F487148

General Info

Members Datasets Scaffolds Average Seq Length
972 485 888 128

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10557269|Ga0105243_105572692
Length 138
Sequence MKEQGKIFLGFAVFILAMAITYGIWTSKSDIGFEAAGTTALVLAFGLCAMIGYYLAFTARRVDSGAGDNPEAEVADDAGELGFFAPHSWQPLALAIGGALAFCGVIFGWWLLWWSLPIILIGLYGWVFEFYRGEDQNQ

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
10 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
19 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
20 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
21 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
22 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
23 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
24 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
25 2808606448 Streptomyces sp. 193411 Isolate Unclassified
26 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
27 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
28 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
29 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
30 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
31 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
32 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
33 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
34 2867428634 Streptomyces sp. RP5T Isolate Unclassified
35 2867475112 Streptomyces sp. TM32 Isolate Unclassified
36 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
37 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
38 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
39 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
40 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
41 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
42 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
43 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
44 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
45 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
46 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
47 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
48 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
49 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
50 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
51 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
52 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
53 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
54 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
55 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
56 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
57 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
58 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
59 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
60 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
61 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
62 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
63 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
64 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
65 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
66 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
67 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
68 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
69 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
70 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
71 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
72 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
73 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
74 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
75 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
81 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
82 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
83 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
84 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
85 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
86 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
87 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
88 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
99 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
157 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
203 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
206 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
220 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
221 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
256 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
257 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
258 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
262 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
263 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
264 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
265 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
268 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
269 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
270 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
271 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
272 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
273 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
274 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
275 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
276 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
277 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
278 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
279 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
280 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
281 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
282 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
283 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
284 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
285 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
286 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
287 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
288 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
289 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
290 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
291 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
292 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
295 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
296 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
303 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
307 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
319 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
320 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
321 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
322 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
323 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
324 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
327 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
330 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
333 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
334 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
335 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
338 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
339 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
340 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
341 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
342 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
343 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
344 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
345 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
348 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
349 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
350 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
351 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
354 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
358 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
359 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
360 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
361 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
362 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
363 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
364 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
365 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
366 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
367 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
368 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
369 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
370 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
371 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
372 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
373 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
374 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
375 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
376 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
377 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
380 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
381 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
382 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
383 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
384 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
385 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
386 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
387 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
388 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
389 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
390 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
391 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
392 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
393 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
394 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
395 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
396 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
397 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
398 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
399 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
400 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
401 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
402 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
403 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
406 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
409 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
410 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
411 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
430 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
431 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
432 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
437 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
438 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
439 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
440 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
443 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
448 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
449 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
450 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
451 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
452 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
453 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
454 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
455 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
456 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
457 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
458 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
459 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
460 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
461 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
462 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
463 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
464 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
465 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
466 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
467 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
468 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
469 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
470 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
471 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
472 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
473 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
474 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
475 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
476 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
477 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
478 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
479 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
480 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
481 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
482 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
483 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
484 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
485 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.33
Metatranscriptomes 1.03
Isolates 8.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0.31
Rhizoplane 5.14
Rhizosphere 84.36
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10027731 3300001989 Bacteria 1977
2 JGI24737J22298_10042112 3300001990 Bacteria 1400
3 JGI24735J21928_10026388 3300002067 Bacteria 1746
4 rootL2_10071834 3300003322 Bacteria 1547
5 rootH1_10005189 3300003323 Bacteria 3055
6 Ga0006562J51391_1053590 3300003578 Bacteria 820
7 Ga0070683_100232527 3300005329 Bacteria 1752
8 Ga0070690_100157618 3300005330 Bacteria 1553
9 Ga0070666_10782452 3300005335 Bacteria 702
10 Ga0068868_100096697 3300005338 Bacteria 2386
11 Ga0070691_10121304 3300005341 Bacteria 1317
12 Ga0070674_100815649 3300005356 Bacteria 807
13 Ga0070714_100415010 3300005435 Bacteria 1274
14 Ga0070714_101168693 3300005435 Bacteria 750
15 Ga0070713_101329880 3300005436 Bacteria 696
16 Ga0070713_101566211 3300005436 Bacteria 639
