F487153
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 972 | 335 | 1944 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300031090|Ga0265760_10099217|Ga0265760_100992172 |
| Length | 152 |
| Sequence | MTGKESGHVDHAAAQTVPHINPDSLEVAPGTAHENLEGWIPALASVSEIHEALEKAFDYRGDLTITLKSGQKIEGYIFDRKIKGPTLSDCFIRVMPKDEPGKLTIPYSDIAALAFTGRDTAAGKSFAAWVKKYNEKKAAGEKNIGIDAEPLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 135 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 209 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 229 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.37 |
| Metatranscriptomes | 4.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.35 |
| Rhizosphere | 93.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265760_10099217 | 3300031090 | Unclassified | 919 |
| 2 | MBSR1b_contig_10165024 | 2162886012 | Bacteria | 3089 |
| 3 | MBSR1b_contig_10507888 | 2162886012 | Bacteria | 3491 |
| 4 | LJNas_1004583 | 3300000546 | Bacteria | 1530 |
| 5 | JGI24752J21851_1011902 | 3300001976 | Bacteria | 1138 |
| 6 | JGI24737J22298_10037023 | 3300001990 | Bacteria | 1505 |
| 7 | JGI24034J26672_10005738 | 3300002239 | Bacteria | 1783 |
| 8 | JGI24751J29686_10002022 | 3300002459 | Bacteria | 4125 |
| 9 | rootL2_10312876 | 3300003322 | Bacteria | 1089 |
| 10 | Ga0058863_10030681 | 3300004799 | Unclassified | 1067 |
| 11 | Ga0058863_10127990 | 3300004799 | Bacteria | 5287 |
| 12 | Ga0058861_10074048 | 3300004800 | Bacteria | 2493 |
| 13 | Ga0058862_10062502 | 3300004803 | Unclassified | 877 |
| 14 | Ga0058862_10211683 | 3300004803 | Bacteria | 1136 |
| 15 | Ga0065712_10139591 | 3300005290 | Bacteria | 1461 |
| 16 | Ga0065715_10006051 | 3300005293 | Bacteria | 3426 |
| 17 | Ga0070658_10057744 | 3300005327 | Unclassified | 3157 |
| 18 | Ga0070658_10246788 | 3300005327 | Bacteria | 1514 |
| 19 | Ga0070658_10510840 | 3300005327 | Bacteria | 1038 |
| 20 | Ga0070676_10024794 | 3300005328 | Bacteria | 3383 |
| 21 | Ga0070683_100007816 | 3300005329 | Bacteria | 9057 |
| 22 | Ga0070683_100026554 | 3300005329 | Bacteria | 5216 |
| 23 | Ga0070683_100249383 | 3300005329 | Bacteria | 1689 |
| 24 | Ga0070690_100010254 | 3300005330 | Bacteria | 5447 |
| 25 | Ga0070690_100244677 | 3300005330 | Bacteria | 1266 |
| 26 | Ga0070690_100503445 | 3300005330 | Bacteria | 906 |
| 27 | Ga0070670_100012670 | 3300005331 | Bacteria | 7219 |
| 28 | Ga0070677_10150025 | 3300005333 | Bacteria | 1084 |
| 29 | Ga0068869_100001091 | 3300005334 | Bacteria | 15829 |
| 30 | Ga0068869_100107562 | 3300005334 | Bacteria | 2118 |
| 31 | Ga0070666_10086109 | 3300005335 | Bacteria | 2152 |
| 32 | Ga0070666_10245933 | 3300005335 | Bacteria | 1265 |
| 33 | Ga0070680_100079702 | 3300005336 | Bacteria | 2699 |
| 34 | Ga0070680_100135809 | 3300005336 | Bacteria | 2060 |
| 35 | Ga0070680_100147717 | 3300005336 | Bacteria | 1973 |
| 36 | Ga0070680_100383749 | 3300005336 | Bacteria | 1196 |
| 37 | Ga0070682_100042189 | 3300005337 | Unclassified | 2815 |
| 38 | Ga0070682_100180365 | 3300005337 | Bacteria | 1474 |
| 39 | Ga0070682_100295611 | 3300005337 | Bacteria | 1186 |
| 40 | Ga0070682_100374723 | 3300005337 | Bacteria | 1068 |
| 41 | Ga0068868_100031940 | 3300005338 | Bacteria | 4047 |
| 42 | Ga0068868_100041104 | 3300005338 | Bacteria | 3601 |
| 43 | Ga0068868_100230334 | 3300005338 | Bacteria | 1554 |
| 44 | Ga0068868_100273165 | 3300005338 | Bacteria | 1428 |
| 45 | Ga0070660_100019734 | 3300005339 | Bacteria | 4944 |
| 46 | Ga0070660_100027487 | 3300005339 | Bacteria | 4246 |
| 47 | Ga0070660_100044512 | 3300005339 | Bacteria | 3396 |
| 48 | Ga0070689_100010978 | 3300005340 | Bacteria | 6474 |
| 49 | Ga0070691_10477605 | 3300005341 | Unclassified | 716 |
| 50 | Ga0070687_100003669 | 3300005343 | Bacteria | 6003 |
| 51 | Ga0070661_100005336 | 3300005344 | Bacteria | 8865 |
| 52 | Ga0070661_100017859 | 3300005344 | Bacteria | 5036 |
| 53 | Ga0070661_100308055 | 3300005344 | Bacteria | 1234 |
| 54 | Ga0070692_10021641 | 3300005345 | Bacteria | 3130 |
| 55 | Ga0070692_10590913 | 3300005345 | Bacteria | 733 |
| 56 | Ga0070668_100018162 | 3300005347 | Bacteria | 5277 |
| 57 | Ga0070668_100052416 | 3300005347 | Unclassified | 3144 |
| 58 | Ga0070668_101380798 | 3300005347 | Unclassified | 642 |
| 59 | Ga0070669_100103593 | 3300005353 | Bacteria | 2150 |
| 60 | Ga0070669_100117210 | 3300005353 | Bacteria | 2027 |
| 61 | Ga0070675_100024569 | 3300005354 | Bacteria | 4826 |
| 62 | Ga0070675_100478110 | 3300005354 | Bacteria | 1120 |
| 63 | Ga0070674_100086726 | 3300005356 | Unclassified | 2249 |
| 64 | Ga0070673_100005154 | 3300005364 | Bacteria | 8337 |
| 65 | Ga0070673_101470164 | 3300005364 | Unclassified | 642 |
| 66 | Ga0070688_100020972 | 3300005365 | Unclassified | 3809 |
| 67 | Ga0070688_100060749 | 3300005365 | Unclassified | 2387 |
| 68 | Ga0070659_100001853 | 3300005366 | Bacteria | 15198 |
| 69 | Ga0070659_100410658 | 3300005366 | Unclassified | 1144 |
| 70 | Ga0070667_100134715 | 3300005367 | Bacteria | 2159 |
| 71 | Ga0070667_100144270 | 3300005367 | Unclassified | 2087 |
| 72 | Ga0070667_100162609 | 3300005367 | Bacteria | 1967 |
| 73 | Ga0070667_100230880 | 3300005367 | Bacteria | 1650 |
| 74 | Ga0070709_10093672 | 3300005434 | Bacteria | 1986 |
| 75 | Ga0070709_10195615 | 3300005434 | Bacteria | 1429 |
| 76 | Ga0070709_10215712 | 3300005434 | Bacteria | 1366 |
| 77 | Ga0070709_11037071 | 3300005434 | Unclassified | 654 |
| 78 | Ga0070714_100000111 | 3300005435 | Bacteria | 67800 |
| 79 | Ga0070714_100085248 | 3300005435 | Bacteria | 2758 |
| 80 | Ga0070714_100177857 | 3300005435 | Bacteria | 1934 |
| 81 | Ga0070714_100224150 | 3300005435 | Unclassified | 1729 |
| 82 | Ga0070714_100274857 | 3300005435 | Bacteria | 1563 |
| 83 | Ga0070714_100330524 | 3300005435 | Bacteria | 1427 |
| 84 | Ga0070714_100493730 | 3300005435 | Bacteria | 1167 |
| 85 | Ga0070714_100633530 | 3300005435 | Bacteria | 1028 |
| 86 | Ga0070714_102154378 | 3300005435 | Unclassified | 543 |
| 87 | Ga0070713_100000231 | 3300005436 | Bacteria | 37112 |
| 88 | Ga0070713_100004047 | 3300005436 | Bacteria | 9767 |
| 89 | Ga0070713_100016019 | 3300005436 | Bacteria | 5627 |
| 90 | Ga0070713_100075339 | 3300005436 | Bacteria | 2862 |
| 91 | Ga0070713_100079167 | 3300005436 | Unclassified | 2799 |
| 92 | Ga0070713_100369294 | 3300005436 | Unclassified | 1335 |
| 93 | Ga0070713_100817667 | 3300005436 | Bacteria | 894 |
| 94 | Ga0070713_100964379 | 3300005436 | Unclassified | 822 |
| 95 | Ga0070710_10005065 | 3300005437 | Bacteria | 6238 |
| 96 | Ga0070710_10117119 | 3300005437 | Bacteria | 1608 |
| 97 | Ga0070710_10144587 | 3300005437 | Unclassified | 1461 |
| 98 | Ga0070710_10186885 | 3300005437 | Unclassified | 1301 |
| 99 | Ga0070701_10104756 | 3300005438 | Bacteria | 1572 |
| 100 | Ga0070711_100000519 | 3300005439 | Bacteria | 19976 |
| 101 | Ga0070711_100000929 | 3300005439 | Bacteria | 15465 |
| 102 | Ga0070711_100039221 | 3300005439 | Bacteria | 3189 |
| 103 | Ga0070711_100082975 | 3300005439 | Bacteria | 2288 |
| 104 | Ga0070711_100406463 | 3300005439 | Unclassified | 1106 |
| 105 | Ga0070711_100517078 | 3300005439 | Unclassified | 986 |
| 106 | Ga0070711_100655150 | 3300005439 | Bacteria | 881 |
| 107 | Ga0070711_101338125 | 3300005439 | Bacteria | 622 |
| 108 | Ga0070711_101516647 | 3300005439 | Bacteria | 585 |
| 109 | Ga0070705_100396319 | 3300005440 | Bacteria | 1021 |
| 110 | Ga0070705_100673471 | 3300005440 | Unclassified | 809 |
| 111 | Ga0070705_101424654 | 3300005440 | Unclassified | 578 |
| 112 | Ga0070694_100308754 | 3300005444 | Bacteria | 1214 |
| 113 | Ga0070694_100509637 | 3300005444 | Unclassified | 958 |
| 114 | Ga0070708_100000410 | 3300005445 | Bacteria | 32257 |
| 115 | Ga0070708_100014908 | 3300005445 | Bacteria | 6406 |
| 116 | Ga0070708_100075059 | 3300005445 | Unclassified | 3051 |
| 117 | Ga0070708_100083480 | 3300005445 | Unclassified | 2896 |
| 118 | Ga0070708_100261059 | 3300005445 | Bacteria | 1628 |
| 119 | Ga0070663_100003902 | 3300005455 | Bacteria | 8695 |
| 120 | Ga0070663_100079392 | 3300005455 | Bacteria | 2407 |
| 121 | Ga0070663_100082057 | 3300005455 | Bacteria | 2371 |
| 122 | Ga0070663_100096112 | 3300005455 | Bacteria | 2203 |
| 123 | Ga0070663_100284221 | 3300005455 | Bacteria | 1319 |
| 124 | Ga0070678_101337073 | 3300005456 | Unclassified | 668 |
| 125 | Ga0070662_100030086 | 3300005457 | Bacteria | 3795 |
| 126 | Ga0070662_100169342 | 3300005457 | Bacteria | 1714 |
| 127 | Ga0070662_101096647 | 3300005457 | Bacteria | 683 |
| 128 | Ga0070662_101701482 | 3300005457 | Unclassified | 545 |
| 129 | Ga0070681_10001954 | 3300005458 | Bacteria | 18621 |
| 130 | Ga0070681_10036253 | 3300005458 | Bacteria | 4952 |
| 131 | Ga0070681_10233915 | 3300005458 | Bacteria | 1752 |
| 132 | Ga0070681_10415393 | 3300005458 | Bacteria | 1257 |
| 133 | Ga0070681_10505284 | 3300005458 | Bacteria | 1122 |
| 134 | Ga0070681_10590882 | 3300005458 | Bacteria | 1024 |
| 135 | Ga0070681_10834360 | 3300005458 | Unclassified | 839 |
| 136 | Ga0070681_10994218 | 3300005458 | Unclassified | 758 |
| 137 | Ga0070681_11179639 | 3300005458 | Unclassified | 687 |
| 138 | Ga0068867_100127797 | 3300005459 | Bacteria | 1971 |
| 139 | Ga0068867_100868312 | 3300005459 | Bacteria | 809 |
| 140 | Ga0070685_10000891 | 3300005466 | Bacteria | 16066 |
| 141 | Ga0070706_100001099 | 3300005467 | Bacteria | 29242 |
| 142 | Ga0070706_100003090 | 3300005467 | Bacteria | 16493 |
| 143 | Ga0070706_100059036 | 3300005467 | Bacteria | 3540 |
| 144 | Ga0070706_100574126 | 3300005467 | Bacteria | 1048 |
| 145 | Ga0070706_100830338 | 3300005467 | Bacteria | 855 |
| 146 | Ga0070706_101123520 | 3300005467 | Bacteria | 723 |
| 147 | Ga0070707_100000229 | 3300005468 | Bacteria | 56136 |
| 148 | Ga0070707_100034150 | 3300005468 | Bacteria | 4850 |
| 149 | Ga0070707_100091366 | 3300005468 | Bacteria | 2947 |
| 150 | Ga0070707_100099997 | 3300005468 | Bacteria | 2809 |
| 151 | Ga0070707_100107375 | 3300005468 | Bacteria | 2708 |
| 152 | Ga0070707_100120929 | 3300005468 | Bacteria | 2542 |
| 153 | Ga0070707_100156922 | 3300005468 | Bacteria | 2217 |
| 154 | Ga0070707_100653099 | 3300005468 | Bacteria | 1014 |
| 155 | Ga0070698_100018118 | 3300005471 | Bacteria | 7414 |
| 156 | Ga0070698_100027170 | 3300005471 | Bacteria | 5953 |
| 157 | Ga0070698_100037896 | 3300005471 | Bacteria | 4969 |
| 158 | Ga0070698_100048291 | 3300005471 | Bacteria | 4349 |
| 159 | Ga0070698_100255932 | 3300005471 | Bacteria | 1683 |
| 160 | Ga0070699_100000703 | 3300005518 | Bacteria | 30997 |
| 161 | Ga0070699_100001773 | 3300005518 | Bacteria | 19653 |
| 162 | Ga0070699_100036450 | 3300005518 | Bacteria | 4255 |
| 163 | Ga0070699_100065354 | 3300005518 | Bacteria | 3157 |
| 164 | Ga0070699_100273390 | 3300005518 | Bacteria | 1513 |
| 165 | Ga0070699_100378618 | 3300005518 | Bacteria | 1277 |
| 166 | Ga0070699_100880063 | 3300005518 | Bacteria | 820 |
| 167 | Ga0070679_100026671 | 3300005530 | Bacteria | 5681 |
| 168 | Ga0070679_100030052 | 3300005530 | Bacteria | 5362 |
| 169 | Ga0070679_100065948 | 3300005530 | Bacteria | 3609 |
| 170 | Ga0070679_100120123 | 3300005530 | Bacteria | 2613 |
| 171 | Ga0070679_100208731 | 3300005530 | Bacteria | 1917 |
| 172 | Ga0070679_101123619 | 3300005530 | Unclassified | 731 |
| 173 | Ga0070684_100025735 | 3300005535 | Bacteria | 4948 |
| 174 | Ga0070684_100184514 | 3300005535 | Bacteria | 1897 |
| 175 | Ga0070684_100396792 | 3300005535 | Bacteria | 1272 |
| 176 | Ga0070684_101036296 | 3300005535 | Bacteria | 770 |
| 177 | Ga0070684_101069149 | 3300005535 | Unclassified | 758 |
| 178 | Ga0070697_100000166 | 3300005536 | Bacteria | 53539 |
| 179 | Ga0070697_100000673 | 3300005536 | Bacteria | 25688 |
| 180 | Ga0070697_100001242 | 3300005536 | Bacteria | 19280 |
| 181 | Ga0070697_100003229 | 3300005536 | Bacteria | 12506 |
