
| 4 | 3300041460 | Ga0451802_0184255 | Ga0451802_0184255_361_708 | 115 |
| 5 | 3300042134 | Ga0450898_001289 | Ga0450898_001289_13_360 | 115 |
| 6 | 3300048903 | Ga0496100_0702744 | Ga0496100_0702744_425_772 | 115 |
| 7 | 3300031852 | Ga0307410_10529789 | Ga0307410_105297892 | 116 |
| 8 | 3300031995 | Ga0307409_100242907 | Ga0307409_1002429072 | 116 |
| 9 | 3300023436 | Ga0256743_101862 | Ga0256743_1018622 | 118 |
| 10 | 3300029285 | Ga0310981_1085041 | Ga0310981_10850411 | 118 |
| 11 | 3300046452 | Ga0495617_006263 | Ga0495617_006263_3301_3681 | 118 |
| 12 | 3300046453 | Ga0495627_099965 | Ga0495627_099965_98_478 | 118 |
| 13 | 3300046454 | Ga0495592_0021014 | Ga0495592_0021014_4052_4432 | 118 |
| 14 | 3300046455 | Ga0495603_0126898 | Ga0495603_0126898_702_1082 | 118 |
| 15 | 3300046457 | Ga0495590_0136685 | Ga0495590_0136685_136_516 | 118 |
| 16 | 3300046459 | Ga0495629_0105292 | Ga0495629_0105292_447_827 | 118 |
| 17 | 3300046460 | Ga0495638_0315325 | Ga0495638_0315325_126_506 | 118 |
| 18 | 3300046462 | Ga0495651_0258242 | Ga0495651_0258242_292_672 | 118 |
| 19 | 3300046463 | Ga0495653_0668693 | Ga0495653_0668693_59_439 | 118 |
| 20 | 3300046472 | Ga0495580_0057492 | Ga0495580_0057492_1587_1967 | 118 |
| 21 | 3300046474 | Ga0495605_0003162 | Ga0495605_0003162_683_1063 | 118 |
| 22 | 3300046477 | Ga0495664_0051469 | Ga0495664_0051469_1120_1500 | 118 |
| 23 | 3300046491 | Ga0495584_0081850 | Ga0495584_0081850_163_543 | 118 |
| 24 | 3300046492 | Ga0495585_0022673 | Ga0495585_0022673_831_1211 | 118 |
| 25 | 3300046499 | Ga0495594_0005538 | Ga0495594_0005538_5702_6082 | 118 |
| 26 | 3300046500 | Ga0495596_0116317 | Ga0495596_0116317_523_903 | 118 |
| 27 | 3300046501 | Ga0495607_0009891 | Ga0495607_0009891_4591_4971 | 118 |
| 28 | 3300046506 | Ga0495583_0017174 | Ga0495583_0017174_545_925 | 118 |
| 29 | 3300046507 | Ga0495606_0029411 | Ga0495606_0029411_2930_3310 | 118 |
| 30 | 3300046511 | Ga0495608_0831771 | Ga0495608_0831771_21_401 | 118 |
| 31 | 3300046512 | Ga0495610_0077293 | Ga0495610_0077293_315_695 | 118 |
| 32 | 3300046513 | Ga0495616_0006389 | Ga0495616_0006389_1394_1774 | 118 |
| 33 | 3300046514 | Ga0495618_0107401 | Ga0495618_0107401_436_816 | 118 |
| 34 | 3300046515 | Ga0495620_0035511 | Ga0495620_0035511_1473_1853 | 118 |
| 35 | 3300046516 | Ga0495628_0154639 | Ga0495628_0154639_480_860 | 118 |
| 36 | 3300046518 | Ga0495631_0057317 | Ga0495631_0057317_929_1309 | 118 |
| 37 | 3300046519 | Ga0495632_0132482 | Ga0495632_0132482_215_595 | 118 |
| 38 | 3300046520 | Ga0495637_0016191 | Ga0495637_0016191_3022_3402 | 118 |
| 39 | 3300046522 | Ga0495643_0001474 | Ga0495643_0001474_90_470 | 118 |
| 40 | 3300046523 | Ga0495644_0235585 | Ga0495644_0235585_236_616 | 118 |
| 41 | 3300046526 | Ga0495666_0055757 | Ga0495666_0055757_1026_1406 | 118 |
| 42 | 3300046529 | Ga0495652_0116035 | Ga0495652_0116035_141_521 | 118 |
| 43 | 3300046530 | Ga0495654_0005542 | Ga0495654_0005542_3128_3508 | 118 |
| 44 | 3300046533 | Ga0495640_0035507 | Ga0495640_0035507_1059_1439 | 118 |
| 45 | 3300046536 | Ga0495587_0423938 | Ga0495587_0423938_33_413 | 118 |
| 46 | 3300046538 | Ga0495609_0006829 | Ga0495609_0006829_4869_5249 | 118 |
| 47 | 3300046542 | Ga0495597_0033225 | Ga0495597_0033225_1055_1435 | 118 |
| 48 | 3300046557 | Ga0495622_0017176 | Ga0495622_0017176_1791_2171 | 118 |
| 49 | 3300046558 | Ga0495633_0011818 | Ga0495633_0011818_3073_3453 | 118 |
| 50 | 3300046616 | Ga0495668_0004207 | Ga0495668_0004207_2952_3332 | 118 |
| 51 | 3300046642 | Ga0495634_0181205 | Ga0495634_0181205_770_1150 | 118 |
| 52 | 3300046648 | Ga0495611_0009341 | Ga0495611_0009341_834_1214 | 118 |
| 53 | 3300046660 | Ga0495625_0201159 | Ga0495625_0201159_548_928 | 118 |
| 54 | 3300046663 | Ga0495635_0140134 | Ga0495635_0140134_163_543 | 118 |
| 55 | 3300046665 | Ga0495661_0041276 | Ga0495661_0041276_2311_2691 | 118 |
| 56 | 3300046675 | Ga0495657_0056113 | Ga0495657_0056113_256_636 | 118 |
| 57 | 3300046689 | Ga0495613_0097743 | Ga0495613_0097743_533_913 | 118 |
| 58 | 3300046692 | Ga0495671_0150419 | Ga0495671_0150419_17_397 | 118 |
| 59 | 3300046694 | Ga0495649_0096671 | Ga0495649_0096671_861_1241 | 118 |
| 60 | 3300046794 | Ga0495589_0025261 | Ga0495589_0025261_2088_2468 | 118 |
| 61 | 3300046809 | Ga0495600_0017894 | Ga0495600_0017894_1104_1484 | 118 |
| 62 | 3300046810 | Ga0495660_0047021 | Ga0495660_0047021_548_928 | 118 |
| 63 | 3300047315 | Ga0495581_0316673 | Ga0495581_0316673_496_876 | 118 |
| 64 | 3300047317 | Ga0495604_0564827 | Ga0495604_0564827_67_447 | 118 |
| 65 | 3300047318 | Ga0495636_0028303 | Ga0495636_0028303_408_788 | 118 |
| 66 | 3300047319 | Ga0495674_0247568 | Ga0495674_0247568_311_691 | 118 |
| 67 | 3300047320 | Ga0495672_0069255 | Ga0495672_0069255_62_442 | 118 |
| 68 | 3300047321 | Ga0495676_0176177 | Ga0495676_0176177_302_682 | 118 |
| 69 | 3300047322 | Ga0495680_0064591 | Ga0495680_0064591_2096_2476 | 118 |
| 70 | 3300047323 | Ga0495683_0065758 | Ga0495683_0065758_437_817 | 118 |
| 71 | 3300047443 | Ga0495687_130088 | Ga0495687_130088_332_712 | 118 |
| 72 | 3300047444 | Ga0495675_0160521 | Ga0495675_0160521_745_1125 | 118 |
| 73 | 3300047445 | Ga0495677_0200632 | Ga0495677_0200632_144_524 | 118 |
| 74 | 3300047446 | Ga0495679_124801 | Ga0495679_124801_28_408 | 118 |
| 75 | 3300047447 | Ga0495685_014983 | Ga0495685_014983_742_1122 | 118 |
| 76 | 3300047470 | Ga0495681_0013335 | Ga0495681_0013335_3661_4041 | 118 |
| 77 | 3300047472 | Ga0495686_0041878 | Ga0495686_0041878_253_633 | 118 |
| 78 | 3300047673 | Ga0495593_0094638 | Ga0495593_0094638_710_1090 | 118 |
| 79 | 3300048088 | Ga0495602_0076786 | Ga0495602_0076786_1903_2283 | 118 |
| 80 | 3300048089 | Ga0495614_0076837 | Ga0495614_0076837_10_390 | 118 |
| 81 | 3300048089 | Ga0495614_0103977 | Ga0495614_0103977_180_560 | 118 |
| 82 | 3300048091 | Ga0495626_0005908 | Ga0495626_0005908_3973_4353 | 118 |
| 83 | 3300049459 | Ga0495678_033991 | Ga0495678_033991_860_1240 | 118 |
| 84 | 3300049460 | Ga0495682_0180797 | Ga0495682_0180797_155_535 | 118 |
| 85 | 3300049823 | Ga0501044_0407519 | Ga0501044_0407519_899_1255 | 118 |
| 86 | 3300053083 | Ga0495655_0028259 | Ga0495655_0028259_277_675 | 118 |
| 87 | 3300005937 | Ga0081455_10272060 | Ga0081455_102720602 | 119 |
| 88 | 3300005548 | Ga0070665_101837875 | Ga0070665_1018378751 | 120 |
| 89 | 3300006028 | Ga0070717_10605855 | Ga0070717_106058552 | 120 |
| 90 | 3300035171 | Ga0373946_0489242 | Ga0373946_0489242_177_572 | 120 |
| 91 | 3300035725 | Ga0373947_0318801 | Ga0373947_0318801_55_450 | 120 |
| 92 | 3300037068 | Ga0373925_0572838 | Ga0373925_0572838_79_474 | 120 |
| 93 | 3300041404 | Ga0439436_0000684 | Ga0439436_0000684_130_528 | 120 |
| 94 | 3300041406 | Ga0439439_0004438 | Ga0439439_0004438_600_998 | 120 |
| 95 | 3300041999 | Ga0439433_0003511 | Ga0439433_0003511_700_1098 | 120 |
| 96 | 3300042014 | Ga0439457_000086 | Ga0439457_000086_927_1325 | 120 |
| 97 | 3300042015 | Ga0439462_0001927 | Ga0439462_0001927_3410_3808 | 120 |
| 98 | 3300046514 | Ga0495618_0289725 | Ga0495618_0289725_366_761 | 120 |
| 99 | 3300046529 | Ga0495652_0377366 | Ga0495652_0377366_296_691 | 120 |
| 100 | 3300046533 | Ga0495640_0241278 | Ga0495640_0241278_324_719 | 120 |
| 101 | 3300046642 | Ga0495634_0588898 | Ga0495634_0588898_211_606 | 120 |
| 102 | 3300046690 | Ga0495624_0132334 | Ga0495624_0132334_469_864 | 120 |
| 103 | 3300047319 | Ga0495674_0003520 | Ga0495674_0003520_7892_8287 | 120 |
| 104 | 3300048088 | Ga0495602_0647174 | Ga0495602_0647174_24_419 | 120 |
| 105 | 3300037068 | Ga0373925_0003887 | Ga0373925_0003887_40_435 | 121 |
| 106 | 3300037068 | Ga0373925_0636822 | Ga0373925_0636822_225_620 | 121 |
| 107 | 3300046642 | Ga0495634_0280187 | Ga0495634_0280187_381_776 | 121 |
| 108 | 3300047319 | Ga0495674_0010300 | Ga0495674_0010300_4851_5246 | 121 |
| 109 | 3300047444 | Ga0495675_0034800 | Ga0495675_0034800_1870_2265 | 121 |
| 110 | 3300048088 | Ga0495602_0026894 | Ga0495602_0026894_3503_3898 | 121 |
| 111 | 3300053077 | Ga0495601_0416963 | Ga0495601_0416963_397_792 | 121 |
| 112 | 3300053084 | Ga0495595_0029865 | Ga0495595_0029865_382_777 | 121 |
| 113 | 3300035086 | Ga0373934_0020715 | Ga0373934_0020715_77_472 | 123 |
| 114 | 3300035120 | Ga0373957_0092862 | Ga0373957_0092862_795_1190 | 123 |
| 115 | 3300035172 | Ga0373955_0413585 | Ga0373955_0413585_196_591 | 123 |
| 116 | 3300035410 | Ga0373924_0071649 | Ga0373924_0071649_534_929 | 123 |
| 117 | 3300035724 | Ga0373933_0012460 | Ga0373933_0012460_4082_4477 | 123 |
| 118 | 3300036401 | Ga0373937_0008597 | Ga0373937_0008597_2885_3280 | 123 |
| 119 | 3300046454 | Ga0495592_0025661 | Ga0495592_0025661_1277_1672 | 123 |
| 120 | 3300046462 | Ga0495651_0001751 | Ga0495651_0001751_12716_13111 | 123 |
| 121 | 3300046477 | Ga0495664_0087080 | Ga0495664_0087080_1189_1584 | 123 |
| 122 | 3300046511 | Ga0495608_0017719 | Ga0495608_0017719_2307_2702 | 123 |