17 Ga0070710_10063880 3300005437 Bacteria 2104
18 Ga0070710_10070403 3300005437 Bacteria 2014
19 Ga0070710_10156338 3300005437 Bacteria 1410
20 Ga0070701_10193181 3300005438 Bacteria 1199
21 Ga0070711_100682644 3300005439 Bacteria 863
22 Ga0070711_100745177 3300005439 Bacteria 827
23 Ga0070705_100539722 3300005440 Bacteria 892
24 Ga0070705_101339695 3300005440 Bacteria 595
25 Ga0070700_100734676 3300005441 Bacteria 788
26 Ga0070694_100270047 3300005444 Bacteria 1293
27 Ga0070708_100773111 3300005445 Bacteria 903
28 Ga0070663_100285765 3300005455 Bacteria 1316
29 Ga0070663_101060980 3300005455 Bacteria 707
30 Ga0070678_100472609 3300005456 Bacteria 1102
31 Ga0070681_10748763 3300005458 Bacteria 894
32 Ga0070707_100250493 3300005468 Bacteria 1724
33 Ga0070707_101001633 3300005468 Bacteria 801
34 Ga0070698_101818939 3300005471 Bacteria 562
35 Ga0070699_100980870 3300005518 Bacteria 775
36 Ga0070679_100373511 3300005530 Bacteria 1373
37 Ga0070697_101284011 3300005536 Bacteria 653
38 Ga0068853_100048731 3300005539 Bacteria 3640
39 Ga0068853_100688180 3300005539 Bacteria 975
40 Ga0068853_101611655 3300005539 Bacteria 629
41 Ga0070686_101096939 3300005544 Bacteria 657
42 Ga0070695_100218855 3300005545 Bacteria 1371
43 Ga0070696_101077107 3300005546 Bacteria 675
44 Ga0070693_100638548 3300005547 Bacteria 773
45 Ga0070665_100521721 3300005548 Bacteria 1199
46 Ga0070665_100654524 3300005548 Bacteria 1064
47 Ga0070665_101837875 3300005548 Bacteria 612
48 Ga0070665_101914105 3300005548 Bacteria 599
49 Ga0070704_100515381 3300005549 Bacteria 1040
50 Ga0068855_100256677 3300005563 Bacteria 1949
51 Ga0068857_100552564 3300005577 Bacteria 1085
52 Ga0068854_101474545 3300005578 Bacteria 617
53 Ga0068856_100199674 3300005614 Bacteria 2014
54 Ga0068856_100220181 3300005614 Bacteria 1913
55 Ga0068856_100314133 3300005614 Bacteria 1584
56 Ga0068856_100710313 3300005614 Bacteria 1025
57 Ga0068852_101175869 3300005616 Bacteria 788
58 Ga0068859_100581934 3300005617 Bacteria 1213
59 Ga0068864_100185388 3300005618 Bacteria 1904
60 Ga0068864_100395102 3300005618 Bacteria 1313
61 Ga0068863_101399911 3300005841 Bacteria 707
62 Ga0068858_100168938 3300005842 Bacteria 2062
63 Ga0068860_100169169 3300005843 Bacteria 2110
64 Ga0081455_10004015 3300005937 Bacteria 16691
65 Ga0081455_10272060 3300005937 Bacteria 1228
66 Ga0070717_10145929 3300006028 Bacteria 2044
67 Ga0070717_10152638 3300006028 Bacteria 1999
68 Ga0070717_10416878 3300006028 Bacteria 1208
69 Ga0070717_10431826 3300006028 Bacteria 1185
70 Ga0070717_10605855 3300006028 Bacteria 994
71 Ga0070717_11551942 3300006028 Bacteria 600
72 Ga0075368_10004269 3300006042 Bacteria 4826
73 Ga0075363_100293472 3300006048 Bacteria 942
74 Ga0070715_10136968 3300006163 Bacteria 1185
75 Ga0070716_100021613 3300006173 Bacteria 3393
76 Ga0070716_100116385 3300006173 Bacteria 1666
77 Ga0070716_100998583 3300006173 Bacteria 662
78 Ga0070712_100175413 3300006175 Bacteria 1666
79 Ga0070712_101735317 3300006175 Bacteria 546
80 Ga0075367_10001041 3300006178 Bacteria 11439
81 Ga0097621_100035028 3300006237 Bacteria 4009
82 Ga0075370_10301153 3300006353 Bacteria 953
83 Ga0068871_100549517 3300006358 Bacteria 1046
84 Ga0075433_10228262 3300006852 Bacteria 1654
85 Ga0075434_100303322 3300006871 Bacteria 1617
86 Ga0075436_100341639 3300006914 Bacteria 1078
87 Ga0097620_100581946 3300006931 Bacteria 1213
88 Ga0099826_10026285 3300006948 Bacteria 4296
89 Ga0075435_100328982 3300007076 Bacteria 1308
90 Ga0075435_100479819 3300007076 Bacteria 1074
91 Ga0105251_10128141 3300009011 Bacteria 1151
92 Ga0105244_10346535 3300009036 Bacteria 685
93 Ga0105250_10005086 3300009092 Bacteria 5942
94 Ga0105245_10205700 3300009098 Bacteria 1892
95 Ga0105245_11536281 3300009098 Bacteria 717
96 Ga0105247_10041300 3300009101 Bacteria 2823
97 Ga0105247_10172002 3300009101 Bacteria 1441
98 Ga0105247_11405408 3300009101 Bacteria 565
99 Ga0114129_10419267 3300009147 Bacteria 1761
100 Ga0105243_10107336 3300009148 Bacteria 2328
101 Ga0105243_10557269 3300009148 Bacteria 1096
102 Ga0105241_10969262 3300009174 Bacteria 794
103 Ga0105241_12052820 3300009174 Bacteria 564
104 Ga0105248_10082744 3300009177 Bacteria 3610
105 Ga0105238_10063263 3300009551 Bacteria 3700
106 Ga0105238_12642113 3300009551 Bacteria 538
107 Ga0105239_10877518 3300010375 Bacteria 1029
108 Ga0105239_10972158 3300010375 Bacteria 976
109 Ga0105246_10120144 3300011119 Bacteria 1946
110 Ga0157373_10369307 3300013100 Bacteria 1025
111 Ga0157370_10246205 3300013104 Bacteria 1654
112 Ga0157369_10243976 3300013105 Bacteria 1876
113 Ga0157369_10718912 3300013105 Bacteria 1028
114 Ga0157374_10029298 3300013296 Bacteria 4983
115 Ga0157378_11055785 3300013297 Bacteria 848
116 Ga0163162_10473298 3300013306 Bacteria 1384
117 Ga0163162_10832576 3300013306 Bacteria 1039
118 Ga0157372_10165322 3300013307 Bacteria 2558
119 Ga0157372_10496678 3300013307 Bacteria 1423
120 Ga0157372_10600373 3300013307 Bacteria 1283
121 Ga0157375_10911352 3300013308 Bacteria 1022
122 Ga0163163_10374178 3300014325 Bacteria 1482
123 Ga0163163_10887502 3300014325 Bacteria 955
124 Ga0182008_10001919 3300014497 Bacteria 13438
125 Ga0157379_10408996 3300014968 Bacteria 1248
126 Ga0157376_10438083 3300014969 Bacteria 1272
127 Ga0157376_10611808 3300014969 Bacteria 1086
128 Ga0157376_11472922 3300014969 Bacteria 713
129 Ga0182007_10000425 3300015262 Bacteria 25802
130 Ga0183367_1007 3300015688 Bacteria 498079
131 Ga0206353_11194541 3300020082 Bacteria 897
132 Ga0154015_1326935 3300020610 Bacteria 836
133 Ga0224712_10214579 3300022467 Bacteria 879
134 Ga0256743_101862 3300023436 Bacteria 1262
135 Ga0207426_1038873 3300025302 Bacteria 1495
136 Ga0207426_1040298 3300025302 Bacteria 1456
137 Ga0209051_1087522 3300025303 Bacteria 877
138 Ga0207713_1010515 3300025735 Bacteria 5115
139 Ga0207713_1159922 3300025735 Bacteria 719
140 Ga0207692_10035420 3300025898 Bacteria 2425
141 Ga0207692_10130107 3300025898 Bacteria 1420
142 Ga0207710_10139366 3300025900 Bacteria 1170
143 Ga0207680_10350480 3300025903 Bacteria 1037
144 Ga0207647_10149420 3300025904 Bacteria 1366
145 Ga0207685_10000617 3300025905 Bacteria 6239
146 Ga0207685_10021217 3300025905 Bacteria 2173
147 Ga0207699_10016013 3300025906 Bacteria 3911
148 Ga0207699_10050003 3300025906 Bacteria 2463
149 Ga0207699_10080229 3300025906 Bacteria 2021
150 Ga0207707_10638188 3300025912 Bacteria 898
151 Ga0207707_10839142 3300025912 Bacteria 763
152 Ga0207693_10305562 3300025915 Bacteria 1246
153 Ga0207693_10670823 3300025915 Bacteria 804
154 Ga0207663_10042260 3300025916 Bacteria 2784
155 Ga0207663_10468322 3300025916 Bacteria 974
156 Ga0207652_10217722 3300025921 Bacteria 1720
157 Ga0207646_10343557 3300025922 Bacteria 1348
158 Ga0207646_10821819 3300025922 Bacteria 827
159 Ga0207694_10074643 3300025924 Bacteria 2654
160 Ga0207687_10291719 3300025927 Bacteria 1311
161 Ga0207700_10040668 3300025928 Bacteria 3395
162 Ga0207700_10177676 3300025928 Bacteria 1780
163 Ga0207700_10362385 3300025928 Bacteria 1264
164 Ga0207700_10370502 3300025928 Bacteria 1250
165 Ga0207700_11615974 3300025928 Bacteria 573
166 Ga0207664_10002431 3300025929 Bacteria 12319
167 Ga0207664_10293459 3300025929 Bacteria 1429
168 Ga0207706_11594896 3300025933 Bacteria 529
169 Ga0207709_10277773 3300025935 Bacteria 1236
170 Ga0207669_10580090 3300025937 Bacteria 909
171 Ga0207665_10005691 3300025939 Bacteria 8302
172 Ga0207665_10069009 3300025939 Bacteria 2409
173 Ga0207665_10107304 3300025939 Bacteria 1958
174 Ga0207691_11519283 3300025940 Bacteria 547
175 Ga0207711_10033686 3300025941 Bacteria 4336
176 Ga0207711_11466409 3300025941 Bacteria 625
177 Ga0207679_10319438 3300025945 Bacteria 1344
178 Ga0207667_10259757 3300025949 Bacteria 1776
179 Ga0207667_10595109 3300025949 Bacteria 1116
180 Ga0207703_10197920 3300026035 Bacteria 1784
181 Ga0207639_10030736 3300026041 Bacteria 3941
182 Ga0207639_10621962 3300026041 Bacteria 997
183 Ga0207678_10540379 3300026067 Bacteria 1019
184 Ga0207678_10961883 3300026067 Bacteria 755
185 Ga0207708_11233702 3300026075 Bacteria 654
186 Ga0207702_10172594 3300026078 Bacteria 1984
187 Ga0207702_10516387 3300026078 Bacteria 1166
188 Ga0207702_10851324 3300026078 Bacteria 902
189 Ga0207641_12570403 3300026088 Bacteria 507
190 Ga0207676_10113816 3300026095 Bacteria 2269
191 Ga0207674_10416833 3300026116 Bacteria 1297
192 Ga0207683_10735870 3300026121 Bacteria 915
193 Ga0207698_10727885 3300026142 Bacteria 989
194 Ga0209371_1010314 3300027312 Bacteria 2887
195 Ga0209371_1076947 3300027312 Bacteria 582
196 Ga0209813_10021207 3300027866 Bacteria 1824
197 Ga0268266_10656977 3300028379 Bacteria 1009
198 Ga0268266_11959708 3300028379 Bacteria 559
199 Ga0268264_10188299 3300028381 Bacteria 1879
200 Ga0268264_11875096 3300028381 Bacteria 609
201 Ga0307515_10051203 3300028794 Bacteria 6165
202 Ga0307515_10062832 3300028794 Bacteria 5234
203 Ga0310981_1085041 3300029285 Bacteria 1267
204 Ga0268256_1008374 3300030500 Bacteria 3548
205 Ga0268256_1060897 3300030500 Bacteria 758
206 Ga0307511_10018496 3300030521 Bacteria 6650
207 Ga0307511_10056944 3300030521 Bacteria 3047
208 Ga0307512_10025397 3300030522 Bacteria 5249
209 Ga0307512_10058758 3300030522 Bacteria 2991
210 Ga0307512_10065236 3300030522 Bacteria 2763
211 Ga0316180_1060732 3300030736 Bacteria 979
212 Ga0307513_10009259 3300031456 Bacteria 12465
213 Ga0307513_10161317 3300031456 Bacteria 2134
214 Ga0307509_10343363 3300031507 Bacteria 1219
215 Ga0307408_101825482 3300031548 Bacteria 582
216 Ga0307508_10002091 3300031616 Bacteria 21502
217 Ga0307508_10043552 3300031616 Bacteria 4020
218 Ga0307508_10338976 3300031616 Bacteria 1095
219 Ga0307508_10571558 3300031616 Bacteria 730
220 Ga0307514_10014518 3300031649 Bacteria 6516
221 Ga0307514_10067194 3300031649 Bacteria 2706
222 Ga0307514_10201513 3300031649 Bacteria 1250
223 Ga0307514_10371278 3300031649 Bacteria 749
224 Ga0307516_10016056 3300031730 Bacteria 7851
225 Ga0307516_10037709 3300031730 Bacteria 4829
226 Ga0307516_10151570 3300031730 Bacteria 2078
227 Ga0307518_10192527 3300031838 Bacteria 1364
228 Ga0307518_10243780 3300031838 Bacteria 1149
229 Ga0307518_10351766 3300031838 Bacteria 857
230 Ga0307410_10529789 3300031852 Bacteria 973
231 Ga0307409_100242907 3300031995 Bacteria 1641
232 Ga0307416_100426561 3300032002 Bacteria 1372
233 Ga0307507_10028139 3300033179 Bacteria 5998
234 Ga0307507_10076087 3300033179 Bacteria 2997
235 Ga0307510_10052729 3300033180 Bacteria 4283
236 Ga0307510_10084655 3300033180 Bacteria 3052
237 Ga0307510_10183090 3300033180 Bacteria 1655
238 Ga0373958_0019233 3300034819 Bacteria 1246
239 Ga0373958_0099970 3300034819 Bacteria 679
240 Ga0373938_0222684 3300034957 Bacteria 530
241 Ga0373928_0086852 3300035084 Bacteria 797
242 Ga0373934_0020715 3300035086 Bacteria 2529
243 Ga0373940_0001079 3300035088 Bacteria 4728
244 Ga0373944_0035080 3300035089 Bacteria 1527
245 Ga0373944_0037257 3300035089 Bacteria 1489
246 Ga0373949_0247144 3300035090 Bacteria 551
247 Ga0373923_0058642 3300035111 Bacteria 1630
248 Ga0373923_0100581 3300035111 Bacteria 1274
249 Ga0373923_0695930 3300035111 Bacteria 504
250 Ga0373932_0121483 3300035112 Bacteria 871
251 Ga0373936_0043708 3300035113 Bacteria 1801
252 Ga0373939_0023720 3300035114 Bacteria 1703
253 Ga0373953_0078809 3300035117 Bacteria 1367
254 Ga0373954_0053801 3300035118 Bacteria 1893
255 Ga0373954_0181928 3300035118 Bacteria 1031
256 Ga0373956_0142941 3300035119 Bacteria 1124
257 Ga0373957_0009130 3300035120 Bacteria 3236
258 Ga0373957_0013939 3300035120 Bacteria 2739
259 Ga0373957_0092862 3300035120 Bacteria 1201
260 Ga0373943_0035744 3300035170 Bacteria 2376
261 Ga0373943_0112152 3300035170 Bacteria 1439
262 Ga0373943_0251485 3300035170 Bacteria 993
263 Ga0373946_0038220 3300035171 Bacteria 1954
264 Ga0373946_0489242 3300035171 Bacteria 630
265 Ga0373955_0075849 3300035172 Bacteria 1890
266 Ga0373955_0413585 3300035172 Bacteria 820
267 Ga0373942_0046238 3300035207 Bacteria 1205
268 Ga0373961_0004920 3300035241 Bacteria 3210
269 Ga0373962_0102583 3300035242 Bacteria 894
270 Ga0373924_0005316 3300035410 Bacteria 4553
271 Ga0373924_0071649 3300035410 Bacteria 1463
272 Ga0373924_0140211 3300035410 Bacteria 1055
273 Ga0373931_0004178 3300035691 Bacteria 6567
274 Ga0373931_0908804 3300035691 Bacteria 592
275 Ga0373935_0237812 3300035692 Bacteria 1270
276 Ga0373927_0269358 3300035695 Bacteria 1120
277 Ga0373933_0012460 3300035724 Bacteria 4695
278 Ga0373933_0035789 3300035724 Bacteria 2902
279 Ga0373947_0318801 3300035725 Bacteria 1039
280 Ga0373947_0385115 3300035725 Bacteria 944
281 Ga0373947_0933184 3300035725 Bacteria 592
282 Ga0373937_0008597 3300036401 Bacteria 8866
283 Ga0373937_0104649 3300036401 Bacteria 2629
284 Ga0373937_0267986 3300036401 Bacteria 1611
285 Ga0372808_013077 3300036459 Bacteria 1181
286 Ga0373925_0003887 3300037068 Bacteria 11421
287 Ga0373925_0035736 3300037068 Bacteria 3667
288 Ga0373925_0176576 3300037068 Bacteria 1688
289 Ga0373925_0572838 3300037068 Bacteria 929
290 Ga0373925_0636822 3300037068 Bacteria 878
291 Ga0373925_0812223 3300037068 Bacteria 771
292 Ga0395900_0037246 3300037418 Bacteria 5017
293 Ga0395898_0010509 3300037466 Bacteria 9674
294 Ga0395898_0155358 3300037466 Bacteria 2188
295 Ga0395905_0807630 3300037471 Bacteria 841
296 Ga0436364_1320712 3300037853 Bacteria 3195
297 Ga0395901_0645693 3300038443 Bacteria 1062
298 Ga0436365_0264669 3300039437 Bacteria 583
299 Ga0439436_0000684 3300041404 Bacteria 9110
300 Ga0439436_0023985 3300041404 Bacteria 1802
301 Ga0439439_0004438 3300041406 Bacteria 3164
302 Ga0439461_0128202 3300041410 Bacteria 640
303 Ga0451795_1608725 3300041456 Bacteria 719
304 Ga0451802_0184255 3300041460 Bacteria 736
305 Ga0451802_1590620 3300041460 Bacteria 507
306 Ga0451807_1437455 3300041486 Bacteria 547
307 Ga0451833_0559030 3300041491 Bacteria 882
308 Ga0451835_0505362 3300041492 Bacteria 1092
309 Ga0451837_0893633 3300041494 Bacteria 1878
310 Ga0451849_0857728 3300041505 Bacteria 898
311 Ga0451855_0456396 3300041511 Bacteria 536
312 Ga0451853_1170256 3300041512 Bacteria 3624
313 Ga0451853_1793210 3300041512 Bacteria 565
314 Ga0451853_3846188 3300041512 Bacteria 1748
315 Ga0439433_0003511 3300041999 Bacteria 3370
316 Ga0439433_0009175 3300041999 Bacteria 2153
317 Ga0439448_0008287 3300042005 Bacteria 3038
318 Ga0439448_0151261 3300042005 Bacteria 805
319 Ga0439449_0000137 3300042007 Bacteria 24720
320 Ga0439454_007571 3300042011 Bacteria 1364