| 182 | Ga0070697_100009587 | 3300005536 | Bacteria | 7562 |
| 183 | Ga0070697_100575543 | 3300005536 | Unclassified | 989 |
| 184 | Ga0070697_101360534 | 3300005536 | Bacteria | 634 |
| 185 | Ga0068853_100000064 | 3300005539 | Bacteria | 75224 |
| 186 | Ga0068853_100145674 | 3300005539 | Bacteria | 2128 |
| 187 | Ga0068853_100145969 | 3300005539 | Bacteria | 2126 |
| 188 | Ga0070672_100078340 | 3300005543 | Unclassified | 2644 |
| 189 | Ga0070672_100815998 | 3300005543 | Bacteria | 821 |
| 190 | Ga0070686_100051263 | 3300005544 | Unclassified | 2626 |
| 191 | Ga0070686_100101894 | 3300005544 | Bacteria | 1941 |
| 192 | Ga0070686_100210482 | 3300005544 | Bacteria | 1399 |
| 193 | Ga0070686_100772422 | 3300005544 | Unclassified | 772 |
| 194 | Ga0070695_100134470 | 3300005545 | Bacteria | 1707 |
| 195 | Ga0070695_100233972 | 3300005545 | Bacteria | 1330 |
| 196 | Ga0070696_100162259 | 3300005546 | Bacteria | 1647 |
| 197 | Ga0070696_100493033 | 3300005546 | Unclassified | 973 |
| 198 | Ga0070693_100065727 | 3300005547 | Bacteria | 2120 |
| 199 | Ga0070693_100425590 | 3300005547 | Bacteria | 926 |
| 200 | Ga0070665_100045644 | 3300005548 | Bacteria | 4400 |
| 201 | Ga0070665_100177480 | 3300005548 | Bacteria | 2131 |
| 202 | Ga0070704_100438251 | 3300005549 | Bacteria | 1122 |
| 203 | Ga0068855_100085404 | 3300005563 | Unclassified | 3651 |
| 204 | Ga0068855_100363724 | 3300005563 | Bacteria | 1592 |
| 205 | Ga0068855_100643803 | 3300005563 | Bacteria | 1139 |
| 206 | Ga0068855_101158651 | 3300005563 | Unclassified | 805 |
| 207 | Ga0068855_101230969 | 3300005563 | Unclassified | 777 |
| 208 | Ga0068855_101943166 | 3300005563 | Unclassified | 595 |
| 209 | Ga0068855_102334590 | 3300005563 | Bacteria | 535 |
| 210 | Ga0070664_100307705 | 3300005564 | Bacteria | 1433 |
| 211 | Ga0068857_100012748 | 3300005577 | Bacteria | 7327 |
| 212 | Ga0068857_100027770 | 3300005577 | Bacteria | 4991 |
| 213 | Ga0068857_100353009 | 3300005577 | Bacteria | 1362 |
| 214 | Ga0068854_100000073 | 3300005578 | Bacteria | 72344 |
| 215 | Ga0068854_100084144 | 3300005578 | Bacteria | 2353 |
| 216 | Ga0068854_100247345 | 3300005578 | Bacteria | 1422 |
| 217 | Ga0068854_100382191 | 3300005578 | Unclassified | 1161 |
| 218 | Ga0068854_100415931 | 3300005578 | Bacteria | 1116 |
| 219 | Ga0068856_100032606 | 3300005614 | Bacteria | 5100 |
| 220 | Ga0068856_100038619 | 3300005614 | Bacteria | 4687 |
| 221 | Ga0068856_100363545 | 3300005614 | Bacteria | 1466 |
| 222 | Ga0068856_101000832 | 3300005614 | Bacteria | 854 |
| 223 | Ga0070702_100018838 | 3300005615 | Unclassified | 3588 |
| 224 | Ga0068852_100108429 | 3300005616 | Bacteria | 2520 |
| 225 | Ga0068852_100706000 | 3300005616 | Bacteria | 1019 |
| 226 | Ga0068852_101138316 | 3300005616 | Bacteria | 801 |
| 227 | Ga0068859_100061883 | 3300005617 | Bacteria | 3772 |
| 228 | Ga0068859_100197826 | 3300005617 | Bacteria | 2094 |
| 229 | Ga0068859_100377869 | 3300005617 | Bacteria | 1512 |
| 230 | Ga0068866_10069989 | 3300005718 | Bacteria | 1850 |
| 231 | Ga0068866_10073008 | 3300005718 | Unclassified | 1819 |
| 232 | Ga0068866_10212732 | 3300005718 | Bacteria | 1162 |
| 233 | Ga0068861_100028262 | 3300005719 | Unclassified | 4092 |
| 234 | Ga0068861_100054581 | 3300005719 | Bacteria | 3045 |
| 235 | Ga0068861_101536641 | 3300005719 | Unclassified | 654 |
| 236 | Ga0068870_10000880 | 3300005840 | Bacteria | 11745 |
| 237 | Ga0068870_10904922 | 3300005840 | Unclassified | 623 |
| 238 | Ga0068863_100209702 | 3300005841 | Bacteria | 1876 |
| 239 | Ga0068863_100235832 | 3300005841 | Bacteria | 1765 |
| 240 | Ga0068863_100292679 | 3300005841 | Bacteria | 1578 |
| 241 | Ga0068858_100010651 | 3300005842 | Bacteria | 8698 |
| 242 | Ga0068858_100032024 | 3300005842 | Bacteria | 4884 |
| 243 | Ga0068858_100210677 | 3300005842 | Bacteria | 1839 |
| 244 | Ga0068858_100522280 | 3300005842 | Unclassified | 1148 |
| 245 | Ga0068860_100021654 | 3300005843 | Bacteria | 6224 |
| 246 | Ga0068860_100075859 | 3300005843 | Bacteria | 3197 |
| 247 | Ga0068860_100231371 | 3300005843 | Unclassified | 1796 |
| 248 | Ga0068860_100660283 | 3300005843 | Bacteria | 1054 |
| 249 | Ga0068862_100008118 | 3300005844 | Bacteria | 8684 |
| 250 | Ga0068862_100024110 | 3300005844 | Bacteria | 5102 |
| 251 | Ga0068862_100209957 | 3300005844 | Bacteria | 1759 |
| 252 | Ga0068862_101164666 | 3300005844 | Unclassified | 768 |
| 253 | Ga0081540_1156928 | 3300005983 | Bacteria | 889 |
| 254 | Ga0070717_10008860 | 3300006028 | Bacteria | 7534 |
| 255 | Ga0070717_10023401 | 3300006028 | Bacteria | 4894 |
| 256 | Ga0070717_10089905 | 3300006028 | Bacteria | 2591 |
| 257 | Ga0070717_10097818 | 3300006028 | Bacteria | 2487 |
| 258 | Ga0070717_10173615 | 3300006028 | Bacteria | 1876 |
| 259 | Ga0070717_10181039 | 3300006028 | Bacteria | 1837 |
| 260 | Ga0070717_10490030 | 3300006028 | Bacteria | 1110 |
| 261 | Ga0070717_10547684 | 3300006028 | Bacteria | 1047 |
| 262 | Ga0070717_10607901 | 3300006028 | Bacteria | 992 |
| 263 | Ga0070717_10671886 | 3300006028 | Unclassified | 941 |
| 264 | Ga0070717_10697941 | 3300006028 | Bacteria | 922 |
| 265 | Ga0070717_10740594 | 3300006028 | Unclassified | 893 |
| 266 | Ga0070717_11123531 | 3300006028 | Bacteria | 716 |
| 267 | Ga0070715_10013418 | 3300006163 | Bacteria | 3009 |
| 268 | Ga0070715_10135758 | 3300006163 | Unclassified | 1189 |
| 269 | Ga0070715_10142113 | 3300006163 | Bacteria | 1167 |
| 270 | Ga0070715_10189289 | 3300006163 | Unclassified | 1038 |
| 271 | Ga0070716_100019448 | 3300006173 | Bacteria | 3550 |
| 272 | Ga0070716_100036790 | 3300006173 | Bacteria | 2700 |
| 273 | Ga0070716_100074262 | 3300006173 | Bacteria | 2008 |
| 274 | Ga0070716_100134428 | 3300006173 | Bacteria | 1568 |
| 275 | Ga0070716_100153955 | 3300006173 | Unclassified | 1482 |
| 276 | Ga0070716_100227152 | 3300006173 | Bacteria | 1258 |
| 277 | Ga0070716_100259291 | 3300006173 | Unclassified | 1189 |
| 278 | Ga0070716_100259949 | 3300006173 | Unclassified | 1187 |
| 279 | Ga0070716_100400203 | 3300006173 | Bacteria | 987 |
| 280 | Ga0070712_100000120 | 3300006175 | Bacteria | 40974 |
| 281 | Ga0070712_100001238 | 3300006175 | Bacteria | 15427 |
| 282 | Ga0070712_100002759 | 3300006175 | Bacteria | 10854 |
| 283 | Ga0070712_100036247 | 3300006175 | Unclassified | 3355 |
| 284 | Ga0070712_100379410 | 3300006175 | Unclassified | 1163 |
| 285 | Ga0070712_100456828 | 3300006175 | Bacteria | 1064 |
| 286 | Ga0070712_100708235 | 3300006175 | Bacteria | 859 |
| 287 | Ga0097621_100023588 | 3300006237 | Bacteria | 4792 |
| 288 | Ga0097621_100051309 | 3300006237 | Bacteria | 3357 |
| 289 | Ga0097621_100078156 | 3300006237 | Bacteria | 2748 |
| 290 | Ga0097621_100088932 | 3300006237 | Bacteria | 2581 |
| 291 | Ga0097621_100655281 | 3300006237 | Bacteria | 964 |
| 292 | Ga0097621_100904805 | 3300006237 | Unclassified | 822 |
| 293 | Ga0068871_100001112 | 3300006358 | Bacteria | 18041 |
| 294 | Ga0068871_100177023 | 3300006358 | Bacteria | 1831 |
| 295 | Ga0068871_100780774 | 3300006358 | Bacteria | 879 |
| 296 | Ga0068871_100984760 | 3300006358 | Unclassified | 785 |
| 297 | Ga0068871_101387326 | 3300006358 | Unclassified | 662 |
| 298 | Ga0075433_10025151 | 3300006852 | Bacteria | 5033 |
| 299 | Ga0075433_10163964 | 3300006852 | Bacteria | 1978 |
| 300 | Ga0075433_10490906 | 3300006852 | Bacteria | 1081 |
| 301 | Ga0075434_100013738 | 3300006871 | Bacteria | 7721 |
| 302 | Ga0075434_100084208 | 3300006871 | Bacteria | 3178 |
| 303 | Ga0075434_100710685 | 3300006871 | Bacteria | 1022 |
| 304 | Ga0068865_100029249 | 3300006881 | Bacteria | 3653 |
| 305 | Ga0068865_100653927 | 3300006881 | Unclassified | 894 |
| 306 | Ga0075436_100045891 | 3300006914 | Bacteria | 3014 |
| 307 | Ga0075436_100257051 | 3300006914 | Bacteria | 1245 |
| 308 | Ga0097620_100061878 | 3300006931 | Bacteria | 3772 |
| 309 | Ga0097620_100197825 | 3300006931 | Bacteria | 2094 |
| 310 | Ga0097620_100377864 | 3300006931 | Bacteria | 1512 |
| 311 | Ga0075435_100000173 | 3300007076 | Bacteria | 37964 |
| 312 | Ga0075435_101534756 | 3300007076 | Unclassified | 584 |
| 313 | Ga0099794_10035084 | 3300007265 | Bacteria | 2366 |
| 314 | Ga0105251_10256404 | 3300009011 | Bacteria | 789 |
| 315 | Ga0105240_10028577 | 3300009093 | Bacteria | 7280 |
| 316 | Ga0105240_10066209 | 3300009093 | Bacteria | 4483 |
| 317 | Ga0105240_10173504 | 3300009093 | Bacteria | 2551 |
| 318 | Ga0105240_10220098 | 3300009093 | Bacteria | 2212 |
| 319 | Ga0105240_10224354 | 3300009093 | Bacteria | 2187 |
| 320 | Ga0105240_10262295 | 3300009093 | Bacteria | 1992 |
| 321 | Ga0105240_10283714 | 3300009093 | Bacteria | 1901 |
| 322 | Ga0111539_10808465 | 3300009094 | Bacteria | 1091 |
| 323 | Ga0105245_10008119 | 3300009098 | Bacteria | 9185 |
| 324 | Ga0105245_10021602 | 3300009098 | Bacteria | 5648 |
| 325 | Ga0105245_10059022 | 3300009098 | Unclassified | 3454 |
| 326 | Ga0105245_10128920 | 3300009098 | Bacteria | 2371 |
| 327 | Ga0105245_10258397 | 3300009098 | Bacteria | 1694 |
| 328 | Ga0105245_10303548 | 3300009098 | Bacteria | 1567 |
| 329 | Ga0105245_10904532 | 3300009098 | Bacteria | 924 |
| 330 | Ga0105247_10075990 | 3300009101 | Bacteria | 2109 |
| 331 | Ga0105247_10103890 | 3300009101 | Bacteria | 1820 |
| 332 | Ga0105247_10121730 | 3300009101 | Unclassified | 1691 |
| 333 | Ga0114129_10662456 | 3300009147 | Bacteria | 1346 |
| 334 | Ga0105243_10390461 | 3300009148 | Bacteria | 1290 |
| 335 | Ga0105241_10006954 | 3300009174 | Bacteria | 8326 |
| 336 | Ga0105241_10098600 | 3300009174 | Bacteria | 2319 |
| 337 | Ga0105241_10169505 | 3300009174 | Bacteria | 1802 |
| 338 | Ga0105241_10320186 | 3300009174 | Bacteria | 1337 |
| 339 | Ga0105241_10354255 | 3300009174 | Bacteria | 1275 |
| 340 | Ga0105241_10802635 | 3300009174 | Bacteria | 867 |
| 341 | Ga0105241_11708493 | 3300009174 | Bacteria | 612 |
| 342 | Ga0105241_12314488 | 3300009174 | Bacteria | 535 |
| 343 | Ga0105242_10025538 | 3300009176 | Bacteria | 4676 |
| 344 | Ga0105242_10067160 | 3300009176 | Bacteria | 2963 |
| 345 | Ga0105242_10196828 | 3300009176 | Bacteria | 1788 |
| 346 | Ga0105242_12553589 | 3300009176 | Unclassified | 559 |
| 347 | Ga0105248_10056683 | 3300009177 | Bacteria | 4396 |
| 348 | Ga0105248_10151081 | 3300009177 | Bacteria | 2620 |
| 349 | Ga0105248_10166343 | 3300009177 | Bacteria | 2486 |
| 350 | Ga0105248_10940186 | 3300009177 | Bacteria | 976 |
| 351 | Ga0105237_10076830 | 3300009545 | Bacteria | 3329 |
| 352 | Ga0105237_10167400 | 3300009545 | Bacteria | 2197 |
| 353 | Ga0105237_10229794 | 3300009545 | Bacteria | 1856 |
| 354 | Ga0105237_10233508 | 3300009545 | Bacteria | 1840 |
| 355 | Ga0105237_10293118 | 3300009545 | Bacteria | 1630 |
| 356 | Ga0105237_10372210 | 3300009545 | Bacteria | 1433 |
| 357 | Ga0105237_10548272 | 3300009545 | Bacteria | 1163 |
| 358 | Ga0105238_10149171 | 3300009551 | Bacteria | 2314 |
| 359 | Ga0105238_10184851 | 3300009551 | Bacteria | 2060 |
| 360 | Ga0105238_10285001 | 3300009551 | Bacteria | 1634 |
| 361 | Ga0105249_10020124 | 3300009553 | Bacteria | 5961 |
| 362 | Ga0105249_10041458 | 3300009553 | Bacteria | 4185 |
| 363 | Ga0105249_10062042 | 3300009553 | Bacteria | 3431 |
| 364 | Ga0105249_10079956 | 3300009553 | Unclassified | 3036 |
| 365 | Ga0099796_10123497 | 3300010159 | Bacteria | 997 |
| 366 | Ga0105239_10033112 | 3300010375 | Bacteria | 5676 |
| 367 | Ga0105239_10169686 | 3300010375 | Bacteria | 2439 |
| 368 | Ga0105239_10356404 | 3300010375 | Bacteria | 1652 |
| 369 | Ga0105239_10469018 | 3300010375 | Bacteria | 1429 |
| 370 | Ga0105239_11650745 | 3300010375 | Bacteria | 741 |
| 371 | Ga0105246_10017813 | 3300011119 | Bacteria | 4517 |
| 372 | Ga0105246_10195957 | 3300011119 | Bacteria | 1567 |
| 373 | Ga0105246_12010072 | 3300011119 | Unclassified | 558 |
| 374 | Ga0157373_10004365 | 3300013100 | Bacteria | 10654 |