| 123 | 3300046516 | Ga0495628_0038949 | Ga0495628_0038949_549_944 | 123 |
| 124 | 3300046529 | Ga0495652_0004599 | Ga0495652_0004599_7913_8308 | 123 |
| 125 | 3300046533 | Ga0495640_0115085 | Ga0495640_0115085_834_1229 | 123 |
| 126 | 3300046536 | Ga0495587_0000971 | Ga0495587_0000971_6581_6976 | 123 |
| 127 | 3300046559 | Ga0495667_0000874 | Ga0495667_0000874_10160_10555 | 123 |
| 128 | 3300046663 | Ga0495635_0001572 | Ga0495635_0001572_4756_5151 | 123 |
| 129 | 3300046675 | Ga0495657_0014880 | Ga0495657_0014880_2596_2991 | 123 |
| 130 | 3300046678 | Ga0495599_0025198 | Ga0495599_0025198_2084_2479 | 123 |
| 131 | 3300046679 | Ga0495623_0105459 | Ga0495623_0105459_927_1322 | 123 |
| 132 | 3300046680 | Ga0495646_0237112 | Ga0495646_0237112_146_541 | 123 |
| 133 | 3300046809 | Ga0495600_0000608 | Ga0495600_0000608_10744_11139 | 123 |
| 134 | 3300047317 | Ga0495604_0009632 | Ga0495604_0009632_1025_1420 | 123 |
| 135 | 3300047322 | Ga0495680_0001885 | Ga0495680_0001885_7498_7893 | 123 |
| 136 | 3300047471 | Ga0495684_0008904 | Ga0495684_0008904_62_457 | 123 |
| 137 | 3300053085 | Ga0495619_0012686 | Ga0495619_0012686_1626_2021 | 123 |
| 138 | 3300028381 | Ga0268264_11875096 | Ga0268264_118750961 | 124 |
| 139 | 3300037068 | Ga0373925_0035736 | Ga0373925_0035736_1540_1935 | 124 |
| 140 | 3300013307 | Ga0157372_10496678 | Ga0157372_104966782 | 125 |
| 141 | 3300014325 | Ga0163163_10887502 | Ga0163163_108875022 | 125 |
| 142 | 3300048903 | Ga0496100_1134469 | Ga0496100_1134469_154_531 | 125 |
| 143 | 3300048904 | Ga0496101_0132337 | Ga0496101_0132337_725_1102 | 125 |
| 144 | 3300048905 | Ga0496102_0210403 | Ga0496102_0210403_1366_1743 | 125 |
| 145 | 3300048907 | Ga0496104_0011442 | Ga0496104_0011442_831_1208 | 125 |
| 146 | 3300048908 | Ga0496105_0006593 | Ga0496105_0006593_1021_1398 | 125 |
| 147 | 3300048911 | Ga0496108_0026910 | Ga0496108_0026910_787_1164 | 125 |
| 148 | 3300048912 | Ga0496109_0007106 | Ga0496109_0007106_1856_2233 | 125 |
| 149 | 3300048913 | Ga0496110_0826360 | Ga0496110_0826360_402_779 | 125 |
| 150 | 3300048914 | Ga0496111_1047920 | Ga0496111_1047920_133_510 | 125 |
| 151 | 3300048915 | Ga0496112_0172894 | Ga0496112_0172894_205_582 | 125 |
| 152 | 3300048916 | Ga0496113_0032644 | Ga0496113_0032644_2809_3186 | 125 |
| 153 | 3300048917 | Ga0496114_0593475 | Ga0496114_0593475_120_497 | 125 |
| 154 | 3300048918 | Ga0496115_0776246 | Ga0496115_0776246_331_708 | 125 |
| 155 | 3300050513 | nmdc:mga0rr50_508850_c1 | nmdc:mga0rr50_508850_c1_443_820 | 125 |
| 156 | 3300037466 | Ga0395898_0155358 | Ga0395898_0155358_1568_1948 | 126 |
| 157 | 3300037471 | Ga0395905_0807630 | Ga0395905_0807630_220_600 | 126 |
| 158 | 3300041491 | Ga0451833_0559030 | Ga0451833_0559030_453_833 | 126 |
| 159 | 3300041494 | Ga0451837_0893633 | Ga0451837_0893633_731_1111 | 126 |
| 160 | 3300041505 | Ga0451849_0857728 | Ga0451849_0857728_98_478 | 126 |
| 161 | 3300041512 | Ga0451853_3846188 | Ga0451853_3846188_182_562 | 126 |
| 162 | 3300041999 | Ga0439433_0009175 | Ga0439433_0009175_1181_1561 | 126 |
| 163 | 3300042005 | Ga0439448_0008287 | Ga0439448_0008287_649_1029 | 126 |
| 164 | 3300042005 | Ga0439448_0151261 | Ga0439448_0151261_88_468 | 126 |
| 165 | 3300042011 | Ga0439454_007571 | Ga0439454_007571_375_755 | 126 |
| 166 | 3300042012 | Ga0439455_0000547 | Ga0439455_0000547_3479_3859 | 126 |
| 167 | 3300042122 | Ga0450920_011782 | Ga0450920_011782_274_654 | 126 |
| 168 | 3300042131 | Ga0450894_000248 | Ga0450894_000248_3157_3537 | 126 |
| 169 | 3300042133 | Ga0450896_016078 | Ga0450896_016078_250_630 | 126 |
| 170 | 3300042135 | Ga0450899_000065 | Ga0450899_000065_557_937 | 126 |
| 171 | 3300042137 | Ga0450902_059245 | Ga0450902_059245_82_462 | 126 |
| 172 | 3300042138 | Ga0450903_000221 | Ga0450903_000221_6034_6414 | 126 |
| 173 | 3300042138 | Ga0450903_005187 | Ga0450903_005187_1059_1439 | 126 |
| 174 | 3300042145 | Ga0450906_005432 | Ga0450906_005432_1358_1738 | 126 |
| 175 | 3300042157 | Ga0439458_0002329 | Ga0439458_0002329_1084_1464 | 126 |
| 176 | 3300042184 | Ga0450908_005929 | Ga0450908_005929_1774_2154 | 126 |
| 177 | 3300046454 | Ga0495592_0003676 | Ga0495592_0003676_5659_6039 | 126 |
| 178 | 3300046454 | Ga0495592_0011647 | Ga0495592_0011647_271_651 | 126 |
| 179 | 3300046455 | Ga0495603_0019429 | Ga0495603_0019429_2161_2541 | 126 |
| 180 | 3300046455 | Ga0495603_0026012 | Ga0495603_0026012_1963_2343 | 126 |
| 181 | 3300046455 | Ga0495603_0099555 | Ga0495603_0099555_589_969 | 126 |
| 182 | 3300046459 | Ga0495629_0099100 | Ga0495629_0099100_109_489 | 126 |
| 183 | 3300046459 | Ga0495629_0122125 | Ga0495629_0122125_268_648 | 126 |
| 184 | 3300046459 | Ga0495629_0147699 | Ga0495629_0147699_440_820 | 126 |
| 185 | 3300046462 | Ga0495651_0004593 | Ga0495651_0004593_1142_1522 | 126 |
| 186 | 3300046462 | Ga0495651_0008099 | Ga0495651_0008099_6199_6579 | 126 |
| 187 | 3300046475 | Ga0495639_0005142 | Ga0495639_0005142_3469_3849 | 126 |
| 188 | 3300046476 | Ga0495662_0031746 | Ga0495662_0031746_1413_1793 | 126 |
| 189 | 3300046476 | Ga0495662_0096022 | Ga0495662_0096022_983_1363 | 126 |
| 190 | 3300046476 | Ga0495662_0224819 | Ga0495662_0224819_267_647 | 126 |
| 191 | 3300046477 | Ga0495664_0000982 | Ga0495664_0000982_9280_9660 | 126 |
| 192 | 3300046499 | Ga0495594_0055352 | Ga0495594_0055352_110_490 | 126 |
| 193 | 3300046499 | Ga0495594_0164135 | Ga0495594_0164135_246_626 | 126 |
| 194 | 3300046499 | Ga0495594_0245011 | Ga0495594_0245011_455_835 | 126 |
| 195 | 3300046499 | Ga0495594_0507841 | Ga0495594_0507841_81_461 | 126 |
| 196 | 3300046514 | Ga0495618_0039491 | Ga0495618_0039491_1812_2192 | 126 |
| 197 | 3300046515 | Ga0495620_0107619 | Ga0495620_0107619_486_866 | 126 |
| 198 | 3300046516 | Ga0495628_0227746 | Ga0495628_0227746_992_1372 | 126 |
| 199 | 3300046517 | Ga0495630_0012111 | Ga0495630_0012111_3571_3951 | 126 |
| 200 | 3300046526 | Ga0495666_0068813 | Ga0495666_0068813_676_1056 | 126 |
| 201 | 3300046526 | Ga0495666_0384319 | Ga0495666_0384319_185_565 | 126 |
| 202 | 3300046529 | Ga0495652_0007058 | Ga0495652_0007058_6445_6825 | 126 |
| 203 | 3300046529 | Ga0495652_0076268 | Ga0495652_0076268_993_1373 | 126 |
| 204 | 3300046533 | Ga0495640_0010606 | Ga0495640_0010606_6383_6763 | 126 |
| 205 | 3300046536 | Ga0495587_0008065 | Ga0495587_0008065_760_1140 | 126 |
| 206 | 3300046538 | Ga0495609_0137205 | Ga0495609_0137205_137_517 | 126 |
| 207 | 3300046543 | Ga0495645_0088163 | Ga0495645_0088163_1367_1747 | 126 |
| 208 | 3300046543 | Ga0495645_0115562 | Ga0495645_0115562_1151_1531 | 126 |
| 209 | 3300046557 | Ga0495622_0022160 | Ga0495622_0022160_2148_2528 | 126 |
| 210 | 3300046558 | Ga0495633_0309358 | Ga0495633_0309358_12_392 | 126 |
| 211 | 3300046559 | Ga0495667_0080239 | Ga0495667_0080239_715_1095 | 126 |
| 212 | 3300046615 | Ga0495656_0034061 | Ga0495656_0034061_1654_2034 | 126 |
| 213 | 3300046616 | Ga0495668_0597230 | Ga0495668_0597230_193_573 | 126 |
| 214 | 3300046642 | Ga0495634_0002168 | Ga0495634_0002168_6112_6492 | 126 |
| 215 | 3300046642 | Ga0495634_0260768 | Ga0495634_0260768_372_752 | 126 |
| 216 | 3300046648 | Ga0495611_0323614 | Ga0495611_0323614_72_452 | 126 |
| 217 | 3300046660 | Ga0495625_0073344 | Ga0495625_0073344_1794_2174 | 126 |
| 218 | 3300046660 | Ga0495625_0110897 | Ga0495625_0110897_72_452 | 126 |
| 219 | 3300046660 | Ga0495625_0147263 | Ga0495625_0147263_804_1184 | 126 |
| 220 | 3300046660 | Ga0495625_0414327 | Ga0495625_0414327_54_434 | 126 |
| 221 | 3300046663 | Ga0495635_0010278 | Ga0495635_0010278_983_1363 | 126 |
| 222 | 3300046663 | Ga0495635_0217987 | Ga0495635_0217987_370_750 | 126 |
| 223 | 3300046664 | Ga0495659_0048127 | Ga0495659_0048127_511_891 | 126 |
| 224 | 3300046665 | Ga0495661_0153711 | Ga0495661_0153711_98_478 | 126 |
| 225 | 3300046674 | Ga0495588_0013464 | Ga0495588_0013464_1559_1939 | 126 |
| 226 | 3300046674 | Ga0495588_0063593 | Ga0495588_0063593_1265_1645 | 126 |
| 227 | 3300046674 | Ga0495588_0332117 | Ga0495588_0332117_97_477 | 126 |
| 228 | 3300046675 | Ga0495657_0010270 | Ga0495657_0010270_5184_5564 | 126 |
| 229 | 3300046675 | Ga0495657_0019959 | Ga0495657_0019959_4381_4761 | 126 |
| 230 | 3300046678 | Ga0495599_0137333 | Ga0495599_0137333_905_1285 | 126 |
| 231 | 3300046679 | Ga0495623_0031400 | Ga0495623_0031400_1875_2255 | 126 |
| 232 | 3300046679 | Ga0495623_0698019 | Ga0495623_0698019_27_407 | 126 |
| 233 | 3300046680 | Ga0495646_0047289 | Ga0495646_0047289_1493_1873 | 126 |
| 234 | 3300046683 | Ga0495658_0130813 | Ga0495658_0130813_100_480 | 126 |
| 235 | 3300046689 | Ga0495613_0001401 | Ga0495613_0001401_1707_2087 | 126 |
| 236 | 3300046689 | Ga0495613_0010252 | Ga0495613_0010252_5170_5550 | 126 |
| 237 | 3300046689 | Ga0495613_0077307 | Ga0495613_0077307_1838_2218 | 126 |
| 238 | 3300046690 | Ga0495624_0379456 | Ga0495624_0379456_101_481 | 126 |
| 239 | 3300046692 | Ga0495671_0273986 | Ga0495671_0273986_216_596 | 126 |