321 Ga0439455_0000547 3300042012 Bacteria 5312
322 Ga0439457_000086 3300042014 Bacteria 21124
323 Ga0439457_001245 3300042014 Bacteria 7652
324 Ga0439462_0001927 3300042015 Bacteria 4731
325 Ga0439463_109550 3300042016 Bacteria 713
326 Ga0450920_011782 3300042122 Bacteria 1633
327 Ga0450890_012694 3300042127 Bacteria 1095
328 Ga0450891_025705 3300042129 Bacteria 594
329 Ga0450894_000248 3300042131 Bacteria 9682
330 Ga0450894_025227 3300042131 Bacteria 814
331 Ga0450896_016078 3300042133 Bacteria 1073
332 Ga0450898_001289 3300042134 Bacteria 3267
333 Ga0450899_000065 3300042135 Bacteria 8675
334 Ga0450900_011926 3300042136 Bacteria 1135
335 Ga0450900_055118 3300042136 Bacteria 614
336 Ga0450902_059245 3300042137 Bacteria 661
337 Ga0450903_000221 3300042138 Bacteria 12729
338 Ga0450903_005187 3300042138 Bacteria 2187
339 Ga0450906_005432 3300042145 Bacteria 2619
340 Ga0439458_0002329 3300042157 Bacteria 4656
341 Ga0450908_005929 3300042184 Bacteria 2333
342 Ga0466969_0003967 3300044656 Bacteria 7858
343 Ga0466972_0000586 3300044658 Bacteria 17695
344 Ga0466972_0059584 3300044658 Bacteria 1832
345 Ga0466972_0076241 3300044658 Bacteria 1597
346 Ga0466965_0040477 3300044683 Bacteria 2294
347 Ga0466965_0165588 3300044683 Bacteria 1161
348 Ga0466965_0700579 3300044683 Bacteria 581
349 Ga0466966_0001630 3300044684 Bacteria 14467
350 Ga0466966_0016908 3300044684 Bacteria 4821
351 Ga0466966_0031052 3300044684 Bacteria 3464
352 Ga0466961_0030602 3300044693 Bacteria 3459
353 Ga0466961_0047105 3300044693 Bacteria 2757
354 Ga0466961_0058538 3300044693 Bacteria 2451
355 Ga0466961_0146856 3300044693 Bacteria 1474
356 Ga0466963_0216315 3300044694 Bacteria 1341
357 Ga0466971_0011446 3300044719 Bacteria 3886
358 Ga0466971_0043028 3300044719 Bacteria 2030
359 Ga0466971_0101053 3300044719 Bacteria 1325
360 Ga0466971_0642434 3300044719 Bacteria 531
361 Ga0466968_0102081 3300044735 Bacteria 1281
362 Ga0466970_0190797 3300044765 Bacteria 1138
363 Ga0466957_0341484 3300044842 Bacteria 1014
364 Ga0466960_0001090 3300044901 Bacteria 9756
365 Ga0466959_0073199 3300045049 Bacteria 2479
366 Ga0466959_0128681 3300045049 Bacteria 1795
367 Ga0466958_0232159 3300045836 Bacteria 1178
368 Ga0466967_1098385 3300045976 Bacteria 792
369 Ga0466967_1522486 3300045976 Bacteria 666
370 Ga0495617_006263 3300046452 Bacteria 4181
371 Ga0495627_099965 3300046453 Bacteria 828
372 Ga0495592_0003676 3300046454 Bacteria 11051
373 Ga0495592_0011647 3300046454 Bacteria 6660
374 Ga0495592_0012279 3300046454 Bacteria 6501
375 Ga0495592_0021014 3300046454 Bacteria 4963
376 Ga0495592_0025661 3300046454 Bacteria 4472
377 Ga0495603_0010502 3300046455 Bacteria 5610
378 Ga0495603_0012292 3300046455 Bacteria 5181
379 Ga0495603_0019429 3300046455 Bacteria 4111
380 Ga0495603_0026012 3300046455 Bacteria 3538
381 Ga0495603_0099555 3300046455 Bacteria 1697
382 Ga0495603_0126898 3300046455 Bacteria 1486
383 Ga0495603_0328122 3300046455 Bacteria 878
384 Ga0495590_0136685 3300046457 Bacteria 883
385 Ga0495629_0018737 3300046459 Bacteria 4948
386 Ga0495629_0056356 3300046459 Bacteria 2748
387 Ga0495629_0060769 3300046459 Bacteria 2640
388 Ga0495629_0062319 3300046459 Bacteria 2605
389 Ga0495629_0099100 3300046459 Bacteria 2033
390 Ga0495629_0105292 3300046459 Bacteria 1967
391 Ga0495629_0122125 3300046459 Bacteria 1814
392 Ga0495629_0123116 3300046459 Bacteria 1806
393 Ga0495629_0146099 3300046459 Bacteria 1644
394 Ga0495629_0147699 3300046459 Bacteria 1634
395 Ga0495638_0315325 3300046460 Bacteria 837
396 Ga0495641_0013023 3300046461 Bacteria 4604
397 Ga0495651_0001751 3300046462 Bacteria 16745
398 Ga0495651_0004593 3300046462 Bacteria 10556
399 Ga0495651_0008099 3300046462 Bacteria 8056
400 Ga0495651_0039883 3300046462 Bacteria 3653
401 Ga0495651_0258242 3300046462 Bacteria 1186
402 Ga0495651_0327337 3300046462 Bacteria 1019
403 Ga0495651_0443265 3300046462 Bacteria 840
404 Ga0495653_0098376 3300046463 Bacteria 2124
405 Ga0495653_0408537 3300046463 Bacteria 861
406 Ga0495653_0603440 3300046463 Bacteria 674
407 Ga0495653_0668693 3300046463 Bacteria 633
408 Ga0495580_0057492 3300046472 Bacteria 2737
409 Ga0495580_0211751 3300046472 Bacteria 1333
410 Ga0495582_0068408 3300046473 Bacteria 1962
411 Ga0495582_0614406 3300046473 Bacteria 629
412 Ga0495605_0003162 3300046474 Bacteria 9895
413 Ga0495639_0005142 3300046475 Bacteria 5620
414 Ga0495639_0562663 3300046475 Bacteria 585
415 Ga0495662_0031746 3300046476 Bacteria 2551
416 Ga0495662_0037224 3300046476 Bacteria 2349
417 Ga0495662_0096022 3300046476 Bacteria 1448
418 Ga0495662_0148741 3300046476 Bacteria 1153
419 Ga0495662_0224819 3300046476 Bacteria 925
420 Ga0495664_0000982 3300046477 Bacteria 14656
421 Ga0495664_0007816 3300046477 Bacteria 5951
422 Ga0495664_0046058 3300046477 Bacteria 2587
423 Ga0495664_0051469 3300046477 Bacteria 2445
424 Ga0495664_0087080 3300046477 Bacteria 1876
425 Ga0495584_0081850 3300046491 Bacteria 1625
426 Ga0495585_0022673 3300046492 Bacteria 3603
427 Ga0495594_0000785 3300046499 Bacteria 16363
428 Ga0495594_0005538 3300046499 Bacteria 6486
429 Ga0495594_0055352 3300046499 Bacteria 2187
430 Ga0495594_0164135 3300046499 Bacteria 1263
431 Ga0495594_0245011 3300046499 Bacteria 1021
432 Ga0495594_0507841 3300046499 Bacteria 684
433 Ga0495594_0544064 3300046499 Bacteria 659
434 Ga0495596_0116317 3300046500 Bacteria 1038
435 Ga0495607_0009891 3300046501 Bacteria 6430
436 Ga0495583_0017174 3300046506 Bacteria 3854
437 Ga0495606_0029411 3300046507 Bacteria 3857
438 Ga0495608_0014967 3300046511 Bacteria 5383
439 Ga0495608_0017719 3300046511 Bacteria 4924
440 Ga0495608_0031694 3300046511 Bacteria 3572
441 Ga0495608_0831771 3300046511 Bacteria 543
442 Ga0495610_0077293 3300046512 Bacteria 1537
443 Ga0495616_0006389 3300046513 Bacteria 7136
444 Ga0495618_0039491 3300046514 Bacteria 2967
445 Ga0495618_0107401 3300046514 Bacteria 1787
446 Ga0495618_0162245 3300046514 Bacteria 1424
447 Ga0495618_0225666 3300046514 Bacteria 1180
448 Ga0495618_0289725 3300046514 Bacteria 1019
449 Ga0495620_0035511 3300046515 Bacteria 2239
450 Ga0495620_0107619 3300046515 Bacteria 1107
451 Ga0495628_0038949 3300046516 Bacteria 3803
452 Ga0495628_0114002 3300046516 Bacteria 2077
453 Ga0495628_0154639 3300046516 Bacteria 1745
454 Ga0495628_0227746 3300046516 Bacteria 1398
455 Ga0495630_0012111 3300046517 Bacteria 6253
456 Ga0495630_0058843 3300046517 Bacteria 2881
457 Ga0495630_0134639 3300046517 Bacteria 1877
458 Ga0495630_0216798 3300046517 Bacteria 1461
459 Ga0495631_0057317 3300046518 Bacteria 1695
460 Ga0495632_0132482 3300046519 Bacteria 1159
461 Ga0495637_0016191 3300046520 Bacteria 3488
462 Ga0495643_0001474 3300046522 Bacteria 21493
463 Ga0495644_0210247 3300046523 Bacteria 751
464 Ga0495644_0235585 3300046523 Bacteria 709
465 Ga0495666_0055757 3300046526 Bacteria 1893
466 Ga0495666_0068813 3300046526 Bacteria 1685
467 Ga0495666_0384319 3300046526 Bacteria 631
468 Ga0495652_0004599 3300046529 Bacteria 13155
469 Ga0495652_0007058 3300046529 Bacteria 10376
470 Ga0495652_0022098 3300046529 Bacteria 5649
471 Ga0495652_0076268 3300046529 Bacteria 2781
472 Ga0495652_0116035 3300046529 Bacteria 2144
473 Ga0495652_0149665 3300046529 Bacteria 1825
474 Ga0495652_0189384 3300046529 Bacteria 1571
475 Ga0495652_0335179 3300046529 Bacteria 1088
476 Ga0495652_0377366 3300046529 Bacteria 1009
477 Ga0495654_0005542 3300046530 Bacteria 7315
478 Ga0495665_0109325 3300046531 Bacteria 1450
479 Ga0495665_0478440 3300046531 Bacteria 628
480 Ga0495640_0010606 3300046533 Bacteria 7108
481 Ga0495640_0014287 3300046533 Bacteria 6014
482 Ga0495640_0035507 3300046533 Bacteria 3528
483 Ga0495640_0038056 3300046533 Bacteria 3386
484 Ga0495640_0115085 3300046533 Bacteria 1753
485 Ga0495640_0241278 3300046533 Bacteria 1134
486 Ga0495586_0105937 3300046535 Bacteria 1563
487 Ga0495586_0319506 3300046535 Bacteria 890
488 Ga0495587_0000971 3300046536 Bacteria 18796
489 Ga0495587_0007439 3300046536 Bacteria 7090
490 Ga0495587_0008065 3300046536 Bacteria 6791
491 Ga0495587_0063365 3300046536 Bacteria 2162
492 Ga0495587_0423938 3300046536 Bacteria 738
493 Ga0495609_0006829 3300046538 Bacteria 5768
494 Ga0495609_0137205 3300046538 Bacteria 1045
495 Ga0495597_0033225 3300046542 Bacteria 2337
496 Ga0495645_0088163 3300046543 Bacteria 2220
497 Ga0495645_0108753 3300046543 Bacteria 1963
498 Ga0495645_0115562 3300046543 Bacteria 1895
499 Ga0495645_0161733 3300046543 Bacteria 1547
500 Ga0495645_0262773 3300046543 Bacteria 1142
501 Ga0495645_0345696 3300046543 Bacteria 959
502 Ga0495622_0017176 3300046557 Bacteria 3368
503 Ga0495622_0022160 3300046557 Bacteria 2960
504 Ga0495622_0030211 3300046557 Bacteria 2532
505 Ga0495633_0011818 3300046558 Bacteria 4681
506 Ga0495633_0309358 3300046558 Bacteria 717
507 Ga0495667_0000874 3300046559 Bacteria 19477
508 Ga0495667_0080239 3300046559 Bacteria 2121
509 Ga0495667_0099233 3300046559 Bacteria 1885
510 Ga0495667_0202979 3300046559 Bacteria 1268
511 Ga0495667_0405671 3300046559 Bacteria 858
512 Ga0495656_0034061 3300046615 Bacteria 2083
513 Ga0495668_0004207 3300046616 Bacteria 10376
514 Ga0495668_0597230 3300046616 Bacteria 610
515 Ga0495634_0002168 3300046642 Bacteria 16508
516 Ga0495634_0023741 3300046642 Bacteria 4308
517 Ga0495634_0096457 3300046642 Bacteria 1914
518 Ga0495634_0181205 3300046642 Bacteria 1318
519 Ga0495634_0260768 3300046642 Bacteria 1057
520 Ga0495634_0280187 3300046642 Bacteria 1013
521 Ga0495634_0588898 3300046642 Bacteria 646
522 Ga0495611_0009341 3300046648 Bacteria 4143
523 Ga0495611_0074377 3300046648 Bacteria 1556
524 Ga0495611_0323614 3300046648 Bacteria 709
525 Ga0495625_0073344 3300046660 Bacteria 2399
526 Ga0495625_0110897 3300046660 Bacteria 1875
527 Ga0495625_0147263 3300046660 Bacteria 1585
528 Ga0495625_0201159 3300046660 Bacteria 1314
529 Ga0495625_0414327 3300046660 Bacteria 839
530 Ga0495635_0001572 3300046663 Bacteria 15329
531 Ga0495635_0010278 3300046663 Bacteria 6544
532 Ga0495635_0037557 3300046663 Bacteria 3353
533 Ga0495635_0140134 3300046663 Bacteria 1647
534 Ga0495635_0217987 3300046663 Bacteria 1291
535 Ga0495635_1056134 3300046663 Bacteria 515
536 Ga0495659_0048127 3300046664 Bacteria 1544
537 Ga0495661_0041276 3300046665 Bacteria 2855
538 Ga0495661_0153711 3300046665 Bacteria 1241
539 Ga0495588_0013464 3300046674 Bacteria 3898
540 Ga0495588_0028011 3300046674 Bacteria 2818
541 Ga0495588_0063593 3300046674 Bacteria 1913
542 Ga0495588_0071193 3300046674 Bacteria 1808
543 Ga0495588_0332117 3300046674 Bacteria 799
544 Ga0495657_0010270 3300046675 Bacteria 7047
545 Ga0495657_0014880 3300046675 Bacteria 5707
546 Ga0495657_0019959 3300046675 Bacteria 4827
547 Ga0495657_0021076 3300046675 Bacteria 4680
548 Ga0495657_0056113 3300046675 Bacteria 2625
549 Ga0495657_0087213 3300046675 Bacteria 2008
550 Ga0495657_0517831 3300046675 Bacteria 694
551 Ga0495599_0015242 3300046678 Bacteria 4767
552 Ga0495599_0025198 3300046678 Bacteria 3722
553 Ga0495599_0026500 3300046678 Bacteria 3633
554 Ga0495599_0137333 3300046678 Bacteria 1517
555 Ga0495623_0031400 3300046679 Bacteria 3415
556 Ga0495623_0034303 3300046679 Bacteria 3255
557 Ga0495623_0065181 3300046679 Bacteria 2278
558 Ga0495623_0105459 3300046679 Bacteria 1713
559 Ga0495623_0107473 3300046679 Bacteria 1694
560 Ga0495623_0698019 3300046679 Bacteria 520
561 Ga0495646_0047289 3300046680 Bacteria 2619
562 Ga0495646_0047994 3300046680 Bacteria 2596
563 Ga0495646_0108644 3300046680 Bacteria 1581
564 Ga0495646_0237112 3300046680 Bacteria 981
565 Ga0495647_0027655 3300046681 Bacteria 2085
566 Ga0495647_0075628 3300046681 Bacteria 1356
567 Ga0495658_0064629 3300046683 Bacteria 2108
568 Ga0495658_0130813 3300046683 Bacteria 1527
569 Ga0495613_0001401 3300046689 Bacteria 18364
570 Ga0495613_0010252 3300046689 Bacteria 6961
571 Ga0495613_0077307 3300046689 Bacteria 2421
572 Ga0495613_0097743 3300046689 Bacteria 2121
573 Ga0495613_0102531 3300046689 Bacteria 2066
574 Ga0495613_0157302 3300046689 Bacteria 1618
575 Ga0495624_0068630 3300046690 Bacteria 2209
576 Ga0495624_0085813 3300046690 Bacteria 1944
577 Ga0495624_0132334 3300046690 Bacteria 1529
578 Ga0495624_0379456 3300046690 Bacteria 849
579 Ga0495671_0150419 3300046692 Bacteria 1133
580 Ga0495671_0273986 3300046692 Bacteria 813
581 Ga0495671_0401508 3300046692 Bacteria 656
582 Ga0495649_0096671 3300046694 Bacteria 1571
583 Ga0495649_0193731 3300046694 Bacteria 1057
584 Ga0495649_0327196 3300046694 Bacteria 777
585 Ga0495589_0014878 3300046794 Bacteria 4002
586 Ga0495589_0025261 3300046794 Bacteria 3015
587 Ga0495589_0107837 3300046794 Bacteria 1345
588 Ga0495600_0000608 3300046809 Bacteria 18481
589 Ga0495600_0017894 3300046809 Bacteria 4510
590 Ga0495600_0142036 3300046809 Bacteria 1557
591 Ga0495600_0153973 3300046809 Bacteria 1487
592 Ga0495600_0324118 3300046809 Bacteria 968
593 Ga0495600_0393451 3300046809 Bacteria 863
594 Ga0495660_0047021 3300046810 Bacteria 2364
595 Ga0495581_0010139 3300047315 Bacteria 5453
596 Ga0495581_0042806 3300047315 Bacteria 2620
597 Ga0495581_0081713 3300047315 Bacteria 1871
598 Ga0495581_0138433 3300047315 Bacteria 1419
599 Ga0495581_0211011 3300047315 Bacteria 1135
600 Ga0495581_0316673 3300047315 Bacteria 911
601 Ga0495604_0003209 3300047317 Bacteria 13065
602 Ga0495604_0008150 3300047317 Bacteria 8294
603 Ga0495604_0009632 3300047317 Bacteria 7640
604 Ga0495604_0042455 3300047317 Bacteria 3564
605 Ga0495604_0061583 3300047317 Bacteria 2869
606 Ga0495604_0081264 3300047317 Bacteria 2426
607 Ga0495604_0564827 3300047317 Bacteria 732
608 Ga0495636_0007858 3300047318 Bacteria 4198
609 Ga0495636_0011299 3300047318 Bacteria 3533
610 Ga0495636_0028303 3300047318 Bacteria 2285
611 Ga0495636_0044515 3300047318 Bacteria 1848
612 Ga0495636_0112676 3300047318 Bacteria 1198
613 Ga0495674_0003520 3300047319 Bacteria 15244
614 Ga0495674_0010300 3300047319 Bacteria 8851
615 Ga0495674_0120696 3300047319 Bacteria 2214
616 Ga0495674_0146574 3300047319 Bacteria 1981
617 Ga0495674_0195350 3300047319 Bacteria 1680
618 Ga0495674_0247568 3300047319 Bacteria 1467
619 Ga0495672_0069255 3300047320 Bacteria 2004
620 Ga0495676_0014968 3300047321 Bacteria 6922
621 Ga0495676_0018421 3300047321 Bacteria 6154
622 Ga0495676_0038934 3300047321 Bacteria 3944
623 Ga0495676_0046083 3300047321 Bacteria 3543
624 Ga0495676_0140359 3300047321 Bacteria 1732
625 Ga0495676_0176177 3300047321 Bacteria 1501
626 Ga0495676_0707702 3300047321 Bacteria 651