| 375 | Ga0157373_10011522 | 3300013100 | Bacteria | 6497 |
| 376 | Ga0157373_10094317 | 3300013100 | Bacteria | 2107 |
| 377 | Ga0157373_10166246 | 3300013100 | Unclassified | 1552 |
| 378 | Ga0157371_10001874 | 3300013102 | Bacteria | 21041 |
| 379 | Ga0157371_10208260 | 3300013102 | Bacteria | 1403 |
| 380 | Ga0157371_10465920 | 3300013102 | Unclassified | 930 |
| 381 | Ga0157371_10566166 | 3300013102 | Bacteria | 843 |
| 382 | Ga0157370_10028414 | 3300013104 | Bacteria | 5501 |
| 383 | Ga0157370_10060172 | 3300013104 | Bacteria | 3607 |
| 384 | Ga0157370_10118275 | 3300013104 | Bacteria | 2475 |
| 385 | Ga0157370_10221891 | 3300013104 | Bacteria | 1751 |
| 386 | Ga0157369_10043736 | 3300013105 | Bacteria | 4881 |
| 387 | Ga0157369_10046631 | 3300013105 | Bacteria | 4709 |
| 388 | Ga0157369_10124073 | 3300013105 | Bacteria | 2739 |
| 389 | Ga0157369_10125246 | 3300013105 | Bacteria | 2725 |
| 390 | Ga0157369_10132681 | 3300013105 | Bacteria | 2638 |
| 391 | Ga0157369_10146034 | 3300013105 | Bacteria | 2501 |
| 392 | Ga0157369_10235144 | 3300013105 | Unclassified | 1915 |
| 393 | Ga0157369_10473017 | 3300013105 | Bacteria | 1297 |
| 394 | Ga0157369_10594901 | 3300013105 | Bacteria | 1142 |
| 395 | Ga0157374_10019511 | 3300013296 | Bacteria | 6001 |
| 396 | Ga0157374_10022249 | 3300013296 | Bacteria | 5654 |
| 397 | Ga0157374_10033622 | 3300013296 | Bacteria | 4680 |
| 398 | Ga0157374_10064959 | 3300013296 | Bacteria | 3426 |
| 399 | Ga0157374_10443072 | 3300013296 | Bacteria | 1299 |
| 400 | Ga0157374_10720541 | 3300013296 | Bacteria | 1011 |
| 401 | Ga0157374_10759293 | 3300013296 | Bacteria | 985 |
| 402 | Ga0157374_11150755 | 3300013296 | Unclassified | 797 |
| 403 | Ga0157374_11601229 | 3300013296 | Unclassified | 675 |
| 404 | Ga0157378_10000080 | 3300013297 | Bacteria | 88903 |
| 405 | Ga0157378_10111486 | 3300013297 | Bacteria | 2509 |
| 406 | Ga0157378_10361976 | 3300013297 | Bacteria | 1420 |
| 407 | Ga0157378_10443252 | 3300013297 | Unclassified | 1287 |
| 408 | Ga0157378_11263202 | 3300013297 | Bacteria | 779 |
| 409 | Ga0157378_12277191 | 3300013297 | Bacteria | 593 |
| 410 | Ga0163162_10002825 | 3300013306 | Bacteria | 16516 |
| 411 | Ga0163162_10008701 | 3300013306 | Bacteria | 9880 |
| 412 | Ga0163162_10081086 | 3300013306 | Unclassified | 3314 |
| 413 | Ga0163162_13259215 | 3300013306 | Unclassified | 520 |
| 414 | Ga0157372_10007870 | 3300013307 | Bacteria | 11329 |
| 415 | Ga0157372_10056045 | 3300013307 | Bacteria | 4404 |
| 416 | Ga0157372_10066678 | 3300013307 | Bacteria | 4044 |
| 417 | Ga0157372_10075172 | 3300013307 | Bacteria | 3811 |
| 418 | Ga0157372_10102361 | 3300013307 | Bacteria | 3272 |
| 419 | Ga0157372_10168758 | 3300013307 | Bacteria | 2531 |
| 420 | Ga0157372_10270722 | 3300013307 | Bacteria | 1973 |
| 421 | Ga0157372_10291043 | 3300013307 | Bacteria | 1899 |
| 422 | Ga0157372_10776359 | 3300013307 | Bacteria | 1114 |
| 423 | Ga0157375_10048295 | 3300013308 | Bacteria | 4162 |
| 424 | Ga0157375_10281354 | 3300013308 | Bacteria | 1826 |
| 425 | Ga0157375_10489877 | 3300013308 | Bacteria | 1394 |
| 426 | Ga0157375_10516078 | 3300013308 | Bacteria | 1358 |
| 427 | Ga0157375_10908356 | 3300013308 | Bacteria | 1024 |
| 428 | Ga0163163_10007748 | 3300014325 | Bacteria | 9491 |
| 429 | Ga0163163_10099513 | 3300014325 | Bacteria | 2929 |
| 430 | Ga0163163_10150928 | 3300014325 | Bacteria | 2367 |
| 431 | Ga0163163_10275599 | 3300014325 | Bacteria | 1733 |
| 432 | Ga0157380_10201360 | 3300014326 | Bacteria | 1767 |
| 433 | Ga0182008_10018152 | 3300014497 | Bacteria | 3644 |
| 434 | Ga0157377_10003870 | 3300014745 | Bacteria | 6818 |
| 435 | Ga0157377_10086320 | 3300014745 | Bacteria | 1844 |
| 436 | Ga0157377_10390755 | 3300014745 | Bacteria | 945 |
| 437 | Ga0157377_10814391 | 3300014745 | Bacteria | 690 |
| 438 | Ga0157379_10009000 | 3300014968 | Bacteria | 8702 |
| 439 | Ga0157379_10100665 | 3300014968 | Bacteria | 2594 |
| 440 | Ga0157379_10145073 | 3300014968 | Unclassified | 2140 |
| 441 | Ga0157379_10160330 | 3300014968 | Unclassified | 2030 |
| 442 | Ga0157379_10409558 | 3300014968 | Bacteria | 1247 |
| 443 | Ga0157376_10005415 | 3300014969 | Bacteria | 8926 |
| 444 | Ga0157376_10051361 | 3300014969 | Bacteria | 3424 |
| 445 | Ga0157376_10189494 | 3300014969 | Unclassified | 1885 |
| 446 | Ga0157376_10312876 | 3300014969 | Bacteria | 1490 |
| 447 | Ga0157376_10523718 | 3300014969 | Bacteria | 1169 |
| 448 | Ga0157376_10975534 | 3300014969 | Bacteria | 869 |
| 449 | Ga0157376_11194216 | 3300014969 | Bacteria | 789 |
| 450 | Ga0182007_10025964 | 3300015262 | Bacteria | 2035 |
| 451 | Ga0163161_10033798 | 3300017792 | Unclassified | 3655 |
| 452 | Ga0197907_10558217 | 3300020069 | Bacteria | 917 |
| 453 | Ga0197907_11041484 | 3300020069 | Bacteria | 1243 |
| 454 | Ga0206356_11447340 | 3300020070 | Bacteria | 1364 |
| 455 | Ga0206356_11591461 | 3300020070 | Bacteria | 750 |
| 456 | Ga0206349_1169383 | 3300020075 | Bacteria | 1322 |
| 457 | Ga0206349_1838695 | 3300020075 | Bacteria | 841 |
| 458 | Ga0206355_1093249 | 3300020076 | Bacteria | 2057 |
| 459 | Ga0206351_10454637 | 3300020077 | Bacteria | 1231 |
| 460 | Ga0206351_10924681 | 3300020077 | Bacteria | 971 |
| 461 | Ga0206352_10096670 | 3300020078 | Bacteria | 756 |
| 462 | Ga0206352_10855043 | 3300020078 | Bacteria | 1979 |
| 463 | Ga0206352_11260177 | 3300020078 | Bacteria | 949 |
| 464 | Ga0206350_10127627 | 3300020080 | Bacteria | 1799 |
| 465 | Ga0206350_10163719 | 3300020080 | Bacteria | 4592 |
| 466 | Ga0206350_10834542 | 3300020080 | Unclassified | 733 |
| 467 | Ga0206350_11365607 | 3300020080 | Bacteria | 1116 |
| 468 | Ga0206354_10640681 | 3300020081 | Unclassified | 1424 |
| 469 | Ga0206353_10792725 | 3300020082 | Bacteria | 895 |
| 470 | Ga0154015_1103445 | 3300020610 | Bacteria | 5206 |
| 471 | Ga0224712_10000977 | 3300022467 | Bacteria | 6217 |
| 472 | Ga0224712_10010981 | 3300022467 | Bacteria | 2790 |
| 473 | Ga0224712_10034546 | 3300022467 | Bacteria | 1860 |
| 474 | Ga0224712_10035179 | 3300022467 | Bacteria | 1847 |
| 475 | Ga0224712_10109093 | 3300022467 | Bacteria | 1185 |
| 476 | Ga0224572_1001294 | 3300024225 | Bacteria | 3617 |
| 477 | Ga0224572_1007760 | 3300024225 | Unclassified | 1973 |
| 478 | Ga0224572_1055539 | 3300024225 | Unclassified | 735 |
| 479 | Ga0228598_1001027 | 3300024227 | Bacteria | 6134 |
| 480 | Ga0228598_1003872 | 3300024227 | Bacteria | 3192 |
| 481 | Ga0228598_1051058 | 3300024227 | Bacteria | 820 |
| 482 | Ga0207697_10024533 | 3300025315 | Bacteria | 2468 |
| 483 | Ga0207682_10045324 | 3300025893 | Bacteria | 1805 |
| 484 | Ga0207692_10054102 | 3300025898 | Bacteria | 2047 |
| 485 | Ga0207692_10058514 | 3300025898 | Bacteria | 1986 |
| 486 | Ga0207692_10135886 | 3300025898 | Unclassified | 1394 |
| 487 | Ga0207642_10186015 | 3300025899 | Bacteria | 1136 |
| 488 | Ga0207642_10996495 | 3300025899 | Bacteria | 539 |
| 489 | Ga0207710_10066155 | 3300025900 | Bacteria | 1649 |
| 490 | Ga0207688_10065973 | 3300025901 | Unclassified | 2046 |
| 491 | Ga0207680_10173866 | 3300025903 | Bacteria | 1452 |
| 492 | Ga0207647_10003789 | 3300025904 | Bacteria | 11305 |
| 493 | Ga0207647_10007432 | 3300025904 | Bacteria | 7916 |
| 494 | Ga0207647_10027290 | 3300025904 | Unclassified | 3723 |
| 495 | Ga0207647_10157480 | 3300025904 | Bacteria | 1326 |
| 496 | Ga0207685_10005205 | 3300025905 | Bacteria | 3407 |
| 497 | Ga0207685_10017481 | 3300025905 | Bacteria | 2320 |
| 498 | Ga0207685_10110844 | 3300025905 | Unclassified | 1189 |
| 499 | Ga0207699_10125381 | 3300025906 | Bacteria | 1667 |
| 500 | Ga0207699_10384781 | 3300025906 | Unclassified | 996 |
| 501 | Ga0207699_10478003 | 3300025906 | Bacteria | 897 |
| 502 | Ga0207699_10645037 | 3300025906 | Bacteria | 773 |
| 503 | Ga0207699_10971116 | 3300025906 | Bacteria | 628 |
| 504 | Ga0207645_10000338 | 3300025907 | Bacteria | 39162 |
| 505 | Ga0207645_10013932 | 3300025907 | Bacteria | 5392 |
| 506 | Ga0207643_10000614 | 3300025908 | Bacteria | 22493 |
| 507 | Ga0207643_10017869 | 3300025908 | Bacteria | 3883 |
| 508 | Ga0207705_10001035 | 3300025909 | Bacteria | 22631 |
| 509 | Ga0207705_10017201 | 3300025909 | Bacteria | 5178 |
| 510 | Ga0207705_10679055 | 3300025909 | Bacteria | 801 |
| 511 | Ga0207684_10012987 | 3300025910 | Bacteria | 7211 |
| 512 | Ga0207684_10014429 | 3300025910 | Bacteria | 6811 |
| 513 | Ga0207684_10014612 | 3300025910 | Bacteria | 6765 |
| 514 | Ga0207684_10135410 | 3300025910 | Bacteria | 2115 |
| 515 | Ga0207684_10772045 | 3300025910 | Unclassified | 814 |
| 516 | Ga0207684_10774697 | 3300025910 | Bacteria | 812 |
| 517 | Ga0207684_10875784 | 3300025910 | Bacteria | 756 |
| 518 | Ga0207684_11108364 | 3300025910 | Bacteria | 658 |
| 519 | Ga0207654_10003614 | 3300025911 | Bacteria | 7801 |
| 520 | Ga0207654_10041563 | 3300025911 | Bacteria | 2596 |
| 521 | Ga0207654_10112878 | 3300025911 | Bacteria | 1694 |
| 522 | Ga0207654_10835798 | 3300025911 | Unclassified | 666 |
| 523 | Ga0207707_10000757 | 3300025912 | Bacteria | 31814 |
| 524 | Ga0207707_10336979 | 3300025912 | Bacteria | 1301 |
| 525 | Ga0207707_10667432 | 3300025912 | Bacteria | 875 |
| 526 | Ga0207707_10854928 | 3300025912 | Unclassified | 755 |
| 527 | Ga0207707_11132574 | 3300025912 | Bacteria | 636 |
| 528 | Ga0207695_10033293 | 3300025913 | Bacteria | 5623 |
| 529 | Ga0207695_10178746 | 3300025913 | Bacteria | 2044 |
| 530 | Ga0207695_10206483 | 3300025913 | Bacteria | 1877 |
| 531 | Ga0207695_10238796 | 3300025913 | Bacteria | 1719 |
| 532 | Ga0207695_10455281 | 3300025913 | Bacteria | 1163 |
| 533 | Ga0207671_10049110 | 3300025914 | Bacteria | 3123 |
| 534 | Ga0207671_10177968 | 3300025914 | Bacteria | 1654 |
| 535 | Ga0207671_10803895 | 3300025914 | Unclassified | 746 |
| 536 | Ga0207693_10000005 | 3300025915 | Bacteria | 186314 |
| 537 | Ga0207693_10000091 | 3300025915 | Bacteria | 80207 |
| 538 | Ga0207693_10000823 | 3300025915 | Bacteria | 27648 |
| 539 | Ga0207693_10011174 | 3300025915 | Bacteria | 7269 |
| 540 | Ga0207693_10035451 | 3300025915 | Unclassified | 3933 |
| 541 | Ga0207693_10268678 | 3300025915 | Unclassified | 1336 |
| 542 | Ga0207663_10002535 | 3300025916 | Bacteria | 8787 |
| 543 | Ga0207663_10020722 | 3300025916 | Bacteria | 3728 |
| 544 | Ga0207663_10033645 | 3300025916 | Bacteria | 3056 |
| 545 | Ga0207663_10151298 | 3300025916 | Bacteria | 1628 |
| 546 | Ga0207663_10287327 | 3300025916 | Bacteria | 1224 |
| 547 | Ga0207663_10333218 | 3300025916 | Unclassified | 1144 |
| 548 | Ga0207660_10052485 | 3300025917 | Bacteria | 2903 |
| 549 | Ga0207660_10309865 | 3300025917 | Bacteria | 1259 |
| 550 | Ga0207660_10659111 | 3300025917 | Bacteria | 853 |
| 551 | Ga0207660_11303255 | 3300025917 | Bacteria | 590 |
| 552 | Ga0207662_10031871 | 3300025918 | Bacteria | 3064 |
| 553 | Ga0207657_10006741 | 3300025919 | Bacteria | 11860 |
| 554 | Ga0207657_10009792 | 3300025919 | Bacteria | 9608 |
| 555 | Ga0207657_10081330 | 3300025919 | Bacteria | 2721 |
| 556 | Ga0207649_10009112 | 3300025920 | Bacteria | 5427 |
| 557 | Ga0207649_10091507 | 3300025920 | Bacteria | 1992 |
| 558 | Ga0207652_10030679 | 3300025921 | Bacteria | 4504 |
| 559 | Ga0207652_10078926 | 3300025921 | Bacteria | 2875 |
| 560 | Ga0207652_10137311 | 3300025921 | Bacteria | 2184 |
| 561 | Ga0207652_10165089 | 3300025921 | Bacteria | 1985 |
| 562 | Ga0207652_10212674 | 3300025921 | Bacteria | 1741 |
| 563 | Ga0207652_10214213 | 3300025921 | Bacteria | 1735 |
| 564 | Ga0207652_10344821 | 3300025921 | Bacteria | 1345 |
| 565 | Ga0207646_10010241 | 3300025922 | Bacteria | 9179 |
| 566 | Ga0207646_10029495 | 3300025922 | Bacteria | 4984 |
| 567 | Ga0207646_10155520 | 3300025922 | Bacteria | 2062 |
| 568 | Ga0207646_10328755 | 3300025922 | Bacteria | 1381 |
| 569 | Ga0207646_11044664 | 3300025922 | Unclassified | 721 |