| 240 | 3300046692 | Ga0495671_0401508 | Ga0495671_0401508_258_638 | 126 |
| 241 | 3300046694 | Ga0495649_0327196 | Ga0495649_0327196_43_423 | 126 |
| 242 | 3300046794 | Ga0495589_0014878 | Ga0495589_0014878_1673_2053 | 126 |
| 243 | 3300046809 | Ga0495600_0153973 | Ga0495600_0153973_525_905 | 126 |
| 244 | 3300046809 | Ga0495600_0324118 | Ga0495600_0324118_218_598 | 126 |
| 245 | 3300046809 | Ga0495600_0393451 | Ga0495600_0393451_271_651 | 126 |
| 246 | 3300047315 | Ga0495581_0010139 | Ga0495581_0010139_3451_3831 | 126 |
| 247 | 3300047315 | Ga0495581_0211011 | Ga0495581_0211011_61_441 | 126 |
| 248 | 3300047317 | Ga0495604_0008150 | Ga0495604_0008150_4973_5353 | 126 |
| 249 | 3300047317 | Ga0495604_0061583 | Ga0495604_0061583_746_1126 | 126 |
| 250 | 3300047318 | Ga0495636_0007858 | Ga0495636_0007858_2534_2914 | 126 |
| 251 | 3300047318 | Ga0495636_0011299 | Ga0495636_0011299_2259_2639 | 126 |
| 252 | 3300047321 | Ga0495676_0014968 | Ga0495676_0014968_1359_1739 | 126 |
| 253 | 3300047321 | Ga0495676_0038934 | Ga0495676_0038934_3453_3833 | 126 |
| 254 | 3300047321 | Ga0495676_1030334 | Ga0495676_1030334_48_428 | 126 |
| 255 | 3300047443 | Ga0495687_017227 | Ga0495687_017227_2353_2733 | 126 |
| 256 | 3300047443 | Ga0495687_068270 | Ga0495687_068270_589_969 | 126 |
| 257 | 3300047444 | Ga0495675_0019097 | Ga0495675_0019097_3609_3989 | 126 |
| 258 | 3300047444 | Ga0495675_0037771 | Ga0495675_0037771_1902_2282 | 126 |
| 259 | 3300047444 | Ga0495675_0104000 | Ga0495675_0104000_271_651 | 126 |
| 260 | 3300047447 | Ga0495685_003724 | Ga0495685_003724_493_873 | 126 |
| 261 | 3300047447 | Ga0495685_008069 | Ga0495685_008069_1581_1961 | 126 |
| 262 | 3300047447 | Ga0495685_028643 | Ga0495685_028643_1467_1847 | 126 |
| 263 | 3300047447 | Ga0495685_031441 | Ga0495685_031441_146_526 | 126 |
| 264 | 3300047447 | Ga0495685_039951 | Ga0495685_039951_85_465 | 126 |
| 265 | 3300047470 | Ga0495681_0163757 | Ga0495681_0163757_166_546 | 126 |
| 266 | 3300047471 | Ga0495684_0056193 | Ga0495684_0056193_1193_1573 | 126 |
| 267 | 3300047673 | Ga0495593_0028253 | Ga0495593_0028253_779_1159 | 126 |
| 268 | 3300047673 | Ga0495593_0572064 | Ga0495593_0572064_156_536 | 126 |
| 269 | 3300048088 | Ga0495602_0072862 | Ga0495602_0072862_932_1312 | 126 |
| 270 | 3300048089 | Ga0495614_0020793 | Ga0495614_0020793_226_606 | 126 |
| 271 | 3300048089 | Ga0495614_0023309 | Ga0495614_0023309_892_1272 | 126 |
| 272 | 3300048089 | Ga0495614_0251233 | Ga0495614_0251233_373_753 | 126 |
| 273 | 3300048908 | Ga0496105_1018356 | Ga0496105_1018356_19_399 | 126 |
| 274 | 3300048909 | Ga0496106_0446778 | Ga0496106_0446778_42_422 | 126 |
| 275 | 3300048911 | Ga0496108_0474173 | Ga0496108_0474173_517_897 | 126 |
| 276 | 3300048912 | Ga0496109_0212314 | Ga0496109_0212314_747_1127 | 126 |
| 277 | 3300048929 | Ga0496126_1171235 | Ga0496126_1171235_50_430 | 126 |
| 278 | 3300049568 | Ga0501031_0559393 | Ga0501031_0559393_64_444 | 126 |
| 279 | 3300049569 | Ga0501032_0310780 | Ga0501032_0310780_182_562 | 126 |
| 280 | 3300049569 | Ga0501032_0722891 | Ga0501032_0722891_62_442 | 126 |
| 281 | 3300049570 | Ga0501033_0455258 | Ga0501033_0455258_452_832 | 126 |
| 282 | 3300049570 | Ga0501033_0839767 | Ga0501033_0839767_35_415 | 126 |
| 283 | 3300049571 | Ga0501034_1237624 | Ga0501034_1237624_60_440 | 126 |
| 284 | 3300049571 | Ga0501034_1264609 | Ga0501034_1264609_70_450 | 126 |
| 285 | 3300049572 | Ga0501036_0130138 | Ga0501036_0130138_891_1271 | 126 |
| 286 | 3300049573 | Ga0501037_0567526 | Ga0501037_0567526_89_469 | 126 |
| 287 | 3300049573 | Ga0501037_0988702 | Ga0501037_0988702_22_402 | 126 |
| 288 | 3300049574 | Ga0501038_0049772 | Ga0501038_0049772_1533_1913 | 126 |
| 289 | 3300049574 | Ga0501038_0298198 | Ga0501038_0298198_30_410 | 126 |
| 290 | 3300049574 | Ga0501038_0368899 | Ga0501038_0368899_63_443 | 126 |
| 291 | 3300049579 | Ga0501043_0006539 | Ga0501043_0006539_7404_7784 | 126 |
| 292 | 3300049579 | Ga0501043_0074611 | Ga0501043_0074611_2273_2653 | 126 |
| 293 | 3300049581 | Ga0501047_0000309 | Ga0501047_0000309_55435_55815 | 126 |
| 294 | 3300049581 | Ga0501047_0205439 | Ga0501047_0205439_757_1137 | 126 |
| 295 | 3300049581 | Ga0501047_0448019 | Ga0501047_0448019_709_1089 | 126 |
| 296 | 3300049581 | Ga0501047_1018267 | Ga0501047_1018267_218_598 | 126 |
| 297 | 3300049583 | Ga0501067_0679780 | Ga0501067_0679780_86_466 | 126 |
| 298 | 3300049585 | Ga0501069_0290303 | Ga0501069_0290303_125_505 | 126 |
| 299 | 3300049652 | Ga0501202_092090 | Ga0501202_092090_335_715 | 126 |
| 300 | 3300049742 | Ga0501080_0477851 | Ga0501080_0477851_321_701 | 126 |
| 301 | 3300049822 | Ga0501035_0038843 | Ga0501035_0038843_3178_3558 | 126 |
| 302 | 3300049822 | Ga0501035_0102652 | Ga0501035_0102652_217_597 | 126 |
| 303 | 3300049822 | Ga0501035_0330293 | Ga0501035_0330293_54_434 | 126 |
| 304 | 3300049822 | Ga0501035_1044827 | Ga0501035_1044827_198_578 | 126 |
| 305 | 3300049823 | Ga0501044_0011335 | Ga0501044_0011335_9224_9604 | 126 |
| 306 | 3300049823 | Ga0501044_0149727 | Ga0501044_0149727_50_430 | 126 |
| 307 | 3300049823 | Ga0501044_1626955 | Ga0501044_1626955_102_482 | 126 |
| 308 | 3300050490 | nmdc:mga03n38_26447_c1 | nmdc:mga03n38_26447_c1_1397_1777 | 126 |
| 309 | 3300050490 | nmdc:mga03n38_90224_c1 | nmdc:mga03n38_90224_c1_190_570 | 126 |
| 310 | 3300050496 | nmdc:mga07m45_290091_c1 | nmdc:mga07m45_290091_c1_308_688 | 126 |
| 311 | 3300053085 | Ga0495619_0352830 | Ga0495619_0352830_512_892 | 126 |
| 312 | 3300053095 | Ga0500640_018388 | Ga0500640_018388_1379_1759 | 126 |
| 313 | 3300053111 | Ga0500572_020073 | Ga0500572_020073_573_953 | 126 |
| 314 | 3300053123 | Ga0500614_003947 | Ga0500614_003947_1504_1884 | 126 |
| 315 | 3300053140 | Ga0500573_0064507 | Ga0500573_0064507_1052_1432 | 126 |
| 316 | iso_pu_bacteria | 2547132111 | 2547409550 | 128 |
| 317 | iso_pu_bacteria | 2554235005 | 2554258940 | 128 |
| 318 | iso_pu_bacteria | 2582581312 | 2585299834 | 128 |
| 319 | iso_pu_bacteria | 2582581313 | 2585306840 | 128 |
| 320 | iso_pu_bacteria | 2616644814 | 2616694324 | 128 |
| 321 | iso_pu_bacteria | 2616644941 | 2616899469 | 128 |
| 322 | iso_pu_bacteria | 2643221548 | 2643759343 | 128 |
| 323 | iso_pu_bacteria | 2643221587 | 2643945118 | 128 |
| 324 | iso_pu_bacteria | 2643221601 | 2644015064 | 128 |
| 325 | iso_pu_bacteria | 2643221631 | 2644176852 | 128 |
| 326 | iso_pu_bacteria | 2643221647 | 2644265504 | 128 |
| 327 | iso_pu_bacteria | 2643221670 | 2644387350 | 128 |
| 328 | iso_pu_bacteria | 2643221673 | 2644408558 | 128 |
| 329 | iso_pu_bacteria | 2643221677 | 2644432017 | 128 |
| 330 | iso_pu_bacteria | 2643221678 | 2644435819 | 128 |
| 331 | iso_pu_bacteria | 2643221682 | 2644463239 | 128 |
| 332 | iso_pu_bacteria | 2643221714 | 2644629354 | 128 |
| 333 | iso_pu_bacteria | 2784132148 | 2784587423 | 128 |
| 334 | iso_pu_bacteria | 2784746763 | 2785344906 | 128 |
| 335 | iso_pu_bacteria | 2784746768 | 2785367971 | 128 |
| 336 | iso_pu_bacteria | 2786546132 | 2786669022 | 128 |
| 337 | iso_pu_bacteria | 2791355406 | 2793981926 | 128 |
| 338 | iso_pu_bacteria | 2808606359 | 2808840630 | 128 |
| 339 | iso_pu_bacteria | 2808606375 | 2808919213 | 128 |
| 340 | iso_pu_bacteria | 2808606448 | 2809230996 | 128 |
| 341 | iso_pu_bacteria | 2808606982 | 2811847640 | 128 |
| 342 | iso_pu_bacteria | 2811994879 | 2812359551 | 128 |
| 343 | iso_pu_bacteria | 2818991463 | 2819694078 | 128 |
| 344 | iso_pu_bacteria | 2818991472 | 2819743215 | 128 |
| 345 | iso_pu_bacteria | 2862178590 | 2862182909 | 128 |
| 346 | iso_pu_bacteria | 2862281513 | 2862288643 | 128 |
| 347 | iso_pu_bacteria | 2862382967 | 2862384707 | 128 |
| 348 | iso_pu_bacteria | 2863404153 | 2863406169 | 128 |
| 349 | iso_pu_bacteria | 2867428634 | 2867432592 | 128 |
| 350 | iso_pu_bacteria | 2867475112 | 2867477560 | 128 |
| 351 | iso_pu_bacteria | 2873151551 | 2873156980 | 128 |
| 352 | iso_pu_bacteria | 2875391855 | 2875393357 | 128 |
| 353 | iso_pu_bacteria | 2877676314 | 2877682573 | 128 |
| 354 | iso_pu_bacteria | 2912723979 | 2912725445 | 128 |
| 355 | iso_pu_bacteria | 2912757875 | 2912759547 | 128 |
| 356 | iso_pu_bacteria | 2918501144 | 2918503230 | 128 |
| 357 | iso_pu_bacteria | 2919468124 | 2919468180 | 128 |
| 358 | iso_pu_bacteria | 2935390628 | 2935395955 | 128 |
| 359 | iso_pu_bacteria | 2946045630 | 2946051335 | 128 |
| 360 | iso_pu_bacteria | 2946064051 | 2946066359 | 128 |
| 361 | iso_pu_bacteria | 2946072368 | 2946074624 | 128 |
| 362 | iso_pu_bacteria | 2947224130 | 2947231016 | 128 |
| 363 | iso_pu_bacteria | 2954002825 | 2954004325 | 128 |
| 364 | iso_pu_bacteria | 2954380949 | 2954387770 | 128 |
| 365 | iso_pu_bacteria | 2954673503 | 2954675305 | 128 |
| 366 | iso_pu_bacteria | 2954682443 | 2954688828 | 128 |
| 367 | iso_pu_bacteria | 2954691527 | 2954698582 | 128 |
| 368 | iso_pu_bacteria | 2954701450 | 2954703643 | 128 |