627 Ga0495676_1030334 3300047321 Bacteria 524
628 Ga0495680_0001885 3300047322 Bacteria 22031
629 Ga0495680_0026400 3300047322 Bacteria 4787
630 Ga0495680_0064591 3300047322 Bacteria 2806
631 Ga0495680_0075219 3300047322 Bacteria 2562
632 Ga0495683_0065758 3300047323 Bacteria 1787
633 Ga0495687_017227 3300047443 Bacteria 3611
634 Ga0495687_068270 3300047443 Bacteria 1435
635 Ga0495687_130088 3300047443 Bacteria 892
636 Ga0495687_194059 3300047443 Bacteria 651
637 Ga0495675_0019097 3300047444 Bacteria 4354
638 Ga0495675_0034800 3300047444 Bacteria 3216
639 Ga0495675_0037771 3300047444 Bacteria 3075
640 Ga0495675_0054126 3300047444 Bacteria 2547
641 Ga0495675_0087256 3300047444 Bacteria 1960
642 Ga0495675_0104000 3300047444 Bacteria 1775
643 Ga0495675_0118855 3300047444 Bacteria 1646
644 Ga0495675_0160521 3300047444 Bacteria 1384
645 Ga0495675_0628417 3300047444 Bacteria 607
646 Ga0495677_0200632 3300047445 Bacteria 775
647 Ga0495679_124801 3300047446 Bacteria 701
648 Ga0495685_003724 3300047447 Bacteria 4881
649 Ga0495685_008069 3300047447 Bacteria 3487
650 Ga0495685_014983 3300047447 Bacteria 2639
651 Ga0495685_028643 3300047447 Bacteria 1916
652 Ga0495685_031441 3300047447 Bacteria 1824
653 Ga0495685_039951 3300047447 Bacteria 1605
654 Ga0495685_057602 3300047447 Bacteria 1312
655 Ga0495681_0013335 3300047470 Bacteria 4775
656 Ga0495681_0163757 3300047470 Bacteria 924
657 Ga0495684_0008904 3300047471 Bacteria 7755
658 Ga0495684_0012338 3300047471 Bacteria 6591
659 Ga0495684_0056193 3300047471 Bacteria 3001
660 Ga0495684_0072549 3300047471 Bacteria 2615
661 Ga0495684_0148003 3300047471 Bacteria 1757
662 Ga0495684_0233778 3300047471 Bacteria 1343
663 Ga0495686_0041878 3300047472 Bacteria 2914
664 Ga0495593_0028253 3300047673 Bacteria 3081
665 Ga0495593_0048248 3300047673 Bacteria 2263
666 Ga0495593_0094638 3300047673 Bacteria 1536
667 Ga0495593_0537526 3300047673 Bacteria 586
668 Ga0495593_0572064 3300047673 Bacteria 567
669 Ga0495602_0026894 3300048088 Bacteria 5540
670 Ga0495602_0072862 3300048088 Bacteria 2926
671 Ga0495602_0076786 3300048088 Bacteria 2829
672 Ga0495602_0088568 3300048088 Bacteria 2576
673 Ga0495602_0134846 3300048088 Bacteria 1963
674 Ga0495602_0647174 3300048088 Bacteria 722
675 Ga0495614_0020793 3300048089 Bacteria 2836
676 Ga0495614_0023309 3300048089 Bacteria 2670
677 Ga0495614_0033404 3300048089 Bacteria 2213
678 Ga0495614_0076837 3300048089 Bacteria 1443
679 Ga0495614_0103977 3300048089 Bacteria 1243
680 Ga0495614_0251233 3300048089 Bacteria 809
681 Ga0495626_0005908 3300048091 Bacteria 7046
682 Ga0496100_0253128 3300048903 Bacteria 1303
683 Ga0496100_0358053 3300048903 Bacteria 1103
684 Ga0496100_0702744 3300048903 Bacteria 789
685 Ga0496100_1134469 3300048903 Bacteria 616
686 Ga0496101_0107467 3300048904 Bacteria 2096
687 Ga0496101_0132337 3300048904 Bacteria 1895
688 Ga0496101_0284848 3300048904 Bacteria 1292
689 Ga0496102_0058401 3300048905 Bacteria 3525
690 Ga0496102_0210403 3300048905 Bacteria 1834
691 Ga0496102_0495841 3300048905 Bacteria 1143
692 Ga0496102_1454266 3300048905 Bacteria 604
693 Ga0496103_0236902 3300048906 Bacteria 1174
694 Ga0496104_0011442 3300048907 Bacteria 7949
695 Ga0496104_0015675 3300048907 Bacteria 6874
696 Ga0496104_0093665 3300048907 Bacteria 2873
697 Ga0496105_0003685 3300048908 Bacteria 11404
698 Ga0496105_0006593 3300048908 Bacteria 8938
699 Ga0496105_0093819 3300048908 Bacteria 2478
700 Ga0496105_1018356 3300048908 Bacteria 619
701 Ga0496106_0446778 3300048909 Bacteria 1039
702 Ga0496106_0644613 3300048909 Bacteria 847
703 Ga0496106_0765174 3300048909 Bacteria 767
704 Ga0496107_0327601 3300048910 Bacteria 1140
705 Ga0496108_0026910 3300048911 Bacteria 4746
706 Ga0496108_0097924 3300048911 Bacteria 2499
707 Ga0496108_0169951 3300048911 Bacteria 1886
708 Ga0496108_0474173 3300048911 Bacteria 1093
709 Ga0496109_0007106 3300048912 Bacteria 9452
710 Ga0496109_0098430 3300048912 Bacteria 2711
711 Ga0496109_0212314 3300048912 Bacteria 1820
712 Ga0496109_0239622 3300048912 Bacteria 1707
713 Ga0496110_0484661 3300048913 Bacteria 1126
714 Ga0496110_0826360 3300048913 Bacteria 831
715 Ga0496111_0314994 3300048914 Bacteria 1159
716 Ga0496111_1047920 3300048914 Bacteria 583
717 Ga0496112_0035310 3300048915 Bacteria 4869
718 Ga0496112_0172894 3300048915 Bacteria 2125
719 Ga0496112_0374359 3300048915 Bacteria 1365
720 Ga0496113_0032644 3300048916 Bacteria 3784
721 Ga0496113_0071570 3300048916 Bacteria 2637
722 Ga0496113_0080300 3300048916 Bacteria 2498
723 Ga0496114_0008917 3300048917 Bacteria 7952
724 Ga0496114_0593475 3300048917 Bacteria 977
725 Ga0496115_0011366 3300048918 Bacteria 6671
726 Ga0496115_0776246 3300048918 Bacteria 747
727 Ga0496126_1171235 3300048929 Bacteria 567
728 Ga0495678_033991 3300049459 Bacteria 2101
729 Ga0495682_0180797 3300049460 Bacteria 749
730 Ga0501311_096093 3300049527 Bacteria 520
731 Ga0501318_000189 3300049534 Bacteria 3222
732 Ga0501323_001026 3300049539 Bacteria 2337
733 Ga0501031_0026414 3300049568 Bacteria 3785
734 Ga0501031_0559393 3300049568 Bacteria 736
735 Ga0501032_0000349 3300049569 Bacteria 38615
736 Ga0501032_0069477 3300049569 Bacteria 2350
737 Ga0501032_0310780 3300049569 Bacteria 1018
738 Ga0501032_0346450 3300049569 Bacteria 957
739 Ga0501032_0722891 3300049569 Bacteria 631
740 Ga0501033_0001339 3300049570 Bacteria 21893
741 Ga0501033_0009633 3300049570 Bacteria 7432
742 Ga0501033_0243176 3300049570 Bacteria 1276
743 Ga0501033_0356168 3300049570 Bacteria 1024
744 Ga0501033_0455258 3300049570 Bacteria 888
745 Ga0501033_0839767 3300049570 Bacteria 619
746 Ga0501034_0004152 3300049571 Bacteria 16221
747 Ga0501034_0035276 3300049571 Bacteria 5071
748 Ga0501034_0202166 3300049571 Bacteria 1944
749 Ga0501034_0552735 3300049571 Bacteria 1060
750 Ga0501034_0564858 3300049571 Bacteria 1046
751 Ga0501034_0613390 3300049571 Bacteria 992
752 Ga0501034_1237624 3300049571 Bacteria 624
753 Ga0501034_1264609 3300049571 Bacteria 615
754 Ga0501036_0006306 3300049572 Bacteria 9624
755 Ga0501036_0060167 3300049572 Bacteria 3217
756 Ga0501036_0068833 3300049572 Bacteria 2995
757 Ga0501036_0086095 3300049572 Bacteria 2656
758 Ga0501036_0130138 3300049572 Bacteria 2125
759 Ga0501036_0211188 3300049572 Bacteria 1631
760 Ga0501037_0002432 3300049573 Bacteria 13465
761 Ga0501037_0014083 3300049573 Bacteria 5891
762 Ga0501037_0052437 3300049573 Bacteria 2983
763 Ga0501037_0567526 3300049573 Bacteria 764
764 Ga0501037_0988702 3300049573 Bacteria 548
765 Ga0501038_0043175 3300049574 Bacteria 3921
766 Ga0501038_0049772 3300049574 Bacteria 3622
767 Ga0501038_0057499 3300049574 Bacteria 3339
768 Ga0501038_0069712 3300049574 Bacteria 2986
769 Ga0501038_0298198 3300049574 Bacteria 1265
770 Ga0501038_0368899 3300049574 Bacteria 1115
771 Ga0501038_1035449 3300049574 Bacteria 601
772 Ga0501039_0022674 3300049575 Bacteria 4817
773 Ga0501039_0038335 3300049575 Bacteria 3701
774 Ga0501039_0125698 3300049575 Bacteria 2011
775 Ga0501039_0351286 3300049575 Bacteria 1159
776 Ga0501040_0067123 3300049576 Bacteria 2471
777 Ga0501041_0001346 3300049577 Bacteria 13537
778 Ga0501042_0032462 3300049578 Bacteria 3697
779 Ga0501042_0048306 3300049578 Bacteria 3034
780 Ga0501043_0003089 3300049579 Bacteria 13812
781 Ga0501043_0006539 3300049579 Bacteria 9351
782 Ga0501043_0048534 3300049579 Bacteria 3337
783 Ga0501043_0074611 3300049579 Bacteria 2664
784 Ga0501043_0223916 3300049579 Bacteria 1454
785 Ga0501043_0797401 3300049579 Bacteria 683
786 Ga0501046_0068069 3300049580 Bacteria 2771
787 Ga0501046_0076664 3300049580 Bacteria 2589
788 Ga0501046_0826353 3300049580 Bacteria 648
789 Ga0501047_0000309 3300049581 Bacteria 56264
790 Ga0501047_0042376 3300049581 Bacteria 4399
791 Ga0501047_0091888 3300049581 Bacteria 2913
792 Ga0501047_0105413 3300049581 Bacteria 2699
793 Ga0501047_0169900 3300049581 Bacteria 2049
794 Ga0501047_0177716 3300049581 Bacteria 1996
795 Ga0501047_0205439 3300049581 Bacteria 1829
796 Ga0501047_0448019 3300049581 Bacteria 1120
797 Ga0501047_0532151 3300049581 Bacteria 1000
798 Ga0501047_1018267 3300049581 Bacteria 641
799 Ga0501048_0002495 3300049582 Bacteria 14051
800 Ga0501048_0017248 3300049582 Bacteria 5320
801 Ga0501048_0430340 3300049582 Bacteria 944
802 Ga0501067_0646671 3300049583 Bacteria 593
803 Ga0501067_0679780 3300049583 Bacteria 578
804 Ga0501068_0005639 3300049584 Bacteria 6857
805 Ga0501068_0746242 3300049584 Bacteria 641
806 Ga0501069_0003348 3300049585 Bacteria 8229
807 Ga0501069_0290303 3300049585 Bacteria 958
808 Ga0501070_0012774 3300049586 Bacteria 7080
809 Ga0501070_0415375 3300049586 Bacteria 1087
810 Ga0501070_0423887 3300049586 Bacteria 1074
811 Ga0501070_0714758 3300049586 Bacteria 791
812 Ga0501070_1006935 3300049586 Bacteria 646
813 Ga0501072_0021693 3300049588 Bacteria 4981
814 Ga0501073_0005694 3300049589 Bacteria 9320
815 Ga0501073_0312185 3300049589 Bacteria 1085
816 Ga0501074_0003000 3300049590 Bacteria 11873
817 Ga0501074_0046313 3300049590 Bacteria 3144
818 Ga0501075_0261223 3300049591 Bacteria 1320
819 Ga0501202_092090 3300049652 Bacteria 727
820 Ga0501224_044829 3300049664 Bacteria 672
821 Ga0501235_032051 3300049669 Bacteria 1188
822 Ga0501079_1132531 3300049741 Bacteria 616
823 Ga0501080_0477851 3300049742 Bacteria 1115
824 Ga0501080_1218819 3300049742 Bacteria 646
825 Ga0501083_0002475 3300049744 Bacteria 12663
826 Ga0501282_017244 3300049778 Bacteria 787
827 Ga0501035_0000922 3300049822 Bacteria 31150
828 Ga0501035_0005042 3300049822 Bacteria 12507
829 Ga0501035_0010143 3300049822 Bacteria 8742
830 Ga0501035_0038843 3300049822 Bacteria 4309
831 Ga0501035_0102652 3300049822 Bacteria 2508
832 Ga0501035_0290273 3300049822 Bacteria 1380
833 Ga0501035_0330293 3300049822 Bacteria 1279
834 Ga0501035_0361878 3300049822 Bacteria 1212
835 Ga0501035_1005156 3300049822 Bacteria 655
836 Ga0501035_1044827 3300049822 Bacteria 640
837 Ga0501044_0002906 3300049823 Bacteria 19500
838 Ga0501044_0007526 3300049823 Bacteria 11978
839 Ga0501044_0011335 3300049823 Bacteria 9658
840 Ga0501044_0014904 3300049823 Bacteria 8380
841 Ga0501044_0087413 3300049823 Bacteria 3148
842 Ga0501044_0149727 3300049823 Bacteria 2317
843 Ga0501044_0167174 3300049823 Bacteria 2173
844 Ga0501044_0216255 3300049823 Bacteria 1868
845 Ga0501044_0324772 3300049823 Bacteria 1462
846 Ga0501044_0407519 3300049823 Bacteria 1271
847 Ga0501044_0509746 3300049823 Bacteria 1103
848 Ga0501044_1155847 3300049823 Bacteria 642
849 Ga0501044_1192379 3300049823 Bacteria 629
850 Ga0501044_1626955 3300049823 Bacteria 511
851 Ga0501045_0147786 3300049824 Bacteria 1748
852 nmdc:mga03n38_26447_c1 3300050490 Bacteria 2396
853 nmdc:mga03n38_35383_c1 3300050490 Bacteria 2139
854 nmdc:mga03n38_90224_c1 3300050490 Bacteria 1457
855 nmdc:mga0yw44_45338_c1 3300050492 Bacteria 2635
856 nmdc:mga06z11_1574_c1 3300050494 Bacteria 8493
857 nmdc:mga04h51_59290_c1 3300050495 Bacteria 1308
858 nmdc:mga07m45_290091_c1 3300050496 Bacteria 952
859 nmdc:mga07m45_55352_c2 3300050496 Bacteria 1862
860 nmdc:mga05p37_444118_c2 3300050507 Bacteria 1117
861 nmdc:mga0n895_242638_c1 3300050512 Bacteria 1829
862 nmdc:mga0rr50_448446_c1 3300050513 Bacteria 1094
863 nmdc:mga0rr50_508850_c1 3300050513 Bacteria 1024
864 nmdc:mga0rr50_918139_c1 3300050513 Bacteria 746
865 nmdc:mga08x19_74811_c1 3300050514 Bacteria 2213
866 nmdc:mga0a205_398235_c1 3300050515 Bacteria 1241
867 Ga0495601_0031633 3300053077 Bacteria 3289
868 Ga0495601_0416963 3300053077 Bacteria 870
869 Ga0495601_0468132 3300053077 Bacteria 814
870 Ga0495612_0073855 3300053078 Bacteria 1425
871 Ga0495655_0028259 3300053083 Bacteria 1338
872 Ga0495595_0014625 3300053084 Bacteria 3333
873 Ga0495595_0022285 3300053084 Bacteria 2779
874 Ga0495595_0029865 3300053084 Bacteria 2442
875 Ga0495619_0012686 3300053085 Bacteria 5305
876 Ga0495619_0016508 3300053085 Bacteria 4675
877 Ga0495619_0153739 3300053085 Bacteria 1587
878 Ga0495619_0352830 3300053085 Bacteria 1018
879 Ga0500640_018388 3300053095 Bacteria 2979
880 Ga0500572_020073 3300053111 Bacteria 1754
881 Ga0500614_003947 3300053123 Bacteria 3166
882 Ga0500573_0064507 3300053140 Bacteria 2095
883 Ga0500573_0182924 3300053140 Bacteria 1125
884 Ga0501084_0323501 3300054114 Bacteria 1302
885 Ga0501082_0884263 3300060353 Bacteria 782
886 Ga0466962_0000908 3300061719 Bacteria 13429
887 Ga0466962_0150123 3300061719 Bacteria 1130
888 Ga0466962_0340479 3300061719 Bacteria 746

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10071834 rootL2_100718342 112
2 3300027312 Ga0209371_1076947 Ga0209371_10769471 113
3 3300030500 Ga0268256_1060897 Ga0268256_10608972 113
4 3300041460 Ga0451802_0184255 Ga0451802_0184255_361_708 115
5 3300042134 Ga0450898_001289 Ga0450898_001289_13_360 115
6 3300048903 Ga0496100_0702744 Ga0496100_0702744_425_772 115
7 3300031852 Ga0307410_10529789 Ga0307410_105297892 116
8 3300031995 Ga0307409_100242907 Ga0307409_1002429072 116
9 3300023436 Ga0256743_101862 Ga0256743_1018622 118
10 3300029285 Ga0310981_1085041 Ga0310981_10850411 118
11 3300046452 Ga0495617_006263 Ga0495617_006263_3301_3681 118
12 3300046453 Ga0495627_099965 Ga0495627_099965_98_478 118
13 3300046454 Ga0495592_0021014 Ga0495592_0021014_4052_4432 118
14 3300046455 Ga0495603_0126898 Ga0495603_0126898_702_1082 118
15 3300046457 Ga0495590_0136685 Ga0495590_0136685_136_516 118
16 3300046459 Ga0495629_0105292 Ga0495629_0105292_447_827 118
17 3300046460 Ga0495638_0315325 Ga0495638_0315325_126_506 118
18 3300046462 Ga0495651_0258242 Ga0495651_0258242_292_672 118
19 3300046463 Ga0495653_0668693 Ga0495653_0668693_59_439 118
20 3300046472 Ga0495580_0057492 Ga0495580_0057492_1587_1967 118
21 3300046474 Ga0495605_0003162 Ga0495605_0003162_683_1063 118
22 3300046477 Ga0495664_0051469 Ga0495664_0051469_1120_1500 118
23 3300046491 Ga0495584_0081850 Ga0495584_0081850_163_543 118
24 3300046492 Ga0495585_0022673 Ga0495585_0022673_831_1211 118
25 3300046499 Ga0495594_0005538 Ga0495594_0005538_5702_6082 118
26 3300046500 Ga0495596_0116317 Ga0495596_0116317_523_903 118
27 3300046501 Ga0495607_0009891 Ga0495607_0009891_4591_4971 118
28 3300046506 Ga0495583_0017174 Ga0495583_0017174_545_925 118
29 3300046507 Ga0495606_0029411 Ga0495606_0029411_2930_3310 118
30 3300046511 Ga0495608_0831771 Ga0495608_0831771_21_401 118
31 3300046512 Ga0495610_0077293 Ga0495610_0077293_315_695 118
32 3300046513 Ga0495616_0006389 Ga0495616_0006389_1394_1774 118
33 3300046514 Ga0495618_0107401 Ga0495618_0107401_436_816 118