| 570 | Ga0207681_10095819 | 3300025923 | Bacteria | 2129 |
| 571 | Ga0207694_10025905 | 3300025924 | Bacteria | 4458 |
| 572 | Ga0207694_10136780 | 3300025924 | Bacteria | 1968 |
| 573 | Ga0207694_10694243 | 3300025924 | Bacteria | 858 |
| 574 | Ga0207650_10000380 | 3300025925 | Bacteria | 41633 |
| 575 | Ga0207650_10911037 | 3300025925 | Bacteria | 747 |
| 576 | Ga0207687_10017987 | 3300025927 | Bacteria | 4663 |
| 577 | Ga0207687_10061324 | 3300025927 | Bacteria | 2656 |
| 578 | Ga0207687_11174707 | 3300025927 | Bacteria | 659 |
| 579 | Ga0207700_10001542 | 3300025928 | Bacteria | 13052 |
| 580 | Ga0207700_10001979 | 3300025928 | Bacteria | 11667 |
| 581 | Ga0207700_10005278 | 3300025928 | Bacteria | 7706 |
| 582 | Ga0207700_10074775 | 3300025928 | Bacteria | 2622 |
| 583 | Ga0207700_10078293 | 3300025928 | Bacteria | 2571 |
| 584 | Ga0207700_10098368 | 3300025928 | Bacteria | 2327 |
| 585 | Ga0207700_10397117 | 3300025928 | Unclassified | 1208 |
| 586 | Ga0207700_10482314 | 3300025928 | Unclassified | 1096 |
| 587 | Ga0207700_10525267 | 3300025928 | Bacteria | 1049 |
| 588 | Ga0207700_10787280 | 3300025928 | Bacteria | 850 |
| 589 | Ga0207664_10000127 | 3300025929 | Bacteria | 66344 |
| 590 | Ga0207664_10029379 | 3300025929 | Bacteria | 4186 |
| 591 | Ga0207664_10069940 | 3300025929 | Bacteria | 2823 |
| 592 | Ga0207664_10106048 | 3300025929 | Bacteria | 2330 |
| 593 | Ga0207664_10125480 | 3300025929 | Bacteria | 2154 |
| 594 | Ga0207664_10129037 | 3300025929 | Bacteria | 2126 |
| 595 | Ga0207664_10195134 | 3300025929 | Unclassified | 1745 |
| 596 | Ga0207664_10599754 | 3300025929 | Bacteria | 989 |
| 597 | Ga0207664_11736818 | 3300025929 | Unclassified | 546 |
| 598 | Ga0207644_10042612 | 3300025931 | Bacteria | 3217 |
| 599 | Ga0207644_10839162 | 3300025931 | Bacteria | 769 |
| 600 | Ga0207690_10049747 | 3300025932 | Unclassified | 2795 |
| 601 | Ga0207690_10072707 | 3300025932 | Bacteria | 2375 |
| 602 | Ga0207690_10477091 | 3300025932 | Bacteria | 1006 |
| 603 | Ga0207706_10019832 | 3300025933 | Bacteria | 6044 |
| 604 | Ga0207706_10029071 | 3300025933 | Bacteria | 4935 |
| 605 | Ga0207706_11214510 | 3300025933 | Unclassified | 626 |
| 606 | Ga0207706_11717576 | 3300025933 | Unclassified | 505 |
| 607 | Ga0207686_10146561 | 3300025934 | Bacteria | 1638 |
| 608 | Ga0207686_11159781 | 3300025934 | Unclassified | 631 |
| 609 | Ga0207669_10041135 | 3300025937 | Bacteria | 2688 |
| 610 | Ga0207669_10337827 | 3300025937 | Bacteria | 1159 |
| 611 | Ga0207704_10307910 | 3300025938 | Bacteria | 1216 |
| 612 | Ga0207704_10597121 | 3300025938 | Unclassified | 903 |
| 613 | Ga0207665_10000034 | 3300025939 | Bacteria | 88735 |
| 614 | Ga0207665_10008083 | 3300025939 | Bacteria | 6943 |
| 615 | Ga0207665_10017320 | 3300025939 | Bacteria | 4734 |
| 616 | Ga0207665_10019102 | 3300025939 | Unclassified | 4503 |
| 617 | Ga0207665_10040271 | 3300025939 | Bacteria | 3117 |
| 618 | Ga0207665_10098805 | 3300025939 | Bacteria | 2034 |
| 619 | Ga0207665_10115258 | 3300025939 | Bacteria | 1893 |
| 620 | Ga0207665_10265692 | 3300025939 | Unclassified | 1272 |
| 621 | Ga0207665_10415139 | 3300025939 | Unclassified | 1027 |
| 622 | Ga0207665_10527390 | 3300025939 | Bacteria | 915 |
| 623 | Ga0207691_10011784 | 3300025940 | Bacteria | 8391 |
| 624 | Ga0207691_10670928 | 3300025940 | Bacteria | 875 |
| 625 | Ga0207711_10006633 | 3300025941 | Bacteria | 9752 |
| 626 | Ga0207711_10663543 | 3300025941 | Bacteria | 973 |
| 627 | Ga0207711_11360936 | 3300025941 | Unclassified | 652 |
| 628 | Ga0207689_10000505 | 3300025942 | Bacteria | 36866 |
| 629 | Ga0207689_10001408 | 3300025942 | Bacteria | 22963 |
| 630 | Ga0207689_10080741 | 3300025942 | Bacteria | 2673 |
| 631 | Ga0207689_10116883 | 3300025942 | Bacteria | 2193 |
| 632 | Ga0207661_10000101 | 3300025944 | Bacteria | 54454 |
| 633 | Ga0207661_10057309 | 3300025944 | Bacteria | 3132 |
| 634 | Ga0207661_10170335 | 3300025944 | Bacteria | 1895 |
| 635 | Ga0207679_10000079 | 3300025945 | Bacteria | 85462 |
| 636 | Ga0207679_10198193 | 3300025945 | Bacteria | 1675 |
| 637 | Ga0207667_10051169 | 3300025949 | Bacteria | 4356 |
| 638 | Ga0207667_10157463 | 3300025949 | Bacteria | 2337 |
| 639 | Ga0207667_10163278 | 3300025949 | Bacteria | 2290 |
| 640 | Ga0207667_10276567 | 3300025949 | Bacteria | 1716 |
| 641 | Ga0207667_10381196 | 3300025949 | Bacteria | 1437 |
| 642 | Ga0207667_10383368 | 3300025949 | Bacteria | 1432 |
| 643 | Ga0207667_11677261 | 3300025949 | Unclassified | 603 |
| 644 | Ga0207667_12005103 | 3300025949 | Bacteria | 539 |
| 645 | Ga0207651_10053780 | 3300025960 | Unclassified | 2754 |
| 646 | Ga0207712_10020472 | 3300025961 | Bacteria | 4332 |
| 647 | Ga0207712_10166549 | 3300025961 | Bacteria | 1718 |
| 648 | Ga0207712_10226480 | 3300025961 | Bacteria | 1498 |
| 649 | Ga0207668_10004801 | 3300025972 | Bacteria | 7957 |
| 650 | Ga0207640_10000033 | 3300025981 | Bacteria | 115787 |
| 651 | Ga0207640_10010538 | 3300025981 | Bacteria | 5212 |
| 652 | Ga0207640_10039077 | 3300025981 | Bacteria | 3000 |
| 653 | Ga0207658_10154867 | 3300025986 | Unclassified | 1872 |
| 654 | Ga0207658_10273759 | 3300025986 | Bacteria | 1444 |
| 655 | Ga0207658_10287059 | 3300025986 | Bacteria | 1413 |
| 656 | Ga0207658_10431553 | 3300025986 | Bacteria | 1164 |
| 657 | Ga0207677_10035469 | 3300026023 | Bacteria | 3240 |
| 658 | Ga0207677_10163975 | 3300026023 | Bacteria | 1730 |
| 659 | Ga0207677_10680036 | 3300026023 | Bacteria | 911 |
| 660 | Ga0207703_10018871 | 3300026035 | Bacteria | 5387 |
| 661 | Ga0207703_10146584 | 3300026035 | Bacteria | 2054 |
| 662 | Ga0207703_10487848 | 3300026035 | Unclassified | 1155 |
| 663 | Ga0207703_10536283 | 3300026035 | Bacteria | 1102 |
| 664 | Ga0207639_10000096 | 3300026041 | Bacteria | 74667 |
| 665 | Ga0207639_10155689 | 3300026041 | Bacteria | 1919 |
| 666 | Ga0207639_10403913 | 3300026041 | Bacteria | 1231 |
| 667 | Ga0207639_10872157 | 3300026041 | Bacteria | 841 |
| 668 | Ga0207678_10005015 | 3300026067 | Bacteria | 11878 |
| 669 | Ga0207678_10015807 | 3300026067 | Bacteria | 6635 |
| 670 | Ga0207678_10022300 | 3300026067 | Bacteria | 5548 |
| 671 | Ga0207678_10054801 | 3300026067 | Bacteria | 3434 |
| 672 | Ga0207678_10311055 | 3300026067 | Bacteria | 1354 |
| 673 | Ga0207678_10475933 | 3300026067 | Unclassified | 1087 |
| 674 | Ga0207708_10025151 | 3300026075 | Bacteria | 4502 |
| 675 | Ga0207702_10280044 | 3300026078 | Unclassified | 1576 |
| 676 | Ga0207702_10841186 | 3300026078 | Bacteria | 908 |
| 677 | Ga0207702_10923848 | 3300026078 | Bacteria | 865 |
| 678 | Ga0207641_10000009 | 3300026088 | Bacteria | 407901 |
| 679 | Ga0207641_10150546 | 3300026088 | Bacteria | 2107 |
| 680 | Ga0207641_10191597 | 3300026088 | Bacteria | 1879 |
| 681 | Ga0207641_10395819 | 3300026088 | Bacteria | 1325 |
| 682 | Ga0207648_10000496 | 3300026089 | Bacteria | 43876 |
| 683 | Ga0207648_10473455 | 3300026089 | Unclassified | 1143 |
| 684 | Ga0207676_10000144 | 3300026095 | Bacteria | 61909 |
| 685 | Ga0207676_10500786 | 3300026095 | Bacteria | 1153 |
| 686 | Ga0207674_10000988 | 3300026116 | Bacteria | 37108 |
| 687 | Ga0207674_10001160 | 3300026116 | Bacteria | 34178 |
| 688 | Ga0207674_10003484 | 3300026116 | Bacteria | 19219 |
| 689 | Ga0207674_10127554 | 3300026116 | Bacteria | 2509 |
| 690 | Ga0207675_100058175 | 3300026118 | Unclassified | 3608 |
| 691 | Ga0207675_100089137 | 3300026118 | Unclassified | 2898 |
| 692 | Ga0207675_100896726 | 3300026118 | Unclassified | 903 |
| 693 | Ga0207683_10000869 | 3300026121 | Bacteria | 27689 |
| 694 | Ga0207683_11286370 | 3300026121 | Unclassified | 677 |
| 695 | Ga0207698_10022579 | 3300026142 | Unclassified | 4376 |
| 696 | Ga0207698_11519730 | 3300026142 | Bacteria | 685 |
| 697 | Ga0209588_1007852 | 3300027671 | Bacteria | 3153 |
| 698 | Ga0209588_1040264 | 3300027671 | Bacteria | 1508 |
| 699 | Ga0209588_1041388 | 3300027671 | Bacteria | 1487 |
| 700 | Ga0209588_1106600 | 3300027671 | Unclassified | 901 |
| 701 | Ga0265356_1000574 | 3300028017 | Bacteria | 6492 |
| 702 | Ga0265357_1017819 | 3300028023 | Unclassified | 763 |
| 703 | Ga0268266_10002830 | 3300028379 | Bacteria | 18089 |
| 704 | Ga0268266_10276075 | 3300028379 | Bacteria | 1561 |
| 705 | Ga0268265_10006045 | 3300028380 | Bacteria | 8228 |
| 706 | Ga0268265_10595893 | 3300028380 | Bacteria | 1055 |
| 707 | Ga0268265_11155559 | 3300028380 | Unclassified | 770 |
| 708 | Ga0268264_10010221 | 3300028381 | Bacteria | 7766 |
| 709 | Ga0268264_10178743 | 3300028381 | Unclassified | 1925 |
| 710 | Ga0268264_10181424 | 3300028381 | Bacteria | 1912 |
| 711 | Ga0268264_10235687 | 3300028381 | Bacteria | 1692 |
| 712 | Ga0268264_10619536 | 3300028381 | Bacteria | 1068 |
| 713 | Ga0265338_10005942 | 3300028800 | Bacteria | 15723 |
| 714 | Ga0265338_10006826 | 3300028800 | Bacteria | 14382 |
| 715 | Ga0265338_10052040 | 3300028800 | Bacteria | 3680 |
| 716 | Ga0265338_10060152 | 3300028800 | Bacteria | 3340 |
| 717 | Ga0265338_10126326 | 3300028800 | Bacteria | 2028 |
| 718 | Ga0265338_10273852 | 3300028800 | Bacteria | 1236 |
| 719 | Ga0265338_10363324 | 3300028800 | Bacteria | 1038 |
| 720 | Ga0265324_10098197 | 3300029957 | Unclassified | 996 |
| 721 | Ga0265762_1002021 | 3300030760 | Bacteria | 3697 |
| 722 | Ga0265762_1002584 | 3300030760 | Bacteria | 3258 |
| 723 | Ga0265762_1003378 | 3300030760 | Unclassified | 2858 |
| 724 | Ga0265763_1014574 | 3300030763 | Unclassified | 772 |
| 725 | Ga0265770_1055588 | 3300030878 | Unclassified | 726 |
| 726 | Ga0265765_1033754 | 3300030879 | Bacteria | 661 |
| 727 | Ga0265760_10002195 | 3300031090 | Bacteria | 5704 |
| 728 | Ga0265760_10006343 | 3300031090 | Unclassified | 3385 |
| 729 | Ga0265760_10006840 | 3300031090 | Bacteria | 3267 |
| 730 | Ga0265760_10016170 | 3300031090 | Bacteria | 2140 |
| 731 | Ga0265760_10018812 | 3300031090 | Bacteria | 1990 |
| 732 | Ga0265760_10125716 | 3300031090 | Unclassified | 826 |
| 733 | Ga0265328_10125846 | 3300031239 | Bacteria | 957 |
| 734 | Ga0265325_10014367 | 3300031241 | Bacteria | 4477 |
| 735 | Ga0265325_10113938 | 3300031241 | Bacteria | 1311 |
| 736 | Ga0265325_10177103 | 3300031241 | Unclassified | 995 |
| 737 | Ga0265340_10153941 | 3300031247 | Bacteria | 1047 |
| 738 | Ga0265340_10201851 | 3300031247 | Unclassified | 894 |
| 739 | Ga0265339_10006223 | 3300031249 | Bacteria | 7857 |
| 740 | Ga0265339_10018542 | 3300031249 | Bacteria | 4100 |
| 741 | Ga0265339_10030341 | 3300031249 | Bacteria | 3062 |
| 742 | Ga0265339_10031897 | 3300031249 | Bacteria | 2974 |
| 743 | Ga0265339_10212712 | 3300031249 | Bacteria | 949 |
| 744 | Ga0265339_10476288 | 3300031249 | Bacteria | 578 |
| 745 | Ga0265331_10082750 | 3300031250 | Bacteria | 1489 |
| 746 | Ga0265316_10021501 | 3300031344 | Bacteria | 5463 |
| 747 | Ga0265316_10069772 | 3300031344 | Unclassified | 2712 |
| 748 | Ga0265316_10174395 | 3300031344 | Bacteria | 1603 |
| 749 | Ga0265316_10209915 | 3300031344 | Unclassified | 1441 |
| 750 | Ga0265313_10243814 | 3300031595 | Unclassified | 735 |
| 751 | Ga0265314_10038422 | 3300031711 | Bacteria | 3458 |
| 752 | Ga0265314_10212192 | 3300031711 | Bacteria | 1136 |
| 753 | Ga0265314_10220850 | 3300031711 | Bacteria | 1106 |
| 754 | Ga0265342_10096806 | 3300031712 | Bacteria | 1686 |
| 755 | Ga0265342_10425544 | 3300031712 | Unclassified | 683 |
| 756 | Ga0265342_10450424 | 3300031712 | Unclassified | 660 |
| 757 | Ga0316214_1001111 | 3300033545 | Bacteria | 3027 |
| 758 | Ga0316212_1000944 | 3300033547 | Bacteria | 3785 |
| 759 | Ga0316212_1025202 | 3300033547 | Unclassified | 834 |
| 760 | Ga0373926_0278338 | 3300035083 | Bacteria | 651 |
| 761 | Ga0373928_0025709 | 3300035084 | Bacteria | 1271 |
| 762 | Ga0373934_0000868 | 3300035086 | Bacteria | 10936 |
| 763 | Ga0373934_0052108 | 3300035086 | Bacteria | 1622 |