| 369 | iso_pu_bacteria | 2954711539 | 2954717556 | 128 |
| 370 | iso_pu_bacteria | 2954721474 | 2954727520 | 128 |
| 371 | iso_pu_bacteria | 2954731030 | 2954734280 | 128 |
| 372 | iso_pu_bacteria | 2954740390 | 2954746416 | 128 |
| 373 | iso_pu_bacteria | 2954749733 | 2954753164 | 128 |
| 374 | iso_pu_bacteria | 2954759201 | 2954765531 | 128 |
| 375 | iso_pu_bacteria | 2966598605 | 2966603702 | 128 |
| 376 | iso_pu_bacteria | 2990088156 | 2990088442 | 128 |
| 377 | iso_pu_bacteria | 2997451912 | 2997458507 | 128 |
| 378 | iso_pu_bacteria | 2997600082 | 2997606550 | 128 |
| 379 | iso_pu_bacteria | 3006321560 | 3006322475 | 128 |
| 380 | iso_pu_bacteria | 3006393351 | 3006395113 | 128 |
| 381 | iso_pu_bacteria | 3006425503 | 3006427693 | 128 |
| 382 | iso_pu_bacteria | 3006486233 | 3006489171 | 128 |
| 383 | iso_pu_bacteria | 8008558824 | 8008562146 | 128 |
| 384 | iso_pu_bacteria | 8008574985 | 8008580042 | 128 |
| 385 | iso_pu_bacteria | 8023623736 | 8023627465 | 128 |
| 386 | iso_pu_bacteria | 8025413630 | 8025414078 | 128 |
| 387 | iso_pu_bacteria | 8025478263 | 8025485902 | 128 |
| 388 | iso_pu_bacteria | 8025530807 | 8025534788 | 128 |
| 389 | iso_pu_bacteria | 8033684223 | 8033689685 | 128 |
| 390 | iso_pu_bacteria | 8047893842 | 8047899577 | 128 |
| 391 | iso_pu_bacteria | 8048127548 | 8048136203 | 128 |
| 392 | iso_pu_bacteria | 8048356638 | 8048359352 | 128 |
| 393 | iso_pu_bacteria | 8048369669 | 8048376527 | 128 |
| 394 | iso_pu_bacteria | 8048379754 | 8048385580 | 128 |
| 395 | iso_pu_bacteria | 8048406513 | 8048409010 | 128 |
| 396 | iso_pu_bacteria | 8054160619 | 8054167291 | 128 |
| 397 | iso_pu_bacteria | 8056447290 | 8056449797 | 128 |
| 398 | iso_pu_bacteria | 8056667051 | 8056672460 | 128 |
| 399 | iso_pu_bacteria | 8056829672 | 8056835875 | 128 |
| 400 | 3300041486 | Ga0451807_1437455 | Ga0451807_1437455_130_522 | 130 |
| 401 | 3300005329 | Ga0070683_100232527 | Ga0070683_1002325272 | 131 |
| 402 | 3300005330 | Ga0070690_100157618 | Ga0070690_1001576182 | 131 |
| 403 | 3300005335 | Ga0070666_10782452 | Ga0070666_107824521 | 131 |
| 404 | 3300005338 | Ga0068868_100096697 | Ga0068868_1000966972 | 131 |
| 405 | 3300005341 | Ga0070691_10121304 | Ga0070691_101213042 | 131 |
| 406 | 3300005356 | Ga0070674_100815649 | Ga0070674_1008156491 | 131 |
| 407 | 3300005435 | Ga0070714_100415010 | Ga0070714_1004150102 | 131 |
| 408 | 3300005435 | Ga0070714_101168693 | Ga0070714_1011686932 | 131 |
| 409 | 3300005436 | Ga0070713_101329880 | Ga0070713_1013298802 | 131 |
| 410 | 3300005436 | Ga0070713_101566211 | Ga0070713_1015662111 | 131 |
| 411 | 3300005437 | Ga0070710_10063880 | Ga0070710_100638802 | 131 |
| 412 | 3300005437 | Ga0070710_10070403 | Ga0070710_100704032 | 131 |
| 413 | 3300005437 | Ga0070710_10156338 | Ga0070710_101563382 | 131 |
| 414 | 3300005438 | Ga0070701_10193181 | Ga0070701_101931812 | 131 |
| 415 | 3300005439 | Ga0070711_100682644 | Ga0070711_1006826442 | 131 |
| 416 | 3300005439 | Ga0070711_100745177 | Ga0070711_1007451771 | 131 |
| 417 | 3300005440 | Ga0070705_100539722 | Ga0070705_1005397222 | 131 |
| 418 | 3300005440 | Ga0070705_101339695 | Ga0070705_1013396951 | 131 |
| 419 | 3300005441 | Ga0070700_100734676 | Ga0070700_1007346762 | 131 |
| 420 | 3300005444 | Ga0070694_100270047 | Ga0070694_1002700472 | 131 |
| 421 | 3300005445 | Ga0070708_100773111 | Ga0070708_1007731111 | 131 |
| 422 | 3300005455 | Ga0070663_100285765 | Ga0070663_1002857652 | 131 |
| 423 | 3300005455 | Ga0070663_101060980 | Ga0070663_1010609802 | 131 |
| 424 | 3300005456 | Ga0070678_100472609 | Ga0070678_1004726092 | 131 |
| 425 | 3300005458 | Ga0070681_10748763 | Ga0070681_107487632 | 131 |
| 426 | 3300005468 | Ga0070707_100250493 | Ga0070707_1002504933 | 131 |
| 427 | 3300005468 | Ga0070707_101001633 | Ga0070707_1010016331 | 131 |
| 428 | 3300005518 | Ga0070699_100980870 | Ga0070699_1009808702 | 131 |
| 429 | 3300005530 | Ga0070679_100373511 | Ga0070679_1003735112 | 131 |
| 430 | 3300005536 | Ga0070697_101284011 | Ga0070697_1012840111 | 131 |
| 431 | 3300005539 | Ga0068853_100688180 | Ga0068853_1006881802 | 131 |
| 432 | 3300005539 | Ga0068853_101611655 | Ga0068853_1016116552 | 131 |
| 433 | 3300005544 | Ga0070686_101096939 | Ga0070686_1010969391 | 131 |
| 434 | 3300005545 | Ga0070695_100218855 | Ga0070695_1002188552 | 131 |
| 435 | 3300005546 | Ga0070696_101077107 | Ga0070696_1010771071 | 131 |
| 436 | 3300005547 | Ga0070693_100638548 | Ga0070693_1006385481 | 131 |
| 437 | 3300005548 | Ga0070665_100654524 | Ga0070665_1006545242 | 131 |
| 438 | 3300005548 | Ga0070665_101914105 | Ga0070665_1019141051 | 131 |
| 439 | 3300005549 | Ga0070704_100515381 | Ga0070704_1005153811 | 131 |
| 440 | 3300005563 | Ga0068855_100256677 | Ga0068855_1002566772 | 131 |
| 441 | 3300005577 | Ga0068857_100552564 | Ga0068857_1005525642 | 131 |
| 442 | 3300005578 | Ga0068854_101474545 | Ga0068854_1014745451 | 131 |
| 443 | 3300005614 | Ga0068856_100199674 | Ga0068856_1001996742 | 131 |
| 444 | 3300005614 | Ga0068856_100220181 | Ga0068856_1002201813 | 131 |
| 445 | 3300005614 | Ga0068856_100314133 | Ga0068856_1003141332 | 131 |
| 446 | 3300005614 | Ga0068856_100710313 | Ga0068856_1007103132 | 131 |
| 447 | 3300005616 | Ga0068852_101175869 | Ga0068852_1011758692 | 131 |
| 448 | 3300005617 | Ga0068859_100581934 | Ga0068859_1005819342 | 131 |
| 449 | 3300005618 | Ga0068864_100185388 | Ga0068864_1001853882 | 131 |
| 450 | 3300005618 | Ga0068864_100395102 | Ga0068864_1003951022 | 131 |
| 451 | 3300005841 | Ga0068863_101399911 | Ga0068863_1013999111 | 131 |
| 452 | 3300005842 | Ga0068858_100168938 | Ga0068858_1001689381 | 131 |
| 453 | 3300005843 | Ga0068860_100169169 | Ga0068860_1001691692 | 131 |
| 454 | 3300006028 | Ga0070717_10145929 | Ga0070717_101459292 | 131 |
| 455 | 3300006028 | Ga0070717_10152638 | Ga0070717_101526383 | 131 |
| 456 | 3300006028 | Ga0070717_10416878 | Ga0070717_104168782 | 131 |
| 457 | 3300006028 | Ga0070717_10431826 | Ga0070717_104318262 | 131 |
| 458 | 3300006028 | Ga0070717_11551942 | Ga0070717_115519422 | 131 |
| 459 | 3300006163 | Ga0070715_10136968 | Ga0070715_101369682 | 131 |
| 460 | 3300006173 | Ga0070716_100021613 | Ga0070716_1000216132 | 131 |
| 461 | 3300006173 | Ga0070716_100116385 | Ga0070716_1001163853 | 131 |
| 462 | 3300006173 | Ga0070716_100998583 | Ga0070716_1009985831 | 131 |
| 463 | 3300006175 | Ga0070712_100175413 | Ga0070712_1001754132 | 131 |
| 464 | 3300006175 | Ga0070712_101735317 | Ga0070712_1017353171 | 131 |
| 465 | 3300006237 | Ga0097621_100035028 | Ga0097621_1000350284 | 131 |
| 466 | 3300006358 | Ga0068871_100549517 | Ga0068871_1005495171 | 131 |
| 467 | 3300006852 | Ga0075433_10228262 | Ga0075433_102282622 | 131 |
| 468 | 3300006871 | Ga0075434_100303322 | Ga0075434_1003033222 | 131 |
| 469 | 3300006914 | Ga0075436_100341639 | Ga0075436_1003416392 | 131 |
| 470 | 3300006931 | Ga0097620_100581946 | Ga0097620_1005819462 | 131 |
| 471 | 3300007076 | Ga0075435_100328982 | Ga0075435_1003289822 | 131 |
| 472 | 3300007076 | Ga0075435_100479819 | Ga0075435_1004798192 | 131 |
| 473 | 3300009098 | Ga0105245_10205700 | Ga0105245_102057003 | 131 |
| 474 | 3300009101 | Ga0105247_10041300 | Ga0105247_100413002 | 131 |
| 475 | 3300009101 | Ga0105247_11405408 | Ga0105247_114054081 | 131 |
| 476 | 3300009147 | Ga0114129_10419267 | Ga0114129_104192672 | 131 |
| 477 | 3300009177 | Ga0105248_10082744 | Ga0105248_100827443 | 131 |
| 478 | 3300009551 | Ga0105238_10063263 | Ga0105238_100632631 | 131 |
| 479 | 3300010375 | Ga0105239_10877518 | Ga0105239_108775182 | 131 |
| 480 | 3300013100 | Ga0157373_10369307 | Ga0157373_103693071 | 131 |
| 481 | 3300013104 | Ga0157370_10246205 | Ga0157370_102462052 | 131 |
| 482 | 3300013105 | Ga0157369_10243976 | Ga0157369_102439762 | 131 |
| 483 | 3300013296 | Ga0157374_10029298 | Ga0157374_100292985 | 131 |
| 484 | 3300013297 | Ga0157378_11055785 | Ga0157378_110557852 | 131 |
| 485 | 3300013306 | Ga0163162_10473298 | Ga0163162_104732982 | 131 |
| 486 | 3300013307 | Ga0157372_10165322 | Ga0157372_101653222 | 131 |
| 487 | 3300013307 | Ga0157372_10600373 | Ga0157372_106003732 | 131 |
| 488 | 3300013308 | Ga0157375_10911352 | Ga0157375_109113521 | 131 |
| 489 | 3300014325 | Ga0163163_10374178 | Ga0163163_103741781 | 131 |
| 490 | 3300014968 | Ga0157379_10408996 | Ga0157379_104089963 | 131 |
| 491 | 3300014969 | Ga0157376_10438083 | Ga0157376_104380833 | 131 |
| 492 | 3300014969 | Ga0157376_11472922 | Ga0157376_114729221 | 131 |
| 493 | 3300020082 | Ga0206353_11194541 | Ga0206353_111945411 | 131 |
| 494 | 3300022467 | Ga0224712_10214579 | Ga0224712_102145792 | 131 |
| 495 | 3300025898 | Ga0207692_10035420 | Ga0207692_100354202 | 131 |
| 496 | 3300025898 | Ga0207692_10130107 | Ga0207692_101301073 | 131 |
| 497 | 3300025900 | Ga0207710_10139366 | Ga0207710_101393661 | 131 |
| 498 | 3300025903 | Ga0207680_10350480 | Ga0207680_103504802 | 131 |