34 3300046515 Ga0495620_0035511 Ga0495620_0035511_1473_1853 118
35 3300046516 Ga0495628_0154639 Ga0495628_0154639_480_860 118
36 3300046518 Ga0495631_0057317 Ga0495631_0057317_929_1309 118
37 3300046519 Ga0495632_0132482 Ga0495632_0132482_215_595 118
38 3300046520 Ga0495637_0016191 Ga0495637_0016191_3022_3402 118
39 3300046522 Ga0495643_0001474 Ga0495643_0001474_90_470 118
40 3300046523 Ga0495644_0235585 Ga0495644_0235585_236_616 118
41 3300046526 Ga0495666_0055757 Ga0495666_0055757_1026_1406 118
42 3300046529 Ga0495652_0116035 Ga0495652_0116035_141_521 118
43 3300046530 Ga0495654_0005542 Ga0495654_0005542_3128_3508 118
44 3300046533 Ga0495640_0035507 Ga0495640_0035507_1059_1439 118
45 3300046536 Ga0495587_0423938 Ga0495587_0423938_33_413 118
46 3300046538 Ga0495609_0006829 Ga0495609_0006829_4869_5249 118
47 3300046542 Ga0495597_0033225 Ga0495597_0033225_1055_1435 118
48 3300046557 Ga0495622_0017176 Ga0495622_0017176_1791_2171 118
49 3300046558 Ga0495633_0011818 Ga0495633_0011818_3073_3453 118
50 3300046616 Ga0495668_0004207 Ga0495668_0004207_2952_3332 118
51 3300046642 Ga0495634_0181205 Ga0495634_0181205_770_1150 118
52 3300046648 Ga0495611_0009341 Ga0495611_0009341_834_1214 118
53 3300046660 Ga0495625_0201159 Ga0495625_0201159_548_928 118
54 3300046663 Ga0495635_0140134 Ga0495635_0140134_163_543 118
55 3300046665 Ga0495661_0041276 Ga0495661_0041276_2311_2691 118
56 3300046675 Ga0495657_0056113 Ga0495657_0056113_256_636 118
57 3300046689 Ga0495613_0097743 Ga0495613_0097743_533_913 118
58 3300046692 Ga0495671_0150419 Ga0495671_0150419_17_397 118
59 3300046694 Ga0495649_0096671 Ga0495649_0096671_861_1241 118
60 3300046794 Ga0495589_0025261 Ga0495589_0025261_2088_2468 118
61 3300046809 Ga0495600_0017894 Ga0495600_0017894_1104_1484 118
62 3300046810 Ga0495660_0047021 Ga0495660_0047021_548_928 118
63 3300047315 Ga0495581_0316673 Ga0495581_0316673_496_876 118
64 3300047317 Ga0495604_0564827 Ga0495604_0564827_67_447 118
65 3300047318 Ga0495636_0028303 Ga0495636_0028303_408_788 118
66 3300047319 Ga0495674_0247568 Ga0495674_0247568_311_691 118
67 3300047320 Ga0495672_0069255 Ga0495672_0069255_62_442 118
68 3300047321 Ga0495676_0176177 Ga0495676_0176177_302_682 118
69 3300047322 Ga0495680_0064591 Ga0495680_0064591_2096_2476 118
70 3300047323 Ga0495683_0065758 Ga0495683_0065758_437_817 118
71 3300047443 Ga0495687_130088 Ga0495687_130088_332_712 118
72 3300047444 Ga0495675_0160521 Ga0495675_0160521_745_1125 118
73 3300047445 Ga0495677_0200632 Ga0495677_0200632_144_524 118
74 3300047446 Ga0495679_124801 Ga0495679_124801_28_408 118
75 3300047447 Ga0495685_014983 Ga0495685_014983_742_1122 118
76 3300047470 Ga0495681_0013335 Ga0495681_0013335_3661_4041 118
77 3300047472 Ga0495686_0041878 Ga0495686_0041878_253_633 118
78 3300047673 Ga0495593_0094638 Ga0495593_0094638_710_1090 118
79 3300048088 Ga0495602_0076786 Ga0495602_0076786_1903_2283 118
80 3300048089 Ga0495614_0076837 Ga0495614_0076837_10_390 118
81 3300048089 Ga0495614_0103977 Ga0495614_0103977_180_560 118
82 3300048091 Ga0495626_0005908 Ga0495626_0005908_3973_4353 118
83 3300049459 Ga0495678_033991 Ga0495678_033991_860_1240 118
84 3300049460 Ga0495682_0180797 Ga0495682_0180797_155_535 118
85 3300049823 Ga0501044_0407519 Ga0501044_0407519_899_1255 118
86 3300053083 Ga0495655_0028259 Ga0495655_0028259_277_675 118
87 3300005937 Ga0081455_10272060 Ga0081455_102720602 119
88 3300005548 Ga0070665_101837875 Ga0070665_1018378751 120
89 3300006028 Ga0070717_10605855 Ga0070717_106058552 120
90 3300035171 Ga0373946_0489242 Ga0373946_0489242_177_572 120
91 3300035725 Ga0373947_0318801 Ga0373947_0318801_55_450 120
92 3300037068 Ga0373925_0572838 Ga0373925_0572838_79_474 120
93 3300041404 Ga0439436_0000684 Ga0439436_0000684_130_528 120
94 3300041406 Ga0439439_0004438 Ga0439439_0004438_600_998 120
95 3300041999 Ga0439433_0003511 Ga0439433_0003511_700_1098 120
96 3300042014 Ga0439457_000086 Ga0439457_000086_927_1325 120
97 3300042015 Ga0439462_0001927 Ga0439462_0001927_3410_3808 120
98 3300046514 Ga0495618_0289725 Ga0495618_0289725_366_761 120
99 3300046529 Ga0495652_0377366 Ga0495652_0377366_296_691 120
100 3300046533 Ga0495640_0241278 Ga0495640_0241278_324_719 120
101 3300046642 Ga0495634_0588898 Ga0495634_0588898_211_606 120
102 3300046690 Ga0495624_0132334 Ga0495624_0132334_469_864 120
103 3300047319 Ga0495674_0003520 Ga0495674_0003520_7892_8287 120
104 3300048088 Ga0495602_0647174 Ga0495602_0647174_24_419 120
105 3300037068 Ga0373925_0003887 Ga0373925_0003887_40_435 121
106 3300037068 Ga0373925_0636822 Ga0373925_0636822_225_620 121
107 3300046642 Ga0495634_0280187 Ga0495634_0280187_381_776 121
108 3300047319 Ga0495674_0010300 Ga0495674_0010300_4851_5246 121
109 3300047444 Ga0495675_0034800 Ga0495675_0034800_1870_2265 121
110 3300048088 Ga0495602_0026894 Ga0495602_0026894_3503_3898 121
111 3300053077 Ga0495601_0416963 Ga0495601_0416963_397_792 121
112 3300053084 Ga0495595_0029865 Ga0495595_0029865_382_777 121
113 3300035086 Ga0373934_0020715 Ga0373934_0020715_77_472 123
114 3300035120 Ga0373957_0092862 Ga0373957_0092862_795_1190 123
115 3300035172 Ga0373955_0413585 Ga0373955_0413585_196_591 123
116 3300035410 Ga0373924_0071649 Ga0373924_0071649_534_929 123
117 3300035724 Ga0373933_0012460 Ga0373933_0012460_4082_4477 123
118 3300036401 Ga0373937_0008597 Ga0373937_0008597_2885_3280 123
119 3300046454 Ga0495592_0025661 Ga0495592_0025661_1277_1672 123
120 3300046462 Ga0495651_0001751 Ga0495651_0001751_12716_13111 123
121 3300046477 Ga0495664_0087080 Ga0495664_0087080_1189_1584 123
122 3300046511 Ga0495608_0017719 Ga0495608_0017719_2307_2702 123
123 3300046516 Ga0495628_0038949 Ga0495628_0038949_549_944 123
124 3300046529 Ga0495652_0004599 Ga0495652_0004599_7913_8308 123
125 3300046533 Ga0495640_0115085 Ga0495640_0115085_834_1229 123
126 3300046536 Ga0495587_0000971 Ga0495587_0000971_6581_6976 123
127 3300046559 Ga0495667_0000874 Ga0495667_0000874_10160_10555 123
128 3300046663 Ga0495635_0001572 Ga0495635_0001572_4756_5151 123
129 3300046675 Ga0495657_0014880 Ga0495657_0014880_2596_2991 123
130 3300046678 Ga0495599_0025198 Ga0495599_0025198_2084_2479 123
131 3300046679 Ga0495623_0105459 Ga0495623_0105459_927_1322 123
132 3300046680 Ga0495646_0237112 Ga0495646_0237112_146_541 123
133 3300046809 Ga0495600_0000608 Ga0495600_0000608_10744_11139 123
134 3300047317 Ga0495604_0009632 Ga0495604_0009632_1025_1420 123
135 3300047322 Ga0495680_0001885 Ga0495680_0001885_7498_7893 123
136 3300047471 Ga0495684_0008904 Ga0495684_0008904_62_457 123
137 3300053085 Ga0495619_0012686 Ga0495619_0012686_1626_2021 123
138 3300028381 Ga0268264_11875096 Ga0268264_118750961 124
139 3300037068 Ga0373925_0035736 Ga0373925_0035736_1540_1935 124
140 3300013307 Ga0157372_10496678 Ga0157372_104966782 125
141 3300014325 Ga0163163_10887502 Ga0163163_108875022 125
142 3300048903 Ga0496100_1134469 Ga0496100_1134469_154_531 125
143 3300048904 Ga0496101_0132337 Ga0496101_0132337_725_1102 125
144 3300048905 Ga0496102_0210403 Ga0496102_0210403_1366_1743 125
145 3300048907 Ga0496104_0011442 Ga0496104_0011442_831_1208 125
146 3300048908 Ga0496105_0006593 Ga0496105_0006593_1021_1398 125
147 3300048911 Ga0496108_0026910 Ga0496108_0026910_787_1164 125
148 3300048912 Ga0496109_0007106 Ga0496109_0007106_1856_2233 125
149 3300048913 Ga0496110_0826360 Ga0496110_0826360_402_779 125
150 3300048914 Ga0496111_1047920 Ga0496111_1047920_133_510 125
151 3300048915 Ga0496112_0172894 Ga0496112_0172894_205_582 125
152 3300048916 Ga0496113_0032644 Ga0496113_0032644_2809_3186 125
153 3300048917 Ga0496114_0593475 Ga0496114_0593475_120_497 125
154 3300048918 Ga0496115_0776246 Ga0496115_0776246_331_708 125
155 3300050513 nmdc:mga0rr50_508850_c1 nmdc:mga0rr50_508850_c1_443_820 125
156 3300037466 Ga0395898_0155358 Ga0395898_0155358_1568_1948 126
157 3300037471 Ga0395905_0807630 Ga0395905_0807630_220_600 126
158 3300041491 Ga0451833_0559030 Ga0451833_0559030_453_833 126
159 3300041494 Ga0451837_0893633 Ga0451837_0893633_731_1111 126
160 3300041505 Ga0451849_0857728 Ga0451849_0857728_98_478 126
161 3300041512 Ga0451853_3846188 Ga0451853_3846188_182_562 126
162 3300041999 Ga0439433_0009175 Ga0439433_0009175_1181_1561 126
163 3300042005 Ga0439448_0008287 Ga0439448_0008287_649_1029 126
164 3300042005 Ga0439448_0151261 Ga0439448_0151261_88_468 126
165 3300042011 Ga0439454_007571 Ga0439454_007571_375_755 126
166 3300042012 Ga0439455_0000547 Ga0439455_0000547_3479_3859 126
167 3300042122 Ga0450920_011782 Ga0450920_011782_274_654 126
168 3300042131 Ga0450894_000248 Ga0450894_000248_3157_3537 126
169 3300042133 Ga0450896_016078 Ga0450896_016078_250_630 126
170 3300042135 Ga0450899_000065 Ga0450899_000065_557_937 126
171 3300042137 Ga0450902_059245 Ga0450902_059245_82_462 126
172 3300042138 Ga0450903_000221 Ga0450903_000221_6034_6414 126
173 3300042138 Ga0450903_005187 Ga0450903_005187_1059_1439 126
174 3300042145 Ga0450906_005432 Ga0450906_005432_1358_1738 126
175 3300042157 Ga0439458_0002329 Ga0439458_0002329_1084_1464 126
176 3300042184 Ga0450908_005929 Ga0450908_005929_1774_2154 126
177 3300046454 Ga0495592_0003676 Ga0495592_0003676_5659_6039 126
178 3300046454 Ga0495592_0011647 Ga0495592_0011647_271_651 126
179 3300046455 Ga0495603_0019429 Ga0495603_0019429_2161_2541 126
180 3300046455 Ga0495603_0026012 Ga0495603_0026012_1963_2343 126
181 3300046455 Ga0495603_0099555 Ga0495603_0099555_589_969 126
182 3300046459 Ga0495629_0099100 Ga0495629_0099100_109_489 126
183 3300046459 Ga0495629_0122125 Ga0495629_0122125_268_648 126
184 3300046459 Ga0495629_0147699 Ga0495629_0147699_440_820 126
185 3300046462 Ga0495651_0004593 Ga0495651_0004593_1142_1522 126
186 3300046462 Ga0495651_0008099 Ga0495651_0008099_6199_6579 126
187 3300046475 Ga0495639_0005142 Ga0495639_0005142_3469_3849 126
188 3300046476 Ga0495662_0031746 Ga0495662_0031746_1413_1793 126
189 3300046476 Ga0495662_0096022 Ga0495662_0096022_983_1363 126
190 3300046476 Ga0495662_0224819 Ga0495662_0224819_267_647 126
191 3300046477 Ga0495664_0000982 Ga0495664_0000982_9280_9660 126
192 3300046499 Ga0495594_0055352 Ga0495594_0055352_110_490 126
193 3300046499 Ga0495594_0164135 Ga0495594_0164135_246_626 126
194 3300046499 Ga0495594_0245011 Ga0495594_0245011_455_835 126
195 3300046499 Ga0495594_0507841 Ga0495594_0507841_81_461 126
196 3300046514 Ga0495618_0039491 Ga0495618_0039491_1812_2192 126
197 3300046515 Ga0495620_0107619 Ga0495620_0107619_486_866 126
198 3300046516 Ga0495628_0227746 Ga0495628_0227746_992_1372 126
199 3300046517 Ga0495630_0012111 Ga0495630_0012111_3571_3951 126
200 3300046526 Ga0495666_0068813 Ga0495666_0068813_676_1056 126
201 3300046526 Ga0495666_0384319 Ga0495666_0384319_185_565 126
202 3300046529 Ga0495652_0007058 Ga0495652_0007058_6445_6825 126
203 3300046529 Ga0495652_0076268 Ga0495652_0076268_993_1373 126
204 3300046533 Ga0495640_0010606 Ga0495640_0010606_6383_6763 126
205 3300046536 Ga0495587_0008065 Ga0495587_0008065_760_1140 126
206 3300046538 Ga0495609_0137205 Ga0495609_0137205_137_517 126
207 3300046543 Ga0495645_0088163 Ga0495645_0088163_1367_1747 126
208 3300046543 Ga0495645_0115562 Ga0495645_0115562_1151_1531 126
209 3300046557 Ga0495622_0022160 Ga0495622_0022160_2148_2528 126
210 3300046558 Ga0495633_0309358 Ga0495633_0309358_12_392 126
211 3300046559 Ga0495667_0080239 Ga0495667_0080239_715_1095 126
212 3300046615 Ga0495656_0034061 Ga0495656_0034061_1654_2034 126
213 3300046616 Ga0495668_0597230 Ga0495668_0597230_193_573 126
214 3300046642 Ga0495634_0002168 Ga0495634_0002168_6112_6492 126
215 3300046642 Ga0495634_0260768 Ga0495634_0260768_372_752 126
216 3300046648 Ga0495611_0323614 Ga0495611_0323614_72_452 126
217 3300046660 Ga0495625_0073344 Ga0495625_0073344_1794_2174 126
218 3300046660 Ga0495625_0110897 Ga0495625_0110897_72_452 126
219 3300046660 Ga0495625_0147263 Ga0495625_0147263_804_1184 126
220 3300046660 Ga0495625_0414327 Ga0495625_0414327_54_434 126
221 3300046663 Ga0495635_0010278 Ga0495635_0010278_983_1363 126
222 3300046663 Ga0495635_0217987 Ga0495635_0217987_370_750 126
223 3300046664 Ga0495659_0048127 Ga0495659_0048127_511_891 126
224 3300046665 Ga0495661_0153711 Ga0495661_0153711_98_478 126
225 3300046674 Ga0495588_0013464 Ga0495588_0013464_1559_1939 126
226 3300046674 Ga0495588_0063593 Ga0495588_0063593_1265_1645 126
227 3300046674 Ga0495588_0332117 Ga0495588_0332117_97_477 126
228 3300046675 Ga0495657_0010270 Ga0495657_0010270_5184_5564 126
229 3300046675 Ga0495657_0019959 Ga0495657_0019959_4381_4761 126
230 3300046678 Ga0495599_0137333 Ga0495599_0137333_905_1285 126
231 3300046679 Ga0495623_0031400 Ga0495623_0031400_1875_2255 126
232 3300046679 Ga0495623_0698019 Ga0495623_0698019_27_407 126
233 3300046680 Ga0495646_0047289 Ga0495646_0047289_1493_1873 126
234 3300046683 Ga0495658_0130813 Ga0495658_0130813_100_480 126
235 3300046689 Ga0495613_0001401 Ga0495613_0001401_1707_2087 126
236 3300046689 Ga0495613_0010252 Ga0495613_0010252_5170_5550 126
237 3300046689 Ga0495613_0077307 Ga0495613_0077307_1838_2218 126
238 3300046690 Ga0495624_0379456 Ga0495624_0379456_101_481 126
239 3300046692 Ga0495671_0273986 Ga0495671_0273986_216_596 126
240 3300046692 Ga0495671_0401508 Ga0495671_0401508_258_638 126
241 3300046694 Ga0495649_0327196 Ga0495649_0327196_43_423 126
242 3300046794 Ga0495589_0014878 Ga0495589_0014878_1673_2053 126
243 3300046809 Ga0495600_0153973 Ga0495600_0153973_525_905 126
244 3300046809 Ga0495600_0324118 Ga0495600_0324118_218_598 126
245 3300046809 Ga0495600_0393451 Ga0495600_0393451_271_651 126
246 3300047315 Ga0495581_0010139 Ga0495581_0010139_3451_3831 126
247 3300047315 Ga0495581_0211011 Ga0495581_0211011_61_441 126
248 3300047317 Ga0495604_0008150 Ga0495604_0008150_4973_5353 126
249 3300047317 Ga0495604_0061583 Ga0495604_0061583_746_1126 126
250 3300047318 Ga0495636_0007858 Ga0495636_0007858_2534_2914 126
251 3300047318 Ga0495636_0011299 Ga0495636_0011299_2259_2639 126
252 3300047321 Ga0495676_0014968 Ga0495676_0014968_1359_1739 126
253 3300047321 Ga0495676_0038934 Ga0495676_0038934_3453_3833 126
254 3300047321 Ga0495676_1030334 Ga0495676_1030334_48_428 126
255 3300047443 Ga0495687_017227 Ga0495687_017227_2353_2733 126
256 3300047443 Ga0495687_068270 Ga0495687_068270_589_969 126
257 3300047444 Ga0495675_0019097 Ga0495675_0019097_3609_3989 126
258 3300047444 Ga0495675_0037771 Ga0495675_0037771_1902_2282 126
259 3300047444 Ga0495675_0104000 Ga0495675_0104000_271_651 126
260 3300047447 Ga0495685_003724 Ga0495685_003724_493_873 126