| 764 | Ga0373944_0035682 | 3300035089 | Bacteria | 1516 |
| 765 | Ga0373951_0069515 | 3300035091 | Bacteria | 895 |
| 766 | Ga0373923_0035547 | 3300035111 | Bacteria | 2029 |
| 767 | Ga0373923_0145710 | 3300035111 | Bacteria | 1072 |
| 768 | Ga0373936_0018437 | 3300035113 | Bacteria | 2696 |
| 769 | Ga0373945_0066118 | 3300035116 | Unclassified | 1359 |
| 770 | Ga0373945_0086323 | 3300035116 | Bacteria | 1209 |
| 771 | Ga0373953_0010330 | 3300035117 | Bacteria | 3245 |
| 772 | Ga0373953_0087982 | 3300035117 | Bacteria | 1297 |
| 773 | Ga0373954_0000181 | 3300035118 | Bacteria | 22823 |
| 774 | Ga0373954_0051805 | 3300035118 | Bacteria | 1928 |
| 775 | Ga0373956_0003585 | 3300035119 | Bacteria | 6261 |
| 776 | Ga0373956_0033719 | 3300035119 | Bacteria | 2252 |
| 777 | Ga0373956_0422144 | 3300035119 | Bacteria | 636 |
| 778 | Ga0373943_0002219 | 3300035170 | Bacteria | 8835 |
| 779 | Ga0373943_0022184 | 3300035170 | Unclassified | 2939 |
| 780 | Ga0373943_0064653 | 3300035170 | Unclassified | 1837 |
| 781 | Ga0373946_0011012 | 3300035171 | Bacteria | 3363 |
| 782 | Ga0373955_0002424 | 3300035172 | Bacteria | 8136 |
| 783 | Ga0373955_0007468 | 3300035172 | Bacteria | 5025 |
| 784 | Ga0373955_0051027 | 3300035172 | Bacteria | 2252 |
| 785 | Ga0373955_0072154 | 3300035172 | Bacteria | 1933 |
| 786 | Ga0373955_0128392 | 3300035172 | Bacteria | 1478 |
| 787 | Ga0373955_0361929 | 3300035172 | Bacteria | 879 |
| 788 | Ga0373961_0281753 | 3300035241 | Unclassified | 610 |
| 789 | Ga0373962_0203097 | 3300035242 | Unclassified | 672 |
| 790 | Ga0373924_0010524 | 3300035410 | Bacteria | 3415 |
| 791 | Ga0373924_0210303 | 3300035410 | Bacteria | 859 |
| 792 | Ga0373924_0394677 | 3300035410 | Unclassified | 618 |
| 793 | Ga0373931_0015803 | 3300035691 | Bacteria | 3705 |
| 794 | Ga0373931_1111024 | 3300035691 | Unclassified | 538 |
| 795 | Ga0373935_0002028 | 3300035692 | Bacteria | 11441 |
| 796 | Ga0373935_0003912 | 3300035692 | Bacteria | 8693 |
| 797 | Ga0373935_0070771 | 3300035692 | Unclassified | 2249 |
| 798 | Ga0373935_0357667 | 3300035692 | Bacteria | 1042 |
| 799 | Ga0373927_0000180 | 3300035695 | Bacteria | 49813 |
| 800 | Ga0373927_0187941 | 3300035695 | Unclassified | 1355 |
| 801 | Ga0373927_0794466 | 3300035695 | Unclassified | 625 |
| 802 | Ga0373933_0003327 | 3300035724 | Bacteria | 8964 |
| 803 | Ga0373933_0020114 | 3300035724 | Bacteria | 3781 |
| 804 | Ga0373947_0000053 | 3300035725 | Bacteria | 57813 |
| 805 | Ga0373947_0018287 | 3300035725 | Bacteria | 4034 |
| 806 | Ga0373947_0161884 | 3300035725 | Bacteria | 1448 |
| 807 | Ga0373947_0188808 | 3300035725 | Unclassified | 1344 |
| 808 | Ga0373937_0000051 | 3300036401 | Bacteria | 104818 |
| 809 | Ga0373937_0002506 | 3300036401 | Bacteria | 15252 |
| 810 | Ga0373937_0008779 | 3300036401 | Bacteria | 8771 |
| 811 | Ga0373937_0546875 | 3300036401 | Bacteria | 1100 |
| 812 | Ga0373925_0005266 | 3300037068 | Bacteria | 9656 |
| 813 | Ga0373925_0008302 | 3300037068 | Bacteria | 7559 |
| 814 | Ga0373925_0026298 | 3300037068 | Bacteria | 4258 |
| 815 | Ga0373925_0163013 | 3300037068 | Bacteria | 1757 |
| 816 | Ga0373925_0258323 | 3300037068 | Bacteria | 1399 |
| 817 | Ga0373925_1576784 | 3300037068 | Unclassified | 537 |
| 818 | Ga0395900_0335368 | 3300037418 | Bacteria | 1489 |
| 819 | Ga0395898_1816264 | 3300037466 | Bacteria | 531 |
| 820 | Ga0395905_0014958 | 3300037471 | Bacteria | 7400 |
| 821 | Ga0395905_0017597 | 3300037471 | Bacteria | 6784 |
| 822 | Ga0395905_0045414 | 3300037471 | Bacteria | 4120 |
| 823 | Ga0395905_1114080 | 3300037471 | Bacteria | 693 |
| 824 | Ga0395905_1210193 | 3300037471 | Unclassified | 659 |
| 825 | Ga0395901_0186796 | 3300038443 | Bacteria | 2174 |
| 826 | Ga0395901_0717626 | 3300038443 | Bacteria | 996 |
| 827 | Ga0395901_0916919 | 3300038443 | Bacteria | 857 |
| 828 | Ga0395901_1081839 | 3300038443 | Bacteria | 773 |
| 829 | Ga0436360_1208757 | 3300039438 | Bacteria | 607 |
| 830 | Ga0436363_0595174 | 3300039450 | Bacteria | 1209 |
| 831 | Ga0436363_1322577 | 3300039450 | Unclassified | 595 |
| 832 | Ga0451839_1217545 | 3300041496 | Bacteria | 552 |
| 833 | Ga0466963_0000297 | 3300044694 | Bacteria | 22355 |
| 834 | Ga0466968_0227172 | 3300044735 | Bacteria | 881 |
| 835 | Ga0466959_0317760 | 3300045049 | Bacteria | 1065 |
| 836 | Ga0466967_0002509 | 3300045976 | Bacteria | 11470 |
| 837 | Ga0466967_0077576 | 3300045976 | Bacteria | 2991 |
| 838 | Ga0495603_0283676 | 3300046455 | Unclassified | 952 |
| 839 | Ga0495629_0027431 | 3300046459 | Bacteria | 4042 |
| 840 | Ga0495638_0180741 | 3300046460 | Bacteria | 1204 |
| 841 | Ga0495651_0060034 | 3300046462 | Unclassified | 2914 |
| 842 | Ga0495651_0109502 | 3300046462 | Unclassified | 2044 |
| 843 | Ga0495653_0137206 | 3300046463 | Bacteria | 1724 |
| 844 | Ga0495580_0000605 | 3300046472 | Bacteria | 30320 |
| 845 | Ga0495580_0047305 | 3300046472 | Bacteria | 3049 |
| 846 | Ga0495580_0689071 | 3300046472 | Unclassified | 669 |
| 847 | Ga0495580_0779842 | 3300046472 | Unclassified | 621 |
| 848 | Ga0495580_0895953 | 3300046472 | Unclassified | 570 |
| 849 | Ga0495582_0049522 | 3300046473 | Unclassified | 2313 |
| 850 | Ga0495582_0146147 | 3300046473 | Bacteria | 1341 |
| 851 | Ga0495664_0042075 | 3300046477 | Bacteria | 2705 |
| 852 | Ga0495594_0015876 | 3300046499 | Bacteria | 3961 |
| 853 | Ga0495608_0031689 | 3300046511 | Bacteria | 3573 |
| 854 | Ga0495630_0036867 | 3300046517 | Bacteria | 3655 |
| 855 | Ga0495630_1496311 | 3300046517 | Bacteria | 507 |
| 856 | Ga0495666_0080879 | 3300046526 | Bacteria | 1537 |
| 857 | Ga0495652_0376511 | 3300046529 | Bacteria | 1011 |
| 858 | Ga0495652_0536900 | 3300046529 | Unclassified | 806 |
| 859 | Ga0495665_0102105 | 3300046531 | Unclassified | 1505 |
| 860 | Ga0495665_0245576 | 3300046531 | Bacteria | 922 |
| 861 | Ga0495640_0033075 | 3300046533 | Bacteria | 3677 |
| 862 | Ga0495587_0000167 | 3300046536 | Bacteria | 47833 |
| 863 | Ga0495587_0035010 | 3300046536 | Unclassified | 3026 |
| 864 | Ga0495656_0037725 | 3300046615 | Unclassified | 1998 |
| 865 | Ga0495634_0098044 | 3300046642 | Bacteria | 1897 |
| 866 | Ga0495611_0401829 | 3300046648 | Unclassified | 626 |
| 867 | Ga0495657_0052261 | 3300046675 | Bacteria | 2740 |
| 868 | Ga0495657_0472594 | 3300046675 | Bacteria | 733 |
| 869 | Ga0495623_0011550 | 3300046679 | Bacteria | 5717 |
| 870 | Ga0495647_0014985 | 3300046681 | Bacteria | 2709 |
| 871 | Ga0495647_0128711 | 3300046681 | Unclassified | 1071 |
| 872 | Ga0495658_0012749 | 3300046683 | Bacteria | 4266 |
| 873 | Ga0495658_0068707 | 3300046683 | Unclassified | 2052 |
| 874 | Ga0495613_0280180 | 3300046689 | Unclassified | 1158 |
| 875 | Ga0495624_0020094 | 3300046690 | Bacteria | 4449 |
| 876 | Ga0495624_0315989 | 3300046690 | Bacteria | 941 |
| 877 | Ga0495670_0378449 | 3300046691 | Unclassified | 764 |
| 878 | Ga0495649_0301486 | 3300046694 | Bacteria | 816 |
| 879 | Ga0495581_0053556 | 3300047315 | Unclassified | 2330 |
| 880 | Ga0495581_0319516 | 3300047315 | Unclassified | 907 |
| 881 | Ga0495604_0004506 | 3300047317 | Bacteria | 11035 |
| 882 | Ga0495674_0008460 | 3300047319 | Bacteria | 9804 |
| 883 | Ga0495674_0033453 | 3300047319 | Unclassified | 4657 |
| 884 | Ga0495674_0060564 | 3300047319 | Bacteria | 3302 |
| 885 | Ga0495674_0073714 | 3300047319 | Unclassified | 2942 |
| 886 | Ga0495676_0051601 | 3300047321 | Bacteria | 3289 |
| 887 | Ga0495676_0219811 | 3300047321 | Bacteria | 1310 |
| 888 | Ga0495680_0072482 | 3300047322 | Bacteria | 2620 |
| 889 | Ga0495675_0001194 | 3300047444 | Bacteria | 15733 |
| 890 | Ga0495684_0057638 | 3300047471 | Bacteria | 2960 |
| 891 | Ga0495684_0081300 | 3300047471 | Unclassified | 2459 |
| 892 | Ga0495686_0001897 | 3300047472 | Bacteria | 20884 |
| 893 | Ga0495602_0000048 | 3300048088 | Bacteria | 116248 |
| 894 | Ga0495602_0002959 | 3300048088 | Bacteria | 17416 |
| 895 | Ga0495602_0046284 | 3300048088 | Bacteria | 3931 |
| 896 | Ga0495602_0440266 | 3300048088 | Bacteria | 922 |
| 897 | Ga0495614_0045562 | 3300048089 | Bacteria | 1880 |
| 898 | Ga0496100_0026318 | 3300048903 | Bacteria | 3565 |
| 899 | Ga0496100_0042506 | 3300048903 | Bacteria | 2903 |
| 900 | Ga0496100_0116428 | 3300048903 | Bacteria | 1865 |
| 901 | Ga0496100_0911684 | 3300048903 | Bacteria | 690 |
| 902 | Ga0496100_1648767 | 3300048903 | Unclassified | 507 |
| 903 | Ga0496101_0046527 | 3300048904 | Bacteria | 3112 |
| 904 | Ga0496101_0058764 | 3300048904 | Bacteria | 2786 |
| 905 | Ga0496101_0078625 | 3300048904 | Unclassified | 2434 |
| 906 | Ga0496102_0004103 | 3300048905 | Bacteria | 12350 |
| 907 | Ga0496102_0037200 | 3300048905 | Bacteria | 4389 |
| 908 | Ga0496102_0181183 | 3300048905 | Bacteria | 1985 |
| 909 | Ga0496102_0268485 | 3300048905 | Bacteria | 1608 |
| 910 | Ga0496102_0373313 | 3300048905 | Bacteria | 1342 |
| 911 | Ga0496102_1016957 | 3300048905 | Bacteria | 749 |
| 912 | Ga0496103_0002092 | 3300048906 | Bacteria | 12758 |
| 913 | Ga0496103_0014865 | 3300048906 | Bacteria | 4627 |
| 914 | Ga0496103_0086595 | 3300048906 | Unclassified | 1975 |
| 915 | Ga0496104_0007099 | 3300048907 | Bacteria | 9874 |
| 916 | Ga0496104_0269857 | 3300048907 | Unclassified | 1614 |
| 917 | Ga0496104_0339491 | 3300048907 | Unclassified | 1415 |
| 918 | Ga0496104_0349726 | 3300048907 | Bacteria | 1391 |
| 919 | Ga0496104_0494630 | 3300048907 | Bacteria | 1134 |
| 920 | Ga0496104_0723416 | 3300048907 | Unclassified | 903 |
| 921 | Ga0496104_0863090 | 3300048907 | Unclassified | 810 |
| 922 | Ga0496104_1221224 | 3300048907 | Bacteria | 655 |
| 923 | Ga0496104_1541235 | 3300048907 | Unclassified | 567 |
| 924 | Ga0496105_0547109 | 3300048908 | Bacteria | 904 |
| 925 | Ga0496105_0730149 | 3300048908 | Bacteria | 758 |
| 926 | Ga0496105_0918168 | 3300048908 | Bacteria | 659 |
| 927 | Ga0496106_0012306 | 3300048909 | Bacteria | 6314 |
| 928 | Ga0496106_0141255 | 3300048909 | Unclassified | 1894 |
| 929 | Ga0496106_0287097 | 3300048909 | Bacteria | 1319 |
| 930 | Ga0496106_0406778 | 3300048909 | Bacteria | 1094 |
| 931 | Ga0496106_1052212 | 3300048909 | Bacteria | 639 |
| 932 | Ga0496107_0443586 | 3300048910 | Unclassified | 964 |
| 933 | Ga0496108_0001332 | 3300048911 | Bacteria | 19405 |
| 934 | Ga0496108_0555264 | 3300048911 | Bacteria | 1002 |
| 935 | Ga0496109_0000183 | 3300048912 | Bacteria | 62532 |
| 936 | Ga0496109_0140860 | 3300048912 | Bacteria | 2255 |
| 937 | Ga0496110_0175254 | 3300048913 | Bacteria | 1946 |
| 938 | Ga0496112_0000030 | 3300048915 | Bacteria | 120429 |
| 939 | Ga0496112_0032189 | 3300048915 | Bacteria | 5091 |
| 940 | Ga0496112_0050305 | 3300048915 | Bacteria | 4086 |
| 941 | Ga0496112_0254126 | 3300048915 | Bacteria | 1708 |
| 942 | Ga0496112_1019367 | 3300048915 | Bacteria | 747 |
| 943 | Ga0496113_1310905 | 3300048916 | Unclassified | 563 |
| 944 | Ga0496114_0089174 | 3300048917 | Bacteria | 2617 |
| 945 | Ga0496114_0313004 | 3300048917 | Bacteria | 1387 |
| 946 | Ga0496114_1039035 | 3300048917 | Bacteria | 703 |
| 947 | Ga0496115_0004579 | 3300048918 | Bacteria | 10015 |
| 948 | Ga0496115_0108511 | 3300048918 | Bacteria | 2279 |
| 949 | Ga0496115_1374763 | 3300048918 | Unclassified | 522 |
| 950 | Ga0496126_0069921 | 3300048929 | Bacteria | 3129 |
| 951 | Ga0501034_0001077 | 3300049571 | Bacteria | 38646 |
| 952 | Ga0501036_0448431 | 3300049572 | Bacteria | 1075 |
| 953 | Ga0501038_0000357 | 3300049574 | Bacteria | 39282 |
| 954 | Ga0501039_0080178 | 3300049575 | Unclassified | 2540 |
| 955 | Ga0501035_0077155 | 3300049822 | Unclassified | 2945 |
| 956 | Ga0501044_0828642 | 3300049823 | Unclassified | 803 |
| 957 | nmdc:mga05p37_697866_c1 | 3300050507 | Bacteria | 1128 |
| 958 | nmdc:mga08y16_480996_c1 | 3300050511 | Bacteria | 1263 |
| 959 | nmdc:mga0n895_5280_c1 | 3300050512 | Bacteria | 10756 |
| 960 | nmdc:mga0n895_632_c1 | 3300050512 | Bacteria | 24449 |
| 961 | nmdc:mga0rr50_1413348_c1 | 3300050513 | Unclassified | 589 |
| 962 | nmdc:mga0rr50_7460_c1 | 3300050513 | Bacteria | 6749 |
| 963 | nmdc:mga08x19_59262_c1 | 3300050514 | Bacteria | 2478 |
| 964 | nmdc:mga08x19_658716_c1 | 3300050514 | Bacteria | 743 |
| 965 | nmdc:mga0a205_34094_c1 | 3300050515 | Bacteria | 4884 |
| 966 | Ga0495601_0030015 | 3300053077 | Unclassified | 3375 |
| 967 | Ga0495619_0351754 | 3300053085 | Bacteria | 1019 |
| 968 | Ga0495619_0625492 | 3300053085 | Unclassified | 735 |
| 969 | Ga0587066_035580 | 3300059490 | Bacteria | 912 |
| 970 | Ga0587128_007638 | 3300059630 | Bacteria | 1373 |
| 971 | Ga0587111_0056265 | 3300060346 | Bacteria | 882 |
| 972 | Ga0501082_0203712 | 3300060353 | Bacteria | 1721 |
| 973 | Ga0265760_10099217 | |||
| 974 | MBSR1b_contig_10165024 | |||
| 975 | MBSR1b_contig_10507888 | |||
| 976 | LJNas_1004583 | |||
| 977 | JGI24752J21851_1011902 | |||
| 978 | JGI24737J22298_10037023 | |||
| 979 | JGI24034J26672_10005738 | |||
| 980 | JGI24751J29686_10002022 | |||
| 981 | rootL2_10312876 | |||
| 982 | Ga0058863_10030681 | |||
| 983 | Ga0058863_10127990 | |||
| 984 | Ga0058861_10074048 | |||
| 985 | Ga0058862_10062502 | |||
| 986 | Ga0058862_10211683 | |||
| 987 | Ga0065712_10139591 | |||
| 988 | Ga0065715_10006051 | |||
| 989 | Ga0070658_10057744 | |||
| 990 | Ga0070658_10246788 | |||
| 991 | Ga0070658_10510840 | |||
| 992 | Ga0070676_10024794 | |||
| 993 | Ga0070683_100007816 | |||
| 994 | Ga0070683_100026554 | |||
| 995 | Ga0070683_100249383 | |||
| 996 | Ga0070690_100010254 | |||
| 997 | Ga0070690_100244677 | |||
| 998 | Ga0070690_100503445 | |||
| 999 | Ga0070670_100012670 | |||
| 1000 | Ga0070677_10150025 | |||
| 1001 | Ga0068869_100001091 | |||
| 1002 | Ga0068869_100107562 | |||
| 1003 | Ga0070666_10086109 | |||
| 1004 | Ga0070666_10245933 | |||
| 1005 | Ga0070680_100079702 | |||
| 1006 | Ga0070680_100135809 | |||
| 1007 | Ga0070680_100147717 | |||
| 1008 | Ga0070680_100383749 | |||
| 1009 | Ga0070682_100042189 | |||
| 1010 | Ga0070682_100180365 | |||
| 1011 | Ga0070682_100295611 | |||
| 1012 | Ga0070682_100374723 | |||
| 1013 | Ga0068868_100031940 | |||
| 1014 | Ga0068868_100041104 | |||
| 1015 | Ga0068868_100230334 | |||
| 1016 | Ga0068868_100273165 | |||
| 1017 | Ga0070660_100019734 | |||
| 1018 | Ga0070660_100027487 | |||
| 1019 | Ga0070660_100044512 | |||
| 1020 | Ga0070689_100010978 | |||
| 1021 | Ga0070691_10477605 | |||
| 1022 | Ga0070687_100003669 | |||
| 1023 | Ga0070661_100005336 | |||
| 1024 | Ga0070661_100017859 | |||
| 1025 | Ga0070661_100308055 | |||
| 1026 | Ga0070692_10021641 | |||
| 1027 | Ga0070692_10590913 | |||
| 1028 | Ga0070668_100018162 | |||
| 1029 | Ga0070668_100052416 | |||
| 1030 | Ga0070668_101380798 | |||
| 1031 | Ga0070669_100103593 | |||
| 1032 | Ga0070669_100117210 | |||
| 1033 | Ga0070675_100024569 | |||
| 1034 | Ga0070675_100478110 | |||
| 1035 | Ga0070674_100086726 | |||
| 1036 | Ga0070673_100005154 | |||
| 1037 | Ga0070673_101470164 | |||
| 1038 | Ga0070688_100020972 | |||
| 1039 | Ga0070688_100060749 | |||
| 1040 | Ga0070659_100001853 | |||
| 1041 | Ga0070659_100410658 | |||
| 1042 | Ga0070667_100134715 | |||
| 1043 | Ga0070667_100144270 | |||
| 1044 | Ga0070667_100162609 | |||
| 1045 | Ga0070667_100230880 | |||
| 1046 | Ga0070709_10093672 | |||
| 1047 | Ga0070709_10195615 | |||
| 1048 | Ga0070709_10215712 | |||
| 1049 | Ga0070709_11037071 | |||
| 1050 | Ga0070714_100000111 | |||
| 1051 | Ga0070714_100085248 | |||
| 1052 | Ga0070714_100177857 | |||
| 1053 | Ga0070714_100224150 | |||
| 1054 | Ga0070714_100274857 | |||
| 1055 | Ga0070714_100330524 | |||
| 1056 | Ga0070714_100493730 | |||
| 1057 | Ga0070714_100633530 | |||
| 1058 | Ga0070714_102154378 | |||
| 1059 | Ga0070713_100000231 | |||
| 1060 | Ga0070713_100004047 | |||
| 1061 | Ga0070713_100016019 | |||
| 1062 | Ga0070713_100075339 | |||
| 1063 | Ga0070713_100079167 | |||
| 1064 | Ga0070713_100369294 | |||
| 1065 | Ga0070713_100817667 | |||
| 1066 | Ga0070713_100964379 | |||
| 1067 | Ga0070710_10005065 | |||
| 1068 | Ga0070710_10117119 | |||
| 1069 | Ga0070710_10144587 | |||
| 1070 | Ga0070710_10186885 | |||
| 1071 | Ga0070701_10104756 | |||
| 1072 | Ga0070711_100000519 | |||
| 1073 | Ga0070711_100000929 | |||
| 1074 | Ga0070711_100039221 | |||
| 1075 | Ga0070711_100082975 | |||
| 1076 | Ga0070711_100406463 | |||
| 1077 | Ga0070711_100517078 | |||
| 1078 | Ga0070711_100655150 | |||
| 1079 | Ga0070711_101338125 | |||
| 1080 | Ga0070711_101516647 | |||
| 1081 | Ga0070705_100396319 | |||
| 1082 | Ga0070705_100673471 | |||
| 1083 | Ga0070705_101424654 | |||
| 1084 | Ga0070694_100308754 | |||
| 1085 | Ga0070694_100509637 | |||
| 1086 | Ga0070708_100000410 | |||
| 1087 | Ga0070708_100014908 | |||
| 1088 | Ga0070708_100075059 | |||
| 1089 | Ga0070708_100083480 | |||
| 1090 | Ga0070708_100261059 | |||
| 1091 | Ga0070663_100003902 | |||
| 1092 | Ga0070663_100079392 | |||
| 1093 | Ga0070663_100082057 | |||
| 1094 | Ga0070663_100096112 | |||
| 1095 | Ga0070663_100284221 | |||
| 1096 | Ga0070678_101337073 | |||
| 1097 | Ga0070662_100030086 | |||
| 1098 | Ga0070662_100169342 | |||
| 1099 | Ga0070662_101096647 | |||
| 1100 | Ga0070662_101701482 | |||
| 1101 | Ga0070681_10001954 | |||
| 1102 | Ga0070681_10036253 | |||
| 1103 | Ga0070681_10233915 | |||
| 1104 | Ga0070681_10415393 | |||
| 1105 | Ga0070681_10505284 | |||
| 1106 | Ga0070681_10590882 | |||
| 1107 | Ga0070681_10834360 | |||
| 1108 | Ga0070681_10994218 | |||
| 1109 | Ga0070681_11179639 | |||
| 1110 | Ga0068867_100127797 | |||
| 1111 | Ga0068867_100868312 | |||
| 1112 | Ga0070685_10000891 | |||
| 1113 | Ga0070706_100001099 | |||
| 1114 | Ga0070706_100003090 | |||
| 1115 | Ga0070706_100059036 | |||
| 1116 | Ga0070706_100574126 | |||
| 1117 | Ga0070706_100830338 | |||
| 1118 | Ga0070706_101123520 | |||
| 1119 | Ga0070707_100000229 | |||
| 1120 | Ga0070707_100034150 | |||
| 1121 | Ga0070707_100091366 | |||
| 1122 | Ga0070707_100099997 | |||
| 1123 | Ga0070707_100107375 | |||
| 1124 | Ga0070707_100120929 | |||
| 1125 | Ga0070707_100156922 | |||
| 1126 | Ga0070707_100653099 | |||
| 1127 | Ga0070698_100018118 | |||
| 1128 | Ga0070698_100027170 | |||
| 1129 | Ga0070698_100037896 | |||
| 1130 | Ga0070698_100048291 | |||
| 1131 | Ga0070698_100255932 | |||
| 1132 | Ga0070699_100000703 | |||
| 1133 | Ga0070699_100001773 | |||
| 1134 | Ga0070699_100036450 | |||
| 1135 | Ga0070699_100065354 | |||
| 1136 | Ga0070699_100273390 | |||
| 1137 | Ga0070699_100378618 | |||
| 1138 | Ga0070699_100880063 | |||
| 1139 | Ga0070679_100026671 | |||
| 1140 | Ga0070679_100030052 | |||
| 1141 | Ga0070679_100065948 | |||
| 1142 | Ga0070679_100120123 | |||
| 1143 | Ga0070679_100208731 | |||
| 1144 | Ga0070679_101123619 | |||
| 1145 | Ga0070684_100025735 | |||
| 1146 | Ga0070684_100184514 | |||
| 1147 | Ga0070684_100396792 | |||
| 1148 | Ga0070684_101036296 | |||
| 1149 | Ga0070684_101069149 | |||
| 1150 | Ga0070697_100000166 | |||
| 1151 | Ga0070697_100000673 | |||
| 1152 | Ga0070697_100001242 | |||
| 1153 | Ga0070697_100003229 | |||
| 1154 | Ga0070697_100009587 | |||
| 1155 | Ga0070697_100575543 | |||
| 1156 | Ga0070697_101360534 | |||
| 1157 | Ga0068853_100000064 | |||
| 1158 | Ga0068853_100145674 | |||
| 1159 | Ga0068853_100145969 | |||
| 1160 | Ga0070672_100078340 | |||
| 1161 | Ga0070672_100815998 | |||
| 1162 | Ga0070686_100051263 | |||
| 1163 | Ga0070686_100101894 | |||
| 1164 | Ga0070686_100210482 | |||
| 1165 | Ga0070686_100772422 | |||
| 1166 | Ga0070695_100134470 | |||
| 1167 | Ga0070695_100233972 | |||
| 1168 | Ga0070696_100162259 | |||
| 1169 | Ga0070696_100493033 | |||
| 1170 | Ga0070693_100065727 | |||
| 1171 | Ga0070693_100425590 | |||
| 1172 | Ga0070665_100045644 | |||
| 1173 | Ga0070665_100177480 | |||
| 1174 | Ga0070704_100438251 | |||
| 1175 | Ga0068855_100085404 | |||
| 1176 | Ga0068855_100363724 | |||
| 1177 | Ga0068855_100643803 | |||
| 1178 | Ga0068855_101158651 | |||
| 1179 | Ga0068855_101230969 | |||
| 1180 | Ga0068855_101943166 | |||
| 1181 | Ga0068855_102334590 | |||
| 1182 | Ga0070664_100307705 | |||
| 1183 | Ga0068857_100012748 | |||
| 1184 | Ga0068857_100027770 | |||
| 1185 | Ga0068857_100353009 | |||
| 1186 | Ga0068854_100000073 | |||
| 1187 | Ga0068854_100084144 | |||
| 1188 | Ga0068854_100247345 | |||
| 1189 | Ga0068854_100382191 | |||
| 1190 | Ga0068854_100415931 | |||
| 1191 | Ga0068856_100032606 | |||
| 1192 | Ga0068856_100038619 | |||
| 1193 | Ga0068856_100363545 | |||
| 1194 | Ga0068856_101000832 | |||
| 1195 | Ga0070702_100018838 | |||
| 1196 | Ga0068852_100108429 | |||
| 1197 | Ga0068852_100706000 | |||
| 1198 | Ga0068852_101138316 | |||
| 1199 | Ga0068859_100061883 | |||
| 1200 | Ga0068859_100197826 | |||
| 1201 | Ga0068859_100377869 | |||
| 1202 | Ga0068866_10069989 | |||
| 1203 | Ga0068866_10073008 | |||
| 1204 | Ga0068866_10212732 | |||
| 1205 | Ga0068861_100028262 | |||
| 1206 | Ga0068861_100054581 | |||
| 1207 | Ga0068861_101536641 | |||
| 1208 | Ga0068870_10000880 | |||
| 1209 | Ga0068870_10904922 | |||
| 1210 | Ga0068863_100209702 | |||
| 1211 | Ga0068863_100235832 | |||
| 1212 | Ga0068863_100292679 | |||
| 1213 | Ga0068858_100010651 | |||
| 1214 | Ga0068858_100032024 | |||
| 1215 | Ga0068858_100210677 | |||
| 1216 | Ga0068858_100522280 | |||
| 1217 | Ga0068860_100021654 | |||
| 1218 | Ga0068860_100075859 | |||
| 1219 | Ga0068860_100231371 | |||
| 1220 | Ga0068860_100660283 | |||
| 1221 | Ga0068862_100008118 | |||
| 1222 | Ga0068862_100024110 | |||
| 1223 | Ga0068862_100209957 | |||
| 1224 | Ga0068862_101164666 | |||
| 1225 | Ga0081540_1156928 | |||
| 1226 | Ga0070717_10008860 | |||
| 1227 | Ga0070717_10023401 | |||
| 1228 | Ga0070717_10089905 | |||
| 1229 | Ga0070717_10097818 | |||
| 1230 | Ga0070717_10173615 | |||
| 1231 | Ga0070717_10181039 | |||
| 1232 | Ga0070717_10490030 | |||
| 1233 | Ga0070717_10547684 | |||
| 1234 | Ga0070717_10607901 | |||
| 1235 | Ga0070717_10671886 | |||
| 1236 | Ga0070717_10697941 | |||
| 1237 | Ga0070717_10740594 | |||
| 1238 | Ga0070717_11123531 | |||
| 1239 | Ga0070715_10013418 | |||
| 1240 | Ga0070715_10135758 | |||
| 1241 | Ga0070715_10142113 | |||
| 1242 | Ga0070715_10189289 | |||
| 1243 | Ga0070716_100019448 | |||
| 1244 | Ga0070716_100036790 | |||
| 1245 | Ga0070716_100074262 | |||
| 1246 | Ga0070716_100134428 | |||
| 1247 | Ga0070716_100153955 | |||
| 1248 | Ga0070716_100227152 | |||
| 1249 | Ga0070716_100259291 | |||
| 1250 | Ga0070716_100259949 | |||
| 1251 | Ga0070716_100400203 | |||
| 1252 | Ga0070712_100000120 | |||
| 1253 | Ga0070712_100001238 | |||
| 1254 | Ga0070712_100002759 | |||
| 1255 | Ga0070712_100036247 | |||
| 1256 | Ga0070712_100379410 | |||
| 1257 | Ga0070712_100456828 | |||
| 1258 | Ga0070712_100708235 | |||
| 1259 | Ga0097621_100023588 | |||
| 1260 | Ga0097621_100051309 | |||
| 1261 | Ga0097621_100078156 | |||
| 1262 | Ga0097621_100088932 | |||
| 1263 | Ga0097621_100655281 | |||
| 1264 | Ga0097621_100904805 | |||
| 1265 | Ga0068871_100001112 | |||
| 1266 | Ga0068871_100177023 | |||
| 1267 | Ga0068871_100780774 | |||
| 1268 | Ga0068871_100984760 | |||
| 1269 | Ga0068871_101387326 | |||
| 1270 | Ga0075433_10025151 | |||
| 1271 | Ga0075433_10163964 | |||
| 1272 | Ga0075433_10490906 | |||
| 1273 | Ga0075434_100013738 | |||
| 1274 | Ga0075434_100084208 | |||
| 1275 | Ga0075434_100710685 | |||
| 1276 | Ga0068865_100029249 | |||
| 1277 | Ga0068865_100653927 | |||
| 1278 | Ga0075436_100045891 | |||
| 1279 | Ga0075436_100257051 | |||
| 1280 | Ga0097620_100061878 | |||
| 1281 | Ga0097620_100197825 | |||
| 1282 | Ga0097620_100377864 | |||
| 1283 | Ga0075435_100000173 | |||
| 1284 | Ga0075435_101534756 | |||
| 1285 | Ga0099794_10035084 | |||
| 1286 | Ga0105251_10256404 | |||
| 1287 | Ga0105240_10028577 | |||
| 1288 | Ga0105240_10066209 | |||
| 1289 | Ga0105240_10173504 | |||
| 1290 | Ga0105240_10220098 | |||
| 1291 | Ga0105240_10224354 | |||
| 1292 | Ga0105240_10262295 | |||
| 1293 | Ga0105240_10283714 | |||
| 1294 | Ga0111539_10808465 | |||
| 1295 | Ga0105245_10008119 | |||
| 1296 | Ga0105245_10021602 | |||
| 1297 | Ga0105245_10059022 | |||
| 1298 | Ga0105245_10128920 | |||
| 1299 | Ga0105245_10258397 | |||
| 1300 | Ga0105245_10303548 | |||
| 1301 | Ga0105245_10904532 | |||
| 1302 | Ga0105247_10075990 | |||
| 1303 | Ga0105247_10103890 | |||
| 1304 | Ga0105247_10121730 | |||
| 1305 | Ga0114129_10662456 | |||
| 1306 | Ga0105243_10390461 | |||
| 1307 | Ga0105241_10006954 | |||
| 1308 | Ga0105241_10098600 | |||
| 1309 | Ga0105241_10169505 | |||
| 1310 | Ga0105241_10320186 | |||
| 1311 | Ga0105241_10354255 | |||
| 1312 | Ga0105241_10802635 | |||
| 1313 | Ga0105241_11708493 | |||
| 1314 | Ga0105241_12314488 | |||
| 1315 | Ga0105242_10025538 | |||
| 1316 | Ga0105242_10067160 | |||
| 1317 | Ga0105242_10196828 | |||
| 1318 | Ga0105242_12553589 | |||
| 1319 | Ga0105248_10056683 | |||
| 1320 | Ga0105248_10151081 | |||
| 1321 | Ga0105248_10166343 | |||
| 1322 | Ga0105248_10940186 | |||
| 1323 | Ga0105237_10076830 | |||
| 1324 | Ga0105237_10167400 | |||
| 1325 | Ga0105237_10229794 | |||
| 1326 | Ga0105237_10233508 | |||
| 1327 | Ga0105237_10293118 | |||
| 1328 | Ga0105237_10372210 | |||
| 1329 | Ga0105237_10548272 | |||
| 1330 | Ga0105238_10149171 | |||
| 1331 | Ga0105238_10184851 | |||
| 1332 | Ga0105238_10285001 | |||
| 1333 | Ga0105249_10020124 | |||
| 1334 | Ga0105249_10041458 | |||
| 1335 | Ga0105249_10062042 | |||
| 1336 | Ga0105249_10079956 | |||
| 1337 | Ga0099796_10123497 | |||
| 1338 | Ga0105239_10033112 | |||
| 1339 | Ga0105239_10169686 | |||
| 1340 | Ga0105239_10356404 | |||
| 1341 | Ga0105239_10469018 | |||
| 1342 | Ga0105239_11650745 | |||
| 1343 | Ga0105246_10017813 | |||
| 1344 | Ga0105246_10195957 | |||
| 1345 | Ga0105246_12010072 | |||
| 1346 | Ga0157373_10004365 | |||
| 1347 | Ga0157373_10011522 | |||
| 1348 | Ga0157373_10094317 | |||
| 1349 | Ga0157373_10166246 | |||
| 1350 | Ga0157371_10001874 | |||
| 1351 | Ga0157371_10208260 | |||
| 1352 | Ga0157371_10465920 | |||
| 1353 | Ga0157371_10566166 | |||
| 1354 | Ga0157370_10028414 | |||
| 1355 | Ga0157370_10060172 | |||
| 1356 | Ga0157370_10118275 | |||
| 1357 | Ga0157370_10221891 | |||
| 1358 | Ga0157369_10043736 | |||
| 1359 | Ga0157369_10046631 | |||
| 1360 | Ga0157369_10124073 | |||
| 1361 | Ga0157369_10125246 | |||
| 1362 | Ga0157369_10132681 | |||
| 1363 | Ga0157369_10146034 | |||
| 1364 | Ga0157369_10235144 | |||
| 1365 | Ga0157369_10473017 | |||
| 1366 | Ga0157369_10594901 | |||
| 1367 | Ga0157374_10019511 | |||
| 1368 | Ga0157374_10022249 | |||
| 1369 | Ga0157374_10033622 | |||
| 1370 | Ga0157374_10064959 | |||
| 1371 | Ga0157374_10443072 | |||
| 1372 | Ga0157374_10720541 | |||
| 1373 | Ga0157374_10759293 | |||
| 1374 | Ga0157374_11150755 | |||
| 1375 | Ga0157374_11601229 | |||
| 1376 | Ga0157378_10000080 | |||
| 1377 | Ga0157378_10111486 | |||
| 1378 | Ga0157378_10361976 | |||
| 1379 | Ga0157378_10443252 | |||
| 1380 | Ga0157378_11263202 | |||
| 1381 | Ga0157378_12277191 | |||
| 1382 | Ga0163162_10002825 | |||
| 1383 | Ga0163162_10008701 | |||
| 1384 | Ga0163162_10081086 | |||
| 1385 | Ga0163162_13259215 | |||
| 1386 | Ga0157372_10007870 | |||
| 1387 | Ga0157372_10056045 | |||
| 1388 | Ga0157372_10066678 | |||
| 1389 | Ga0157372_10075172 | |||
| 1390 | Ga0157372_10102361 | |||
| 1391 | Ga0157372_10168758 | |||
| 1392 | Ga0157372_10270722 | |||
| 1393 | Ga0157372_10291043 | |||
| 1394 | Ga0157372_10776359 | |||
| 1395 | Ga0157375_10048295 | |||
| 1396 | Ga0157375_10281354 | |||
| 1397 | Ga0157375_10489877 | |||
| 1398 | Ga0157375_10516078 | |||
| 1399 | Ga0157375_10908356 | |||
| 1400 | Ga0163163_10007748 | |||
| 1401 | Ga0163163_10099513 | |||
| 1402 | Ga0163163_10150928 | |||
| 1403 | Ga0163163_10275599 | |||
| 1404 | Ga0157380_10201360 | |||
| 1405 | Ga0182008_10018152 | |||
| 1406 | Ga0157377_10003870 | |||
| 1407 | Ga0157377_10086320 | |||
| 1408 | Ga0157377_10390755 | |||
| 1409 | Ga0157377_10814391 | |||
| 1410 | Ga0157379_10009000 | |||
| 1411 | Ga0157379_10100665 | |||
| 1412 | Ga0157379_10145073 | |||
| 1413 | Ga0157379_10160330 | |||
| 1414 | Ga0157379_10409558 | |||
| 1415 | Ga0157376_10005415 | |||
| 1416 | Ga0157376_10051361 | |||
| 1417 | Ga0157376_10189494 | |||
| 1418 | Ga0157376_10312876 | |||
| 1419 | Ga0157376_10523718 | |||
| 1420 | Ga0157376_10975534 | |||
| 1421 | Ga0157376_11194216 | |||
| 1422 | Ga0182007_10025964 | |||
| 1423 | Ga0163161_10033798 | |||
| 1424 | Ga0197907_10558217 | |||
| 1425 | Ga0197907_11041484 | |||
| 1426 | Ga0206356_11447340 | |||
| 1427 | Ga0206356_11591461 | |||
| 1428 | Ga0206349_1169383 | |||
| 1429 | Ga0206349_1838695 | |||
| 1430 | Ga0206355_1093249 | |||
| 1431 | Ga0206351_10454637 | |||
| 1432 | Ga0206351_10924681 | |||
| 1433 | Ga0206352_10096670 | |||
| 1434 | Ga0206352_10855043 | |||
| 1435 | Ga0206352_11260177 | |||
| 1436 | Ga0206350_10127627 | |||
| 1437 | Ga0206350_10163719 | |||
| 1438 | Ga0206350_10834542 | |||
| 1439 | Ga0206350_11365607 | |||
| 1440 | Ga0206354_10640681 | |||
| 1441 | Ga0206353_10792725 | |||
| 1442 | Ga0154015_1103445 | |||
| 1443 | Ga0224712_10000977 | |||
| 1444 | Ga0224712_10010981 | |||
| 1445 | Ga0224712_10034546 | |||
| 1446 | Ga0224712_10035179 | |||
| 1447 | Ga0224712_10109093 | |||
| 1448 | Ga0224572_1001294 | |||
| 1449 | Ga0224572_1007760 | |||
| 1450 | Ga0224572_1055539 | |||
| 1451 | Ga0228598_1001027 | |||
| 1452 | Ga0228598_1003872 | |||
| 1453 | Ga0228598_1051058 | |||
| 1454 | Ga0207697_10024533 | |||
| 1455 | Ga0207682_10045324 | |||
| 1456 | Ga0207692_10054102 | |||
| 1457 | Ga0207692_10058514 | |||
| 1458 | Ga0207692_10135886 | |||
| 1459 | Ga0207642_10186015 | |||
| 1460 | Ga0207642_10996495 | |||
| 1461 | Ga0207710_10066155 | |||
| 1462 | Ga0207688_10065973 | |||
| 1463 | Ga0207680_10173866 | |||
| 1464 | Ga0207647_10003789 | |||
| 1465 | Ga0207647_10007432 | |||
| 1466 | Ga0207647_10027290 | |||
| 1467 | Ga0207647_10157480 | |||
| 1468 | Ga0207685_10005205 | |||
| 1469 | Ga0207685_10017481 | |||
| 1470 | Ga0207685_10110844 | |||
| 1471 | Ga0207699_10125381 | |||
| 1472 | Ga0207699_10384781 | |||
| 1473 | Ga0207699_10478003 | |||
| 1474 | Ga0207699_10645037 | |||
| 1475 | Ga0207699_10971116 | |||
| 1476 | Ga0207645_10000338 | |||
| 1477 | Ga0207645_10013932 | |||
| 1478 | Ga0207643_10000614 | |||
| 1479 | Ga0207643_10017869 | |||
| 1480 | Ga0207705_10001035 | |||
| 1481 | Ga0207705_10017201 | |||
| 1482 | Ga0207705_10679055 | |||
| 1483 | Ga0207684_10012987 | |||
| 1484 | Ga0207684_10014429 | |||
| 1485 | Ga0207684_10014612 | |||
| 1486 | Ga0207684_10135410 | |||
| 1487 | Ga0207684_10772045 | |||
| 1488 | Ga0207684_10774697 | |||
| 1489 | Ga0207684_10875784 | |||
| 1490 | Ga0207684_11108364 | |||
| 1491 | Ga0207654_10003614 | |||
| 1492 | Ga0207654_10041563 | |||
| 1493 | Ga0207654_10112878 | |||
| 1494 | Ga0207654_10835798 | |||
| 1495 | Ga0207707_10000757 | |||
| 1496 | Ga0207707_10336979 | |||
| 1497 | Ga0207707_10667432 | |||
| 1498 | Ga0207707_10854928 | |||
| 1499 | Ga0207707_11132574 | |||
| 1500 | Ga0207695_10033293 | |||
| 1501 | Ga0207695_10178746 | |||
| 1502 | Ga0207695_10206483 | |||
| 1503 | Ga0207695_10238796 | |||
| 1504 | Ga0207695_10455281 | |||
| 1505 | Ga0207671_10049110 | |||
| 1506 | Ga0207671_10177968 | |||
| 1507 | Ga0207671_10803895 | |||
| 1508 | Ga0207693_10000005 | |||
| 1509 | Ga0207693_10000091 | |||
| 1510 | Ga0207693_10000823 | |||
| 1511 | Ga0207693_10011174 | |||
| 1512 | Ga0207693_10035451 | |||
| 1513 | Ga0207693_10268678 | |||
| 1514 | Ga0207663_10002535 | |||
| 1515 | Ga0207663_10020722 | |||
| 1516 | Ga0207663_10033645 | |||
| 1517 | Ga0207663_10151298 | |||
| 1518 | Ga0207663_10287327 | |||
| 1519 | Ga0207663_10333218 | |||
| 1520 | Ga0207660_10052485 | |||
| 1521 | Ga0207660_10309865 | |||
| 1522 | Ga0207660_10659111 | |||
| 1523 | Ga0207660_11303255 | |||
| 1524 | Ga0207662_10031871 | |||
| 1525 | Ga0207657_10006741 | |||
| 1526 | Ga0207657_10009792 | |||
| 1527 | Ga0207657_10081330 | |||
| 1528 | Ga0207649_10009112 | |||
| 1529 | Ga0207649_10091507 | |||
| 1530 | Ga0207652_10030679 | |||
| 1531 | Ga0207652_10078926 | |||
| 1532 | Ga0207652_10137311 | |||
| 1533 | Ga0207652_10165089 | |||
| 1534 | Ga0207652_10212674 | |||
| 1535 | Ga0207652_10214213 | |||
| 1536 | Ga0207652_10344821 | |||
| 1537 | Ga0207646_10010241 | |||
| 1538 | Ga0207646_10029495 | |||
| 1539 | Ga0207646_10155520 | |||
| 1540 | Ga0207646_10328755 | |||
| 1541 | Ga0207646_11044664 | |||
| 1542 | Ga0207681_10095819 | |||
| 1543 | Ga0207694_10025905 | |||
| 1544 | Ga0207694_10136780 | |||
| 1545 | Ga0207694_10694243 | |||
| 1546 | Ga0207650_10000380 | |||
| 1547 | Ga0207650_10911037 | |||
| 1548 | Ga0207687_10017987 | |||
| 1549 | Ga0207687_10061324 | |||
| 1550 | Ga0207687_11174707 | |||
| 1551 | Ga0207700_10001542 | |||
| 1552 | Ga0207700_10001979 | |||
| 1553 | Ga0207700_10005278 | |||
| 1554 | Ga0207700_10074775 | |||
| 1555 | Ga0207700_10078293 | |||
| 1556 | Ga0207700_10098368 | |||
| 1557 | Ga0207700_10397117 | |||
| 1558 | Ga0207700_10482314 | |||
| 1559 | Ga0207700_10525267 | |||
| 1560 | Ga0207700_10787280 | |||
| 1561 | Ga0207664_10000127 | |||
| 1562 | Ga0207664_10029379 | |||
| 1563 | Ga0207664_10069940 | |||
| 1564 | Ga0207664_10106048 | |||
| 1565 | Ga0207664_10125480 | |||
| 1566 | Ga0207664_10129037 | |||
| 1567 | Ga0207664_10195134 | |||
| 1568 | Ga0207664_10599754 | |||
| 1569 | Ga0207664_11736818 | |||
| 1570 | Ga0207644_10042612 | |||
| 1571 | Ga0207644_10839162 | |||
| 1572 | Ga0207690_10049747 | |||
| 1573 | Ga0207690_10072707 | |||
| 1574 | Ga0207690_10477091 | |||
| 1575 | Ga0207706_10019832 | |||
| 1576 | Ga0207706_10029071 | |||
| 1577 | Ga0207706_11214510 | |||
| 1578 | Ga0207706_11717576 | |||
| 1579 | Ga0207686_10146561 | |||
| 1580 | Ga0207686_11159781 | |||
| 1581 | Ga0207669_10041135 | |||
| 1582 | Ga0207669_10337827 | |||
| 1583 | Ga0207704_10307910 | |||
| 1584 | Ga0207704_10597121 | |||
| 1585 | Ga0207665_10000034 | |||
| 1586 | Ga0207665_10008083 | |||
| 1587 | Ga0207665_10017320 | |||
| 1588 | Ga0207665_10019102 | |||
| 1589 | Ga0207665_10040271 | |||
| 1590 | Ga0207665_10098805 | |||
| 1591 | Ga0207665_10115258 | |||
| 1592 | Ga0207665_10265692 | |||
| 1593 | Ga0207665_10415139 | |||
| 1594 | Ga0207665_10527390 | |||
| 1595 | Ga0207691_10011784 | |||
| 1596 | Ga0207691_10670928 | |||
| 1597 | Ga0207711_10006633 | |||
| 1598 | Ga0207711_10663543 | |||
| 1599 | Ga0207711_11360936 | |||
| 1600 | Ga0207689_10000505 | |||
| 1601 | Ga0207689_10001408 | |||
| 1602 | Ga0207689_10080741 | |||
| 1603 | Ga0207689_10116883 | |||
| 1604 | Ga0207661_10000101 | |||
| 1605 | Ga0207661_10057309 | |||
| 1606 | Ga0207661_10170335 | |||
| 1607 | Ga0207679_10000079 | |||
| 1608 | Ga0207679_10198193 | |||
| 1609 | Ga0207667_10051169 | |||
| 1610 | Ga0207667_10157463 | |||
| 1611 | Ga0207667_10163278 | |||
| 1612 | Ga0207667_10276567 | |||
| 1613 | Ga0207667_10381196 | |||
| 1614 | Ga0207667_10383368 | |||
| 1615 | Ga0207667_11677261 | |||
| 1616 | Ga0207667_12005103 | |||
| 1617 | Ga0207651_10053780 | |||
| 1618 | Ga0207712_10020472 | |||
| 1619 | Ga0207712_10166549 | |||
| 1620 | Ga0207712_10226480 | |||
| 1621 | Ga0207668_10004801 | |||
| 1622 | Ga0207640_10000033 | |||
| 1623 | Ga0207640_10010538 | |||
| 1624 | Ga0207640_10039077 | |||
| 1625 | Ga0207658_10154867 | |||
| 1626 | Ga0207658_10273759 | |||
| 1627 | Ga0207658_10287059 | |||
| 1628 | Ga0207658_10431553 | |||
| 1629 | Ga0207677_10035469 | |||
| 1630 | Ga0207677_10163975 | |||
| 1631 | Ga0207677_10680036 | |||
| 1632 | Ga0207703_10018871 | |||
| 1633 | Ga0207703_10146584 | |||
| 1634 | Ga0207703_10487848 | |||
| 1635 | Ga0207703_10536283 | |||
| 1636 | Ga0207639_10000096 | |||
| 1637 | Ga0207639_10155689 | |||
| 1638 | Ga0207639_10403913 | |||
| 1639 | Ga0207639_10872157 | |||
| 1640 | Ga0207678_10005015 | |||
| 1641 | Ga0207678_10015807 | |||
| 1642 | Ga0207678_10022300 | |||
| 1643 | Ga0207678_10054801 | |||
| 1644 | Ga0207678_10311055 | |||
| 1645 | Ga0207678_10475933 | |||
| 1646 | Ga0207708_10025151 | |||
| 1647 | Ga0207702_10280044 | |||
| 1648 | Ga0207702_10841186 | |||
| 1649 | Ga0207702_10923848 | |||
| 1650 | Ga0207641_10000009 | |||
| 1651 | Ga0207641_10150546 | |||
| 1652 | Ga0207641_10191597 | |||
| 1653 | Ga0207641_10395819 | |||
| 1654 | Ga0207648_10000496 | |||
| 1655 | Ga0207648_10473455 | |||
| 1656 | Ga0207676_10000144 | |||
| 1657 | Ga0207676_10500786 | |||
| 1658 | Ga0207674_10000988 | |||
| 1659 | Ga0207674_10001160 | |||
| 1660 | Ga0207674_10003484 | |||
| 1661 | Ga0207674_10127554 | |||
| 1662 | Ga0207675_100058175 | |||
| 1663 | Ga0207675_100089137 | |||
| 1664 | Ga0207675_100896726 | |||
| 1665 | Ga0207683_10000869 | |||
| 1666 | Ga0207683_11286370 | |||
| 1667 | Ga0207698_10022579 | |||
| 1668 | Ga0207698_11519730 | |||
| 1669 | Ga0209588_1007852 | |||
| 1670 | Ga0209588_1040264 | |||
| 1671 | Ga0209588_1041388 | |||
| 1672 | Ga0209588_1106600 | |||
| 1673 | Ga0265356_1000574 | |||
| 1674 | Ga0265357_1017819 | |||
| 1675 | Ga0268266_10002830 | |||
| 1676 | Ga0268266_10276075 | |||
| 1677 | Ga0268265_10006045 | |||
| 1678 | Ga0268265_10595893 | |||
| 1679 | Ga0268265_11155559 | |||
| 1680 | Ga0268264_10010221 | |||
| 1681 | Ga0268264_10178743 | |||
| 1682 | Ga0268264_10181424 | |||
| 1683 | Ga0268264_10235687 | |||
| 1684 | Ga0268264_10619536 | |||
| 1685 | Ga0265338_10005942 | |||
| 1686 | Ga0265338_10006826 | |||
| 1687 | Ga0265338_10052040 | |||
| 1688 | Ga0265338_10060152 | |||
| 1689 | Ga0265338_10126326 | |||
| 1690 | Ga0265338_10273852 | |||
| 1691 | Ga0265338_10363324 | |||
| 1692 | Ga0265324_10098197 | |||
| 1693 | Ga0265762_1002021 | |||
| 1694 | Ga0265762_1002584 | |||
| 1695 | Ga0265762_1003378 | |||
| 1696 | Ga0265763_1014574 | |||
| 1697 | Ga0265770_1055588 | |||
| 1698 | Ga0265765_1033754 | |||
| 1699 | Ga0265760_10002195 | |||
| 1700 | Ga0265760_10006343 | |||
| 1701 | Ga0265760_10006840 | |||
| 1702 | Ga0265760_10016170 | |||
| 1703 | Ga0265760_10018812 | |||
| 1704 | Ga0265760_10125716 | |||
| 1705 | Ga0265328_10125846 | |||
| 1706 | Ga0265325_10014367 | |||
| 1707 | Ga0265325_10113938 | |||
| 1708 | Ga0265325_10177103 | |||
| 1709 | Ga0265340_10153941 | |||
| 1710 | Ga0265340_10201851 | |||
| 1711 | Ga0265339_10006223 | |||
| 1712 | Ga0265339_10018542 | |||
| 1713 | Ga0265339_10030341 | |||
| 1714 | Ga0265339_10031897 | |||
| 1715 | Ga0265339_10212712 | |||
| 1716 | Ga0265339_10476288 | |||
| 1717 | Ga0265331_10082750 | |||
| 1718 | Ga0265316_10021501 | |||
| 1719 | Ga0265316_10069772 | |||
| 1720 | Ga0265316_10174395 | |||
| 1721 | Ga0265316_10209915 | |||
| 1722 | Ga0265313_10243814 | |||
| 1723 | Ga0265314_10038422 | |||
| 1724 | Ga0265314_10212192 | |||
| 1725 | Ga0265314_10220850 | |||
| 1726 | Ga0265342_10096806 | |||
| 1727 | Ga0265342_10425544 | |||
| 1728 | Ga0265342_10450424 | |||
| 1729 | Ga0316214_1001111 | |||
| 1730 | Ga0316212_1000944 | |||
| 1731 | Ga0316212_1025202 | |||
| 1732 | Ga0373926_0278338 | |||
| 1733 | Ga0373928_0025709 | |||
| 1734 | Ga0373934_0000868 | |||
| 1735 | Ga0373934_0052108 | |||
| 1736 | Ga0373944_0035682 | |||
| 1737 | Ga0373951_0069515 | |||
| 1738 | Ga0373923_0035547 | |||
| 1739 | Ga0373923_0145710 | |||
| 1740 | Ga0373936_0018437 | |||
| 1741 | Ga0373945_0066118 | |||
| 1742 | Ga0373945_0086323 | |||
| 1743 | Ga0373953_0010330 | |||
| 1744 | Ga0373953_0087982 | |||
| 1745 | Ga0373954_0000181 | |||
| 1746 | Ga0373954_0051805 | |||
| 1747 | Ga0373956_0003585 | |||
| 1748 | Ga0373956_0033719 | |||
| 1749 | Ga0373956_0422144 | |||
| 1750 | Ga0373943_0002219 | |||
| 1751 | Ga0373943_0022184 | |||
| 1752 | Ga0373943_0064653 | |||
| 1753 | Ga0373946_0011012 | |||
| 1754 | Ga0373955_0002424 | |||
| 1755 | Ga0373955_0007468 | |||
| 1756 | Ga0373955_0051027 | |||
| 1757 | Ga0373955_0072154 | |||
| 1758 | Ga0373955_0128392 | |||
| 1759 | Ga0373955_0361929 | |||
| 1760 | Ga0373961_0281753 | |||
| 1761 | Ga0373962_0203097 | |||
| 1762 | Ga0373924_0010524 | |||
| 1763 | Ga0373924_0210303 | |||
| 1764 | Ga0373924_0394677 | |||
| 1765 | Ga0373931_0015803 | |||
| 1766 | Ga0373931_1111024 | |||
| 1767 | Ga0373935_0002028 | |||
| 1768 | Ga0373935_0003912 | |||
| 1769 | Ga0373935_0070771 | |||
| 1770 | Ga0373935_0357667 | |||
| 1771 | Ga0373927_0000180 | |||
| 1772 | Ga0373927_0187941 | |||
| 1773 | Ga0373927_0794466 | |||
| 1774 | Ga0373933_0003327 | |||
| 1775 | Ga0373933_0020114 | |||
| 1776 | Ga0373947_0000053 | |||
| 1777 | Ga0373947_0018287 | |||
| 1778 | Ga0373947_0161884 | |||
| 1779 | Ga0373947_0188808 | |||
| 1780 | Ga0373937_0000051 | |||
| 1781 | Ga0373937_0002506 | |||
| 1782 | Ga0373937_0008779 | |||
| 1783 | Ga0373937_0546875 | |||
| 1784 | Ga0373925_0005266 | |||
| 1785 | Ga0373925_0008302 | |||
| 1786 | Ga0373925_0026298 | |||
| 1787 | Ga0373925_0163013 | |||
| 1788 | Ga0373925_0258323 | |||
| 1789 | Ga0373925_1576784 | |||
| 1790 | Ga0395900_0335368 | |||
| 1791 | Ga0395898_1816264 | |||
| 1792 | Ga0395905_0014958 | |||
| 1793 | Ga0395905_0017597 | |||
| 1794 | Ga0395905_0045414 | |||
| 1795 | Ga0395905_1114080 | |||
| 1796 | Ga0395905_1210193 | |||
| 1797 | Ga0395901_0186796 | |||
| 1798 | Ga0395901_0717626 | |||
| 1799 | Ga0395901_0916919 | |||
| 1800 | Ga0395901_1081839 | |||
| 1801 | Ga0436360_1208757 | |||
| 1802 | Ga0436363_0595174 | |||
| 1803 | Ga0436363_1322577 | |||
| 1804 | Ga0451839_1217545 | |||
| 1805 | Ga0466963_0000297 | |||
| 1806 | Ga0466968_0227172 | |||
| 1807 | Ga0466959_0317760 | |||
| 1808 | Ga0466967_0002509 | |||
| 1809 | Ga0466967_0077576 | |||
| 1810 | Ga0495603_0283676 | |||
| 1811 | Ga0495629_0027431 | |||
| 1812 | Ga0495638_0180741 | |||
| 1813 | Ga0495651_0060034 | |||
| 1814 | Ga0495651_0109502 | |||
| 1815 | Ga0495653_0137206 | |||
| 1816 | Ga0495580_0000605 | |||
| 1817 | Ga0495580_0047305 | |||
| 1818 | Ga0495580_0689071 | |||
| 1819 | Ga0495580_0779842 | |||
| 1820 | Ga0495580_0895953 | |||
| 1821 | Ga0495582_0049522 | |||
| 1822 | Ga0495582_0146147 | |||
| 1823 | Ga0495664_0042075 | |||
| 1824 | Ga0495594_0015876 | |||
| 1825 | Ga0495608_0031689 | |||
| 1826 | Ga0495630_0036867 | |||
| 1827 | Ga0495630_1496311 | |||
| 1828 | Ga0495666_0080879 | |||
| 1829 | Ga0495652_0376511 | |||
| 1830 | Ga0495652_0536900 | |||
| 1831 | Ga0495665_0102105 | |||
| 1832 | Ga0495665_0245576 | |||
| 1833 | Ga0495640_0033075 | |||
| 1834 | Ga0495587_0000167 | |||
| 1835 | Ga0495587_0035010 | |||
| 1836 | Ga0495656_0037725 | |||
| 1837 | Ga0495634_0098044 | |||
| 1838 | Ga0495611_0401829 | |||
| 1839 | Ga0495657_0052261 | |||
| 1840 | Ga0495657_0472594 | |||
| 1841 | Ga0495623_0011550 | |||
| 1842 | Ga0495647_0014985 | |||
| 1843 | Ga0495647_0128711 | |||
| 1844 | Ga0495658_0012749 | |||
| 1845 | Ga0495658_0068707 | |||
| 1846 | Ga0495613_0280180 | |||
| 1847 | Ga0495624_0020094 | |||
| 1848 | Ga0495624_0315989 | |||
| 1849 | Ga0495670_0378449 | |||
| 1850 | Ga0495649_0301486 | |||
| 1851 | Ga0495581_0053556 | |||
| 1852 | Ga0495581_0319516 | |||
| 1853 | Ga0495604_0004506 | |||
| 1854 | Ga0495674_0008460 | |||
| 1855 | Ga0495674_0033453 | |||
| 1856 | Ga0495674_0060564 | |||
| 1857 | Ga0495674_0073714 | |||
| 1858 | Ga0495676_0051601 | |||
| 1859 | Ga0495676_0219811 | |||
| 1860 | Ga0495680_0072482 | |||
| 1861 | Ga0495675_0001194 | |||
| 1862 | Ga0495684_0057638 | |||
| 1863 | Ga0495684_0081300 | |||
| 1864 | Ga0495686_0001897 | |||
| 1865 | Ga0495602_0000048 | |||
| 1866 | Ga0495602_0002959 | |||
| 1867 | Ga0495602_0046284 | |||
| 1868 | Ga0495602_0440266 | |||
| 1869 | Ga0495614_0045562 | |||
| 1870 | Ga0496100_0026318 | |||
| 1871 | Ga0496100_0042506 | |||
| 1872 | Ga0496100_0116428 | |||
| 1873 | Ga0496100_0911684 | |||
| 1874 | Ga0496100_1648767 | |||
| 1875 | Ga0496101_0046527 | |||
| 1876 | Ga0496101_0058764 | |||
| 1877 | Ga0496101_0078625 | |||
| 1878 | Ga0496102_0004103 | |||
| 1879 | Ga0496102_0037200 | |||
| 1880 | Ga0496102_0181183 | |||
| 1881 | Ga0496102_0268485 | |||
| 1882 | Ga0496102_0373313 | |||
| 1883 | Ga0496102_1016957 | |||
| 1884 | Ga0496103_0002092 | |||
| 1885 | Ga0496103_0014865 | |||
| 1886 | Ga0496103_0086595 | |||
| 1887 | Ga0496104_0007099 | |||
| 1888 | Ga0496104_0269857 | |||
| 1889 | Ga0496104_0339491 | |||
| 1890 | Ga0496104_0349726 | |||
| 1891 | Ga0496104_0494630 | |||
| 1892 | Ga0496104_0723416 | |||
| 1893 | Ga0496104_0863090 | |||
| 1894 | Ga0496104_1221224 | |||
| 1895 | Ga0496104_1541235 | |||
| 1896 | Ga0496105_0547109 | |||
| 1897 | Ga0496105_0730149 | |||
| 1898 | Ga0496105_0918168 | |||
| 1899 | Ga0496106_0012306 | |||
| 1900 | Ga0496106_0141255 | |||
| 1901 | Ga0496106_0287097 | |||
| 1902 | Ga0496106_0406778 | |||
| 1903 | Ga0496106_1052212 | |||
| 1904 | Ga0496107_0443586 | |||
| 1905 | Ga0496108_0001332 | |||
| 1906 | Ga0496108_0555264 | |||
| 1907 | Ga0496109_0000183 | |||
| 1908 | Ga0496109_0140860 | |||
| 1909 | Ga0496110_0175254 | |||
| 1910 | Ga0496112_0000030 | |||
| 1911 | Ga0496112_0032189 | |||
| 1912 | Ga0496112_0050305 | |||
| 1913 | Ga0496112_0254126 | |||
| 1914 | Ga0496112_1019367 | |||
| 1915 | Ga0496113_1310905 | |||
| 1916 | Ga0496114_0089174 | |||
| 1917 | Ga0496114_0313004 | |||
| 1918 | Ga0496114_1039035 | |||
| 1919 | Ga0496115_0004579 | |||
| 1920 | Ga0496115_0108511 | |||
| 1921 | Ga0496115_1374763 | |||
| 1922 | Ga0496126_0069921 | |||
| 1923 | Ga0501034_0001077 | |||
| 1924 | Ga0501036_0448431 | |||
| 1925 | Ga0501038_0000357 | |||
| 1926 | Ga0501039_0080178 | |||
| 1927 | Ga0501035_0077155 | |||
| 1928 | Ga0501044_0828642 | |||
| 1929 | nmdc:mga05p37_697866_c1 | |||
| 1930 | nmdc:mga08y16_480996_c1 | |||
| 1931 | nmdc:mga0n895_5280_c1 | |||
| 1932 | nmdc:mga0n895_632_c1 | |||
| 1933 | nmdc:mga0rr50_1413348_c1 | |||
| 1934 | nmdc:mga0rr50_7460_c1 | |||
| 1935 | nmdc:mga08x19_59262_c1 | |||
| 1936 | nmdc:mga08x19_658716_c1 | |||
| 1937 | nmdc:mga0a205_34094_c1 | |||
| 1938 | Ga0495601_0030015 | |||
| 1939 | Ga0495619_0351754 | |||
| 1940 | Ga0495619_0625492 | |||
| 1941 | Ga0587066_035580 | |||
| 1942 | Ga0587128_007638 | |||
| 1943 | Ga0587111_0056265 | |||
| 1944 | Ga0501082_0203712 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nl3-assembly1.cif.gz_D | crystal structure of listeria monocytogenes hfq in complex with u6 rna | 0.8249 | 47 | 109 |
| 8p91-assembly1.cif.gz_A | hfq from chromobacterium haemolyticum; a p6 space group monomer | 0.824 | 47 | 109 |
| 7oh8-assembly1.cif.gz_B | r17a mutant of hfq protein from neisseria meningitidis | 0.8161 | 47 | 109 |
| 4noy-assembly1.cif.gz_A | crystal structure of listeria monocytogenes hfq f43w | 0.8151 | 44 | 109 |
| 4a53-assembly1.cif.gz_A | structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6 | 0.8104 | 50 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYW7_1_63_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.8421 | 52 | 109 | 2.30.30.100 |
| 3hsbD00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8391 | 47 | 109 | 2.30.30.100 |
| 2ej9A02 | Mainly Beta;Roll;SH3 type barrels.; | 0.8328 | 54 | 106 | 2.30.30.100 |
| 4a53A01 | Mainly Beta;Roll;SH3 type barrels.; | 0.8136 | 50 | 109 | 2.30.30.100 |
| 3qsuF00 | Mainly Beta;Roll;SH3 type barrels.; | 0.7898 | 44 | 107 | 2.30.30.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350UNM5-F1-model_v4 | Uncharacterized protein | 0.8395 | 39 | 145 |
|
| AF-A0A350UNM5-F1-model_v4 | Uncharacterized protein | 0.8258 | 39 | 145 |
|
| AF-A0A1L8MKA6-F1-model_v4 | LSM domain protein | 0.818 | 49 | 109 |
|
| AF-A0A371IQ45-F1-model_v4 | Uncharacterized protein | 0.8172 | 52 | 109 |
|
| AF-A0A840DR02-F1-model_v4 | LSM domain protein | 0.8157 | 49 | 108 |
|