| 499 | 3300025905 | Ga0207685_10000617 | Ga0207685_100006178 | 131 |
| 500 | 3300025905 | Ga0207685_10021217 | Ga0207685_100212174 | 131 |
| 501 | 3300025906 | Ga0207699_10016013 | Ga0207699_100160136 | 131 |
| 502 | 3300025906 | Ga0207699_10050003 | Ga0207699_100500032 | 131 |
| 503 | 3300025906 | Ga0207699_10080229 | Ga0207699_100802292 | 131 |
| 504 | 3300025912 | Ga0207707_10839142 | Ga0207707_108391421 | 131 |
| 505 | 3300025915 | Ga0207693_10305562 | Ga0207693_103055621 | 131 |
| 506 | 3300025915 | Ga0207693_10670823 | Ga0207693_106708232 | 131 |
| 507 | 3300025916 | Ga0207663_10042260 | Ga0207663_100422602 | 131 |
| 508 | 3300025916 | Ga0207663_10468322 | Ga0207663_104683221 | 131 |
| 509 | 3300025921 | Ga0207652_10217722 | Ga0207652_102177222 | 131 |
| 510 | 3300025922 | Ga0207646_10343557 | Ga0207646_103435573 | 131 |
| 511 | 3300025922 | Ga0207646_10821819 | Ga0207646_108218191 | 131 |
| 512 | 3300025924 | Ga0207694_10074643 | Ga0207694_100746433 | 131 |
| 513 | 3300025927 | Ga0207687_10291719 | Ga0207687_102917192 | 131 |
| 514 | 3300025928 | Ga0207700_10040668 | Ga0207700_100406682 | 131 |
| 515 | 3300025928 | Ga0207700_10177676 | Ga0207700_101776762 | 131 |
| 516 | 3300025928 | Ga0207700_10362385 | Ga0207700_103623851 | 131 |
| 517 | 3300025928 | Ga0207700_10370502 | Ga0207700_103705022 | 131 |
| 518 | 3300025928 | Ga0207700_11615974 | Ga0207700_116159742 | 131 |
| 519 | 3300025929 | Ga0207664_10002431 | Ga0207664_100024318 | 131 |
| 520 | 3300025929 | Ga0207664_10293459 | Ga0207664_102934592 | 131 |
| 521 | 3300025937 | Ga0207669_10580090 | Ga0207669_105800902 | 131 |
| 522 | 3300025939 | Ga0207665_10005691 | Ga0207665_100056918 | 131 |
| 523 | 3300025939 | Ga0207665_10069009 | Ga0207665_100690092 | 131 |
| 524 | 3300025939 | Ga0207665_10107304 | Ga0207665_101073041 | 131 |
| 525 | 3300025941 | Ga0207711_10033686 | Ga0207711_100336865 | 131 |
| 526 | 3300025949 | Ga0207667_10259757 | Ga0207667_102597572 | 131 |
| 527 | 3300026035 | Ga0207703_10197920 | Ga0207703_101979202 | 131 |
| 528 | 3300026041 | Ga0207639_10621962 | Ga0207639_106219622 | 131 |
| 529 | 3300026067 | Ga0207678_10961883 | Ga0207678_109618832 | 131 |
| 530 | 3300026075 | Ga0207708_11233702 | Ga0207708_112337021 | 131 |
| 531 | 3300026078 | Ga0207702_10172594 | Ga0207702_101725942 | 131 |
| 532 | 3300026078 | Ga0207702_10516387 | Ga0207702_105163872 | 131 |
| 533 | 3300026088 | Ga0207641_12570403 | Ga0207641_125704031 | 131 |
| 534 | 3300026095 | Ga0207676_10113816 | Ga0207676_101138163 | 131 |
| 535 | 3300026116 | Ga0207674_10416833 | Ga0207674_104168332 | 131 |
| 536 | 3300026121 | Ga0207683_10735870 | Ga0207683_107358701 | 131 |
| 537 | 3300026142 | Ga0207698_10727885 | Ga0207698_107278851 | 131 |
| 538 | 3300028379 | Ga0268266_10656977 | Ga0268266_106569772 | 131 |
| 539 | 3300028379 | Ga0268266_11959708 | Ga0268266_119597081 | 131 |
| 540 | 3300028381 | Ga0268264_10188299 | Ga0268264_101882992 | 131 |
| 541 | 3300034819 | Ga0373958_0019233 | Ga0373958_0019233_841_1236 | 131 |
| 542 | 3300034819 | Ga0373958_0099970 | Ga0373958_0099970_77_472 | 131 |
| 543 | 3300034957 | Ga0373938_0222684 | Ga0373938_0222684_17_412 | 131 |
| 544 | 3300035084 | Ga0373928_0086852 | Ga0373928_0086852_206_601 | 131 |
| 545 | 3300035088 | Ga0373940_0001079 | Ga0373940_0001079_3369_3764 | 131 |
| 546 | 3300035089 | Ga0373944_0035080 | Ga0373944_0035080_1015_1410 | 131 |
| 547 | 3300035089 | Ga0373944_0037257 | Ga0373944_0037257_510_905 | 131 |
| 548 | 3300035090 | Ga0373949_0247144 | Ga0373949_0247144_55_450 | 131 |
| 549 | 3300035111 | Ga0373923_0058642 | Ga0373923_0058642_98_493 | 131 |
| 550 | 3300035111 | Ga0373923_0100581 | Ga0373923_0100581_394_789 | 131 |
| 551 | 3300035111 | Ga0373923_0695930 | Ga0373923_0695930_65_460 | 131 |
| 552 | 3300035112 | Ga0373932_0121483 | Ga0373932_0121483_243_638 | 131 |
| 553 | 3300035113 | Ga0373936_0043708 | Ga0373936_0043708_1133_1528 | 131 |
| 554 | 3300035114 | Ga0373939_0023720 | Ga0373939_0023720_104_499 | 131 |
| 555 | 3300035117 | Ga0373953_0078809 | Ga0373953_0078809_85_480 | 131 |
| 556 | 3300035118 | Ga0373954_0053801 | Ga0373954_0053801_1066_1461 | 131 |
| 557 | 3300035118 | Ga0373954_0181928 | Ga0373954_0181928_70_465 | 131 |
| 558 | 3300035119 | Ga0373956_0142941 | Ga0373956_0142941_64_459 | 131 |
| 559 | 3300035120 | Ga0373957_0009130 | Ga0373957_0009130_1559_1954 | 131 |
| 560 | 3300035120 | Ga0373957_0013939 | Ga0373957_0013939_1766_2161 | 131 |
| 561 | 3300035170 | Ga0373943_0035744 | Ga0373943_0035744_766_1161 | 131 |
| 562 | 3300035170 | Ga0373943_0112152 | Ga0373943_0112152_839_1234 | 131 |
| 563 | 3300035170 | Ga0373943_0251485 | Ga0373943_0251485_91_486 | 131 |
| 564 | 3300035171 | Ga0373946_0038220 | Ga0373946_0038220_328_723 | 131 |
| 565 | 3300035172 | Ga0373955_0075849 | Ga0373955_0075849_40_435 | 131 |
| 566 | 3300035207 | Ga0373942_0046238 | Ga0373942_0046238_471_866 | 131 |
| 567 | 3300035241 | Ga0373961_0004920 | Ga0373961_0004920_2798_3193 | 131 |
| 568 | 3300035242 | Ga0373962_0102583 | Ga0373962_0102583_360_755 | 131 |
| 569 | 3300035410 | Ga0373924_0005316 | Ga0373924_0005316_2745_3140 | 131 |
| 570 | 3300035410 | Ga0373924_0140211 | Ga0373924_0140211_102_497 | 131 |
| 571 | 3300035691 | Ga0373931_0004178 | Ga0373931_0004178_454_849 | 131 |
| 572 | 3300035691 | Ga0373931_0908804 | Ga0373931_0908804_32_427 | 131 |
| 573 | 3300035692 | Ga0373935_0237812 | Ga0373935_0237812_265_660 | 131 |
| 574 | 3300035695 | Ga0373927_0269358 | Ga0373927_0269358_228_623 | 131 |
| 575 | 3300035724 | Ga0373933_0035789 | Ga0373933_0035789_1066_1461 | 131 |
| 576 | 3300035725 | Ga0373947_0385115 | Ga0373947_0385115_471_866 | 131 |
| 577 | 3300035725 | Ga0373947_0933184 | Ga0373947_0933184_118_513 | 131 |
| 578 | 3300036401 | Ga0373937_0104649 | Ga0373937_0104649_1363_1758 | 131 |
| 579 | 3300036401 | Ga0373937_0267986 | Ga0373937_0267986_1108_1503 | 131 |
| 580 | 3300036459 | Ga0372808_013077 | Ga0372808_013077_349_744 | 131 |
| 581 | 3300037068 | Ga0373925_0176576 | Ga0373925_0176576_1063_1458 | 131 |
| 582 | 3300037068 | Ga0373925_0812223 | Ga0373925_0812223_22_417 | 131 |
| 583 | 3300041512 | Ga0451853_1793210 | Ga0451853_1793210_28_423 | 131 |
| 584 | 3300046454 | Ga0495592_0012279 | Ga0495592_0012279_3430_3825 | 131 |
| 585 | 3300046455 | Ga0495603_0328122 | Ga0495603_0328122_273_668 | 131 |
| 586 | 3300046459 | Ga0495629_0062319 | Ga0495629_0062319_1390_1785 | 131 |
| 587 | 3300046459 | Ga0495629_0123116 | Ga0495629_0123116_157_552 | 131 |
| 588 | 3300046459 | Ga0495629_0146099 | Ga0495629_0146099_844_1239 | 131 |
| 589 | 3300046461 | Ga0495641_0013023 | Ga0495641_0013023_256_651 | 131 |
| 590 | 3300046462 | Ga0495651_0039883 | Ga0495651_0039883_2078_2473 | 131 |
| 591 | 3300046462 | Ga0495651_0327337 | Ga0495651_0327337_276_671 | 131 |
| 592 | 3300046462 | Ga0495651_0443265 | Ga0495651_0443265_19_414 | 131 |
| 593 | 3300046463 | Ga0495653_0098376 | Ga0495653_0098376_1363_1758 | 131 |
| 594 | 3300046463 | Ga0495653_0408537 | Ga0495653_0408537_45_440 | 131 |
| 595 | 3300046463 | Ga0495653_0603440 | Ga0495653_0603440_260_655 | 131 |
| 596 | 3300046472 | Ga0495580_0211751 | Ga0495580_0211751_795_1190 | 131 |
| 597 | 3300046473 | Ga0495582_0068408 | Ga0495582_0068408_510_905 | 131 |
| 598 | 3300046473 | Ga0495582_0614406 | Ga0495582_0614406_75_470 | 131 |
| 599 | 3300046475 | Ga0495639_0562663 | Ga0495639_0562663_143_538 | 131 |
| 600 | 3300046476 | Ga0495662_0037224 | Ga0495662_0037224_833_1228 | 131 |
| 601 | 3300046476 | Ga0495662_0148741 | Ga0495662_0148741_402_797 | 131 |
| 602 | 3300046477 | Ga0495664_0007816 | Ga0495664_0007816_474_869 | 131 |
| 603 | 3300046477 | Ga0495664_0046058 | Ga0495664_0046058_340_735 | 131 |
| 604 | 3300046499 | Ga0495594_0544064 | Ga0495594_0544064_76_471 | 131 |
| 605 | 3300046511 | Ga0495608_0014967 | Ga0495608_0014967_3542_3937 | 131 |
| 606 | 3300046511 | Ga0495608_0031694 | Ga0495608_0031694_2259_2654 | 131 |
| 607 | 3300046514 | Ga0495618_0162245 | Ga0495618_0162245_478_873 | 131 |
| 608 | 3300046514 | Ga0495618_0225666 | Ga0495618_0225666_569_964 | 131 |
| 609 | 3300046516 | Ga0495628_0114002 | Ga0495628_0114002_1293_1688 | 131 |
| 610 | 3300046517 | Ga0495630_0058843 | Ga0495630_0058843_1826_2221 | 131 |
| 611 | 3300046517 | Ga0495630_0134639 | Ga0495630_0134639_322_717 | 131 |
| 612 | 3300046529 | Ga0495652_0022098 | Ga0495652_0022098_2843_3238 | 131 |
| 613 | 3300046529 | Ga0495652_0149665 | Ga0495652_0149665_580_975 | 131 |
| 614 | 3300046529 | Ga0495652_0189384 | Ga0495652_0189384_955_1350 | 131 |
| 615 | 3300046529 | Ga0495652_0335179 | Ga0495652_0335179_114_509 | 131 |
| 616 | 3300046531 | Ga0495665_0109325 | Ga0495665_0109325_955_1350 | 131 |
| 617 | 3300046531 | Ga0495665_0478440 | Ga0495665_0478440_102_497 | 131 |
| 618 | 3300046533 | Ga0495640_0014287 | Ga0495640_0014287_2839_3234 | 131 |