261 3300047447 Ga0495685_008069 Ga0495685_008069_1581_1961 126
262 3300047447 Ga0495685_028643 Ga0495685_028643_1467_1847 126
263 3300047447 Ga0495685_031441 Ga0495685_031441_146_526 126
264 3300047447 Ga0495685_039951 Ga0495685_039951_85_465 126
265 3300047470 Ga0495681_0163757 Ga0495681_0163757_166_546 126
266 3300047471 Ga0495684_0056193 Ga0495684_0056193_1193_1573 126
267 3300047673 Ga0495593_0028253 Ga0495593_0028253_779_1159 126
268 3300047673 Ga0495593_0572064 Ga0495593_0572064_156_536 126
269 3300048088 Ga0495602_0072862 Ga0495602_0072862_932_1312 126
270 3300048089 Ga0495614_0020793 Ga0495614_0020793_226_606 126
271 3300048089 Ga0495614_0023309 Ga0495614_0023309_892_1272 126
272 3300048089 Ga0495614_0251233 Ga0495614_0251233_373_753 126
273 3300048908 Ga0496105_1018356 Ga0496105_1018356_19_399 126
274 3300048909 Ga0496106_0446778 Ga0496106_0446778_42_422 126
275 3300048911 Ga0496108_0474173 Ga0496108_0474173_517_897 126
276 3300048912 Ga0496109_0212314 Ga0496109_0212314_747_1127 126
277 3300048929 Ga0496126_1171235 Ga0496126_1171235_50_430 126
278 3300049568 Ga0501031_0559393 Ga0501031_0559393_64_444 126
279 3300049569 Ga0501032_0310780 Ga0501032_0310780_182_562 126
280 3300049569 Ga0501032_0722891 Ga0501032_0722891_62_442 126
281 3300049570 Ga0501033_0455258 Ga0501033_0455258_452_832 126
282 3300049570 Ga0501033_0839767 Ga0501033_0839767_35_415 126
283 3300049571 Ga0501034_1237624 Ga0501034_1237624_60_440 126
284 3300049571 Ga0501034_1264609 Ga0501034_1264609_70_450 126
285 3300049572 Ga0501036_0130138 Ga0501036_0130138_891_1271 126
286 3300049573 Ga0501037_0567526 Ga0501037_0567526_89_469 126
287 3300049573 Ga0501037_0988702 Ga0501037_0988702_22_402 126
288 3300049574 Ga0501038_0049772 Ga0501038_0049772_1533_1913 126
289 3300049574 Ga0501038_0298198 Ga0501038_0298198_30_410 126
290 3300049574 Ga0501038_0368899 Ga0501038_0368899_63_443 126
291 3300049579 Ga0501043_0006539 Ga0501043_0006539_7404_7784 126
292 3300049579 Ga0501043_0074611 Ga0501043_0074611_2273_2653 126
293 3300049581 Ga0501047_0000309 Ga0501047_0000309_55435_55815 126
294 3300049581 Ga0501047_0205439 Ga0501047_0205439_757_1137 126
295 3300049581 Ga0501047_0448019 Ga0501047_0448019_709_1089 126
296 3300049581 Ga0501047_1018267 Ga0501047_1018267_218_598 126
297 3300049583 Ga0501067_0679780 Ga0501067_0679780_86_466 126
298 3300049585 Ga0501069_0290303 Ga0501069_0290303_125_505 126
299 3300049652 Ga0501202_092090 Ga0501202_092090_335_715 126
300 3300049742 Ga0501080_0477851 Ga0501080_0477851_321_701 126
301 3300049822 Ga0501035_0038843 Ga0501035_0038843_3178_3558 126
302 3300049822 Ga0501035_0102652 Ga0501035_0102652_217_597 126
303 3300049822 Ga0501035_0330293 Ga0501035_0330293_54_434 126
304 3300049822 Ga0501035_1044827 Ga0501035_1044827_198_578 126
305 3300049823 Ga0501044_0011335 Ga0501044_0011335_9224_9604 126
306 3300049823 Ga0501044_0149727 Ga0501044_0149727_50_430 126
307 3300049823 Ga0501044_1626955 Ga0501044_1626955_102_482 126
308 3300050490 nmdc:mga03n38_26447_c1 nmdc:mga03n38_26447_c1_1397_1777 126
309 3300050490 nmdc:mga03n38_90224_c1 nmdc:mga03n38_90224_c1_190_570 126
310 3300050496 nmdc:mga07m45_290091_c1 nmdc:mga07m45_290091_c1_308_688 126
311 3300053085 Ga0495619_0352830 Ga0495619_0352830_512_892 126
312 3300053095 Ga0500640_018388 Ga0500640_018388_1379_1759 126
313 3300053111 Ga0500572_020073 Ga0500572_020073_573_953 126
314 3300053123 Ga0500614_003947 Ga0500614_003947_1504_1884 126
315 3300053140 Ga0500573_0064507 Ga0500573_0064507_1052_1432 126
316 iso_pu_bacteria 2547132111 2547409550 128
317 iso_pu_bacteria 2554235005 2554258940 128
318 iso_pu_bacteria 2582581312 2585299834 128
319 iso_pu_bacteria 2582581313 2585306840 128
320 iso_pu_bacteria 2616644814 2616694324 128
321 iso_pu_bacteria 2616644941 2616899469 128
322 iso_pu_bacteria 2643221548 2643759343 128
323 iso_pu_bacteria 2643221587 2643945118 128
324 iso_pu_bacteria 2643221601 2644015064 128
325 iso_pu_bacteria 2643221631 2644176852 128
326 iso_pu_bacteria 2643221647 2644265504 128
327 iso_pu_bacteria 2643221670 2644387350 128
328 iso_pu_bacteria 2643221673 2644408558 128
329 iso_pu_bacteria 2643221677 2644432017 128
330 iso_pu_bacteria 2643221678 2644435819 128
331 iso_pu_bacteria 2643221682 2644463239 128
332 iso_pu_bacteria 2643221714 2644629354 128
333 iso_pu_bacteria 2784132148 2784587423 128
334 iso_pu_bacteria 2784746763 2785344906 128
335 iso_pu_bacteria 2784746768 2785367971 128
336 iso_pu_bacteria 2786546132 2786669022 128
337 iso_pu_bacteria 2791355406 2793981926 128
338 iso_pu_bacteria 2808606359 2808840630 128
339 iso_pu_bacteria 2808606375 2808919213 128
340 iso_pu_bacteria 2808606448 2809230996 128
341 iso_pu_bacteria 2808606982 2811847640 128
342 iso_pu_bacteria 2811994879 2812359551 128
343 iso_pu_bacteria 2818991463 2819694078 128
344 iso_pu_bacteria 2818991472 2819743215 128
345 iso_pu_bacteria 2862178590 2862182909 128
346 iso_pu_bacteria 2862281513 2862288643 128
347 iso_pu_bacteria 2862382967 2862384707 128
348 iso_pu_bacteria 2863404153 2863406169 128
349 iso_pu_bacteria 2867428634 2867432592 128
350 iso_pu_bacteria 2867475112 2867477560 128
351 iso_pu_bacteria 2873151551 2873156980 128
352 iso_pu_bacteria 2875391855 2875393357 128
353 iso_pu_bacteria 2877676314 2877682573 128
354 iso_pu_bacteria 2912723979 2912725445 128
355 iso_pu_bacteria 2912757875 2912759547 128
356 iso_pu_bacteria 2918501144 2918503230 128
357 iso_pu_bacteria 2919468124 2919468180 128
358 iso_pu_bacteria 2935390628 2935395955 128
359 iso_pu_bacteria 2946045630 2946051335 128
360 iso_pu_bacteria 2946064051 2946066359 128
361 iso_pu_bacteria 2946072368 2946074624 128
362 iso_pu_bacteria 2947224130 2947231016 128
363 iso_pu_bacteria 2954002825 2954004325 128
364 iso_pu_bacteria 2954380949 2954387770 128
365 iso_pu_bacteria 2954673503 2954675305 128
366 iso_pu_bacteria 2954682443 2954688828 128
367 iso_pu_bacteria 2954691527 2954698582 128
368 iso_pu_bacteria 2954701450 2954703643 128
369 iso_pu_bacteria 2954711539 2954717556 128
370 iso_pu_bacteria 2954721474 2954727520 128
371 iso_pu_bacteria 2954731030 2954734280 128
372 iso_pu_bacteria 2954740390 2954746416 128
373 iso_pu_bacteria 2954749733 2954753164 128
374 iso_pu_bacteria 2954759201 2954765531 128
375 iso_pu_bacteria 2966598605 2966603702 128
376 iso_pu_bacteria 2990088156 2990088442 128
377 iso_pu_bacteria 2997451912 2997458507 128
378 iso_pu_bacteria 2997600082 2997606550 128
379 iso_pu_bacteria 3006321560 3006322475 128
380 iso_pu_bacteria 3006393351 3006395113 128
381 iso_pu_bacteria 3006425503 3006427693 128
382 iso_pu_bacteria 3006486233 3006489171 128
383 iso_pu_bacteria 8008558824 8008562146 128
384 iso_pu_bacteria 8008574985 8008580042 128
385 iso_pu_bacteria 8023623736 8023627465 128
386 iso_pu_bacteria 8025413630 8025414078 128
387 iso_pu_bacteria 8025478263 8025485902 128
388 iso_pu_bacteria 8025530807 8025534788 128
389 iso_pu_bacteria 8033684223 8033689685 128
390 iso_pu_bacteria 8047893842 8047899577 128
391 iso_pu_bacteria 8048127548 8048136203 128
392 iso_pu_bacteria 8048356638 8048359352 128
393 iso_pu_bacteria 8048369669 8048376527 128
394 iso_pu_bacteria 8048379754 8048385580 128
395 iso_pu_bacteria 8048406513 8048409010 128
396 iso_pu_bacteria 8054160619 8054167291 128
397 iso_pu_bacteria 8056447290 8056449797 128
398 iso_pu_bacteria 8056667051 8056672460 128
399 iso_pu_bacteria 8056829672 8056835875 128
400 3300041486 Ga0451807_1437455 Ga0451807_1437455_130_522 130
401 3300005329 Ga0070683_100232527 Ga0070683_1002325272 131
402 3300005330 Ga0070690_100157618 Ga0070690_1001576182 131
403 3300005335 Ga0070666_10782452 Ga0070666_107824521 131
404 3300005338 Ga0068868_100096697 Ga0068868_1000966972 131
405 3300005341 Ga0070691_10121304 Ga0070691_101213042 131
406 3300005356 Ga0070674_100815649 Ga0070674_1008156491 131
407 3300005435 Ga0070714_100415010 Ga0070714_1004150102 131
408 3300005435 Ga0070714_101168693 Ga0070714_1011686932 131
409 3300005436 Ga0070713_101329880 Ga0070713_1013298802 131
410 3300005436 Ga0070713_101566211 Ga0070713_1015662111 131
411 3300005437 Ga0070710_10063880 Ga0070710_100638802 131
412 3300005437 Ga0070710_10070403 Ga0070710_100704032 131
413 3300005437 Ga0070710_10156338 Ga0070710_101563382 131
414 3300005438 Ga0070701_10193181 Ga0070701_101931812 131
415 3300005439 Ga0070711_100682644 Ga0070711_1006826442 131
416 3300005439 Ga0070711_100745177 Ga0070711_1007451771 131
417 3300005440 Ga0070705_100539722 Ga0070705_1005397222 131
418 3300005440 Ga0070705_101339695 Ga0070705_1013396951 131
419 3300005441 Ga0070700_100734676 Ga0070700_1007346762 131
420 3300005444 Ga0070694_100270047 Ga0070694_1002700472 131
421 3300005445 Ga0070708_100773111 Ga0070708_1007731111 131
422 3300005455 Ga0070663_100285765 Ga0070663_1002857652 131
423 3300005455 Ga0070663_101060980 Ga0070663_1010609802 131
424 3300005456 Ga0070678_100472609 Ga0070678_1004726092 131
425 3300005458 Ga0070681_10748763 Ga0070681_107487632 131
426 3300005468 Ga0070707_100250493 Ga0070707_1002504933 131
427 3300005468 Ga0070707_101001633 Ga0070707_1010016331 131
428 3300005518 Ga0070699_100980870 Ga0070699_1009808702 131
429 3300005530 Ga0070679_100373511 Ga0070679_1003735112 131
430 3300005536 Ga0070697_101284011 Ga0070697_1012840111 131
431 3300005539 Ga0068853_100688180 Ga0068853_1006881802 131
432 3300005539 Ga0068853_101611655 Ga0068853_1016116552 131
433 3300005544 Ga0070686_101096939 Ga0070686_1010969391 131
434 3300005545 Ga0070695_100218855 Ga0070695_1002188552 131
435 3300005546 Ga0070696_101077107 Ga0070696_1010771071 131
436 3300005547 Ga0070693_100638548 Ga0070693_1006385481 131
437 3300005548 Ga0070665_100654524 Ga0070665_1006545242 131
438 3300005548 Ga0070665_101914105 Ga0070665_1019141051 131
439 3300005549 Ga0070704_100515381 Ga0070704_1005153811 131
440 3300005563 Ga0068855_100256677 Ga0068855_1002566772 131
441 3300005577 Ga0068857_100552564 Ga0068857_1005525642 131
442 3300005578 Ga0068854_101474545 Ga0068854_1014745451 131
443 3300005614 Ga0068856_100199674 Ga0068856_1001996742 131
444 3300005614 Ga0068856_100220181 Ga0068856_1002201813 131
445 3300005614 Ga0068856_100314133 Ga0068856_1003141332 131
446 3300005614 Ga0068856_100710313 Ga0068856_1007103132 131
447 3300005616 Ga0068852_101175869 Ga0068852_1011758692 131
448 3300005617 Ga0068859_100581934 Ga0068859_1005819342 131
449 3300005618 Ga0068864_100185388 Ga0068864_1001853882 131
450 3300005618 Ga0068864_100395102 Ga0068864_1003951022 131
451 3300005841 Ga0068863_101399911 Ga0068863_1013999111 131
452 3300005842 Ga0068858_100168938 Ga0068858_1001689381 131
453 3300005843 Ga0068860_100169169 Ga0068860_1001691692 131
454 3300006028 Ga0070717_10145929 Ga0070717_101459292 131
455 3300006028 Ga0070717_10152638 Ga0070717_101526383 131
456 3300006028 Ga0070717_10416878 Ga0070717_104168782 131
457 3300006028 Ga0070717_10431826 Ga0070717_104318262 131
458 3300006028 Ga0070717_11551942 Ga0070717_115519422 131
459 3300006163 Ga0070715_10136968 Ga0070715_101369682 131
460 3300006173 Ga0070716_100021613 Ga0070716_1000216132 131
461 3300006173 Ga0070716_100116385 Ga0070716_1001163853 131
462 3300006173 Ga0070716_100998583 Ga0070716_1009985831 131
463 3300006175 Ga0070712_100175413 Ga0070712_1001754132 131
464 3300006175 Ga0070712_101735317 Ga0070712_1017353171 131
465 3300006237 Ga0097621_100035028 Ga0097621_1000350284 131
466 3300006358 Ga0068871_100549517 Ga0068871_1005495171 131
467 3300006852 Ga0075433_10228262 Ga0075433_102282622 131
468 3300006871 Ga0075434_100303322 Ga0075434_1003033222 131
469 3300006914 Ga0075436_100341639 Ga0075436_1003416392 131
470 3300006931 Ga0097620_100581946 Ga0097620_1005819462 131
471 3300007076 Ga0075435_100328982 Ga0075435_1003289822 131
472 3300007076 Ga0075435_100479819 Ga0075435_1004798192 131
473 3300009098 Ga0105245_10205700 Ga0105245_102057003 131
474 3300009101 Ga0105247_10041300 Ga0105247_100413002 131
475 3300009101 Ga0105247_11405408 Ga0105247_114054081 131
476 3300009147 Ga0114129_10419267 Ga0114129_104192672 131
477 3300009177 Ga0105248_10082744 Ga0105248_100827443 131
478 3300009551 Ga0105238_10063263 Ga0105238_100632631 131
479 3300010375 Ga0105239_10877518 Ga0105239_108775182 131
480 3300013100 Ga0157373_10369307 Ga0157373_103693071 131
481 3300013104 Ga0157370_10246205 Ga0157370_102462052 131
482 3300013105 Ga0157369_10243976 Ga0157369_102439762 131
483 3300013296 Ga0157374_10029298 Ga0157374_100292985 131
484 3300013297 Ga0157378_11055785 Ga0157378_110557852 131
485 3300013306 Ga0163162_10473298 Ga0163162_104732982 131
486 3300013307 Ga0157372_10165322 Ga0157372_101653222 131
487 3300013307 Ga0157372_10600373 Ga0157372_106003732 131
488 3300013308 Ga0157375_10911352 Ga0157375_109113521 131
489 3300014325 Ga0163163_10374178 Ga0163163_103741781 131
490 3300014968 Ga0157379_10408996 Ga0157379_104089963 131
491 3300014969 Ga0157376_10438083 Ga0157376_104380833 131
492 3300014969 Ga0157376_11472922 Ga0157376_114729221 131
493 3300020082 Ga0206353_11194541 Ga0206353_111945411 131
494 3300022467 Ga0224712_10214579 Ga0224712_102145792 131
495 3300025898 Ga0207692_10035420 Ga0207692_100354202 131
496 3300025898 Ga0207692_10130107 Ga0207692_101301073 131
497 3300025900 Ga0207710_10139366 Ga0207710_101393661 131
498 3300025903 Ga0207680_10350480 Ga0207680_103504802 131
499 3300025905 Ga0207685_10000617 Ga0207685_100006178 131
500 3300025905 Ga0207685_10021217 Ga0207685_100212174 131
501 3300025906 Ga0207699_10016013 Ga0207699_100160136 131
502 3300025906 Ga0207699_10050003 Ga0207699_100500032 131
503 3300025906 Ga0207699_10080229 Ga0207699_100802292 131
504 3300025912 Ga0207707_10839142 Ga0207707_108391421 131
505 3300025915 Ga0207693_10305562 Ga0207693_103055621 131
506 3300025915 Ga0207693_10670823 Ga0207693_106708232 131
507 3300025916 Ga0207663_10042260 Ga0207663_100422602 131
508 3300025916 Ga0207663_10468322 Ga0207663_104683221 131
509 3300025921 Ga0207652_10217722 Ga0207652_102177222 131
510 3300025922 Ga0207646_10343557 Ga0207646_103435573 131
511 3300025922 Ga0207646_10821819 Ga0207646_108218191 131
512 3300025924 Ga0207694_10074643 Ga0207694_100746433 131
513 3300025927 Ga0207687_10291719 Ga0207687_102917192 131
514 3300025928 Ga0207700_10040668 Ga0207700_100406682 131
515 3300025928 Ga0207700_10177676 Ga0207700_101776762 131
516 3300025928 Ga0207700_10362385 Ga0207700_103623851 131
517 3300025928 Ga0207700_10370502 Ga0207700_103705022 131
518 3300025928 Ga0207700_11615974 Ga0207700_116159742 131
519 3300025929 Ga0207664_10002431 Ga0207664_100024318 131
520 3300025929 Ga0207664_10293459 Ga0207664_102934592 131
521 3300025937 Ga0207669_10580090 Ga0207669_105800902 131
522 3300025939 Ga0207665_10005691 Ga0207665_100056918 131
523 3300025939 Ga0207665_10069009 Ga0207665_100690092 131
524 3300025939 Ga0207665_10107304 Ga0207665_101073041 131
525 3300025941 Ga0207711_10033686 Ga0207711_100336865 131
526 3300025949 Ga0207667_10259757 Ga0207667_102597572 131
527 3300026035 Ga0207703_10197920 Ga0207703_101979202 131
528 3300026041 Ga0207639_10621962 Ga0207639_106219622 131
529 3300026067 Ga0207678_10961883 Ga0207678_109618832 131
530 3300026075 Ga0207708_11233702 Ga0207708_112337021 131
531 3300026078 Ga0207702_10172594 Ga0207702_101725942 131
532 3300026078 Ga0207702_10516387 Ga0207702_105163872 131
533 3300026088 Ga0207641_12570403 Ga0207641_125704031 131
534 3300026095 Ga0207676_10113816 Ga0207676_101138163 131
535 3300026116 Ga0207674_10416833 Ga0207674_104168332 131
536 3300026121 Ga0207683_10735870 Ga0207683_107358701 131
537 3300026142 Ga0207698_10727885 Ga0207698_107278851 131
538 3300028379 Ga0268266_10656977 Ga0268266_106569772 131
539 3300028379 Ga0268266_11959708 Ga0268266_119597081 131
540 3300028381 Ga0268264_10188299 Ga0268264_101882992 131
541 3300034819 Ga0373958_0019233 Ga0373958_0019233_841_1236 131
542 3300034819 Ga0373958_0099970 Ga0373958_0099970_77_472 131
543 3300034957 Ga0373938_0222684 Ga0373938_0222684_17_412 131
544 3300035084 Ga0373928_0086852 Ga0373928_0086852_206_601 131
545 3300035088 Ga0373940_0001079 Ga0373940_0001079_3369_3764 131
546 3300035089 Ga0373944_0035080 Ga0373944_0035080_1015_1410 131
547 3300035089 Ga0373944_0037257 Ga0373944_0037257_510_905 131
548 3300035090 Ga0373949_0247144 Ga0373949_0247144_55_450 131
549 3300035111 Ga0373923_0058642 Ga0373923_0058642_98_493 131
550 3300035111 Ga0373923_0100581 Ga0373923_0100581_394_789 131
551 3300035111 Ga0373923_0695930 Ga0373923_0695930_65_460 131
552 3300035112 Ga0373932_0121483 Ga0373932_0121483_243_638 131
553 3300035113 Ga0373936_0043708 Ga0373936_0043708_1133_1528 131
554 3300035114 Ga0373939_0023720 Ga0373939_0023720_104_499 131
555 3300035117 Ga0373953_0078809 Ga0373953_0078809_85_480 131
556 3300035118 Ga0373954_0053801 Ga0373954_0053801_1066_1461 131
557 3300035118 Ga0373954_0181928 Ga0373954_0181928_70_465 131
558 3300035119 Ga0373956_0142941 Ga0373956_0142941_64_459 131
559 3300035120 Ga0373957_0009130 Ga0373957_0009130_1559_1954 131
560 3300035120 Ga0373957_0013939 Ga0373957_0013939_1766_2161 131
561 3300035170 Ga0373943_0035744 Ga0373943_0035744_766_1161 131
562 3300035170 Ga0373943_0112152 Ga0373943_0112152_839_1234 131
563 3300035170 Ga0373943_0251485 Ga0373943_0251485_91_486 131
564 3300035171 Ga0373946_0038220 Ga0373946_0038220_328_723 131
565 3300035172 Ga0373955_0075849 Ga0373955_0075849_40_435 131
566 3300035207 Ga0373942_0046238 Ga0373942_0046238_471_866 131
567 3300035241 Ga0373961_0004920 Ga0373961_0004920_2798_3193 131
568 3300035242 Ga0373962_0102583 Ga0373962_0102583_360_755 131
569 3300035410 Ga0373924_0005316 Ga0373924_0005316_2745_3140 131
570 3300035410 Ga0373924_0140211 Ga0373924_0140211_102_497 131
571 3300035691 Ga0373931_0004178 Ga0373931_0004178_454_849 131
572 3300035691 Ga0373931_0908804 Ga0373931_0908804_32_427 131
573 3300035692 Ga0373935_0237812 Ga0373935_0237812_265_660 131
574 3300035695 Ga0373927_0269358 Ga0373927_0269358_228_623 131
575 3300035724 Ga0373933_0035789 Ga0373933_0035789_1066_1461 131
576 3300035725 Ga0373947_0385115 Ga0373947_0385115_471_866 131
577 3300035725 Ga0373947_0933184 Ga0373947_0933184_118_513 131
578 3300036401 Ga0373937_0104649 Ga0373937_0104649_1363_1758 131
579 3300036401 Ga0373937_0267986 Ga0373937_0267986_1108_1503 131
580 3300036459 Ga0372808_013077 Ga0372808_013077_349_744 131
581 3300037068 Ga0373925_0176576 Ga0373925_0176576_1063_1458 131
582 3300037068 Ga0373925_0812223 Ga0373925_0812223_22_417 131
583 3300041512 Ga0451853_1793210 Ga0451853_1793210_28_423 131
584 3300046454 Ga0495592_0012279 Ga0495592_0012279_3430_3825 131
585 3300046455 Ga0495603_0328122 Ga0495603_0328122_273_668 131
586 3300046459 Ga0495629_0062319 Ga0495629_0062319_1390_1785 131
587 3300046459 Ga0495629_0123116 Ga0495629_0123116_157_552 131
588 3300046459 Ga0495629_0146099 Ga0495629_0146099_844_1239 131
589 3300046461 Ga0495641_0013023 Ga0495641_0013023_256_651 131
590 3300046462 Ga0495651_0039883 Ga0495651_0039883_2078_2473 131
591 3300046462 Ga0495651_0327337 Ga0495651_0327337_276_671 131
592 3300046462 Ga0495651_0443265 Ga0495651_0443265_19_414 131
593 3300046463 Ga0495653_0098376 Ga0495653_0098376_1363_1758 131
594 3300046463 Ga0495653_0408537 Ga0495653_0408537_45_440 131
595 3300046463 Ga0495653_0603440 Ga0495653_0603440_260_655 131
596 3300046472 Ga0495580_0211751 Ga0495580_0211751_795_1190 131
597 3300046473 Ga0495582_0068408 Ga0495582_0068408_510_905 131
598 3300046473 Ga0495582_0614406 Ga0495582_0614406_75_470 131
599 3300046475 Ga0495639_0562663 Ga0495639_0562663_143_538 131
600 3300046476 Ga0495662_0037224 Ga0495662_0037224_833_1228 131
601 3300046476 Ga0495662_0148741 Ga0495662_0148741_402_797 131
602 3300046477 Ga0495664_0007816 Ga0495664_0007816_474_869 131
603 3300046477 Ga0495664_0046058 Ga0495664_0046058_340_735 131
604 3300046499 Ga0495594_0544064 Ga0495594_0544064_76_471 131
605 3300046511 Ga0495608_0014967 Ga0495608_0014967_3542_3937 131
606 3300046511 Ga0495608_0031694 Ga0495608_0031694_2259_2654 131
607 3300046514 Ga0495618_0162245 Ga0495618_0162245_478_873 131
608 3300046514 Ga0495618_0225666 Ga0495618_0225666_569_964 131
609 3300046516 Ga0495628_0114002 Ga0495628_0114002_1293_1688 131
610 3300046517 Ga0495630_0058843 Ga0495630_0058843_1826_2221 131
611 3300046517 Ga0495630_0134639 Ga0495630_0134639_322_717 131
612 3300046529 Ga0495652_0022098 Ga0495652_0022098_2843_3238 131
613 3300046529 Ga0495652_0149665 Ga0495652_0149665_580_975 131
614 3300046529 Ga0495652_0189384 Ga0495652_0189384_955_1350 131
615 3300046529 Ga0495652_0335179 Ga0495652_0335179_114_509 131
616 3300046531 Ga0495665_0109325 Ga0495665_0109325_955_1350 131
617 3300046531 Ga0495665_0478440 Ga0495665_0478440_102_497 131
618 3300046533 Ga0495640_0014287 Ga0495640_0014287_2839_3234 131
619 3300046533 Ga0495640_0038056 Ga0495640_0038056_826_1221 131
620 3300046535 Ga0495586_0105937 Ga0495586_0105937_62_457 131
621 3300046536 Ga0495587_0007439 Ga0495587_0007439_2842_3237 131
622 3300046536 Ga0495587_0063365 Ga0495587_0063365_1216_1611 131
623 3300046543 Ga0495645_0108753 Ga0495645_0108753_484_879 131
624 3300046543 Ga0495645_0161733 Ga0495645_0161733_552_947 131
625 3300046543 Ga0495645_0262773 Ga0495645_0262773_138_533 131
626 3300046543 Ga0495645_0345696 Ga0495645_0345696_247_642 131
627 3300046559 Ga0495667_0099233 Ga0495667_0099233_580_975 131
628 3300046559 Ga0495667_0202979 Ga0495667_0202979_484_879 131
629 3300046559 Ga0495667_0405671 Ga0495667_0405671_125_520 131
630 3300046642 Ga0495634_0023741 Ga0495634_0023741_1088_1483 131
631 3300046642 Ga0495634_0096457 Ga0495634_0096457_1236_1631 131
632 3300046663 Ga0495635_0037557 Ga0495635_0037557_2868_3263 131
633 3300046675 Ga0495657_0087213 Ga0495657_0087213_1114_1509 131
634 3300046675 Ga0495657_0517831 Ga0495657_0517831_190_585 131
635 3300046678 Ga0495599_0015242 Ga0495599_0015242_1763_2158 131
636 3300046678 Ga0495599_0026500 Ga0495599_0026500_2849_3244 131
637 3300046679 Ga0495623_0034303 Ga0495623_0034303_32_427 131
638 3300046679 Ga0495623_0107473 Ga0495623_0107473_890_1285 131
639 3300046680 Ga0495646_0047994 Ga0495646_0047994_253_648 131
640 3300046680 Ga0495646_0108644 Ga0495646_0108644_620_1015 131
641 3300046681 Ga0495647_0027655 Ga0495647_0027655_1647_2042 131
642 3300046681 Ga0495647_0075628 Ga0495647_0075628_55_450 131
643 3300046683 Ga0495658_0064629 Ga0495658_0064629_1322_1717 131
644 3300046689 Ga0495613_0102531 Ga0495613_0102531_1597_1992 131
645 3300046690 Ga0495624_0068630 Ga0495624_0068630_1159_1554 131
646 3300046690 Ga0495624_0085813 Ga0495624_0085813_422_817 131
647 3300046809 Ga0495600_0142036 Ga0495600_0142036_95_490 131
648 3300047315 Ga0495581_0042806 Ga0495581_0042806_1234_1629 131
649 3300047315 Ga0495581_0138433 Ga0495581_0138433_593_988 131
650 3300047317 Ga0495604_0042455 Ga0495604_0042455_1259_1654 131
651 3300047317 Ga0495604_0081264 Ga0495604_0081264_770_1165 131
652 3300047319 Ga0495674_0120696 Ga0495674_0120696_350_745 131
653 3300047319 Ga0495674_0146574 Ga0495674_0146574_604_999 131
654 3300047319 Ga0495674_0195350 Ga0495674_0195350_904_1299 131
655 3300047321 Ga0495676_0140359 Ga0495676_0140359_467_862 131
656 3300047321 Ga0495676_0707702 Ga0495676_0707702_128_523 131
657 3300047322 Ga0495680_0026400 Ga0495680_0026400_1458_1853 131
658 3300047322 Ga0495680_0075219 Ga0495680_0075219_387_782 131
659 3300047444 Ga0495675_0087256 Ga0495675_0087256_133_528 131
660 3300047444 Ga0495675_0118855 Ga0495675_0118855_1139_1534 131
661 3300047471 Ga0495684_0012338 Ga0495684_0012338_2767_3162 131
662 3300047471 Ga0495684_0072549 Ga0495684_0072549_806_1201 131
663 3300047471 Ga0495684_0148003 Ga0495684_0148003_528_923 131
664 3300047471 Ga0495684_0233778 Ga0495684_0233778_514_909 131
665 3300047673 Ga0495593_0048248 Ga0495593_0048248_1206_1601 131
666 3300047673 Ga0495593_0537526 Ga0495593_0537526_11_406 131
667 3300048088 Ga0495602_0088568 Ga0495602_0088568_2164_2559 131
668 3300048088 Ga0495602_0134846 Ga0495602_0134846_1153_1548 131
669 3300048903 Ga0496100_0253128 Ga0496100_0253128_743_1138 131
670 3300048903 Ga0496100_0358053 Ga0496100_0358053_476_871 131
671 3300048904 Ga0496101_0107467 Ga0496101_0107467_1241_1636 131
672 3300048904 Ga0496101_0284848 Ga0496101_0284848_44_439 131
673 3300048905 Ga0496102_0058401 Ga0496102_0058401_475_870 131
674 3300048905 Ga0496102_1454266 Ga0496102_1454266_171_566 131
675 3300048906 Ga0496103_0236902 Ga0496103_0236902_226_621 131
676 3300048907 Ga0496104_0015675 Ga0496104_0015675_3840_4235 131
677 3300048907 Ga0496104_0093665 Ga0496104_0093665_624_1019 131
678 3300048908 Ga0496105_0003685 Ga0496105_0003685_10490_10885 131
679 3300048908 Ga0496105_0093819 Ga0496105_0093819_687_1082 131
680 3300048909 Ga0496106_0765174 Ga0496106_0765174_73_468 131
681 3300048910 Ga0496107_0327601 Ga0496107_0327601_617_1012 131
682 3300048911 Ga0496108_0097924 Ga0496108_0097924_1216_1611 131
683 3300048911 Ga0496108_0169951 Ga0496108_0169951_1165_1560 131
684 3300048912 Ga0496109_0098430 Ga0496109_0098430_2292_2687 131
685 3300048912 Ga0496109_0239622 Ga0496109_0239622_125_520 131
686 3300048913 Ga0496110_0484661 Ga0496110_0484661_617_1012 131
687 3300048914 Ga0496111_0314994 Ga0496111_0314994_334_729 131
688 3300048915 Ga0496112_0035310 Ga0496112_0035310_3038_3433 131
689 3300048915 Ga0496112_0374359 Ga0496112_0374359_469_864 131
690 3300048916 Ga0496113_0071570 Ga0496113_0071570_718_1113 131
691 3300048916 Ga0496113_0080300 Ga0496113_0080300_1529_1924 131
692 3300048917 Ga0496114_0008917 Ga0496114_0008917_1887_2282 131
693 3300048918 Ga0496115_0011366 Ga0496115_0011366_5540_5935 131
694 3300050507 nmdc:mga05p37_444118_c2 nmdc:mga05p37_444118_c2_427_822 131
695 3300050512 nmdc:mga0n895_242638_c1 nmdc:mga0n895_242638_c1_853_1248 131
696 3300050513 nmdc:mga0rr50_448446_c1 nmdc:mga0rr50_448446_c1_566_961 131
697 3300050513 nmdc:mga0rr50_918139_c1 nmdc:mga0rr50_918139_c1_99_494 131
698 3300050514 nmdc:mga08x19_74811_c1 nmdc:mga08x19_74811_c1_481_876 131
699 3300050515 nmdc:mga0a205_398235_c1 nmdc:mga0a205_398235_c1_653_1048 131
700 3300053077 Ga0495601_0031633 Ga0495601_0031633_1980_2375 131
701 3300053077 Ga0495601_0468132 Ga0495601_0468132_204_599 131
702 3300053078 Ga0495612_0073855 Ga0495612_0073855_91_486 131
703 3300053084 Ga0495595_0014625 Ga0495595_0014625_92_487 131
704 3300053084 Ga0495595_0022285 Ga0495595_0022285_2109_2504 131
705 3300053085 Ga0495619_0016508 Ga0495619_0016508_3732_4127 131
706 3300053085 Ga0495619_0153739 Ga0495619_0153739_380_775 131
707 3300001989 JGI24739J22299_10027731 JGI24739J22299_100277312 132
708 3300001990 JGI24737J22298_10042112 JGI24737J22298_100421122 132
709 3300002067 JGI24735J21928_10026388 JGI24735J21928_100263882 132
710 3300003323 rootH1_10005189 rootH1_100051892 132
711 3300003578 Ga0006562J51391_1053590 Ga0006562J51391_10535901 132
712 3300005471 Ga0070698_101818939 Ga0070698_1018189391 132
713 3300005539 Ga0068853_100048731 Ga0068853_1000487312 132
714 3300005548 Ga0070665_100521721 Ga0070665_1005217212 132
715 3300005937 Ga0081455_10004015 Ga0081455_1000401519 132
716 3300006042 Ga0075368_10004269 Ga0075368_100042695 132
717 3300006048 Ga0075363_100293472 Ga0075363_1002934722 132
718 3300006178 Ga0075367_10001041 Ga0075367_100010414 132
719 3300006353 Ga0075370_10301153 Ga0075370_103011532 132
720 3300006948 Ga0099826_10026285 Ga0099826_100262854 132
721 3300009011 Ga0105251_10128141 Ga0105251_101281412 132
722 3300009036 Ga0105244_10346535 Ga0105244_103465352 132
723 3300009092 Ga0105250_10005086 Ga0105250_100050868 132
724 3300009098 Ga0105245_11536281 Ga0105245_115362812 132
725 3300009101 Ga0105247_10172002 Ga0105247_101720021 132
726 3300009148 Ga0105243_10107336 Ga0105243_101073362 132
727 3300009148 Ga0105243_10557269 Ga0105243_105572692 132
728 3300009174 Ga0105241_10969262 Ga0105241_109692622 132
729 3300009174 Ga0105241_12052820 Ga0105241_120528202 132
730 3300009551 Ga0105238_12642113 Ga0105238_126421131 132
731 3300010375 Ga0105239_10972158 Ga0105239_109721582 132
732 3300011119 Ga0105246_10120144 Ga0105246_101201442 132
733 3300013105 Ga0157369_10718912 Ga0157369_107189122 132
734 3300013306 Ga0163162_10832576 Ga0163162_108325762 132
735 3300014497 Ga0182008_10001919 Ga0182008_100019195 132
736 3300014969 Ga0157376_10611808 Ga0157376_106118082 132
737 3300015262 Ga0182007_10000425 Ga0182007_1000042514 132
738 3300015688 Ga0183367_1007 Ga0183367_1007464 132
739 3300020610 Ga0154015_1326935 Ga0154015_13269352 132
740 3300025302 Ga0207426_1038873 Ga0207426_10388732 132
741 3300025302 Ga0207426_1040298 Ga0207426_10402982 132
742 3300025303 Ga0209051_1087522 Ga0209051_10875222 132
743 3300025735 Ga0207713_1010515 Ga0207713_10105152 132
744 3300025735 Ga0207713_1159922 Ga0207713_11599222 132
745 3300025904 Ga0207647_10149420 Ga0207647_101494202 132
746 3300025912 Ga0207707_10638188 Ga0207707_106381882 132
747 3300025933 Ga0207706_11594896 Ga0207706_115948961 132