| 619 | 3300046533 | Ga0495640_0038056 | Ga0495640_0038056_826_1221 | 131 |
| 620 | 3300046535 | Ga0495586_0105937 | Ga0495586_0105937_62_457 | 131 |
| 621 | 3300046536 | Ga0495587_0007439 | Ga0495587_0007439_2842_3237 | 131 |
| 622 | 3300046536 | Ga0495587_0063365 | Ga0495587_0063365_1216_1611 | 131 |
| 623 | 3300046543 | Ga0495645_0108753 | Ga0495645_0108753_484_879 | 131 |
| 624 | 3300046543 | Ga0495645_0161733 | Ga0495645_0161733_552_947 | 131 |
| 625 | 3300046543 | Ga0495645_0262773 | Ga0495645_0262773_138_533 | 131 |
| 626 | 3300046543 | Ga0495645_0345696 | Ga0495645_0345696_247_642 | 131 |
| 627 | 3300046559 | Ga0495667_0099233 | Ga0495667_0099233_580_975 | 131 |
| 628 | 3300046559 | Ga0495667_0202979 | Ga0495667_0202979_484_879 | 131 |
| 629 | 3300046559 | Ga0495667_0405671 | Ga0495667_0405671_125_520 | 131 |
| 630 | 3300046642 | Ga0495634_0023741 | Ga0495634_0023741_1088_1483 | 131 |
| 631 | 3300046642 | Ga0495634_0096457 | Ga0495634_0096457_1236_1631 | 131 |
| 632 | 3300046663 | Ga0495635_0037557 | Ga0495635_0037557_2868_3263 | 131 |
| 633 | 3300046675 | Ga0495657_0087213 | Ga0495657_0087213_1114_1509 | 131 |
| 634 | 3300046675 | Ga0495657_0517831 | Ga0495657_0517831_190_585 | 131 |
| 635 | 3300046678 | Ga0495599_0015242 | Ga0495599_0015242_1763_2158 | 131 |
| 636 | 3300046678 | Ga0495599_0026500 | Ga0495599_0026500_2849_3244 | 131 |
| 637 | 3300046679 | Ga0495623_0034303 | Ga0495623_0034303_32_427 | 131 |
| 638 | 3300046679 | Ga0495623_0107473 | Ga0495623_0107473_890_1285 | 131 |
| 639 | 3300046680 | Ga0495646_0047994 | Ga0495646_0047994_253_648 | 131 |
| 640 | 3300046680 | Ga0495646_0108644 | Ga0495646_0108644_620_1015 | 131 |
| 641 | 3300046681 | Ga0495647_0027655 | Ga0495647_0027655_1647_2042 | 131 |
| 642 | 3300046681 | Ga0495647_0075628 | Ga0495647_0075628_55_450 | 131 |
| 643 | 3300046683 | Ga0495658_0064629 | Ga0495658_0064629_1322_1717 | 131 |
| 644 | 3300046689 | Ga0495613_0102531 | Ga0495613_0102531_1597_1992 | 131 |
| 645 | 3300046690 | Ga0495624_0068630 | Ga0495624_0068630_1159_1554 | 131 |
| 646 | 3300046690 | Ga0495624_0085813 | Ga0495624_0085813_422_817 | 131 |
| 647 | 3300046809 | Ga0495600_0142036 | Ga0495600_0142036_95_490 | 131 |
| 648 | 3300047315 | Ga0495581_0042806 | Ga0495581_0042806_1234_1629 | 131 |
| 649 | 3300047315 | Ga0495581_0138433 | Ga0495581_0138433_593_988 | 131 |
| 650 | 3300047317 | Ga0495604_0042455 | Ga0495604_0042455_1259_1654 | 131 |
| 651 | 3300047317 | Ga0495604_0081264 | Ga0495604_0081264_770_1165 | 131 |
| 652 | 3300047319 | Ga0495674_0120696 | Ga0495674_0120696_350_745 | 131 |
| 653 | 3300047319 | Ga0495674_0146574 | Ga0495674_0146574_604_999 | 131 |
| 654 | 3300047319 | Ga0495674_0195350 | Ga0495674_0195350_904_1299 | 131 |
| 655 | 3300047321 | Ga0495676_0140359 | Ga0495676_0140359_467_862 | 131 |
| 656 | 3300047321 | Ga0495676_0707702 | Ga0495676_0707702_128_523 | 131 |
| 657 | 3300047322 | Ga0495680_0026400 | Ga0495680_0026400_1458_1853 | 131 |
| 658 | 3300047322 | Ga0495680_0075219 | Ga0495680_0075219_387_782 | 131 |
| 659 | 3300047444 | Ga0495675_0087256 | Ga0495675_0087256_133_528 | 131 |
| 660 | 3300047444 | Ga0495675_0118855 | Ga0495675_0118855_1139_1534 | 131 |
| 661 | 3300047471 | Ga0495684_0012338 | Ga0495684_0012338_2767_3162 | 131 |
| 662 | 3300047471 | Ga0495684_0072549 | Ga0495684_0072549_806_1201 | 131 |
| 663 | 3300047471 | Ga0495684_0148003 | Ga0495684_0148003_528_923 | 131 |
| 664 | 3300047471 | Ga0495684_0233778 | Ga0495684_0233778_514_909 | 131 |
| 665 | 3300047673 | Ga0495593_0048248 | Ga0495593_0048248_1206_1601 | 131 |
| 666 | 3300047673 | Ga0495593_0537526 | Ga0495593_0537526_11_406 | 131 |
| 667 | 3300048088 | Ga0495602_0088568 | Ga0495602_0088568_2164_2559 | 131 |
| 668 | 3300048088 | Ga0495602_0134846 | Ga0495602_0134846_1153_1548 | 131 |
| 669 | 3300048903 | Ga0496100_0253128 | Ga0496100_0253128_743_1138 | 131 |
| 670 | 3300048903 | Ga0496100_0358053 | Ga0496100_0358053_476_871 | 131 |
| 671 | 3300048904 | Ga0496101_0107467 | Ga0496101_0107467_1241_1636 | 131 |
| 672 | 3300048904 | Ga0496101_0284848 | Ga0496101_0284848_44_439 | 131 |
| 673 | 3300048905 | Ga0496102_0058401 | Ga0496102_0058401_475_870 | 131 |
| 674 | 3300048905 | Ga0496102_1454266 | Ga0496102_1454266_171_566 | 131 |
| 675 | 3300048906 | Ga0496103_0236902 | Ga0496103_0236902_226_621 | 131 |
| 676 | 3300048907 | Ga0496104_0015675 | Ga0496104_0015675_3840_4235 | 131 |
| 677 | 3300048907 | Ga0496104_0093665 | Ga0496104_0093665_624_1019 | 131 |
| 678 | 3300048908 | Ga0496105_0003685 | Ga0496105_0003685_10490_10885 | 131 |
| 679 | 3300048908 | Ga0496105_0093819 | Ga0496105_0093819_687_1082 | 131 |
| 680 | 3300048909 | Ga0496106_0765174 | Ga0496106_0765174_73_468 | 131 |
| 681 | 3300048910 | Ga0496107_0327601 | Ga0496107_0327601_617_1012 | 131 |
| 682 | 3300048911 | Ga0496108_0097924 | Ga0496108_0097924_1216_1611 | 131 |
| 683 | 3300048911 | Ga0496108_0169951 | Ga0496108_0169951_1165_1560 | 131 |
| 684 | 3300048912 | Ga0496109_0098430 | Ga0496109_0098430_2292_2687 | 131 |
| 685 | 3300048912 | Ga0496109_0239622 | Ga0496109_0239622_125_520 | 131 |
| 686 | 3300048913 | Ga0496110_0484661 | Ga0496110_0484661_617_1012 | 131 |
| 687 | 3300048914 | Ga0496111_0314994 | Ga0496111_0314994_334_729 | 131 |
| 688 | 3300048915 | Ga0496112_0035310 | Ga0496112_0035310_3038_3433 | 131 |
| 689 | 3300048915 | Ga0496112_0374359 | Ga0496112_0374359_469_864 | 131 |
| 690 | 3300048916 | Ga0496113_0071570 | Ga0496113_0071570_718_1113 | 131 |
| 691 | 3300048916 | Ga0496113_0080300 | Ga0496113_0080300_1529_1924 | 131 |
| 692 | 3300048917 | Ga0496114_0008917 | Ga0496114_0008917_1887_2282 | 131 |
| 693 | 3300048918 | Ga0496115_0011366 | Ga0496115_0011366_5540_5935 | 131 |
| 694 | 3300050507 | nmdc:mga05p37_444118_c2 | nmdc:mga05p37_444118_c2_427_822 | 131 |
| 695 | 3300050512 | nmdc:mga0n895_242638_c1 | nmdc:mga0n895_242638_c1_853_1248 | 131 |
| 696 | 3300050513 | nmdc:mga0rr50_448446_c1 | nmdc:mga0rr50_448446_c1_566_961 | 131 |
| 697 | 3300050513 | nmdc:mga0rr50_918139_c1 | nmdc:mga0rr50_918139_c1_99_494 | 131 |
| 698 | 3300050514 | nmdc:mga08x19_74811_c1 | nmdc:mga08x19_74811_c1_481_876 | 131 |
| 699 | 3300050515 | nmdc:mga0a205_398235_c1 | nmdc:mga0a205_398235_c1_653_1048 | 131 |
| 700 | 3300053077 | Ga0495601_0031633 | Ga0495601_0031633_1980_2375 | 131 |
| 701 | 3300053077 | Ga0495601_0468132 | Ga0495601_0468132_204_599 | 131 |
| 702 | 3300053078 | Ga0495612_0073855 | Ga0495612_0073855_91_486 | 131 |
| 703 | 3300053084 | Ga0495595_0014625 | Ga0495595_0014625_92_487 | 131 |
| 704 | 3300053084 | Ga0495595_0022285 | Ga0495595_0022285_2109_2504 | 131 |
| 705 | 3300053085 | Ga0495619_0016508 | Ga0495619_0016508_3732_4127 | 131 |
| 706 | 3300053085 | Ga0495619_0153739 | Ga0495619_0153739_380_775 | 131 |
| 707 | 3300001989 | JGI24739J22299_10027731 | JGI24739J22299_100277312 | 132 |
| 708 | 3300001990 | JGI24737J22298_10042112 | JGI24737J22298_100421122 | 132 |
| 709 | 3300002067 | JGI24735J21928_10026388 | JGI24735J21928_100263882 | 132 |
| 710 | 3300003323 | rootH1_10005189 | rootH1_100051892 | 132 |
| 711 | 3300003578 | Ga0006562J51391_1053590 | Ga0006562J51391_10535901 | 132 |
| 712 | 3300005471 | Ga0070698_101818939 | Ga0070698_1018189391 | 132 |
| 713 | 3300005539 | Ga0068853_100048731 | Ga0068853_1000487312 | 132 |
| 714 | 3300005548 | Ga0070665_100521721 | Ga0070665_1005217212 | 132 |
| 715 | 3300005937 | Ga0081455_10004015 | Ga0081455_1000401519 | 132 |
| 716 | 3300006042 | Ga0075368_10004269 | Ga0075368_100042695 | 132 |
| 717 | 3300006048 | Ga0075363_100293472 | Ga0075363_1002934722 | 132 |
| 718 | 3300006178 | Ga0075367_10001041 | Ga0075367_100010414 | 132 |
| 719 | 3300006353 | Ga0075370_10301153 | Ga0075370_103011532 | 132 |
| 720 | 3300006948 | Ga0099826_10026285 | Ga0099826_100262854 | 132 |
| 721 | 3300009011 | Ga0105251_10128141 | Ga0105251_101281412 | 132 |
| 722 | 3300009036 | Ga0105244_10346535 | Ga0105244_103465352 | 132 |
| 723 | 3300009092 | Ga0105250_10005086 | Ga0105250_100050868 | 132 |
| 724 | 3300009098 | Ga0105245_11536281 | Ga0105245_115362812 | 132 |
| 725 | 3300009101 | Ga0105247_10172002 | Ga0105247_101720021 | 132 |
| 726 | 3300009148 | Ga0105243_10107336 | Ga0105243_101073362 | 132 |
| 727 | 3300009148 | Ga0105243_10557269 | Ga0105243_105572692 | 132 |
| 728 | 3300009174 | Ga0105241_10969262 | Ga0105241_109692622 | 132 |
| 729 | 3300009174 | Ga0105241_12052820 | Ga0105241_120528202 | 132 |
| 730 | 3300009551 | Ga0105238_12642113 | Ga0105238_126421131 | 132 |
| 731 | 3300010375 | Ga0105239_10972158 | Ga0105239_109721582 | 132 |
| 732 | 3300011119 | Ga0105246_10120144 | Ga0105246_101201442 | 132 |
| 733 | 3300013105 | Ga0157369_10718912 | Ga0157369_107189122 | 132 |
| 734 | 3300013306 | Ga0163162_10832576 | Ga0163162_108325762 | 132 |
| 735 | 3300014497 | Ga0182008_10001919 | Ga0182008_100019195 | 132 |