748 3300025935 Ga0207709_10277773 Ga0207709_102777732 132
749 3300025940 Ga0207691_11519283 Ga0207691_115192831 132
750 3300025941 Ga0207711_11466409 Ga0207711_114664091 132
751 3300025945 Ga0207679_10319438 Ga0207679_103194382 132
752 3300025949 Ga0207667_10595109 Ga0207667_105951092 132
753 3300026041 Ga0207639_10030736 Ga0207639_100307365 132
754 3300026067 Ga0207678_10540379 Ga0207678_105403792 132
755 3300026078 Ga0207702_10851324 Ga0207702_108513242 132
756 3300027312 Ga0209371_1010314 Ga0209371_10103142 132
757 3300027866 Ga0209813_10021207 Ga0209813_100212072 132
758 3300028794 Ga0307515_10051203 Ga0307515_100512037 132
759 3300028794 Ga0307515_10062832 Ga0307515_100628326 132
760 3300030500 Ga0268256_1008374 Ga0268256_10083743 132
761 3300030521 Ga0307511_10018496 Ga0307511_100184962 132
762 3300030521 Ga0307511_10056944 Ga0307511_100569444 132
763 3300030522 Ga0307512_10025397 Ga0307512_100253974 132
764 3300030522 Ga0307512_10058758 Ga0307512_100587582 132
765 3300030522 Ga0307512_10065236 Ga0307512_100652362 132
766 3300030736 Ga0316180_1060732 Ga0316180_10607322 132
767 3300031456 Ga0307513_10009259 Ga0307513_100092595 132
768 3300031456 Ga0307513_10161317 Ga0307513_101613172 132
769 3300031507 Ga0307509_10343363 Ga0307509_103433632 132
770 3300031548 Ga0307408_101825482 Ga0307408_1018254822 132
771 3300031616 Ga0307508_10002091 Ga0307508_100020915 132
772 3300031616 Ga0307508_10043552 Ga0307508_100435522 132
773 3300031616 Ga0307508_10338976 Ga0307508_103389762 132
774 3300031616 Ga0307508_10571558 Ga0307508_105715582 132
775 3300031649 Ga0307514_10014518 Ga0307514_100145182 132
776 3300031649 Ga0307514_10067194 Ga0307514_100671943 132
777 3300031649 Ga0307514_10201513 Ga0307514_102015132 132
778 3300031649 Ga0307514_10371278 Ga0307514_103712782 132
779 3300031730 Ga0307516_10016056 Ga0307516_100160564 132
780 3300031730 Ga0307516_10037709 Ga0307516_100377092 132
781 3300031730 Ga0307516_10151570 Ga0307516_101515703 132
782 3300031838 Ga0307518_10192527 Ga0307518_101925272 132
783 3300031838 Ga0307518_10243780 Ga0307518_102437802 132
784 3300031838 Ga0307518_10351766 Ga0307518_103517662 132
785 3300032002 Ga0307416_100426561 Ga0307416_1004265611 132
786 3300033179 Ga0307507_10028139 Ga0307507_100281392 132
787 3300033179 Ga0307507_10076087 Ga0307507_100760872 132
788 3300033180 Ga0307510_10052729 Ga0307510_100527293 132
789 3300033180 Ga0307510_10084655 Ga0307510_100846552 132
790 3300033180 Ga0307510_10183090 Ga0307510_101830902 132
791 3300037418 Ga0395900_0037246 Ga0395900_0037246_2210_2608 132
792 3300037466 Ga0395898_0010509 Ga0395898_0010509_1423_1821 132
793 3300037853 Ga0436364_1320712 Ga0436364_1320712_1047_1445 132
794 3300038443 Ga0395901_0645693 Ga0395901_0645693_545_943 132
795 3300039437 Ga0436365_0264669 Ga0436365_0264669_110_508 132
796 3300041404 Ga0439436_0023985 Ga0439436_0023985_558_956 132
797 3300041410 Ga0439461_0128202 Ga0439461_0128202_85_483 132
798 3300041456 Ga0451795_1608725 Ga0451795_1608725_190_588 132
799 3300041460 Ga0451802_1590620 Ga0451802_1590620_89_487 132
800 3300041492 Ga0451835_0505362 Ga0451835_0505362_453_851 132
801 3300041511 Ga0451855_0456396 Ga0451855_0456396_72_470 132
802 3300041512 Ga0451853_1170256 Ga0451853_1170256_2423_2821 132
803 3300042007 Ga0439449_0000137 Ga0439449_0000137_16196_16594 132
804 3300042014 Ga0439457_001245 Ga0439457_001245_6003_6401 132
805 3300042016 Ga0439463_109550 Ga0439463_109550_133_531 132
806 3300042127 Ga0450890_012694 Ga0450890_012694_416_814 132
807 3300042129 Ga0450891_025705 Ga0450891_025705_94_492 132
808 3300042131 Ga0450894_025227 Ga0450894_025227_191_589 132
809 3300042136 Ga0450900_011926 Ga0450900_011926_310_708 132
810 3300042136 Ga0450900_055118 Ga0450900_055118_159_557 132
811 3300044656 Ga0466969_0003967 Ga0466969_0003967_1285_1683 132
812 3300044658 Ga0466972_0000586 Ga0466972_0000586_5499_5897 132
813 3300044658 Ga0466972_0059584 Ga0466972_0059584_617_1015 132
814 3300044658 Ga0466972_0076241 Ga0466972_0076241_1144_1542 132
815 3300044683 Ga0466965_0040477 Ga0466965_0040477_733_1131 132
816 3300044683 Ga0466965_0165588 Ga0466965_0165588_507_905 132
817 3300044683 Ga0466965_0700579 Ga0466965_0700579_80_478 132
818 3300044684 Ga0466966_0001630 Ga0466966_0001630_12577_12975 132
819 3300044684 Ga0466966_0016908 Ga0466966_0016908_2913_3311 132
820 3300044684 Ga0466966_0031052 Ga0466966_0031052_161_559 132
821 3300044693 Ga0466961_0030602 Ga0466961_0030602_3013_3411 132
822 3300044693 Ga0466961_0047105 Ga0466961_0047105_1472_1870 132
823 3300044693 Ga0466961_0058538 Ga0466961_0058538_1886_2284 132
824 3300044693 Ga0466961_0146856 Ga0466961_0146856_346_744 132
825 3300044694 Ga0466963_0216315 Ga0466963_0216315_208_606 132
826 3300044719 Ga0466971_0011446 Ga0466971_0011446_60_458 132
827 3300044719 Ga0466971_0043028 Ga0466971_0043028_622_1020 132
828 3300044719 Ga0466971_0101053 Ga0466971_0101053_462_860 132
829 3300044719 Ga0466971_0642434 Ga0466971_0642434_24_422 132
830 3300044735 Ga0466968_0102081 Ga0466968_0102081_303_701 132
831 3300044765 Ga0466970_0190797 Ga0466970_0190797_620_1018 132
832 3300044842 Ga0466957_0341484 Ga0466957_0341484_357_755 132
833 3300044901 Ga0466960_0001090 Ga0466960_0001090_3322_3720 132
834 3300045049 Ga0466959_0073199 Ga0466959_0073199_1479_1877 132
835 3300045049 Ga0466959_0128681 Ga0466959_0128681_956_1354 132
836 3300045836 Ga0466958_0232159 Ga0466958_0232159_35_433 132
837 3300045976 Ga0466967_1098385 Ga0466967_1098385_137_535 132
838 3300045976 Ga0466967_1522486 Ga0466967_1522486_146_544 132
839 3300046455 Ga0495603_0010502 Ga0495603_0010502_4054_4452 132
840 3300046455 Ga0495603_0012292 Ga0495603_0012292_1679_2077 132
841 3300046459 Ga0495629_0018737 Ga0495629_0018737_2251_2649 132
842 3300046459 Ga0495629_0056356 Ga0495629_0056356_1950_2348 132
843 3300046459 Ga0495629_0060769 Ga0495629_0060769_818_1216 132
844 3300046499 Ga0495594_0000785 Ga0495594_0000785_14539_14937 132
845 3300046517 Ga0495630_0216798 Ga0495630_0216798_50_448 132
846 3300046523 Ga0495644_0210247 Ga0495644_0210247_144_542 132
847 3300046535 Ga0495586_0319506 Ga0495586_0319506_40_456 132
848 3300046557 Ga0495622_0030211 Ga0495622_0030211_709_1107 132
849 3300046648 Ga0495611_0074377 Ga0495611_0074377_148_546 132
850 3300046663 Ga0495635_1056134 Ga0495635_1056134_103_501 132
851 3300046674 Ga0495588_0028011 Ga0495588_0028011_815_1213 132
852 3300046674 Ga0495588_0071193 Ga0495588_0071193_150_566 132
853 3300046675 Ga0495657_0021076 Ga0495657_0021076_2817_3215 132
854 3300046679 Ga0495623_0065181 Ga0495623_0065181_1701_2117 132
855 3300046689 Ga0495613_0157302 Ga0495613_0157302_1128_1526 132
856 3300046694 Ga0495649_0193731 Ga0495649_0193731_550_948 132
857 3300046794 Ga0495589_0107837 Ga0495589_0107837_438_836 132
858 3300047315 Ga0495581_0081713 Ga0495581_0081713_1462_1860 132
859 3300047317 Ga0495604_0003209 Ga0495604_0003209_3401_3817 132
860 3300047318 Ga0495636_0044515 Ga0495636_0044515_1027_1425 132
861 3300047318 Ga0495636_0112676 Ga0495636_0112676_490_888 132
862 3300047321 Ga0495676_0018421 Ga0495676_0018421_2353_2751 132
863 3300047321 Ga0495676_0046083 Ga0495676_0046083_1143_1541 132
864 3300047443 Ga0495687_194059 Ga0495687_194059_43_441 132
865 3300047444 Ga0495675_0054126 Ga0495675_0054126_305_721 132
866 3300047444 Ga0495675_0628417 Ga0495675_0628417_72_488 132
867 3300047447 Ga0495685_057602 Ga0495685_057602_35_451 132
868 3300048089 Ga0495614_0033404 Ga0495614_0033404_68_466 132
869 3300048905 Ga0496102_0495841 Ga0496102_0495841_542_940 132
870 3300048909 Ga0496106_0644613 Ga0496106_0644613_208_606 132
871 3300049527 Ga0501311_096093 Ga0501311_096093_69_467 132
872 3300049534 Ga0501318_000189 Ga0501318_000189_14_412 132
873 3300049539 Ga0501323_001026 Ga0501323_001026_1823_2239 132
874 3300049568 Ga0501031_0026414 Ga0501031_0026414_1857_2255 132
875 3300049569 Ga0501032_0000349 Ga0501032_0000349_35094_35492 132
876 3300049569 Ga0501032_0069477 Ga0501032_0069477_1424_1822 132
877 3300049569 Ga0501032_0346450 Ga0501032_0346450_245_643 132
878 3300049570 Ga0501033_0001339 Ga0501033_0001339_20801_21199 132
879 3300049570 Ga0501033_0009633 Ga0501033_0009633_1820_2218 132
880 3300049570 Ga0501033_0243176 Ga0501033_0243176_206_604 132
881 3300049570 Ga0501033_0356168 Ga0501033_0356168_213_611 132
882 3300049571 Ga0501034_0004152 Ga0501034_0004152_4535_4933 132
883 3300049571 Ga0501034_0035276 Ga0501034_0035276_4600_4998 132
884 3300049571 Ga0501034_0202166 Ga0501034_0202166_1500_1898 132
885 3300049571 Ga0501034_0552735 Ga0501034_0552735_611_1009 132
886 3300049571 Ga0501034_0564858 Ga0501034_0564858_201_599 132
887 3300049571 Ga0501034_0613390 Ga0501034_0613390_557_955 132
888 3300049572 Ga0501036_0006306 Ga0501036_0006306_7844_8242 132
889 3300049572 Ga0501036_0060167 Ga0501036_0060167_361_759 132
890 3300049572 Ga0501036_0068833 Ga0501036_0068833_1141_1539 132
891 3300049572 Ga0501036_0086095 Ga0501036_0086095_439_837 132
892 3300049572 Ga0501036_0211188 Ga0501036_0211188_1087_1485 132
893 3300049573 Ga0501037_0002432 Ga0501037_0002432_8684_9082 132
894 3300049573 Ga0501037_0014083 Ga0501037_0014083_4101_4499 132
895 3300049573 Ga0501037_0052437 Ga0501037_0052437_2396_2794 132
896 3300049574 Ga0501038_0043175 Ga0501038_0043175_213_611 132
897 3300049574 Ga0501038_0057499 Ga0501038_0057499_1687_2085 132
898 3300049574 Ga0501038_0069712 Ga0501038_0069712_2279_2677 132
899 3300049574 Ga0501038_1035449 Ga0501038_1035449_11_409 132
900 3300049575 Ga0501039_0022674 Ga0501039_0022674_334_732 132
901 3300049575 Ga0501039_0038335 Ga0501039_0038335_1163_1561 132
902 3300049575 Ga0501039_0125698 Ga0501039_0125698_33_431 132
903 3300049575 Ga0501039_0351286 Ga0501039_0351286_581_979 132
904 3300049576 Ga0501040_0067123 Ga0501040_0067123_1930_2328 132
905 3300049577 Ga0501041_0001346 Ga0501041_0001346_8520_8918 132
906 3300049578 Ga0501042_0032462 Ga0501042_0032462_212_610 132
907 3300049578 Ga0501042_0048306 Ga0501042_0048306_1207_1605 132
908 3300049579 Ga0501043_0003089 Ga0501043_0003089_9041_9439 132
909 3300049579 Ga0501043_0048534 Ga0501043_0048534_600_998 132
910 3300049579 Ga0501043_0223916 Ga0501043_0223916_240_638 132
911 3300049579 Ga0501043_0797401 Ga0501043_0797401_149_547 132
912 3300049580 Ga0501046_0068069 Ga0501046_0068069_182_580 132
913 3300049580 Ga0501046_0076664 Ga0501046_0076664_978_1376 132
914 3300049580 Ga0501046_0826353 Ga0501046_0826353_187_585 132
915 3300049581 Ga0501047_0042376 Ga0501047_0042376_617_1015 132
916 3300049581 Ga0501047_0091888 Ga0501047_0091888_1582_1980 132
917 3300049581 Ga0501047_0105413 Ga0501047_0105413_186_584 132
918 3300049581 Ga0501047_0169900 Ga0501047_0169900_1477_1875 132
919 3300049581 Ga0501047_0177716 Ga0501047_0177716_1383_1781 132
920 3300049581 Ga0501047_0532151 Ga0501047_0532151_541_939 132
921 3300049582 Ga0501048_0002495 Ga0501048_0002495_9041_9439 132
922 3300049582 Ga0501048_0017248 Ga0501048_0017248_3079_3477 132
923 3300049582 Ga0501048_0430340 Ga0501048_0430340_448_846 132
924 3300049583 Ga0501067_0646671 Ga0501067_0646671_173_571 132
925 3300049584 Ga0501068_0005639 Ga0501068_0005639_2058_2456 132
926 3300049584 Ga0501068_0746242 Ga0501068_0746242_227_625 132
927 3300049585 Ga0501069_0003348 Ga0501069_0003348_7796_8194 132
928 3300049586 Ga0501070_0012774 Ga0501070_0012774_4528_4926 132
929 3300049586 Ga0501070_0415375 Ga0501070_0415375_432_830 132
930 3300049586 Ga0501070_0423887 Ga0501070_0423887_17_415 132
931 3300049586 Ga0501070_0714758 Ga0501070_0714758_181_579 132
932 3300049586 Ga0501070_1006935 Ga0501070_1006935_61_459 132
933 3300049588 Ga0501072_0021693 Ga0501072_0021693_4511_4909 132
934 3300049589 Ga0501073_0005694 Ga0501073_0005694_7412_7810 132
935 3300049589 Ga0501073_0312185 Ga0501073_0312185_69_467 132
936 3300049590 Ga0501074_0003000 Ga0501074_0003000_3853_4251 132
937 3300049590 Ga0501074_0046313 Ga0501074_0046313_1356_1754 132
938 3300049591 Ga0501075_0261223 Ga0501075_0261223_738_1136 132
939 3300049664 Ga0501224_044829 Ga0501224_044829_183_581 132
940 3300049669 Ga0501235_032051 Ga0501235_032051_313_711 132
941 3300049741 Ga0501079_1132531 Ga0501079_1132531_153_551 132
942 3300049742 Ga0501080_1218819 Ga0501080_1218819_55_453 132
943 3300049744 Ga0501083_0002475 Ga0501083_0002475_4570_4968 132
944 3300049778 Ga0501282_017244 Ga0501282_017244_205_603 132
945 3300049822 Ga0501035_0000922 Ga0501035_0000922_2927_3325 132
946 3300049822 Ga0501035_0005042 Ga0501035_0005042_5634_6032 132
947 3300049822 Ga0501035_0010143 Ga0501035_0010143_6373_6771 132
948 3300049822 Ga0501035_0290273 Ga0501035_0290273_783_1181 132
949 3300049822 Ga0501035_0361878 Ga0501035_0361878_372_770 132
950 3300049822 Ga0501035_1005156 Ga0501035_1005156_203_601 132
951 3300049823 Ga0501044_0002906 Ga0501044_0002906_14729_15127 132
952 3300049823 Ga0501044_0007526 Ga0501044_0007526_2598_2996 132
953 3300049823 Ga0501044_0014904 Ga0501044_0014904_2818_3216 132
954 3300049823 Ga0501044_0087413 Ga0501044_0087413_884_1282 132
955 3300049823 Ga0501044_0167174 Ga0501044_0167174_72_470 132
956 3300049823 Ga0501044_0216255 Ga0501044_0216255_1424_1822 132
957 3300049823 Ga0501044_0324772 Ga0501044_0324772_789_1187 132
958 3300049823 Ga0501044_0509746 Ga0501044_0509746_25_423 132
959 3300049823 Ga0501044_1155847 Ga0501044_1155847_42_440 132
960 3300049823 Ga0501044_1192379 Ga0501044_1192379_42_440 132
961 3300049824 Ga0501045_0147786 Ga0501045_0147786_342_740 132
962 3300050490 nmdc:mga03n38_35383_c1 nmdc:mga03n38_35383_c1_1664_2062 132
963 3300050492 nmdc:mga0yw44_45338_c1 nmdc:mga0yw44_45338_c1_815_1213 132
964 3300050494 nmdc:mga06z11_1574_c1 nmdc:mga06z11_1574_c1_7536_7934 132
965 3300050495 nmdc:mga04h51_59290_c1 nmdc:mga04h51_59290_c1_560_958 132
966 3300050496 nmdc:mga07m45_55352_c2 nmdc:mga07m45_55352_c2_1084_1482 132
967 3300053140 Ga0500573_0182924 Ga0500573_0182924_614_1012 132
968 3300054114 Ga0501084_0323501 Ga0501084_0323501_725_1123 132
969 3300060353 Ga0501082_0884263 Ga0501082_0884263_339_737 132
970 3300061719 Ga0466962_0000908 Ga0466962_0000908_4304_4702 132
971 3300061719 Ga0466962_0150123 Ga0466962_0150123_703_1101 132
972 3300061719 Ga0466962_0340479 Ga0466962_0340479_41_439 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12270

Cyt_c_ox_IV

Cytochrome c oxidase subunit IV

1

136

0.99

Feature Viewer

pLDDT pTM Quality
82.76 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map