| 736 | 3300014969 | Ga0157376_10611808 | Ga0157376_106118082 | 132 |
| 737 | 3300015262 | Ga0182007_10000425 | Ga0182007_1000042514 | 132 |
| 738 | 3300015688 | Ga0183367_1007 | Ga0183367_1007464 | 132 |
| 739 | 3300020610 | Ga0154015_1326935 | Ga0154015_13269352 | 132 |
| 740 | 3300025302 | Ga0207426_1038873 | Ga0207426_10388732 | 132 |
| 741 | 3300025302 | Ga0207426_1040298 | Ga0207426_10402982 | 132 |
| 742 | 3300025303 | Ga0209051_1087522 | Ga0209051_10875222 | 132 |
| 743 | 3300025735 | Ga0207713_1010515 | Ga0207713_10105152 | 132 |
| 744 | 3300025735 | Ga0207713_1159922 | Ga0207713_11599222 | 132 |
| 745 | 3300025904 | Ga0207647_10149420 | Ga0207647_101494202 | 132 |
| 746 | 3300025912 | Ga0207707_10638188 | Ga0207707_106381882 | 132 |
| 747 | 3300025933 | Ga0207706_11594896 | Ga0207706_115948961 | 132 |
| 748 | 3300025935 | Ga0207709_10277773 | Ga0207709_102777732 | 132 |
| 749 | 3300025940 | Ga0207691_11519283 | Ga0207691_115192831 | 132 |
| 750 | 3300025941 | Ga0207711_11466409 | Ga0207711_114664091 | 132 |
| 751 | 3300025945 | Ga0207679_10319438 | Ga0207679_103194382 | 132 |
| 752 | 3300025949 | Ga0207667_10595109 | Ga0207667_105951092 | 132 |
| 753 | 3300026041 | Ga0207639_10030736 | Ga0207639_100307365 | 132 |
| 754 | 3300026067 | Ga0207678_10540379 | Ga0207678_105403792 | 132 |
| 755 | 3300026078 | Ga0207702_10851324 | Ga0207702_108513242 | 132 |
| 756 | 3300027312 | Ga0209371_1010314 | Ga0209371_10103142 | 132 |
| 757 | 3300027866 | Ga0209813_10021207 | Ga0209813_100212072 | 132 |
| 758 | 3300028794 | Ga0307515_10051203 | Ga0307515_100512037 | 132 |
| 759 | 3300028794 | Ga0307515_10062832 | Ga0307515_100628326 | 132 |
| 760 | 3300030500 | Ga0268256_1008374 | Ga0268256_10083743 | 132 |
| 761 | 3300030521 | Ga0307511_10018496 | Ga0307511_100184962 | 132 |
| 762 | 3300030521 | Ga0307511_10056944 | Ga0307511_100569444 | 132 |
| 763 | 3300030522 | Ga0307512_10025397 | Ga0307512_100253974 | 132 |
| 764 | 3300030522 | Ga0307512_10058758 | Ga0307512_100587582 | 132 |
| 765 | 3300030522 | Ga0307512_10065236 | Ga0307512_100652362 | 132 |
| 766 | 3300030736 | Ga0316180_1060732 | Ga0316180_10607322 | 132 |
| 767 | 3300031456 | Ga0307513_10009259 | Ga0307513_100092595 | 132 |
| 768 | 3300031456 | Ga0307513_10161317 | Ga0307513_101613172 | 132 |
| 769 | 3300031507 | Ga0307509_10343363 | Ga0307509_103433632 | 132 |
| 770 | 3300031548 | Ga0307408_101825482 | Ga0307408_1018254822 | 132 |
| 771 | 3300031616 | Ga0307508_10002091 | Ga0307508_100020915 | 132 |
| 772 | 3300031616 | Ga0307508_10043552 | Ga0307508_100435522 | 132 |
| 773 | 3300031616 | Ga0307508_10338976 | Ga0307508_103389762 | 132 |
| 774 | 3300031616 | Ga0307508_10571558 | Ga0307508_105715582 | 132 |
| 775 | 3300031649 | Ga0307514_10014518 | Ga0307514_100145182 | 132 |
| 776 | 3300031649 | Ga0307514_10067194 | Ga0307514_100671943 | 132 |
| 777 | 3300031649 | Ga0307514_10201513 | Ga0307514_102015132 | 132 |
| 778 | 3300031649 | Ga0307514_10371278 | Ga0307514_103712782 | 132 |
| 779 | 3300031730 | Ga0307516_10016056 | Ga0307516_100160564 | 132 |
| 780 | 3300031730 | Ga0307516_10037709 | Ga0307516_100377092 | 132 |
| 781 | 3300031730 | Ga0307516_10151570 | Ga0307516_101515703 | 132 |
| 782 | 3300031838 | Ga0307518_10192527 | Ga0307518_101925272 | 132 |
| 783 | 3300031838 | Ga0307518_10243780 | Ga0307518_102437802 | 132 |
| 784 | 3300031838 | Ga0307518_10351766 | Ga0307518_103517662 | 132 |
| 785 | 3300032002 | Ga0307416_100426561 | Ga0307416_1004265611 | 132 |
| 786 | 3300033179 | Ga0307507_10028139 | Ga0307507_100281392 | 132 |
| 787 | 3300033179 | Ga0307507_10076087 | Ga0307507_100760872 | 132 |
| 788 | 3300033180 | Ga0307510_10052729 | Ga0307510_100527293 | 132 |
| 789 | 3300033180 | Ga0307510_10084655 | Ga0307510_100846552 | 132 |
| 790 | 3300033180 | Ga0307510_10183090 | Ga0307510_101830902 | 132 |
| 791 | 3300037418 | Ga0395900_0037246 | Ga0395900_0037246_2210_2608 | 132 |
| 792 | 3300037466 | Ga0395898_0010509 | Ga0395898_0010509_1423_1821 | 132 |
| 793 | 3300037853 | Ga0436364_1320712 | Ga0436364_1320712_1047_1445 | 132 |
| 794 | 3300038443 | Ga0395901_0645693 | Ga0395901_0645693_545_943 | 132 |
| 795 | 3300039437 | Ga0436365_0264669 | Ga0436365_0264669_110_508 | 132 |
| 796 | 3300041404 | Ga0439436_0023985 | Ga0439436_0023985_558_956 | 132 |
| 797 | 3300041410 | Ga0439461_0128202 | Ga0439461_0128202_85_483 | 132 |
| 798 | 3300041456 | Ga0451795_1608725 | Ga0451795_1608725_190_588 | 132 |
| 799 | 3300041460 | Ga0451802_1590620 | Ga0451802_1590620_89_487 | 132 |
| 800 | 3300041492 | Ga0451835_0505362 | Ga0451835_0505362_453_851 | 132 |
| 801 | 3300041511 | Ga0451855_0456396 | Ga0451855_0456396_72_470 | 132 |
| 802 | 3300041512 | Ga0451853_1170256 | Ga0451853_1170256_2423_2821 | 132 |
| 803 | 3300042007 | Ga0439449_0000137 | Ga0439449_0000137_16196_16594 | 132 |
| 804 | 3300042014 | Ga0439457_001245 | Ga0439457_001245_6003_6401 | 132 |
| 805 | 3300042016 | Ga0439463_109550 | Ga0439463_109550_133_531 | 132 |
| 806 | 3300042127 | Ga0450890_012694 | Ga0450890_012694_416_814 | 132 |
| 807 | 3300042129 | Ga0450891_025705 | Ga0450891_025705_94_492 | 132 |
| 808 | 3300042131 | Ga0450894_025227 | Ga0450894_025227_191_589 | 132 |
| 809 | 3300042136 | Ga0450900_011926 | Ga0450900_011926_310_708 | 132 |
| 810 | 3300042136 | Ga0450900_055118 | Ga0450900_055118_159_557 | 132 |
| 811 | 3300044656 | Ga0466969_0003967 | Ga0466969_0003967_1285_1683 | 132 |
| 812 | 3300044658 | Ga0466972_0000586 | Ga0466972_0000586_5499_5897 | 132 |
| 813 | 3300044658 | Ga0466972_0059584 | Ga0466972_0059584_617_1015 | 132 |
| 814 | 3300044658 | Ga0466972_0076241 | Ga0466972_0076241_1144_1542 | 132 |
| 815 | 3300044683 | Ga0466965_0040477 | Ga0466965_0040477_733_1131 | 132 |
| 816 | 3300044683 | Ga0466965_0165588 | Ga0466965_0165588_507_905 | 132 |
| 817 | 3300044683 | Ga0466965_0700579 | Ga0466965_0700579_80_478 | 132 |
| 818 | 3300044684 | Ga0466966_0001630 | Ga0466966_0001630_12577_12975 | 132 |
| 819 | 3300044684 | Ga0466966_0016908 | Ga0466966_0016908_2913_3311 | 132 |
| 820 | 3300044684 | Ga0466966_0031052 | Ga0466966_0031052_161_559 | 132 |
| 821 | 3300044693 | Ga0466961_0030602 | Ga0466961_0030602_3013_3411 | 132 |
| 822 | 3300044693 | Ga0466961_0047105 | Ga0466961_0047105_1472_1870 | 132 |
| 823 | 3300044693 | Ga0466961_0058538 | Ga0466961_0058538_1886_2284 | 132 |
| 824 | 3300044693 | Ga0466961_0146856 | Ga0466961_0146856_346_744 | 132 |
| 825 | 3300044694 | Ga0466963_0216315 | Ga0466963_0216315_208_606 | 132 |
| 826 | 3300044719 | Ga0466971_0011446 | Ga0466971_0011446_60_458 | 132 |
| 827 | 3300044719 | Ga0466971_0043028 | Ga0466971_0043028_622_1020 | 132 |
| 828 | 3300044719 | Ga0466971_0101053 | Ga0466971_0101053_462_860 | 132 |
| 829 | 3300044719 | Ga0466971_0642434 | Ga0466971_0642434_24_422 | 132 |
| 830 | 3300044735 | Ga0466968_0102081 | Ga0466968_0102081_303_701 | 132 |
| 831 | 3300044765 | Ga0466970_0190797 | Ga0466970_0190797_620_1018 | 132 |
| 832 | 3300044842 | Ga0466957_0341484 | Ga0466957_0341484_357_755 | 132 |
| 833 | 3300044901 | Ga0466960_0001090 | Ga0466960_0001090_3322_3720 | 132 |
| 834 | 3300045049 | Ga0466959_0073199 | Ga0466959_0073199_1479_1877 | 132 |
| 835 | 3300045049 | Ga0466959_0128681 | Ga0466959_0128681_956_1354 | 132 |
| 836 | 3300045836 | Ga0466958_0232159 | Ga0466958_0232159_35_433 | 132 |
| 837 | 3300045976 | Ga0466967_1098385 | Ga0466967_1098385_137_535 | 132 |
| 838 | 3300045976 | Ga0466967_1522486 | Ga0466967_1522486_146_544 | 132 |
| 839 | 3300046455 | Ga0495603_0010502 | Ga0495603_0010502_4054_4452 | 132 |
| 840 | 3300046455 | Ga0495603_0012292 | Ga0495603_0012292_1679_2077 | 132 |
| 841 | 3300046459 | Ga0495629_0018737 | Ga0495629_0018737_2251_2649 | 132 |
| 842 | 3300046459 | Ga0495629_0056356 | Ga0495629_0056356_1950_2348 | 132 |
| 843 | 3300046459 | Ga0495629_0060769 | Ga0495629_0060769_818_1216 | 132 |
| 844 | 3300046499 | Ga0495594_0000785 | Ga0495594_0000785_14539_14937 | 132 |
| 845 | 3300046517 | Ga0495630_0216798 | Ga0495630_0216798_50_448 | 132 |
| 846 | 3300046523 | Ga0495644_0210247 | Ga0495644_0210247_144_542 | 132 |
| 847 | 3300046535 | Ga0495586_0319506 | Ga0495586_0319506_40_456 | 132 |
| 848 | 3300046557 | Ga0495622_0030211 | Ga0495622_0030211_709_1107 | 132 |
| 849 | 3300046648 | Ga0495611_0074377 | Ga0495611_0074377_148_546 | 132 |
| 850 | 3300046663 | Ga0495635_1056134 | Ga0495635_1056134_103_501 | 132 |
| 851 | 3300046674 | Ga0495588_0028011 | Ga0495588_0028011_815_1213 | 132 |
| 852 | 3300046674 | Ga0495588_0071193 | Ga0495588_0071193_150_566 | 132 |
| 853 | 3300046675 | Ga0495657_0021076 | Ga0495657_0021076_2817_3215 | 132 |
| 854 | 3300046679 | Ga0495623_0065181 | Ga0495623_0065181_1701_2117 | 132 |
| 855 | 3300046689 | Ga0495613_0157302 | Ga0495613_0157302_1128_1526 | 132 |
| 856 | 3300046694 | Ga0495649_0193731 | Ga0495649_0193731_550_948 | 132 |
| 857 | 3300046794 | Ga0495589_0107837 | Ga0495589_0107837_438_836 | 132 |
| 858 | 3300047315 | Ga0495581_0081713 | Ga0495581_0081713_1462_1860 | 132 |
| 859 | 3300047317 | Ga0495604_0003209 | Ga0495604_0003209_3401_3817 | 132 |
| 860 | 3300047318 | Ga0495636_0044515 | Ga0495636_0044515_1027_1425 | 132 |
| 861 | 3300047318 | Ga0495636_0112676 | Ga0495636_0112676_490_888 | 132 |
| 862 | 3300047321 | Ga0495676_0018421 | Ga0495676_0018421_2353_2751 | 132 |
| 863 | 3300047321 | Ga0495676_0046083 | Ga0495676_0046083_1143_1541 | 132 |
| 864 | 3300047443 | Ga0495687_194059 | Ga0495687_194059_43_441 | 132 |
| 865 | 3300047444 | Ga0495675_0054126 | Ga0495675_0054126_305_721 | 132 |
| 866 | 3300047444 | Ga0495675_0628417 | Ga0495675_0628417_72_488 | 132 |
| 867 | 3300047447 | Ga0495685_057602 | Ga0495685_057602_35_451 | 132 |
| 868 | 3300048089 | Ga0495614_0033404 | Ga0495614_0033404_68_466 | 132 |
| 869 | 3300048905 | Ga0496102_0495841 | Ga0496102_0495841_542_940 | 132 |
| 870 | 3300048909 | Ga0496106_0644613 | Ga0496106_0644613_208_606 | 132 |
| 871 | 3300049527 | Ga0501311_096093 | Ga0501311_096093_69_467 | 132 |
| 872 | 3300049534 | Ga0501318_000189 | Ga0501318_000189_14_412 | 132 |
| 873 | 3300049539 | Ga0501323_001026 | Ga0501323_001026_1823_2239 | 132 |
| 874 | 3300049568 | Ga0501031_0026414 | Ga0501031_0026414_1857_2255 | 132 |
| 875 | 3300049569 | Ga0501032_0000349 | Ga0501032_0000349_35094_35492 | 132 |
| 876 | 3300049569 | Ga0501032_0069477 | Ga0501032_0069477_1424_1822 | 132 |
| 877 | 3300049569 | Ga0501032_0346450 | Ga0501032_0346450_245_643 | 132 |
| 878 | 3300049570 | Ga0501033_0001339 | Ga0501033_0001339_20801_21199 | 132 |
| 879 | 3300049570 | Ga0501033_0009633 | Ga0501033_0009633_1820_2218 | 132 |
| 880 | 3300049570 | Ga0501033_0243176 | Ga0501033_0243176_206_604 | 132 |
| 881 | 3300049570 | Ga0501033_0356168 | Ga0501033_0356168_213_611 | 132 |
| 882 | 3300049571 | Ga0501034_0004152 | Ga0501034_0004152_4535_4933 | 132 |
| 883 | 3300049571 | Ga0501034_0035276 | Ga0501034_0035276_4600_4998 | 132 |
| 884 | 3300049571 | Ga0501034_0202166 | Ga0501034_0202166_1500_1898 | 132 |
| 885 | 3300049571 | Ga0501034_0552735 | Ga0501034_0552735_611_1009 | 132 |
| 886 | 3300049571 | Ga0501034_0564858 | Ga0501034_0564858_201_599 | 132 |
| 887 | 3300049571 | Ga0501034_0613390 | Ga0501034_0613390_557_955 | 132 |
| 888 | 3300049572 | Ga0501036_0006306 | Ga0501036_0006306_7844_8242 | 132 |
| 889 | 3300049572 | Ga0501036_0060167 | Ga0501036_0060167_361_759 | 132 |
| 890 | 3300049572 | Ga0501036_0068833 | Ga0501036_0068833_1141_1539 | 132 |
| 891 | 3300049572 | Ga0501036_0086095 | Ga0501036_0086095_439_837 | 132 |
| 892 | 3300049572 | Ga0501036_0211188 | Ga0501036_0211188_1087_1485 | 132 |
| 893 | 3300049573 | Ga0501037_0002432 | Ga0501037_0002432_8684_9082 | 132 |
| 894 | 3300049573 | Ga0501037_0014083 | Ga0501037_0014083_4101_4499 | 132 |
| 895 | 3300049573 | Ga0501037_0052437 | Ga0501037_0052437_2396_2794 | 132 |
| 896 | 3300049574 | Ga0501038_0043175 | Ga0501038_0043175_213_611 | 132 |
| 897 | 3300049574 | Ga0501038_0057499 | Ga0501038_0057499_1687_2085 | 132 |
| 898 | 3300049574 | Ga0501038_0069712 | Ga0501038_0069712_2279_2677 | 132 |
| 899 | 3300049574 | Ga0501038_1035449 | Ga0501038_1035449_11_409 | 132 |
| 900 | 3300049575 | Ga0501039_0022674 | Ga0501039_0022674_334_732 | 132 |
| 901 | 3300049575 | Ga0501039_0038335 | Ga0501039_0038335_1163_1561 | 132 |
| 902 | 3300049575 | Ga0501039_0125698 | Ga0501039_0125698_33_431 | 132 |
| 903 | 3300049575 | Ga0501039_0351286 | Ga0501039_0351286_581_979 | 132 |
| 904 | 3300049576 | Ga0501040_0067123 | Ga0501040_0067123_1930_2328 | 132 |
| 905 | 3300049577 | Ga0501041_0001346 | Ga0501041_0001346_8520_8918 | 132 |
| 906 | 3300049578 | Ga0501042_0032462 | Ga0501042_0032462_212_610 | 132 |
| 907 | 3300049578 | Ga0501042_0048306 | Ga0501042_0048306_1207_1605 | 132 |
| 908 | 3300049579 | Ga0501043_0003089 | Ga0501043_0003089_9041_9439 | 132 |
| 909 | 3300049579 | Ga0501043_0048534 | Ga0501043_0048534_600_998 | 132 |
| 910 | 3300049579 | Ga0501043_0223916 | Ga0501043_0223916_240_638 | 132 |
| 911 | 3300049579 | Ga0501043_0797401 | Ga0501043_0797401_149_547 | 132 |
| 912 | 3300049580 | Ga0501046_0068069 | Ga0501046_0068069_182_580 | 132 |
| 913 | 3300049580 | Ga0501046_0076664 | Ga0501046_0076664_978_1376 | 132 |
| 914 | 3300049580 | Ga0501046_0826353 | Ga0501046_0826353_187_585 | 132 |
| 915 | 3300049581 | Ga0501047_0042376 | Ga0501047_0042376_617_1015 | 132 |
| 916 | 3300049581 | Ga0501047_0091888 | Ga0501047_0091888_1582_1980 | 132 |
| 917 | 3300049581 | Ga0501047_0105413 | Ga0501047_0105413_186_584 | 132 |
| 918 | 3300049581 | Ga0501047_0169900 | Ga0501047_0169900_1477_1875 | 132 |
| 919 | 3300049581 | Ga0501047_0177716 | Ga0501047_0177716_1383_1781 | 132 |
| 920 | 3300049581 | Ga0501047_0532151 | Ga0501047_0532151_541_939 | 132 |
| 921 | 3300049582 | Ga0501048_0002495 | Ga0501048_0002495_9041_9439 | 132 |
| 922 | 3300049582 | Ga0501048_0017248 | Ga0501048_0017248_3079_3477 | 132 |
| 923 | 3300049582 | Ga0501048_0430340 | Ga0501048_0430340_448_846 | 132 |
| 924 | 3300049583 | Ga0501067_0646671 | Ga0501067_0646671_173_571 | 132 |
| 925 | 3300049584 | Ga0501068_0005639 | Ga0501068_0005639_2058_2456 | 132 |
| 926 | 3300049584 | Ga0501068_0746242 | Ga0501068_0746242_227_625 | 132 |
| 927 | 3300049585 | Ga0501069_0003348 | Ga0501069_0003348_7796_8194 | 132 |
| 928 | 3300049586 | Ga0501070_0012774 | Ga0501070_0012774_4528_4926 | 132 |
| 929 | 3300049586 | Ga0501070_0415375 | Ga0501070_0415375_432_830 | 132 |
| 930 | 3300049586 | Ga0501070_0423887 | Ga0501070_0423887_17_415 | 132 |
| 931 | 3300049586 | Ga0501070_0714758 | Ga0501070_0714758_181_579 | 132 |
| 932 | 3300049586 | Ga0501070_1006935 | Ga0501070_1006935_61_459 | 132 |
| 933 | 3300049588 | Ga0501072_0021693 | Ga0501072_0021693_4511_4909 | 132 |
| 934 | 3300049589 | Ga0501073_0005694 | Ga0501073_0005694_7412_7810 | 132 |
| 935 | 3300049589 | Ga0501073_0312185 | Ga0501073_0312185_69_467 | 132 |
| 936 | 3300049590 | Ga0501074_0003000 | Ga0501074_0003000_3853_4251 | 132 |
| 937 | 3300049590 | Ga0501074_0046313 | Ga0501074_0046313_1356_1754 | 132 |
| 938 | 3300049591 | Ga0501075_0261223 | Ga0501075_0261223_738_1136 | 132 |
| 939 | 3300049664 | Ga0501224_044829 | Ga0501224_044829_183_581 | 132 |
| 940 | 3300049669 | Ga0501235_032051 | Ga0501235_032051_313_711 | 132 |
| 941 | 3300049741 | Ga0501079_1132531 | Ga0501079_1132531_153_551 | 132 |
| 942 | 3300049742 | Ga0501080_1218819 | Ga0501080_1218819_55_453 | 132 |
| 943 | 3300049744 | Ga0501083_0002475 | Ga0501083_0002475_4570_4968 | 132 |
| 944 | 3300049778 | Ga0501282_017244 | Ga0501282_017244_205_603 | 132 |
| 945 | 3300049822 | Ga0501035_0000922 | Ga0501035_0000922_2927_3325 | 132 |
| 946 | 3300049822 | Ga0501035_0005042 | Ga0501035_0005042_5634_6032 | 132 |
| 947 | 3300049822 | Ga0501035_0010143 | Ga0501035_0010143_6373_6771 | 132 |
| 948 | 3300049822 | Ga0501035_0290273 | Ga0501035_0290273_783_1181 | 132 |
| 949 | 3300049822 | Ga0501035_0361878 | Ga0501035_0361878_372_770 | 132 |
| 950 | 3300049822 | Ga0501035_1005156 | Ga0501035_1005156_203_601 | 132 |
| 951 | 3300049823 | Ga0501044_0002906 | Ga0501044_0002906_14729_15127 | 132 |
| 952 | 3300049823 | Ga0501044_0007526 | Ga0501044_0007526_2598_2996 | 132 |
| 953 | 3300049823 | Ga0501044_0014904 | Ga0501044_0014904_2818_3216 | 132 |
| 954 | 3300049823 | Ga0501044_0087413 | Ga0501044_0087413_884_1282 | 132 |
| 955 | 3300049823 | Ga0501044_0167174 | Ga0501044_0167174_72_470 | 132 |
| 956 | 3300049823 | Ga0501044_0216255 | Ga0501044_0216255_1424_1822 | 132 |
| 957 | 3300049823 | Ga0501044_0324772 | Ga0501044_0324772_789_1187 | 132 |
| 958 | 3300049823 | Ga0501044_0509746 | Ga0501044_0509746_25_423 | 132 |
| 959 | 3300049823 | Ga0501044_1155847 | Ga0501044_1155847_42_440 | 132 |
| 960 | 3300049823 | Ga0501044_1192379 | Ga0501044_1192379_42_440 | 132 |
| 961 | 3300049824 | Ga0501045_0147786 | Ga0501045_0147786_342_740 | 132 |
| 962 | 3300050490 | nmdc:mga03n38_35383_c1 | nmdc:mga03n38_35383_c1_1664_2062 | 132 |
| 963 | 3300050492 | nmdc:mga0yw44_45338_c1 | nmdc:mga0yw44_45338_c1_815_1213 | 132 |
| 964 | 3300050494 | nmdc:mga06z11_1574_c1 | nmdc:mga06z11_1574_c1_7536_7934 | 132 |
| 965 | 3300050495 | nmdc:mga04h51_59290_c1 | nmdc:mga04h51_59290_c1_560_958 | 132 |
| 966 | 3300050496 | nmdc:mga07m45_55352_c2 | nmdc:mga07m45_55352_c2_1084_1482 | 132 |
| 967 | 3300053140 | Ga0500573_0182924 | Ga0500573_0182924_614_1012 | 132 |
| 968 | 3300054114 | Ga0501084_0323501 | Ga0501084_0323501_725_1123 | 132 |
| 969 | 3300060353 | Ga0501082_0884263 | Ga0501082_0884263_339_737 | 132 |
| 970 | 3300061719 | Ga0466962_0000908 | Ga0466962_0000908_4304_4702 | 132 |
| 971 | 3300061719 | Ga0466962_0150123 | Ga0466962_0150123_703_1101 | 132 |
| 972 | 3300061719 | Ga0466962_0340479 | Ga0466962_0340479_41_439 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar