F487153

General Info

Members Datasets Scaffolds Average Seq Length
972 335 1944 148

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10099217|Ga0265760_100992172
Length 152
Sequence MTGKESGHVDHAAAQTVPHINPDSLEVAPGTAHENLEGWIPALASVSEIHEALEKAFDYRGDLTITLKSGQKIEGYIFDRKIKGPTLSDCFIRVMPKDEPGKLTIPYSDIAALAFTGRDTAAGKSFAAWVKKYNEKKAAGEKNIGIDAEPLD

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
135 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
143 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
209 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
215 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
229 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
232 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
283 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 4.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.35
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 20.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10099217 3300031090 Unclassified 919
2 MBSR1b_contig_10165024 2162886012 Bacteria 3089
3 MBSR1b_contig_10507888 2162886012 Bacteria 3491
4 LJNas_1004583 3300000546 Bacteria 1530
5 JGI24752J21851_1011902 3300001976 Bacteria 1138
6 JGI24737J22298_10037023 3300001990 Bacteria 1505
7 JGI24034J26672_10005738 3300002239 Bacteria 1783
8 JGI24751J29686_10002022 3300002459 Bacteria 4125
9 rootL2_10312876 3300003322 Bacteria 1089
10 Ga0058863_10030681 3300004799 Unclassified 1067
11 Ga0058863_10127990 3300004799 Bacteria 5287
12 Ga0058861_10074048 3300004800 Bacteria 2493
13 Ga0058862_10062502 3300004803 Unclassified 877
14 Ga0058862_10211683 3300004803 Bacteria 1136
15 Ga0065712_10139591 3300005290 Bacteria 1461
16 Ga0065715_10006051 3300005293 Bacteria 3426
17 Ga0070658_10057744 3300005327 Unclassified 3157
18 Ga0070658_10246788 3300005327 Bacteria 1514
19 Ga0070658_10510840 3300005327 Bacteria 1038
20 Ga0070676_10024794 3300005328 Bacteria 3383
21 Ga0070683_100007816 3300005329 Bacteria 9057
22 Ga0070683_100026554 3300005329 Bacteria 5216
23 Ga0070683_100249383 3300005329 Bacteria 1689
24 Ga0070690_100010254 3300005330 Bacteria 5447
25 Ga0070690_100244677 3300005330 Bacteria 1266
26 Ga0070690_100503445 3300005330 Bacteria 906
27 Ga0070670_100012670 3300005331 Bacteria 7219
28 Ga0070677_10150025 3300005333 Bacteria 1084
29 Ga0068869_100001091 3300005334 Bacteria 15829
30 Ga0068869_100107562 3300005334 Bacteria 2118
31 Ga0070666_10086109 3300005335 Bacteria 2152
32 Ga0070666_10245933 3300005335 Bacteria 1265
33 Ga0070680_100079702 3300005336 Bacteria 2699
34 Ga0070680_100135809 3300005336 Bacteria 2060
35 Ga0070680_100147717 3300005336 Bacteria 1973
36 Ga0070680_100383749 3300005336 Bacteria 1196
37 Ga0070682_100042189 3300005337 Unclassified 2815
38 Ga0070682_100180365 3300005337 Bacteria 1474
39 Ga0070682_100295611 3300005337 Bacteria 1186
40 Ga0070682_100374723 3300005337 Bacteria 1068
41 Ga0068868_100031940 3300005338 Bacteria 4047
42 Ga0068868_100041104 3300005338 Bacteria 3601
43 Ga0068868_100230334 3300005338 Bacteria 1554
44 Ga0068868_100273165 3300005338 Bacteria 1428
45 Ga0070660_100019734 3300005339 Bacteria 4944
46 Ga0070660_100027487 3300005339 Bacteria 4246
47 Ga0070660_100044512 3300005339 Bacteria 3396
48 Ga0070689_100010978 3300005340 Bacteria 6474
49 Ga0070691_10477605 3300005341 Unclassified 716
50 Ga0070687_100003669 3300005343 Bacteria 6003
51 Ga0070661_100005336 3300005344 Bacteria 8865
52 Ga0070661_100017859 3300005344 Bacteria 5036
53 Ga0070661_100308055 3300005344 Bacteria 1234
54 Ga0070692_10021641 3300005345 Bacteria 3130
55 Ga0070692_10590913 3300005345 Bacteria 733
56 Ga0070668_100018162 3300005347 Bacteria 5277
57 Ga0070668_100052416 3300005347 Unclassified 3144
58 Ga0070668_101380798 3300005347 Unclassified 642
59 Ga0070669_100103593 3300005353 Bacteria 2150
60 Ga0070669_100117210 3300005353 Bacteria 2027
61 Ga0070675_100024569 3300005354 Bacteria 4826
62 Ga0070675_100478110 3300005354 Bacteria 1120
63 Ga0070674_100086726 3300005356 Unclassified 2249
64 Ga0070673_100005154 3300005364 Bacteria 8337
65 Ga0070673_101470164 3300005364 Unclassified 642
66 Ga0070688_100020972 3300005365 Unclassified 3809
67 Ga0070688_100060749 3300005365 Unclassified 2387
68 Ga0070659_100001853 3300005366 Bacteria 15198
69 Ga0070659_100410658 3300005366 Unclassified 1144
70 Ga0070667_100134715 3300005367 Bacteria 2159
71 Ga0070667_100144270 3300005367 Unclassified 2087
72 Ga0070667_100162609 3300005367 Bacteria 1967
73 Ga0070667_100230880 3300005367 Bacteria 1650
74 Ga0070709_10093672 3300005434 Bacteria 1986
75 Ga0070709_10195615 3300005434 Bacteria 1429
76 Ga0070709_10215712 3300005434 Bacteria 1366
77 Ga0070709_11037071 3300005434 Unclassified 654
78 Ga0070714_100000111 3300005435 Bacteria 67800
79 Ga0070714_100085248 3300005435 Bacteria 2758
80 Ga0070714_100177857 3300005435 Bacteria 1934
81 Ga0070714_100224150 3300005435 Unclassified 1729
82 Ga0070714_100274857 3300005435 Bacteria 1563
83 Ga0070714_100330524 3300005435 Bacteria 1427
84 Ga0070714_100493730 3300005435 Bacteria 1167
85 Ga0070714_100633530 3300005435 Bacteria 1028
86 Ga0070714_102154378 3300005435 Unclassified 543
87 Ga0070713_100000231 3300005436 Bacteria 37112
88 Ga0070713_100004047 3300005436 Bacteria 9767
89 Ga0070713_100016019 3300005436 Bacteria 5627
90 Ga0070713_100075339 3300005436 Bacteria 2862
91 Ga0070713_100079167 3300005436 Unclassified 2799
92 Ga0070713_100369294 3300005436 Unclassified 1335
93 Ga0070713_100817667 3300005436 Bacteria 894
94 Ga0070713_100964379 3300005436 Unclassified 822
95 Ga0070710_10005065 3300005437 Bacteria 6238
96 Ga0070710_10117119 3300005437 Bacteria 1608
97 Ga0070710_10144587 3300005437 Unclassified 1461
98 Ga0070710_10186885 3300005437 Unclassified 1301
99 Ga0070701_10104756 3300005438 Bacteria 1572
100 Ga0070711_100000519 3300005439 Bacteria 19976
101 Ga0070711_100000929 3300005439 Bacteria 15465
102 Ga0070711_100039221 3300005439 Bacteria 3189
103 Ga0070711_100082975 3300005439 Bacteria 2288
104 Ga0070711_100406463 3300005439 Unclassified 1106
105 Ga0070711_100517078 3300005439 Unclassified 986
106 Ga0070711_100655150 3300005439 Bacteria 881
107 Ga0070711_101338125 3300005439 Bacteria 622
108 Ga0070711_101516647 3300005439 Bacteria 585
109 Ga0070705_100396319 3300005440 Bacteria 1021
110 Ga0070705_100673471 3300005440 Unclassified 809
111 Ga0070705_101424654 3300005440 Unclassified 578
112 Ga0070694_100308754 3300005444 Bacteria 1214
113 Ga0070694_100509637 3300005444 Unclassified 958
114 Ga0070708_100000410 3300005445 Bacteria 32257
115 Ga0070708_100014908 3300005445 Bacteria 6406
116 Ga0070708_100075059 3300005445 Unclassified 3051
117 Ga0070708_100083480 3300005445 Unclassified 2896
118 Ga0070708_100261059 3300005445 Bacteria 1628
119 Ga0070663_100003902 3300005455 Bacteria 8695
120 Ga0070663_100079392 3300005455 Bacteria 2407
121 Ga0070663_100082057 3300005455 Bacteria 2371
122 Ga0070663_100096112 3300005455 Bacteria 2203
123 Ga0070663_100284221 3300005455 Bacteria 1319
124 Ga0070678_101337073 3300005456 Unclassified 668
125 Ga0070662_100030086 3300005457 Bacteria 3795
126 Ga0070662_100169342 3300005457 Bacteria 1714
127 Ga0070662_101096647 3300005457 Bacteria 683
128 Ga0070662_101701482 3300005457 Unclassified 545
129 Ga0070681_10001954 3300005458 Bacteria 18621
130 Ga0070681_10036253 3300005458 Bacteria 4952
131 Ga0070681_10233915 3300005458 Bacteria 1752
132 Ga0070681_10415393 3300005458 Bacteria 1257
133 Ga0070681_10505284 3300005458 Bacteria 1122
134 Ga0070681_10590882 3300005458 Bacteria 1024
135 Ga0070681_10834360 3300005458 Unclassified 839
136 Ga0070681_10994218 3300005458 Unclassified 758
137 Ga0070681_11179639 3300005458 Unclassified 687
138 Ga0068867_100127797 3300005459 Bacteria 1971
139 Ga0068867_100868312 3300005459 Bacteria 809
140 Ga0070685_10000891 3300005466 Bacteria 16066
141 Ga0070706_100001099 3300005467 Bacteria 29242
142 Ga0070706_100003090 3300005467 Bacteria 16493
143 Ga0070706_100059036 3300005467 Bacteria 3540
144 Ga0070706_100574126 3300005467 Bacteria 1048
145 Ga0070706_100830338 3300005467 Bacteria 855
146 Ga0070706_101123520 3300005467 Bacteria 723
147 Ga0070707_100000229 3300005468 Bacteria 56136
148 Ga0070707_100034150 3300005468 Bacteria 4850
149 Ga0070707_100091366 3300005468 Bacteria 2947
150 Ga0070707_100099997 3300005468 Bacteria 2809
151 Ga0070707_100107375 3300005468 Bacteria 2708
152 Ga0070707_100120929 3300005468 Bacteria 2542
153 Ga0070707_100156922 3300005468 Bacteria 2217
154 Ga0070707_100653099 3300005468 Bacteria 1014
155 Ga0070698_100018118 3300005471 Bacteria 7414
156 Ga0070698_100027170 3300005471 Bacteria 5953
157 Ga0070698_100037896 3300005471 Bacteria 4969
158 Ga0070698_100048291 3300005471 Bacteria 4349
159 Ga0070698_100255932 3300005471 Bacteria 1683
160 Ga0070699_100000703 3300005518 Bacteria 30997
161 Ga0070699_100001773 3300005518 Bacteria 19653
162 Ga0070699_100036450 3300005518 Bacteria 4255
163 Ga0070699_100065354 3300005518 Bacteria 3157
164 Ga0070699_100273390 3300005518 Bacteria 1513
165 Ga0070699_100378618 3300005518 Bacteria 1277
166 Ga0070699_100880063 3300005518 Bacteria 820
167 Ga0070679_100026671 3300005530 Bacteria 5681
168 Ga0070679_100030052 3300005530 Bacteria 5362
169 Ga0070679_100065948 3300005530 Bacteria 3609
170 Ga0070679_100120123 3300005530 Bacteria 2613
171 Ga0070679_100208731 3300005530 Bacteria 1917
172 Ga0070679_101123619 3300005530 Unclassified 731
173 Ga0070684_100025735 3300005535 Bacteria 4948
174 Ga0070684_100184514 3300005535 Bacteria 1897
175 Ga0070684_100396792 3300005535 Bacteria 1272
176 Ga0070684_101036296 3300005535 Bacteria 770
177 Ga0070684_101069149 3300005535 Unclassified 758
178 Ga0070697_100000166 3300005536 Bacteria 53539
179 Ga0070697_100000673 3300005536 Bacteria 25688
180 Ga0070697_100001242 3300005536 Bacteria 19280
181 Ga0070697_100003229 3300005536 Bacteria 12506
182 Ga0070697_100009587 3300005536 Bacteria 7562
183 Ga0070697_100575543 3300005536 Unclassified 989
184 Ga0070697_101360534 3300005536 Bacteria 634
185 Ga0068853_100000064 3300005539 Bacteria 75224
186 Ga0068853_100145674 3300005539 Bacteria 2128
187 Ga0068853_100145969 3300005539 Bacteria 2126
188 Ga0070672_100078340 3300005543 Unclassified 2644
189 Ga0070672_100815998 3300005543 Bacteria 821
190 Ga0070686_100051263 3300005544 Unclassified 2626
191 Ga0070686_100101894 3300005544 Bacteria 1941
192 Ga0070686_100210482 3300005544 Bacteria 1399
193 Ga0070686_100772422 3300005544 Unclassified 772
194 Ga0070695_100134470 3300005545 Bacteria 1707
195 Ga0070695_100233972 3300005545 Bacteria 1330
196 Ga0070696_100162259 3300005546 Bacteria 1647
197 Ga0070696_100493033 3300005546 Unclassified 973
198 Ga0070693_100065727 3300005547 Bacteria 2120
199 Ga0070693_100425590 3300005547 Bacteria 926
200 Ga0070665_100045644 3300005548 Bacteria 4400
201 Ga0070665_100177480 3300005548 Bacteria 2131
202 Ga0070704_100438251 3300005549 Bacteria 1122
203 Ga0068855_100085404 3300005563 Unclassified 3651
204 Ga0068855_100363724 3300005563 Bacteria 1592
205 Ga0068855_100643803 3300005563 Bacteria 1139
206 Ga0068855_101158651 3300005563 Unclassified 805
207 Ga0068855_101230969 3300005563 Unclassified 777
208 Ga0068855_101943166 3300005563 Unclassified 595
209 Ga0068855_102334590 3300005563 Bacteria 535
210 Ga0070664_100307705 3300005564 Bacteria 1433
211 Ga0068857_100012748 3300005577 Bacteria 7327
212 Ga0068857_100027770 3300005577 Bacteria 4991
213 Ga0068857_100353009 3300005577 Bacteria 1362
214 Ga0068854_100000073 3300005578 Bacteria 72344
215 Ga0068854_100084144 3300005578 Bacteria 2353
216 Ga0068854_100247345 3300005578 Bacteria 1422
217 Ga0068854_100382191 3300005578 Unclassified 1161
218 Ga0068854_100415931 3300005578 Bacteria 1116
219 Ga0068856_100032606 3300005614 Bacteria 5100
220 Ga0068856_100038619 3300005614 Bacteria 4687
221 Ga0068856_100363545 3300005614 Bacteria 1466
222 Ga0068856_101000832 3300005614 Bacteria 854
223 Ga0070702_100018838 3300005615 Unclassified 3588
224 Ga0068852_100108429 3300005616 Bacteria 2520
225 Ga0068852_100706000 3300005616 Bacteria 1019
226 Ga0068852_101138316 3300005616 Bacteria 801
227 Ga0068859_100061883 3300005617 Bacteria 3772
228 Ga0068859_100197826 3300005617 Bacteria 2094
229 Ga0068859_100377869 3300005617 Bacteria 1512
230 Ga0068866_10069989 3300005718 Bacteria 1850
231 Ga0068866_10073008 3300005718 Unclassified 1819
232 Ga0068866_10212732 3300005718 Bacteria 1162
233 Ga0068861_100028262 3300005719 Unclassified 4092
234 Ga0068861_100054581 3300005719 Bacteria 3045
235 Ga0068861_101536641 3300005719 Unclassified 654
236 Ga0068870_10000880 3300005840 Bacteria 11745
237 Ga0068870_10904922 3300005840 Unclassified 623
238 Ga0068863_100209702 3300005841 Bacteria 1876
239 Ga0068863_100235832 3300005841 Bacteria 1765
240 Ga0068863_100292679 3300005841 Bacteria 1578
241 Ga0068858_100010651 3300005842 Bacteria 8698
242 Ga0068858_100032024 3300005842 Bacteria 4884
243 Ga0068858_100210677 3300005842 Bacteria 1839
244 Ga0068858_100522280 3300005842 Unclassified 1148
245 Ga0068860_100021654 3300005843 Bacteria 6224
246 Ga0068860_100075859 3300005843 Bacteria 3197
247 Ga0068860_100231371 3300005843 Unclassified 1796
248 Ga0068860_100660283 3300005843 Bacteria 1054
249 Ga0068862_100008118 3300005844 Bacteria 8684
250 Ga0068862_100024110 3300005844 Bacteria 5102
251 Ga0068862_100209957 3300005844 Bacteria 1759
252 Ga0068862_101164666 3300005844 Unclassified 768
253 Ga0081540_1156928 3300005983 Bacteria 889
254 Ga0070717_10008860 3300006028 Bacteria 7534
255 Ga0070717_10023401 3300006028 Bacteria 4894
256 Ga0070717_10089905 3300006028 Bacteria 2591
257 Ga0070717_10097818 3300006028 Bacteria 2487
258 Ga0070717_10173615 3300006028 Bacteria 1876
259 Ga0070717_10181039 3300006028 Bacteria 1837
260 Ga0070717_10490030 3300006028 Bacteria 1110
261 Ga0070717_10547684 3300006028 Bacteria 1047
262 Ga0070717_10607901 3300006028 Bacteria 992
263 Ga0070717_10671886 3300006028 Unclassified 941
264 Ga0070717_10697941 3300006028 Bacteria 922
265 Ga0070717_10740594 3300006028 Unclassified 893
266 Ga0070717_11123531 3300006028 Bacteria 716
267 Ga0070715_10013418 3300006163 Bacteria 3009
268 Ga0070715_10135758 3300006163 Unclassified 1189
269 Ga0070715_10142113 3300006163 Bacteria 1167
270 Ga0070715_10189289 3300006163 Unclassified 1038
271 Ga0070716_100019448 3300006173 Bacteria 3550
272 Ga0070716_100036790 3300006173 Bacteria 2700
273 Ga0070716_100074262 3300006173 Bacteria 2008
274 Ga0070716_100134428 3300006173 Bacteria 1568
275 Ga0070716_100153955 3300006173 Unclassified 1482
276 Ga0070716_100227152 3300006173 Bacteria 1258
277 Ga0070716_100259291 3300006173 Unclassified 1189
278 Ga0070716_100259949 3300006173 Unclassified 1187
279 Ga0070716_100400203 3300006173 Bacteria 987
280 Ga0070712_100000120 3300006175 Bacteria 40974
281 Ga0070712_100001238 3300006175 Bacteria 15427
282 Ga0070712_100002759 3300006175 Bacteria 10854
283 Ga0070712_100036247 3300006175 Unclassified 3355
284 Ga0070712_100379410 3300006175 Unclassified 1163
285 Ga0070712_100456828 3300006175 Bacteria 1064
286 Ga0070712_100708235 3300006175 Bacteria 859
287 Ga0097621_100023588 3300006237 Bacteria 4792
288 Ga0097621_100051309 3300006237 Bacteria 3357
289 Ga0097621_100078156 3300006237 Bacteria 2748
290 Ga0097621_100088932 3300006237 Bacteria 2581
291 Ga0097621_100655281 3300006237 Bacteria 964
292 Ga0097621_100904805 3300006237 Unclassified 822
293 Ga0068871_100001112 3300006358 Bacteria 18041
294 Ga0068871_100177023 3300006358 Bacteria 1831
295 Ga0068871_100780774 3300006358 Bacteria 879
296 Ga0068871_100984760 3300006358 Unclassified 785
297 Ga0068871_101387326 3300006358 Unclassified 662
298 Ga0075433_10025151 3300006852 Bacteria 5033
299 Ga0075433_10163964 3300006852 Bacteria 1978
300 Ga0075433_10490906 3300006852 Bacteria 1081
301 Ga0075434_100013738 3300006871 Bacteria 7721
302 Ga0075434_100084208 3300006871 Bacteria 3178
303 Ga0075434_100710685 3300006871 Bacteria 1022
304 Ga0068865_100029249 3300006881 Bacteria 3653
305 Ga0068865_100653927 3300006881 Unclassified 894
306 Ga0075436_100045891 3300006914 Bacteria 3014
307 Ga0075436_100257051 3300006914 Bacteria 1245
308 Ga0097620_100061878 3300006931 Bacteria 3772
309 Ga0097620_100197825 3300006931 Bacteria 2094
310 Ga0097620_100377864 3300006931 Bacteria 1512
311 Ga0075435_100000173 3300007076 Bacteria 37964
312 Ga0075435_101534756 3300007076 Unclassified 584
313 Ga0099794_10035084 3300007265 Bacteria 2366
314 Ga0105251_10256404 3300009011 Bacteria 789
315 Ga0105240_10028577 3300009093 Bacteria 7280
316 Ga0105240_10066209 3300009093 Bacteria 4483
317 Ga0105240_10173504 3300009093 Bacteria 2551
318 Ga0105240_10220098 3300009093 Bacteria 2212
319 Ga0105240_10224354 3300009093 Bacteria 2187
320 Ga0105240_10262295 3300009093 Bacteria 1992
321 Ga0105240_10283714 3300009093 Bacteria 1901
322 Ga0111539_10808465 3300009094 Bacteria 1091
323 Ga0105245_10008119 3300009098 Bacteria 9185
324 Ga0105245_10021602 3300009098 Bacteria 5648
325 Ga0105245_10059022 3300009098 Unclassified 3454
326 Ga0105245_10128920 3300009098 Bacteria 2371
327 Ga0105245_10258397 3300009098 Bacteria 1694
328 Ga0105245_10303548 3300009098 Bacteria 1567
329 Ga0105245_10904532 3300009098 Bacteria 924
330 Ga0105247_10075990 3300009101 Bacteria 2109
331 Ga0105247_10103890 3300009101 Bacteria 1820
332 Ga0105247_10121730 3300009101 Unclassified 1691
333 Ga0114129_10662456 3300009147 Bacteria 1346
334 Ga0105243_10390461 3300009148 Bacteria 1290
335 Ga0105241_10006954 3300009174 Bacteria 8326
336 Ga0105241_10098600 3300009174 Bacteria 2319
337 Ga0105241_10169505 3300009174 Bacteria 1802
338 Ga0105241_10320186 3300009174 Bacteria 1337
339 Ga0105241_10354255 3300009174 Bacteria 1275
340 Ga0105241_10802635 3300009174 Bacteria 867
341 Ga0105241_11708493 3300009174 Bacteria 612
342 Ga0105241_12314488 3300009174 Bacteria 535
343 Ga0105242_10025538 3300009176 Bacteria 4676
344 Ga0105242_10067160 3300009176 Bacteria 2963
345 Ga0105242_10196828 3300009176 Bacteria 1788
346 Ga0105242_12553589 3300009176 Unclassified 559
347 Ga0105248_10056683 3300009177 Bacteria 4396
348 Ga0105248_10151081 3300009177 Bacteria 2620
349 Ga0105248_10166343 3300009177 Bacteria 2486
350 Ga0105248_10940186 3300009177 Bacteria 976
351 Ga0105237_10076830 3300009545 Bacteria 3329
352 Ga0105237_10167400 3300009545 Bacteria 2197
353 Ga0105237_10229794 3300009545 Bacteria 1856
354 Ga0105237_10233508 3300009545 Bacteria 1840
355 Ga0105237_10293118 3300009545 Bacteria 1630
356 Ga0105237_10372210 3300009545 Bacteria 1433
357 Ga0105237_10548272 3300009545 Bacteria 1163
358 Ga0105238_10149171 3300009551 Bacteria 2314
359 Ga0105238_10184851 3300009551 Bacteria 2060
360 Ga0105238_10285001 3300009551 Bacteria 1634
361 Ga0105249_10020124 3300009553 Bacteria 5961
362 Ga0105249_10041458 3300009553 Bacteria 4185
363 Ga0105249_10062042 3300009553 Bacteria 3431
364 Ga0105249_10079956 3300009553 Unclassified 3036
365 Ga0099796_10123497 3300010159 Bacteria 997
366 Ga0105239_10033112 3300010375 Bacteria 5676
367 Ga0105239_10169686 3300010375 Bacteria 2439
368 Ga0105239_10356404 3300010375 Bacteria 1652
369 Ga0105239_10469018 3300010375 Bacteria 1429
370 Ga0105239_11650745 3300010375 Bacteria 741
371 Ga0105246_10017813 3300011119 Bacteria 4517
372 Ga0105246_10195957 3300011119 Bacteria 1567
373 Ga0105246_12010072 3300011119 Unclassified 558
374 Ga0157373_10004365 3300013100 Bacteria 10654
375 Ga0157373_10011522 3300013100 Bacteria 6497
376 Ga0157373_10094317 3300013100 Bacteria 2107
377 Ga0157373_10166246 3300013100 Unclassified 1552
378 Ga0157371_10001874 3300013102 Bacteria 21041
379 Ga0157371_10208260 3300013102 Bacteria 1403
380 Ga0157371_10465920 3300013102 Unclassified 930
381 Ga0157371_10566166 3300013102 Bacteria 843
382 Ga0157370_10028414 3300013104 Bacteria 5501
383 Ga0157370_10060172 3300013104 Bacteria 3607
384 Ga0157370_10118275 3300013104 Bacteria 2475
385 Ga0157370_10221891 3300013104 Bacteria 1751
386 Ga0157369_10043736 3300013105 Bacteria 4881
387 Ga0157369_10046631 3300013105 Bacteria 4709
388 Ga0157369_10124073 3300013105 Bacteria 2739
389 Ga0157369_10125246 3300013105 Bacteria 2725
390 Ga0157369_10132681 3300013105 Bacteria 2638
391 Ga0157369_10146034 3300013105 Bacteria 2501
392 Ga0157369_10235144 3300013105 Unclassified 1915
393 Ga0157369_10473017 3300013105 Bacteria 1297
394 Ga0157369_10594901 3300013105 Bacteria 1142
395 Ga0157374_10019511 3300013296 Bacteria 6001
396 Ga0157374_10022249 3300013296 Bacteria 5654
397 Ga0157374_10033622 3300013296 Bacteria 4680
398 Ga0157374_10064959 3300013296 Bacteria 3426
399 Ga0157374_10443072 3300013296 Bacteria 1299
400 Ga0157374_10720541 3300013296 Bacteria 1011
401 Ga0157374_10759293 3300013296 Bacteria 985
402 Ga0157374_11150755 3300013296 Unclassified 797
403 Ga0157374_11601229 3300013296 Unclassified 675
404 Ga0157378_10000080 3300013297 Bacteria 88903
405 Ga0157378_10111486 3300013297 Bacteria 2509
406 Ga0157378_10361976 3300013297 Bacteria 1420
407 Ga0157378_10443252 3300013297 Unclassified 1287
408 Ga0157378_11263202 3300013297 Bacteria 779
409 Ga0157378_12277191 3300013297 Bacteria 593
410 Ga0163162_10002825 3300013306 Bacteria 16516
411 Ga0163162_10008701 3300013306 Bacteria 9880
412 Ga0163162_10081086 3300013306 Unclassified 3314
413 Ga0163162_13259215 3300013306 Unclassified 520
414 Ga0157372_10007870 3300013307 Bacteria 11329
415 Ga0157372_10056045 3300013307 Bacteria 4404
416 Ga0157372_10066678 3300013307 Bacteria 4044
417 Ga0157372_10075172 3300013307 Bacteria 3811
418 Ga0157372_10102361 3300013307 Bacteria 3272
419 Ga0157372_10168758 3300013307 Bacteria 2531
420 Ga0157372_10270722 3300013307 Bacteria 1973
421 Ga0157372_10291043 3300013307 Bacteria 1899
422 Ga0157372_10776359 3300013307 Bacteria 1114
423 Ga0157375_10048295 3300013308 Bacteria 4162
424 Ga0157375_10281354 3300013308 Bacteria 1826
425 Ga0157375_10489877 3300013308 Bacteria 1394
426 Ga0157375_10516078 3300013308 Bacteria 1358
427 Ga0157375_10908356 3300013308 Bacteria 1024
428 Ga0163163_10007748 3300014325 Bacteria 9491
429 Ga0163163_10099513 3300014325 Bacteria 2929
430 Ga0163163_10150928 3300014325 Bacteria 2367
431 Ga0163163_10275599 3300014325 Bacteria 1733
432 Ga0157380_10201360 3300014326 Bacteria 1767
433 Ga0182008_10018152 3300014497 Bacteria 3644
434 Ga0157377_10003870 3300014745 Bacteria 6818
435 Ga0157377_10086320 3300014745 Bacteria 1844
436 Ga0157377_10390755 3300014745 Bacteria 945
437 Ga0157377_10814391 3300014745 Bacteria 690
438 Ga0157379_10009000 3300014968 Bacteria 8702
439 Ga0157379_10100665 3300014968 Bacteria 2594
440 Ga0157379_10145073 3300014968 Unclassified 2140
441 Ga0157379_10160330 3300014968 Unclassified 2030
442 Ga0157379_10409558 3300014968 Bacteria 1247
443 Ga0157376_10005415 3300014969 Bacteria 8926
444 Ga0157376_10051361 3300014969 Bacteria 3424
445 Ga0157376_10189494 3300014969 Unclassified 1885
446 Ga0157376_10312876 3300014969 Bacteria 1490
447 Ga0157376_10523718 3300014969 Bacteria 1169
448 Ga0157376_10975534 3300014969 Bacteria 869
449 Ga0157376_11194216 3300014969 Bacteria 789
450 Ga0182007_10025964 3300015262 Bacteria 2035
451 Ga0163161_10033798 3300017792 Unclassified 3655
452 Ga0197907_10558217 3300020069 Bacteria 917
453 Ga0197907_11041484 3300020069 Bacteria 1243
454 Ga0206356_11447340 3300020070 Bacteria 1364
455 Ga0206356_11591461 3300020070 Bacteria 750
456 Ga0206349_1169383 3300020075 Bacteria 1322
457 Ga0206349_1838695 3300020075 Bacteria 841
458 Ga0206355_1093249 3300020076 Bacteria 2057
459 Ga0206351_10454637 3300020077 Bacteria 1231
460 Ga0206351_10924681 3300020077 Bacteria 971
461 Ga0206352_10096670 3300020078 Bacteria 756
462 Ga0206352_10855043 3300020078 Bacteria 1979
463 Ga0206352_11260177 3300020078 Bacteria 949
464 Ga0206350_10127627 3300020080 Bacteria 1799
465 Ga0206350_10163719 3300020080 Bacteria 4592
466 Ga0206350_10834542 3300020080 Unclassified 733
467 Ga0206350_11365607 3300020080 Bacteria 1116
468 Ga0206354_10640681 3300020081 Unclassified 1424
469 Ga0206353_10792725 3300020082 Bacteria 895
470 Ga0154015_1103445 3300020610 Bacteria 5206
471 Ga0224712_10000977 3300022467 Bacteria 6217
472 Ga0224712_10010981 3300022467 Bacteria 2790
473 Ga0224712_10034546 3300022467 Bacteria 1860
474 Ga0224712_10035179 3300022467 Bacteria 1847
475 Ga0224712_10109093 3300022467 Bacteria 1185
476 Ga0224572_1001294 3300024225 Bacteria 3617
477 Ga0224572_1007760 3300024225 Unclassified 1973
478 Ga0224572_1055539 3300024225 Unclassified 735
479 Ga0228598_1001027 3300024227 Bacteria 6134
480 Ga0228598_1003872 3300024227 Bacteria 3192
481 Ga0228598_1051058 3300024227 Bacteria 820
482 Ga0207697_10024533 3300025315 Bacteria 2468
483 Ga0207682_10045324 3300025893 Bacteria 1805
484 Ga0207692_10054102 3300025898 Bacteria 2047
485 Ga0207692_10058514 3300025898 Bacteria 1986
486 Ga0207692_10135886 3300025898 Unclassified 1394
487 Ga0207642_10186015 3300025899 Bacteria 1136
488 Ga0207642_10996495 3300025899 Bacteria 539
489 Ga0207710_10066155 3300025900 Bacteria 1649
490 Ga0207688_10065973 3300025901 Unclassified 2046
491 Ga0207680_10173866 3300025903 Bacteria 1452
492 Ga0207647_10003789 3300025904 Bacteria 11305
493 Ga0207647_10007432 3300025904 Bacteria 7916
494 Ga0207647_10027290 3300025904 Unclassified 3723
495 Ga0207647_10157480 3300025904 Bacteria 1326
496 Ga0207685_10005205 3300025905 Bacteria 3407
497 Ga0207685_10017481 3300025905 Bacteria 2320
498 Ga0207685_10110844 3300025905 Unclassified 1189
499 Ga0207699_10125381 3300025906 Bacteria 1667
500 Ga0207699_10384781 3300025906 Unclassified 996
501 Ga0207699_10478003 3300025906 Bacteria 897
502 Ga0207699_10645037 3300025906 Bacteria 773
503 Ga0207699_10971116 3300025906 Bacteria 628
504 Ga0207645_10000338 3300025907 Bacteria 39162
505 Ga0207645_10013932 3300025907 Bacteria 5392
506 Ga0207643_10000614 3300025908 Bacteria 22493
507 Ga0207643_10017869 3300025908 Bacteria 3883
508 Ga0207705_10001035 3300025909 Bacteria 22631
509 Ga0207705_10017201 3300025909 Bacteria 5178
510 Ga0207705_10679055 3300025909 Bacteria 801
511 Ga0207684_10012987 3300025910 Bacteria 7211
512 Ga0207684_10014429 3300025910 Bacteria 6811
513 Ga0207684_10014612 3300025910 Bacteria 6765
514 Ga0207684_10135410 3300025910 Bacteria 2115
515 Ga0207684_10772045 3300025910 Unclassified 814
516 Ga0207684_10774697 3300025910 Bacteria 812
517 Ga0207684_10875784 3300025910 Bacteria 756
518 Ga0207684_11108364 3300025910 Bacteria 658
519 Ga0207654_10003614 3300025911 Bacteria 7801
520 Ga0207654_10041563 3300025911 Bacteria 2596
521 Ga0207654_10112878 3300025911 Bacteria 1694
522 Ga0207654_10835798 3300025911 Unclassified 666
523 Ga0207707_10000757 3300025912 Bacteria 31814
524 Ga0207707_10336979 3300025912 Bacteria 1301
525 Ga0207707_10667432 3300025912 Bacteria 875
526 Ga0207707_10854928 3300025912 Unclassified 755
527 Ga0207707_11132574 3300025912 Bacteria 636
528 Ga0207695_10033293 3300025913 Bacteria 5623
529 Ga0207695_10178746 3300025913 Bacteria 2044
530 Ga0207695_10206483 3300025913 Bacteria 1877
531 Ga0207695_10238796 3300025913 Bacteria 1719
532 Ga0207695_10455281 3300025913 Bacteria 1163
533 Ga0207671_10049110 3300025914 Bacteria 3123
534 Ga0207671_10177968 3300025914 Bacteria 1654
535 Ga0207671_10803895 3300025914 Unclassified 746
536 Ga0207693_10000005 3300025915 Bacteria 186314
537 Ga0207693_10000091 3300025915 Bacteria 80207
538 Ga0207693_10000823 3300025915 Bacteria 27648
539 Ga0207693_10011174 3300025915 Bacteria 7269
540 Ga0207693_10035451 3300025915 Unclassified 3933
541 Ga0207693_10268678 3300025915 Unclassified 1336
542 Ga0207663_10002535 3300025916 Bacteria 8787
543 Ga0207663_10020722 3300025916 Bacteria 3728
544 Ga0207663_10033645 3300025916 Bacteria 3056
545 Ga0207663_10151298 3300025916 Bacteria 1628
546 Ga0207663_10287327 3300025916 Bacteria 1224
547 Ga0207663_10333218 3300025916 Unclassified 1144
548 Ga0207660_10052485 3300025917 Bacteria 2903
549 Ga0207660_10309865 3300025917 Bacteria 1259
550 Ga0207660_10659111 3300025917 Bacteria 853
551 Ga0207660_11303255 3300025917 Bacteria 590
552 Ga0207662_10031871 3300025918 Bacteria 3064
553 Ga0207657_10006741 3300025919 Bacteria 11860
554 Ga0207657_10009792 3300025919 Bacteria 9608
555 Ga0207657_10081330 3300025919 Bacteria 2721
556 Ga0207649_10009112 3300025920 Bacteria 5427
557 Ga0207649_10091507 3300025920 Bacteria 1992
558 Ga0207652_10030679 3300025921 Bacteria 4504
559 Ga0207652_10078926 3300025921 Bacteria 2875
560 Ga0207652_10137311 3300025921 Bacteria 2184
561 Ga0207652_10165089 3300025921 Bacteria 1985
562 Ga0207652_10212674 3300025921 Bacteria 1741
563 Ga0207652_10214213 3300025921 Bacteria 1735
564 Ga0207652_10344821 3300025921 Bacteria 1345
565 Ga0207646_10010241 3300025922 Bacteria 9179
566 Ga0207646_10029495 3300025922 Bacteria 4984
567 Ga0207646_10155520 3300025922 Bacteria 2062
568 Ga0207646_10328755 3300025922 Bacteria 1381
569 Ga0207646_11044664 3300025922 Unclassified 721
570 Ga0207681_10095819 3300025923 Bacteria 2129
571 Ga0207694_10025905 3300025924 Bacteria 4458
572 Ga0207694_10136780 3300025924 Bacteria 1968
573 Ga0207694_10694243 3300025924 Bacteria 858
574 Ga0207650_10000380 3300025925 Bacteria 41633
575 Ga0207650_10911037 3300025925 Bacteria 747
576 Ga0207687_10017987 3300025927 Bacteria 4663
577 Ga0207687_10061324 3300025927 Bacteria 2656
578 Ga0207687_11174707 3300025927 Bacteria 659
579 Ga0207700_10001542 3300025928 Bacteria 13052
580 Ga0207700_10001979 3300025928 Bacteria 11667
581 Ga0207700_10005278 3300025928 Bacteria 7706
582 Ga0207700_10074775 3300025928 Bacteria 2622
583 Ga0207700_10078293 3300025928 Bacteria 2571
584 Ga0207700_10098368 3300025928 Bacteria 2327
585 Ga0207700_10397117 3300025928 Unclassified 1208
586 Ga0207700_10482314 3300025928 Unclassified 1096
587 Ga0207700_10525267 3300025928 Bacteria 1049
588 Ga0207700_10787280 3300025928 Bacteria 850
589 Ga0207664_10000127 3300025929 Bacteria 66344
590 Ga0207664_10029379 3300025929 Bacteria 4186
591 Ga0207664_10069940 3300025929 Bacteria 2823
592 Ga0207664_10106048 3300025929 Bacteria 2330
593 Ga0207664_10125480 3300025929 Bacteria 2154
594 Ga0207664_10129037 3300025929 Bacteria 2126
595 Ga0207664_10195134 3300025929 Unclassified 1745
596 Ga0207664_10599754 3300025929 Bacteria 989
597 Ga0207664_11736818 3300025929 Unclassified 546
598 Ga0207644_10042612 3300025931 Bacteria 3217
599 Ga0207644_10839162 3300025931 Bacteria 769
600 Ga0207690_10049747 3300025932 Unclassified 2795
601 Ga0207690_10072707 3300025932 Bacteria 2375
602 Ga0207690_10477091 3300025932 Bacteria 1006
603 Ga0207706_10019832 3300025933 Bacteria 6044
604 Ga0207706_10029071 3300025933 Bacteria 4935
605 Ga0207706_11214510 3300025933 Unclassified 626
606 Ga0207706_11717576 3300025933 Unclassified 505
607 Ga0207686_10146561 3300025934 Bacteria 1638
608 Ga0207686_11159781 3300025934 Unclassified 631
609 Ga0207669_10041135 3300025937 Bacteria 2688
610 Ga0207669_10337827 3300025937 Bacteria 1159
611 Ga0207704_10307910 3300025938 Bacteria 1216
612 Ga0207704_10597121 3300025938 Unclassified 903
613 Ga0207665_10000034 3300025939 Bacteria 88735
614 Ga0207665_10008083 3300025939 Bacteria 6943
615 Ga0207665_10017320 3300025939 Bacteria 4734
616 Ga0207665_10019102 3300025939 Unclassified 4503
617 Ga0207665_10040271 3300025939 Bacteria 3117
618 Ga0207665_10098805 3300025939 Bacteria 2034
619 Ga0207665_10115258 3300025939 Bacteria 1893
620 Ga0207665_10265692 3300025939 Unclassified 1272
621 Ga0207665_10415139 3300025939 Unclassified 1027
622 Ga0207665_10527390 3300025939 Bacteria 915
623 Ga0207691_10011784 3300025940 Bacteria 8391
624 Ga0207691_10670928 3300025940 Bacteria 875
625 Ga0207711_10006633 3300025941 Bacteria 9752
626 Ga0207711_10663543 3300025941 Bacteria 973
627 Ga0207711_11360936 3300025941 Unclassified 652
628 Ga0207689_10000505 3300025942 Bacteria 36866
629 Ga0207689_10001408 3300025942 Bacteria 22963
630 Ga0207689_10080741 3300025942 Bacteria 2673
631 Ga0207689_10116883 3300025942 Bacteria 2193
632 Ga0207661_10000101 3300025944 Bacteria 54454
633 Ga0207661_10057309 3300025944 Bacteria 3132
634 Ga0207661_10170335 3300025944 Bacteria 1895
635 Ga0207679_10000079 3300025945 Bacteria 85462
636 Ga0207679_10198193 3300025945 Bacteria 1675
637 Ga0207667_10051169 3300025949 Bacteria 4356
638 Ga0207667_10157463 3300025949 Bacteria 2337
639 Ga0207667_10163278 3300025949 Bacteria 2290
640 Ga0207667_10276567 3300025949 Bacteria 1716
641 Ga0207667_10381196 3300025949 Bacteria 1437
642 Ga0207667_10383368 3300025949 Bacteria 1432
643 Ga0207667_11677261 3300025949 Unclassified 603
644 Ga0207667_12005103 3300025949 Bacteria 539
645 Ga0207651_10053780 3300025960 Unclassified 2754
646 Ga0207712_10020472 3300025961 Bacteria 4332
647 Ga0207712_10166549 3300025961 Bacteria 1718
648 Ga0207712_10226480 3300025961 Bacteria 1498
649 Ga0207668_10004801 3300025972 Bacteria 7957
650 Ga0207640_10000033 3300025981 Bacteria 115787
651 Ga0207640_10010538 3300025981 Bacteria 5212
652 Ga0207640_10039077 3300025981 Bacteria 3000
653 Ga0207658_10154867 3300025986 Unclassified 1872
654 Ga0207658_10273759 3300025986 Bacteria 1444
655 Ga0207658_10287059 3300025986 Bacteria 1413
656 Ga0207658_10431553 3300025986 Bacteria 1164
657 Ga0207677_10035469 3300026023 Bacteria 3240
658 Ga0207677_10163975 3300026023 Bacteria 1730
659 Ga0207677_10680036 3300026023 Bacteria 911
660 Ga0207703_10018871 3300026035 Bacteria 5387
661 Ga0207703_10146584 3300026035 Bacteria 2054
662 Ga0207703_10487848 3300026035 Unclassified 1155
663 Ga0207703_10536283 3300026035 Bacteria 1102
664 Ga0207639_10000096 3300026041 Bacteria 74667
665 Ga0207639_10155689 3300026041 Bacteria 1919
666 Ga0207639_10403913 3300026041 Bacteria 1231
667 Ga0207639_10872157 3300026041 Bacteria 841
668 Ga0207678_10005015 3300026067 Bacteria 11878
669 Ga0207678_10015807 3300026067 Bacteria 6635
670 Ga0207678_10022300 3300026067 Bacteria 5548
671 Ga0207678_10054801 3300026067 Bacteria 3434
672 Ga0207678_10311055 3300026067 Bacteria 1354
673 Ga0207678_10475933 3300026067 Unclassified 1087
674 Ga0207708_10025151 3300026075 Bacteria 4502
675 Ga0207702_10280044 3300026078 Unclassified 1576
676 Ga0207702_10841186 3300026078 Bacteria 908
677 Ga0207702_10923848 3300026078 Bacteria 865
678 Ga0207641_10000009 3300026088 Bacteria 407901
679 Ga0207641_10150546 3300026088 Bacteria 2107
680 Ga0207641_10191597 3300026088 Bacteria 1879
681 Ga0207641_10395819 3300026088 Bacteria 1325
682 Ga0207648_10000496 3300026089 Bacteria 43876
683 Ga0207648_10473455 3300026089 Unclassified 1143
684 Ga0207676_10000144 3300026095 Bacteria 61909
685 Ga0207676_10500786 3300026095 Bacteria 1153
686 Ga0207674_10000988 3300026116 Bacteria 37108
687 Ga0207674_10001160 3300026116 Bacteria 34178
688 Ga0207674_10003484 3300026116 Bacteria 19219
689 Ga0207674_10127554 3300026116 Bacteria 2509
690 Ga0207675_100058175 3300026118 Unclassified 3608
691 Ga0207675_100089137 3300026118 Unclassified 2898
692 Ga0207675_100896726 3300026118 Unclassified 903
693 Ga0207683_10000869 3300026121 Bacteria 27689
694 Ga0207683_11286370 3300026121 Unclassified 677
695 Ga0207698_10022579 3300026142 Unclassified 4376
696 Ga0207698_11519730 3300026142 Bacteria 685
697 Ga0209588_1007852 3300027671 Bacteria 3153
698 Ga0209588_1040264 3300027671 Bacteria 1508
699 Ga0209588_1041388 3300027671 Bacteria 1487
700 Ga0209588_1106600 3300027671 Unclassified 901
701 Ga0265356_1000574 3300028017 Bacteria 6492
702 Ga0265357_1017819 3300028023 Unclassified 763
703 Ga0268266_10002830 3300028379 Bacteria 18089
704 Ga0268266_10276075 3300028379 Bacteria 1561
705 Ga0268265_10006045 3300028380 Bacteria 8228
706 Ga0268265_10595893 3300028380 Bacteria 1055
707 Ga0268265_11155559 3300028380 Unclassified 770
708 Ga0268264_10010221 3300028381 Bacteria 7766
709 Ga0268264_10178743 3300028381 Unclassified 1925
710 Ga0268264_10181424 3300028381 Bacteria 1912
711 Ga0268264_10235687 3300028381 Bacteria 1692
712 Ga0268264_10619536 3300028381 Bacteria 1068
713 Ga0265338_10005942 3300028800 Bacteria 15723
714 Ga0265338_10006826 3300028800 Bacteria 14382
715 Ga0265338_10052040 3300028800 Bacteria 3680
716 Ga0265338_10060152 3300028800 Bacteria 3340
717 Ga0265338_10126326 3300028800 Bacteria 2028
718 Ga0265338_10273852 3300028800 Bacteria 1236
719 Ga0265338_10363324 3300028800 Bacteria 1038
720 Ga0265324_10098197 3300029957 Unclassified 996
721 Ga0265762_1002021 3300030760 Bacteria 3697
722 Ga0265762_1002584 3300030760 Bacteria 3258
723 Ga0265762_1003378 3300030760 Unclassified 2858
724 Ga0265763_1014574 3300030763 Unclassified 772
725 Ga0265770_1055588 3300030878 Unclassified 726
726 Ga0265765_1033754 3300030879 Bacteria 661
727 Ga0265760_10002195 3300031090 Bacteria 5704
728 Ga0265760_10006343 3300031090 Unclassified 3385
729 Ga0265760_10006840 3300031090 Bacteria 3267
730 Ga0265760_10016170 3300031090 Bacteria 2140
731 Ga0265760_10018812 3300031090 Bacteria 1990
732 Ga0265760_10125716 3300031090 Unclassified 826
733 Ga0265328_10125846 3300031239 Bacteria 957
734 Ga0265325_10014367 3300031241 Bacteria 4477
735 Ga0265325_10113938 3300031241 Bacteria 1311
736 Ga0265325_10177103 3300031241 Unclassified 995
737 Ga0265340_10153941 3300031247 Bacteria 1047
738 Ga0265340_10201851 3300031247 Unclassified 894
739 Ga0265339_10006223 3300031249 Bacteria 7857
740 Ga0265339_10018542 3300031249 Bacteria 4100
741 Ga0265339_10030341 3300031249 Bacteria 3062
742 Ga0265339_10031897 3300031249 Bacteria 2974
743 Ga0265339_10212712 3300031249 Bacteria 949
744 Ga0265339_10476288 3300031249 Bacteria 578
745 Ga0265331_10082750 3300031250 Bacteria 1489
746 Ga0265316_10021501 3300031344 Bacteria 5463
747 Ga0265316_10069772 3300031344 Unclassified 2712
748 Ga0265316_10174395 3300031344 Bacteria 1603
749 Ga0265316_10209915 3300031344 Unclassified 1441
750 Ga0265313_10243814 3300031595 Unclassified 735
751 Ga0265314_10038422 3300031711 Bacteria 3458
752 Ga0265314_10212192 3300031711 Bacteria 1136
753 Ga0265314_10220850 3300031711 Bacteria 1106
754 Ga0265342_10096806 3300031712 Bacteria 1686
755 Ga0265342_10425544 3300031712 Unclassified 683
756 Ga0265342_10450424 3300031712 Unclassified 660
757 Ga0316214_1001111 3300033545 Bacteria 3027
758 Ga0316212_1000944 3300033547 Bacteria 3785
759 Ga0316212_1025202 3300033547 Unclassified 834
760 Ga0373926_0278338 3300035083 Bacteria 651
761 Ga0373928_0025709 3300035084 Bacteria 1271
762 Ga0373934_0000868 3300035086 Bacteria 10936
763 Ga0373934_0052108 3300035086 Bacteria 1622
764 Ga0373944_0035682 3300035089 Bacteria 1516
765 Ga0373951_0069515 3300035091 Bacteria 895
766 Ga0373923_0035547 3300035111 Bacteria 2029
767 Ga0373923_0145710 3300035111 Bacteria 1072
768 Ga0373936_0018437 3300035113 Bacteria 2696
769 Ga0373945_0066118 3300035116 Unclassified 1359
770 Ga0373945_0086323 3300035116 Bacteria 1209
771 Ga0373953_0010330 3300035117 Bacteria 3245
772 Ga0373953_0087982 3300035117 Bacteria 1297
773 Ga0373954_0000181 3300035118 Bacteria 22823
774 Ga0373954_0051805 3300035118 Bacteria 1928
775 Ga0373956_0003585 3300035119 Bacteria 6261
776 Ga0373956_0033719 3300035119 Bacteria 2252
777 Ga0373956_0422144 3300035119 Bacteria 636
778 Ga0373943_0002219 3300035170 Bacteria 8835
779 Ga0373943_0022184 3300035170 Unclassified 2939
780 Ga0373943_0064653 3300035170 Unclassified 1837
781 Ga0373946_0011012 3300035171 Bacteria 3363
782 Ga0373955_0002424 3300035172 Bacteria 8136
783 Ga0373955_0007468 3300035172 Bacteria 5025
784 Ga0373955_0051027 3300035172 Bacteria 2252
785 Ga0373955_0072154 3300035172 Bacteria 1933
786 Ga0373955_0128392 3300035172 Bacteria 1478
787 Ga0373955_0361929 3300035172 Bacteria 879
788 Ga0373961_0281753 3300035241 Unclassified 610
789 Ga0373962_0203097 3300035242 Unclassified 672
790 Ga0373924_0010524 3300035410 Bacteria 3415
791 Ga0373924_0210303 3300035410 Bacteria 859
792 Ga0373924_0394677 3300035410 Unclassified 618
793 Ga0373931_0015803 3300035691 Bacteria 3705
794 Ga0373931_1111024 3300035691 Unclassified 538
795 Ga0373935_0002028 3300035692 Bacteria 11441
796 Ga0373935_0003912 3300035692 Bacteria 8693
797 Ga0373935_0070771 3300035692 Unclassified 2249
798 Ga0373935_0357667 3300035692 Bacteria 1042
799 Ga0373927_0000180 3300035695 Bacteria 49813
800 Ga0373927_0187941 3300035695 Unclassified 1355
801 Ga0373927_0794466 3300035695 Unclassified 625
802 Ga0373933_0003327 3300035724 Bacteria 8964
803 Ga0373933_0020114 3300035724 Bacteria 3781
804 Ga0373947_0000053 3300035725 Bacteria 57813
805 Ga0373947_0018287 3300035725 Bacteria 4034
806 Ga0373947_0161884 3300035725 Bacteria 1448
807 Ga0373947_0188808 3300035725 Unclassified 1344
808 Ga0373937_0000051 3300036401 Bacteria 104818
809 Ga0373937_0002506 3300036401 Bacteria 15252
810 Ga0373937_0008779 3300036401 Bacteria 8771
811 Ga0373937_0546875 3300036401 Bacteria 1100
812 Ga0373925_0005266 3300037068 Bacteria 9656
813 Ga0373925_0008302 3300037068 Bacteria 7559
814 Ga0373925_0026298 3300037068 Bacteria 4258
815 Ga0373925_0163013 3300037068 Bacteria 1757
816 Ga0373925_0258323 3300037068 Bacteria 1399
817 Ga0373925_1576784 3300037068 Unclassified 537
818 Ga0395900_0335368 3300037418 Bacteria 1489
819 Ga0395898_1816264 3300037466 Bacteria 531
820 Ga0395905_0014958 3300037471 Bacteria 7400
821 Ga0395905_0017597 3300037471 Bacteria 6784
822 Ga0395905_0045414 3300037471 Bacteria 4120
823 Ga0395905_1114080 3300037471 Bacteria 693
824 Ga0395905_1210193 3300037471 Unclassified 659
825 Ga0395901_0186796 3300038443 Bacteria 2174
826 Ga0395901_0717626 3300038443 Bacteria 996
827 Ga0395901_0916919 3300038443 Bacteria 857
828 Ga0395901_1081839 3300038443 Bacteria 773
829 Ga0436360_1208757 3300039438 Bacteria 607
830 Ga0436363_0595174 3300039450 Bacteria 1209
831 Ga0436363_1322577 3300039450 Unclassified 595
832 Ga0451839_1217545 3300041496 Bacteria 552
833 Ga0466963_0000297 3300044694 Bacteria 22355
834 Ga0466968_0227172 3300044735 Bacteria 881
835 Ga0466959_0317760 3300045049 Bacteria 1065
836 Ga0466967_0002509 3300045976 Bacteria 11470
837 Ga0466967_0077576 3300045976 Bacteria 2991
838 Ga0495603_0283676 3300046455 Unclassified 952
839 Ga0495629_0027431 3300046459 Bacteria 4042
840 Ga0495638_0180741 3300046460 Bacteria 1204
841 Ga0495651_0060034 3300046462 Unclassified 2914
842 Ga0495651_0109502 3300046462 Unclassified 2044
843 Ga0495653_0137206 3300046463 Bacteria 1724
844 Ga0495580_0000605 3300046472 Bacteria 30320
845 Ga0495580_0047305 3300046472 Bacteria 3049
846 Ga0495580_0689071 3300046472 Unclassified 669
847 Ga0495580_0779842 3300046472 Unclassified 621
848 Ga0495580_0895953 3300046472 Unclassified 570
849 Ga0495582_0049522 3300046473 Unclassified 2313
850 Ga0495582_0146147 3300046473 Bacteria 1341
851 Ga0495664_0042075 3300046477 Bacteria 2705
852 Ga0495594_0015876 3300046499 Bacteria 3961
853 Ga0495608_0031689 3300046511 Bacteria 3573
854 Ga0495630_0036867 3300046517 Bacteria 3655
855 Ga0495630_1496311 3300046517 Bacteria 507
856 Ga0495666_0080879 3300046526 Bacteria 1537
857 Ga0495652_0376511 3300046529 Bacteria 1011
858 Ga0495652_0536900 3300046529 Unclassified 806
859 Ga0495665_0102105 3300046531 Unclassified 1505
860 Ga0495665_0245576 3300046531 Bacteria 922
861 Ga0495640_0033075 3300046533 Bacteria 3677
862 Ga0495587_0000167 3300046536 Bacteria 47833
863 Ga0495587_0035010 3300046536 Unclassified 3026
864 Ga0495656_0037725 3300046615 Unclassified 1998
865 Ga0495634_0098044 3300046642 Bacteria 1897
866 Ga0495611_0401829 3300046648 Unclassified 626
867 Ga0495657_0052261 3300046675 Bacteria 2740
868 Ga0495657_0472594 3300046675 Bacteria 733
869 Ga0495623_0011550 3300046679 Bacteria 5717
870 Ga0495647_0014985 3300046681 Bacteria 2709
871 Ga0495647_0128711 3300046681 Unclassified 1071
872 Ga0495658_0012749 3300046683 Bacteria 4266
873 Ga0495658_0068707 3300046683 Unclassified 2052
874 Ga0495613_0280180 3300046689 Unclassified 1158
875 Ga0495624_0020094 3300046690 Bacteria 4449
876 Ga0495624_0315989 3300046690 Bacteria 941
877 Ga0495670_0378449 3300046691 Unclassified 764
878 Ga0495649_0301486 3300046694 Bacteria 816
879 Ga0495581_0053556 3300047315 Unclassified 2330
880 Ga0495581_0319516 3300047315 Unclassified 907
881 Ga0495604_0004506 3300047317 Bacteria 11035
882 Ga0495674_0008460 3300047319 Bacteria 9804
883 Ga0495674_0033453 3300047319 Unclassified 4657
884 Ga0495674_0060564 3300047319 Bacteria 3302
885 Ga0495674_0073714 3300047319 Unclassified 2942
886 Ga0495676_0051601 3300047321 Bacteria 3289
887 Ga0495676_0219811 3300047321 Bacteria 1310
888 Ga0495680_0072482 3300047322 Bacteria 2620
889 Ga0495675_0001194 3300047444 Bacteria 15733
890 Ga0495684_0057638 3300047471 Bacteria 2960
891 Ga0495684_0081300 3300047471 Unclassified 2459
892 Ga0495686_0001897 3300047472 Bacteria 20884
893 Ga0495602_0000048 3300048088 Bacteria 116248
894 Ga0495602_0002959 3300048088 Bacteria 17416
895 Ga0495602_0046284 3300048088 Bacteria 3931
896 Ga0495602_0440266 3300048088 Bacteria 922
897 Ga0495614_0045562 3300048089 Bacteria 1880
898 Ga0496100_0026318 3300048903 Bacteria 3565
899 Ga0496100_0042506 3300048903 Bacteria 2903
900 Ga0496100_0116428 3300048903 Bacteria 1865
901 Ga0496100_0911684 3300048903 Bacteria 690
902 Ga0496100_1648767 3300048903 Unclassified 507
903 Ga0496101_0046527 3300048904 Bacteria 3112
904 Ga0496101_0058764 3300048904 Bacteria 2786
905 Ga0496101_0078625 3300048904 Unclassified 2434
906 Ga0496102_0004103 3300048905 Bacteria 12350
907 Ga0496102_0037200 3300048905 Bacteria 4389
908 Ga0496102_0181183 3300048905 Bacteria 1985
909 Ga0496102_0268485 3300048905 Bacteria 1608
910 Ga0496102_0373313 3300048905 Bacteria 1342
911 Ga0496102_1016957 3300048905 Bacteria 749
912 Ga0496103_0002092 3300048906 Bacteria 12758
913 Ga0496103_0014865 3300048906 Bacteria 4627
914 Ga0496103_0086595 3300048906 Unclassified 1975
915 Ga0496104_0007099 3300048907 Bacteria 9874
916 Ga0496104_0269857 3300048907 Unclassified 1614
917 Ga0496104_0339491 3300048907 Unclassified 1415
918 Ga0496104_0349726 3300048907 Bacteria 1391
919 Ga0496104_0494630 3300048907 Bacteria 1134
920 Ga0496104_0723416 3300048907 Unclassified 903
921 Ga0496104_0863090 3300048907 Unclassified 810
922 Ga0496104_1221224 3300048907 Bacteria 655
923 Ga0496104_1541235 3300048907 Unclassified 567
924 Ga0496105_0547109 3300048908 Bacteria 904
925 Ga0496105_0730149 3300048908 Bacteria 758
926 Ga0496105_0918168 3300048908 Bacteria 659
927 Ga0496106_0012306 3300048909 Bacteria 6314
928 Ga0496106_0141255 3300048909 Unclassified 1894
929 Ga0496106_0287097 3300048909 Bacteria 1319
930 Ga0496106_0406778 3300048909 Bacteria 1094
931 Ga0496106_1052212 3300048909 Bacteria 639
932 Ga0496107_0443586 3300048910 Unclassified 964
933 Ga0496108_0001332 3300048911 Bacteria 19405
934 Ga0496108_0555264 3300048911 Bacteria 1002
935 Ga0496109_0000183 3300048912 Bacteria 62532
936 Ga0496109_0140860 3300048912 Bacteria 2255
937 Ga0496110_0175254 3300048913 Bacteria 1946
938 Ga0496112_0000030 3300048915 Bacteria 120429
939 Ga0496112_0032189 3300048915 Bacteria 5091
940 Ga0496112_0050305 3300048915 Bacteria 4086
941 Ga0496112_0254126 3300048915 Bacteria 1708
942 Ga0496112_1019367 3300048915 Bacteria 747
943 Ga0496113_1310905 3300048916 Unclassified 563
944 Ga0496114_0089174 3300048917 Bacteria 2617
945 Ga0496114_0313004 3300048917 Bacteria 1387
946 Ga0496114_1039035 3300048917 Bacteria 703
947 Ga0496115_0004579 3300048918 Bacteria 10015
948 Ga0496115_0108511 3300048918 Bacteria 2279
949 Ga0496115_1374763 3300048918 Unclassified 522
950 Ga0496126_0069921 3300048929 Bacteria 3129
951 Ga0501034_0001077 3300049571 Bacteria 38646
952 Ga0501036_0448431 3300049572 Bacteria 1075
953 Ga0501038_0000357 3300049574 Bacteria 39282
954 Ga0501039_0080178 3300049575 Unclassified 2540
955 Ga0501035_0077155 3300049822 Unclassified 2945
956 Ga0501044_0828642 3300049823 Unclassified 803
957 nmdc:mga05p37_697866_c1 3300050507 Bacteria 1128
958 nmdc:mga08y16_480996_c1 3300050511 Bacteria 1263
959 nmdc:mga0n895_5280_c1 3300050512 Bacteria 10756
960 nmdc:mga0n895_632_c1 3300050512 Bacteria 24449
961 nmdc:mga0rr50_1413348_c1 3300050513 Unclassified 589
962 nmdc:mga0rr50_7460_c1 3300050513 Bacteria 6749
963 nmdc:mga08x19_59262_c1 3300050514 Bacteria 2478
964 nmdc:mga08x19_658716_c1 3300050514 Bacteria 743
965 nmdc:mga0a205_34094_c1 3300050515 Bacteria 4884
966 Ga0495601_0030015 3300053077 Unclassified 3375
967 Ga0495619_0351754 3300053085 Bacteria 1019
968 Ga0495619_0625492 3300053085 Unclassified 735
969 Ga0587066_035580 3300059490 Bacteria 912
970 Ga0587128_007638 3300059630 Bacteria 1373
971 Ga0587111_0056265 3300060346 Bacteria 882
972 Ga0501082_0203712 3300060353 Bacteria 1721
973 Ga0265760_10099217
974 MBSR1b_contig_10165024
975 MBSR1b_contig_10507888
976 LJNas_1004583
977 JGI24752J21851_1011902
978 JGI24737J22298_10037023
979 JGI24034J26672_10005738
980 JGI24751J29686_10002022
981 rootL2_10312876
982 Ga0058863_10030681
983 Ga0058863_10127990
984 Ga0058861_10074048
985 Ga0058862_10062502
986 Ga0058862_10211683
987 Ga0065712_10139591
988 Ga0065715_10006051
989 Ga0070658_10057744
990 Ga0070658_10246788
991 Ga0070658_10510840
992 Ga0070676_10024794
993 Ga0070683_100007816
994 Ga0070683_100026554
995 Ga0070683_100249383
996 Ga0070690_100010254
997 Ga0070690_100244677
998 Ga0070690_100503445
999 Ga0070670_100012670
1000 Ga0070677_10150025
1001 Ga0068869_100001091
1002 Ga0068869_100107562
1003 Ga0070666_10086109
1004 Ga0070666_10245933
1005 Ga0070680_100079702
1006 Ga0070680_100135809
1007 Ga0070680_100147717
1008 Ga0070680_100383749
1009 Ga0070682_100042189
1010 Ga0070682_100180365
1011 Ga0070682_100295611
1012 Ga0070682_100374723
1013 Ga0068868_100031940
1014 Ga0068868_100041104
1015 Ga0068868_100230334
1016 Ga0068868_100273165
1017 Ga0070660_100019734
1018 Ga0070660_100027487
1019 Ga0070660_100044512
1020 Ga0070689_100010978
1021 Ga0070691_10477605
1022 Ga0070687_100003669
1023 Ga0070661_100005336
1024 Ga0070661_100017859
1025 Ga0070661_100308055
1026 Ga0070692_10021641
1027 Ga0070692_10590913
1028 Ga0070668_100018162
1029 Ga0070668_100052416
1030 Ga0070668_101380798
1031 Ga0070669_100103593
1032 Ga0070669_100117210
1033 Ga0070675_100024569
1034 Ga0070675_100478110
1035 Ga0070674_100086726
1036 Ga0070673_100005154
1037 Ga0070673_101470164
1038 Ga0070688_100020972
1039 Ga0070688_100060749
1040 Ga0070659_100001853
1041 Ga0070659_100410658
1042 Ga0070667_100134715
1043 Ga0070667_100144270
1044 Ga0070667_100162609
1045 Ga0070667_100230880
1046 Ga0070709_10093672
1047 Ga0070709_10195615
1048 Ga0070709_10215712
1049 Ga0070709_11037071
1050 Ga0070714_100000111
1051 Ga0070714_100085248
1052 Ga0070714_100177857
1053 Ga0070714_100224150
1054 Ga0070714_100274857
1055 Ga0070714_100330524
1056 Ga0070714_100493730
1057 Ga0070714_100633530
1058 Ga0070714_102154378
1059 Ga0070713_100000231
1060 Ga0070713_100004047
1061 Ga0070713_100016019
1062 Ga0070713_100075339
1063 Ga0070713_100079167
1064 Ga0070713_100369294
1065 Ga0070713_100817667
1066 Ga0070713_100964379
1067 Ga0070710_10005065
1068 Ga0070710_10117119
1069 Ga0070710_10144587
1070 Ga0070710_10186885
1071 Ga0070701_10104756
1072 Ga0070711_100000519
1073 Ga0070711_100000929
1074 Ga0070711_100039221
1075 Ga0070711_100082975
1076 Ga0070711_100406463
1077 Ga0070711_100517078
1078 Ga0070711_100655150
1079 Ga0070711_101338125
1080 Ga0070711_101516647
1081 Ga0070705_100396319
1082 Ga0070705_100673471
1083 Ga0070705_101424654
1084 Ga0070694_100308754
1085 Ga0070694_100509637
1086 Ga0070708_100000410
1087 Ga0070708_100014908
1088 Ga0070708_100075059
1089 Ga0070708_100083480
1090 Ga0070708_100261059
1091 Ga0070663_100003902
1092 Ga0070663_100079392
1093 Ga0070663_100082057
1094 Ga0070663_100096112
1095 Ga0070663_100284221
1096 Ga0070678_101337073
1097 Ga0070662_100030086
1098 Ga0070662_100169342
1099 Ga0070662_101096647
1100 Ga0070662_101701482
1101 Ga0070681_10001954
1102 Ga0070681_10036253
1103 Ga0070681_10233915
1104 Ga0070681_10415393
1105 Ga0070681_10505284
1106 Ga0070681_10590882
1107 Ga0070681_10834360
1108 Ga0070681_10994218
1109 Ga0070681_11179639
1110 Ga0068867_100127797
1111 Ga0068867_100868312
1112 Ga0070685_10000891
1113 Ga0070706_100001099
1114 Ga0070706_100003090
1115 Ga0070706_100059036
1116 Ga0070706_100574126
1117 Ga0070706_100830338
1118 Ga0070706_101123520
1119 Ga0070707_100000229
1120 Ga0070707_100034150
1121 Ga0070707_100091366
1122 Ga0070707_100099997
1123 Ga0070707_100107375
1124 Ga0070707_100120929
1125 Ga0070707_100156922
1126 Ga0070707_100653099
1127 Ga0070698_100018118
1128 Ga0070698_100027170
1129 Ga0070698_100037896
1130 Ga0070698_100048291
1131 Ga0070698_100255932
1132 Ga0070699_100000703
1133 Ga0070699_100001773
1134 Ga0070699_100036450
1135 Ga0070699_100065354
1136 Ga0070699_100273390
1137 Ga0070699_100378618
1138 Ga0070699_100880063
1139 Ga0070679_100026671
1140 Ga0070679_100030052
1141 Ga0070679_100065948
1142 Ga0070679_100120123
1143 Ga0070679_100208731
1144 Ga0070679_101123619
1145 Ga0070684_100025735
1146 Ga0070684_100184514
1147 Ga0070684_100396792
1148 Ga0070684_101036296
1149 Ga0070684_101069149
1150 Ga0070697_100000166
1151 Ga0070697_100000673
1152 Ga0070697_100001242
1153 Ga0070697_100003229
1154 Ga0070697_100009587
1155 Ga0070697_100575543
1156 Ga0070697_101360534
1157 Ga0068853_100000064
1158 Ga0068853_100145674
1159 Ga0068853_100145969
1160 Ga0070672_100078340
1161 Ga0070672_100815998
1162 Ga0070686_100051263
1163 Ga0070686_100101894
1164 Ga0070686_100210482
1165 Ga0070686_100772422
1166 Ga0070695_100134470
1167 Ga0070695_100233972
1168 Ga0070696_100162259
1169 Ga0070696_100493033
1170 Ga0070693_100065727
1171 Ga0070693_100425590
1172 Ga0070665_100045644
1173 Ga0070665_100177480
1174 Ga0070704_100438251
1175 Ga0068855_100085404
1176 Ga0068855_100363724
1177 Ga0068855_100643803
1178 Ga0068855_101158651
1179 Ga0068855_101230969
1180 Ga0068855_101943166
1181 Ga0068855_102334590
1182 Ga0070664_100307705
1183 Ga0068857_100012748
1184 Ga0068857_100027770
1185 Ga0068857_100353009
1186 Ga0068854_100000073
1187 Ga0068854_100084144
1188 Ga0068854_100247345
1189 Ga0068854_100382191
1190 Ga0068854_100415931
1191 Ga0068856_100032606
1192 Ga0068856_100038619
1193 Ga0068856_100363545
1194 Ga0068856_101000832
1195 Ga0070702_100018838
1196 Ga0068852_100108429
1197 Ga0068852_100706000
1198 Ga0068852_101138316
1199 Ga0068859_100061883
1200 Ga0068859_100197826
1201 Ga0068859_100377869
1202 Ga0068866_10069989
1203 Ga0068866_10073008
1204 Ga0068866_10212732
1205 Ga0068861_100028262
1206 Ga0068861_100054581
1207 Ga0068861_101536641
1208 Ga0068870_10000880
1209 Ga0068870_10904922
1210 Ga0068863_100209702
1211 Ga0068863_100235832
1212 Ga0068863_100292679
1213 Ga0068858_100010651
1214 Ga0068858_100032024
1215 Ga0068858_100210677
1216 Ga0068858_100522280
1217 Ga0068860_100021654
1218 Ga0068860_100075859
1219 Ga0068860_100231371
1220 Ga0068860_100660283
1221 Ga0068862_100008118
1222 Ga0068862_100024110
1223 Ga0068862_100209957
1224 Ga0068862_101164666
1225 Ga0081540_1156928
1226 Ga0070717_10008860
1227 Ga0070717_10023401
1228 Ga0070717_10089905
1229 Ga0070717_10097818
1230 Ga0070717_10173615
1231 Ga0070717_10181039
1232 Ga0070717_10490030
1233 Ga0070717_10547684
1234 Ga0070717_10607901
1235 Ga0070717_10671886
1236 Ga0070717_10697941
1237 Ga0070717_10740594
1238 Ga0070717_11123531
1239 Ga0070715_10013418
1240 Ga0070715_10135758
1241 Ga0070715_10142113
1242 Ga0070715_10189289
1243 Ga0070716_100019448
1244 Ga0070716_100036790
1245 Ga0070716_100074262
1246 Ga0070716_100134428
1247 Ga0070716_100153955
1248 Ga0070716_100227152
1249 Ga0070716_100259291
1250 Ga0070716_100259949
1251 Ga0070716_100400203
1252 Ga0070712_100000120
1253 Ga0070712_100001238
1254 Ga0070712_100002759
1255 Ga0070712_100036247
1256 Ga0070712_100379410
1257 Ga0070712_100456828
1258 Ga0070712_100708235
1259 Ga0097621_100023588
1260 Ga0097621_100051309
1261 Ga0097621_100078156
1262 Ga0097621_100088932
1263 Ga0097621_100655281
1264 Ga0097621_100904805
1265 Ga0068871_100001112
1266 Ga0068871_100177023
1267 Ga0068871_100780774
1268 Ga0068871_100984760
1269 Ga0068871_101387326
1270 Ga0075433_10025151
1271 Ga0075433_10163964
1272 Ga0075433_10490906
1273 Ga0075434_100013738
1274 Ga0075434_100084208
1275 Ga0075434_100710685
1276 Ga0068865_100029249
1277 Ga0068865_100653927
1278 Ga0075436_100045891
1279 Ga0075436_100257051
1280 Ga0097620_100061878
1281 Ga0097620_100197825
1282 Ga0097620_100377864
1283 Ga0075435_100000173
1284 Ga0075435_101534756
1285 Ga0099794_10035084
1286 Ga0105251_10256404
1287 Ga0105240_10028577
1288 Ga0105240_10066209
1289 Ga0105240_10173504
1290 Ga0105240_10220098
1291 Ga0105240_10224354
1292 Ga0105240_10262295
1293 Ga0105240_10283714
1294 Ga0111539_10808465
1295 Ga0105245_10008119
1296 Ga0105245_10021602
1297 Ga0105245_10059022
1298 Ga0105245_10128920
1299 Ga0105245_10258397
1300 Ga0105245_10303548
1301 Ga0105245_10904532
1302 Ga0105247_10075990
1303 Ga0105247_10103890
1304 Ga0105247_10121730
1305 Ga0114129_10662456
1306 Ga0105243_10390461
1307 Ga0105241_10006954
1308 Ga0105241_10098600
1309 Ga0105241_10169505
1310 Ga0105241_10320186
1311 Ga0105241_10354255
1312 Ga0105241_10802635
1313 Ga0105241_11708493
1314 Ga0105241_12314488
1315 Ga0105242_10025538
1316 Ga0105242_10067160
1317 Ga0105242_10196828
1318 Ga0105242_12553589
1319 Ga0105248_10056683
1320 Ga0105248_10151081
1321 Ga0105248_10166343
1322 Ga0105248_10940186
1323 Ga0105237_10076830
1324 Ga0105237_10167400
1325 Ga0105237_10229794
1326 Ga0105237_10233508
1327 Ga0105237_10293118
1328 Ga0105237_10372210
1329 Ga0105237_10548272
1330 Ga0105238_10149171
1331 Ga0105238_10184851
1332 Ga0105238_10285001
1333 Ga0105249_10020124
1334 Ga0105249_10041458
1335 Ga0105249_10062042
1336 Ga0105249_10079956
1337 Ga0099796_10123497
1338 Ga0105239_10033112
1339 Ga0105239_10169686
1340 Ga0105239_10356404
1341 Ga0105239_10469018
1342 Ga0105239_11650745
1343 Ga0105246_10017813
1344 Ga0105246_10195957
1345 Ga0105246_12010072
1346 Ga0157373_10004365
1347 Ga0157373_10011522
1348 Ga0157373_10094317
1349 Ga0157373_10166246
1350 Ga0157371_10001874
1351 Ga0157371_10208260
1352 Ga0157371_10465920
1353 Ga0157371_10566166
1354 Ga0157370_10028414
1355 Ga0157370_10060172
1356 Ga0157370_10118275
1357 Ga0157370_10221891
1358 Ga0157369_10043736
1359 Ga0157369_10046631
1360 Ga0157369_10124073
1361 Ga0157369_10125246
1362 Ga0157369_10132681
1363 Ga0157369_10146034
1364 Ga0157369_10235144
1365 Ga0157369_10473017
1366 Ga0157369_10594901
1367 Ga0157374_10019511
1368 Ga0157374_10022249
1369 Ga0157374_10033622
1370 Ga0157374_10064959
1371 Ga0157374_10443072
1372 Ga0157374_10720541
1373 Ga0157374_10759293
1374 Ga0157374_11150755
1375 Ga0157374_11601229
1376 Ga0157378_10000080
1377 Ga0157378_10111486
1378 Ga0157378_10361976
1379 Ga0157378_10443252
1380 Ga0157378_11263202
1381 Ga0157378_12277191
1382 Ga0163162_10002825
1383 Ga0163162_10008701
1384 Ga0163162_10081086
1385 Ga0163162_13259215
1386 Ga0157372_10007870
1387 Ga0157372_10056045
1388 Ga0157372_10066678
1389 Ga0157372_10075172
1390 Ga0157372_10102361
1391 Ga0157372_10168758
1392 Ga0157372_10270722
1393 Ga0157372_10291043
1394 Ga0157372_10776359
1395 Ga0157375_10048295
1396 Ga0157375_10281354
1397 Ga0157375_10489877
1398 Ga0157375_10516078
1399 Ga0157375_10908356
1400 Ga0163163_10007748
1401 Ga0163163_10099513
1402 Ga0163163_10150928
1403 Ga0163163_10275599
1404 Ga0157380_10201360
1405 Ga0182008_10018152
1406 Ga0157377_10003870
1407 Ga0157377_10086320
1408 Ga0157377_10390755
1409 Ga0157377_10814391
1410 Ga0157379_10009000
1411 Ga0157379_10100665
1412 Ga0157379_10145073
1413 Ga0157379_10160330
1414 Ga0157379_10409558
1415 Ga0157376_10005415
1416 Ga0157376_10051361
1417 Ga0157376_10189494
1418 Ga0157376_10312876
1419 Ga0157376_10523718
1420 Ga0157376_10975534
1421 Ga0157376_11194216
1422 Ga0182007_10025964
1423 Ga0163161_10033798
1424 Ga0197907_10558217
1425 Ga0197907_11041484
1426 Ga0206356_11447340
1427 Ga0206356_11591461
1428 Ga0206349_1169383
1429 Ga0206349_1838695
1430 Ga0206355_1093249
1431 Ga0206351_10454637
1432 Ga0206351_10924681
1433 Ga0206352_10096670
1434 Ga0206352_10855043
1435 Ga0206352_11260177
1436 Ga0206350_10127627
1437 Ga0206350_10163719
1438 Ga0206350_10834542
1439 Ga0206350_11365607
1440 Ga0206354_10640681
1441 Ga0206353_10792725
1442 Ga0154015_1103445
1443 Ga0224712_10000977
1444 Ga0224712_10010981
1445 Ga0224712_10034546
1446 Ga0224712_10035179
1447 Ga0224712_10109093
1448 Ga0224572_1001294
1449 Ga0224572_1007760
1450 Ga0224572_1055539
1451 Ga0228598_1001027
1452 Ga0228598_1003872
1453 Ga0228598_1051058
1454 Ga0207697_10024533
1455 Ga0207682_10045324
1456 Ga0207692_10054102
1457 Ga0207692_10058514
1458 Ga0207692_10135886
1459 Ga0207642_10186015
1460 Ga0207642_10996495
1461 Ga0207710_10066155
1462 Ga0207688_10065973
1463 Ga0207680_10173866
1464 Ga0207647_10003789
1465 Ga0207647_10007432
1466 Ga0207647_10027290
1467 Ga0207647_10157480
1468 Ga0207685_10005205
1469 Ga0207685_10017481
1470 Ga0207685_10110844
1471 Ga0207699_10125381
1472 Ga0207699_10384781
1473 Ga0207699_10478003
1474 Ga0207699_10645037
1475 Ga0207699_10971116
1476 Ga0207645_10000338
1477 Ga0207645_10013932
1478 Ga0207643_10000614
1479 Ga0207643_10017869
1480 Ga0207705_10001035
1481 Ga0207705_10017201
1482 Ga0207705_10679055
1483 Ga0207684_10012987
1484 Ga0207684_10014429
1485 Ga0207684_10014612
1486 Ga0207684_10135410
1487 Ga0207684_10772045
1488 Ga0207684_10774697
1489 Ga0207684_10875784
1490 Ga0207684_11108364
1491 Ga0207654_10003614
1492 Ga0207654_10041563
1493 Ga0207654_10112878
1494 Ga0207654_10835798
1495 Ga0207707_10000757
1496 Ga0207707_10336979
1497 Ga0207707_10667432
1498 Ga0207707_10854928
1499 Ga0207707_11132574
1500 Ga0207695_10033293
1501 Ga0207695_10178746
1502 Ga0207695_10206483
1503 Ga0207695_10238796
1504 Ga0207695_10455281
1505 Ga0207671_10049110
1506 Ga0207671_10177968
1507 Ga0207671_10803895
1508 Ga0207693_10000005
1509 Ga0207693_10000091
1510 Ga0207693_10000823
1511 Ga0207693_10011174
1512 Ga0207693_10035451
1513 Ga0207693_10268678
1514 Ga0207663_10002535
1515 Ga0207663_10020722
1516 Ga0207663_10033645
1517 Ga0207663_10151298
1518 Ga0207663_10287327
1519 Ga0207663_10333218
1520 Ga0207660_10052485
1521 Ga0207660_10309865
1522 Ga0207660_10659111
1523 Ga0207660_11303255
1524 Ga0207662_10031871
1525 Ga0207657_10006741
1526 Ga0207657_10009792
1527 Ga0207657_10081330
1528 Ga0207649_10009112
1529 Ga0207649_10091507
1530 Ga0207652_10030679
1531 Ga0207652_10078926
1532 Ga0207652_10137311
1533 Ga0207652_10165089
1534 Ga0207652_10212674
1535 Ga0207652_10214213
1536 Ga0207652_10344821
1537 Ga0207646_10010241
1538 Ga0207646_10029495
1539 Ga0207646_10155520
1540 Ga0207646_10328755
1541 Ga0207646_11044664
1542 Ga0207681_10095819
1543 Ga0207694_10025905
1544 Ga0207694_10136780
1545 Ga0207694_10694243
1546 Ga0207650_10000380
1547 Ga0207650_10911037
1548 Ga0207687_10017987
1549 Ga0207687_10061324
1550 Ga0207687_11174707
1551 Ga0207700_10001542
1552 Ga0207700_10001979
1553 Ga0207700_10005278
1554 Ga0207700_10074775
1555 Ga0207700_10078293
1556 Ga0207700_10098368
1557 Ga0207700_10397117
1558 Ga0207700_10482314
1559 Ga0207700_10525267
1560 Ga0207700_10787280
1561 Ga0207664_10000127
1562 Ga0207664_10029379
1563 Ga0207664_10069940
1564 Ga0207664_10106048
1565 Ga0207664_10125480
1566 Ga0207664_10129037
1567 Ga0207664_10195134
1568 Ga0207664_10599754
1569 Ga0207664_11736818
1570 Ga0207644_10042612
1571 Ga0207644_10839162
1572 Ga0207690_10049747
1573 Ga0207690_10072707
1574 Ga0207690_10477091
1575 Ga0207706_10019832
1576 Ga0207706_10029071
1577 Ga0207706_11214510
1578 Ga0207706_11717576
1579 Ga0207686_10146561
1580 Ga0207686_11159781
1581 Ga0207669_10041135
1582 Ga0207669_10337827
1583 Ga0207704_10307910
1584 Ga0207704_10597121
1585 Ga0207665_10000034
1586 Ga0207665_10008083
1587 Ga0207665_10017320
1588 Ga0207665_10019102
1589 Ga0207665_10040271
1590 Ga0207665_10098805
1591 Ga0207665_10115258
1592 Ga0207665_10265692
1593 Ga0207665_10415139
1594 Ga0207665_10527390
1595 Ga0207691_10011784
1596 Ga0207691_10670928
1597 Ga0207711_10006633
1598 Ga0207711_10663543
1599 Ga0207711_11360936
1600 Ga0207689_10000505
1601 Ga0207689_10001408
1602 Ga0207689_10080741
1603 Ga0207689_10116883
1604 Ga0207661_10000101
1605 Ga0207661_10057309
1606 Ga0207661_10170335
1607 Ga0207679_10000079
1608 Ga0207679_10198193
1609 Ga0207667_10051169
1610 Ga0207667_10157463
1611 Ga0207667_10163278
1612 Ga0207667_10276567
1613 Ga0207667_10381196
1614 Ga0207667_10383368
1615 Ga0207667_11677261
1616 Ga0207667_12005103
1617 Ga0207651_10053780
1618 Ga0207712_10020472
1619 Ga0207712_10166549
1620 Ga0207712_10226480
1621 Ga0207668_10004801
1622 Ga0207640_10000033
1623 Ga0207640_10010538
1624 Ga0207640_10039077
1625 Ga0207658_10154867
1626 Ga0207658_10273759
1627 Ga0207658_10287059
1628 Ga0207658_10431553
1629 Ga0207677_10035469
1630 Ga0207677_10163975
1631 Ga0207677_10680036
1632 Ga0207703_10018871
1633 Ga0207703_10146584
1634 Ga0207703_10487848
1635 Ga0207703_10536283
1636 Ga0207639_10000096
1637 Ga0207639_10155689
1638 Ga0207639_10403913
1639 Ga0207639_10872157
1640 Ga0207678_10005015
1641 Ga0207678_10015807
1642 Ga0207678_10022300
1643 Ga0207678_10054801
1644 Ga0207678_10311055
1645 Ga0207678_10475933
1646 Ga0207708_10025151
1647 Ga0207702_10280044
1648 Ga0207702_10841186
1649 Ga0207702_10923848
1650 Ga0207641_10000009
1651 Ga0207641_10150546
1652 Ga0207641_10191597
1653 Ga0207641_10395819
1654 Ga0207648_10000496
1655 Ga0207648_10473455
1656 Ga0207676_10000144
1657 Ga0207676_10500786
1658 Ga0207674_10000988
1659 Ga0207674_10001160
1660 Ga0207674_10003484
1661 Ga0207674_10127554
1662 Ga0207675_100058175
1663 Ga0207675_100089137
1664 Ga0207675_100896726
1665 Ga0207683_10000869
1666 Ga0207683_11286370
1667 Ga0207698_10022579
1668 Ga0207698_11519730
1669 Ga0209588_1007852
1670 Ga0209588_1040264
1671 Ga0209588_1041388
1672 Ga0209588_1106600
1673 Ga0265356_1000574
1674 Ga0265357_1017819
1675 Ga0268266_10002830
1676 Ga0268266_10276075
1677 Ga0268265_10006045
1678 Ga0268265_10595893
1679 Ga0268265_11155559
1680 Ga0268264_10010221
1681 Ga0268264_10178743
1682 Ga0268264_10181424
1683 Ga0268264_10235687
1684 Ga0268264_10619536
1685 Ga0265338_10005942
1686 Ga0265338_10006826
1687 Ga0265338_10052040
1688 Ga0265338_10060152
1689 Ga0265338_10126326
1690 Ga0265338_10273852
1691 Ga0265338_10363324
1692 Ga0265324_10098197
1693 Ga0265762_1002021
1694 Ga0265762_1002584
1695 Ga0265762_1003378
1696 Ga0265763_1014574
1697 Ga0265770_1055588
1698 Ga0265765_1033754
1699 Ga0265760_10002195
1700 Ga0265760_10006343
1701 Ga0265760_10006840
1702 Ga0265760_10016170
1703 Ga0265760_10018812
1704 Ga0265760_10125716
1705 Ga0265328_10125846
1706 Ga0265325_10014367
1707 Ga0265325_10113938
1708 Ga0265325_10177103
1709 Ga0265340_10153941
1710 Ga0265340_10201851
1711 Ga0265339_10006223
1712 Ga0265339_10018542
1713 Ga0265339_10030341
1714 Ga0265339_10031897
1715 Ga0265339_10212712
1716 Ga0265339_10476288
1717 Ga0265331_10082750
1718 Ga0265316_10021501
1719 Ga0265316_10069772
1720 Ga0265316_10174395
1721 Ga0265316_10209915
1722 Ga0265313_10243814
1723 Ga0265314_10038422
1724 Ga0265314_10212192
1725 Ga0265314_10220850
1726 Ga0265342_10096806
1727 Ga0265342_10425544
1728 Ga0265342_10450424
1729 Ga0316214_1001111
1730 Ga0316212_1000944
1731 Ga0316212_1025202
1732 Ga0373926_0278338
1733 Ga0373928_0025709
1734 Ga0373934_0000868
1735 Ga0373934_0052108
1736 Ga0373944_0035682
1737 Ga0373951_0069515
1738 Ga0373923_0035547
1739 Ga0373923_0145710
1740 Ga0373936_0018437
1741 Ga0373945_0066118
1742 Ga0373945_0086323
1743 Ga0373953_0010330
1744 Ga0373953_0087982
1745 Ga0373954_0000181
1746 Ga0373954_0051805
1747 Ga0373956_0003585
1748 Ga0373956_0033719
1749 Ga0373956_0422144
1750 Ga0373943_0002219
1751 Ga0373943_0022184
1752 Ga0373943_0064653
1753 Ga0373946_0011012
1754 Ga0373955_0002424
1755 Ga0373955_0007468
1756 Ga0373955_0051027
1757 Ga0373955_0072154
1758 Ga0373955_0128392
1759 Ga0373955_0361929
1760 Ga0373961_0281753
1761 Ga0373962_0203097
1762 Ga0373924_0010524
1763 Ga0373924_0210303
1764 Ga0373924_0394677
1765 Ga0373931_0015803
1766 Ga0373931_1111024
1767 Ga0373935_0002028
1768 Ga0373935_0003912
1769 Ga0373935_0070771
1770 Ga0373935_0357667
1771 Ga0373927_0000180
1772 Ga0373927_0187941
1773 Ga0373927_0794466
1774 Ga0373933_0003327
1775 Ga0373933_0020114
1776 Ga0373947_0000053
1777 Ga0373947_0018287
1778 Ga0373947_0161884
1779 Ga0373947_0188808
1780 Ga0373937_0000051
1781 Ga0373937_0002506
1782 Ga0373937_0008779
1783 Ga0373937_0546875
1784 Ga0373925_0005266
1785 Ga0373925_0008302
1786 Ga0373925_0026298
1787 Ga0373925_0163013
1788 Ga0373925_0258323
1789 Ga0373925_1576784
1790 Ga0395900_0335368
1791 Ga0395898_1816264
1792 Ga0395905_0014958
1793 Ga0395905_0017597
1794 Ga0395905_0045414
1795 Ga0395905_1114080
1796 Ga0395905_1210193
1797 Ga0395901_0186796
1798 Ga0395901_0717626
1799 Ga0395901_0916919
1800 Ga0395901_1081839
1801 Ga0436360_1208757
1802 Ga0436363_0595174
1803 Ga0436363_1322577
1804 Ga0451839_1217545
1805 Ga0466963_0000297
1806 Ga0466968_0227172
1807 Ga0466959_0317760
1808 Ga0466967_0002509
1809 Ga0466967_0077576
1810 Ga0495603_0283676
1811 Ga0495629_0027431
1812 Ga0495638_0180741
1813 Ga0495651_0060034
1814 Ga0495651_0109502
1815 Ga0495653_0137206
1816 Ga0495580_0000605
1817 Ga0495580_0047305
1818 Ga0495580_0689071
1819 Ga0495580_0779842
1820 Ga0495580_0895953
1821 Ga0495582_0049522
1822 Ga0495582_0146147
1823 Ga0495664_0042075
1824 Ga0495594_0015876
1825 Ga0495608_0031689
1826 Ga0495630_0036867
1827 Ga0495630_1496311
1828 Ga0495666_0080879
1829 Ga0495652_0376511
1830 Ga0495652_0536900
1831 Ga0495665_0102105
1832 Ga0495665_0245576
1833 Ga0495640_0033075
1834 Ga0495587_0000167
1835 Ga0495587_0035010
1836 Ga0495656_0037725
1837 Ga0495634_0098044
1838 Ga0495611_0401829
1839 Ga0495657_0052261
1840 Ga0495657_0472594
1841 Ga0495623_0011550
1842 Ga0495647_0014985
1843 Ga0495647_0128711
1844 Ga0495658_0012749
1845 Ga0495658_0068707
1846 Ga0495613_0280180
1847 Ga0495624_0020094
1848 Ga0495624_0315989
1849 Ga0495670_0378449
1850 Ga0495649_0301486
1851 Ga0495581_0053556
1852 Ga0495581_0319516
1853 Ga0495604_0004506
1854 Ga0495674_0008460
1855 Ga0495674_0033453
1856 Ga0495674_0060564
1857 Ga0495674_0073714
1858 Ga0495676_0051601
1859 Ga0495676_0219811
1860 Ga0495680_0072482
1861 Ga0495675_0001194
1862 Ga0495684_0057638
1863 Ga0495684_0081300
1864 Ga0495686_0001897
1865 Ga0495602_0000048
1866 Ga0495602_0002959
1867 Ga0495602_0046284
1868 Ga0495602_0440266
1869 Ga0495614_0045562
1870 Ga0496100_0026318
1871 Ga0496100_0042506
1872 Ga0496100_0116428
1873 Ga0496100_0911684
1874 Ga0496100_1648767
1875 Ga0496101_0046527
1876 Ga0496101_0058764
1877 Ga0496101_0078625
1878 Ga0496102_0004103
1879 Ga0496102_0037200
1880 Ga0496102_0181183
1881 Ga0496102_0268485
1882 Ga0496102_0373313
1883 Ga0496102_1016957
1884 Ga0496103_0002092
1885 Ga0496103_0014865
1886 Ga0496103_0086595
1887 Ga0496104_0007099
1888 Ga0496104_0269857
1889 Ga0496104_0339491
1890 Ga0496104_0349726
1891 Ga0496104_0494630
1892 Ga0496104_0723416
1893 Ga0496104_0863090
1894 Ga0496104_1221224
1895 Ga0496104_1541235
1896 Ga0496105_0547109
1897 Ga0496105_0730149
1898 Ga0496105_0918168
1899 Ga0496106_0012306
1900 Ga0496106_0141255
1901 Ga0496106_0287097
1902 Ga0496106_0406778
1903 Ga0496106_1052212
1904 Ga0496107_0443586
1905 Ga0496108_0001332
1906 Ga0496108_0555264
1907 Ga0496109_0000183
1908 Ga0496109_0140860
1909 Ga0496110_0175254
1910 Ga0496112_0000030
1911 Ga0496112_0032189
1912 Ga0496112_0050305
1913 Ga0496112_0254126
1914 Ga0496112_1019367
1915 Ga0496113_1310905
1916 Ga0496114_0089174
1917 Ga0496114_0313004
1918 Ga0496114_1039035
1919 Ga0496115_0004579
1920 Ga0496115_0108511
1921 Ga0496115_1374763
1922 Ga0496126_0069921
1923 Ga0501034_0001077
1924 Ga0501036_0448431
1925 Ga0501038_0000357
1926 Ga0501039_0080178
1927 Ga0501035_0077155
1928 Ga0501044_0828642
1929 nmdc:mga05p37_697866_c1
1930 nmdc:mga08y16_480996_c1
1931 nmdc:mga0n895_5280_c1
1932 nmdc:mga0n895_632_c1
1933 nmdc:mga0rr50_1413348_c1
1934 nmdc:mga0rr50_7460_c1
1935 nmdc:mga08x19_59262_c1
1936 nmdc:mga08x19_658716_c1
1937 nmdc:mga0a205_34094_c1
1938 Ga0495601_0030015
1939 Ga0495619_0351754
1940 Ga0495619_0625492
1941 Ga0587066_035580
1942 Ga0587128_007638
1943 Ga0587111_0056265
1944 Ga0501082_0203712

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nl3-assembly1.cif.gz_D crystal structure of listeria monocytogenes hfq in complex with u6 rna 0.8249 47 109
8p91-assembly1.cif.gz_A hfq from chromobacterium haemolyticum; a p6 space group monomer 0.824 47 109
7oh8-assembly1.cif.gz_B r17a mutant of hfq protein from neisseria meningitidis 0.8161 47 109
4noy-assembly1.cif.gz_A crystal structure of listeria monocytogenes hfq f43w 0.8151 44 109
4a53-assembly1.cif.gz_A structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6 0.8104 50 108
ID Description Score Start End Superfamily
af_Q2FYW7_1_63_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8421 52 109 2.30.30.100
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.8391 47 109 2.30.30.100
2ej9A02 Mainly Beta;Roll;SH3 type barrels.; 0.8328 54 106 2.30.30.100
4a53A01 Mainly Beta;Roll;SH3 type barrels.; 0.8136 50 109 2.30.30.100
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.7898 44 107 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A350UNM5-F1-model_v4 Uncharacterized protein 0.8395 39 145
AF-A0A350UNM5-F1-model_v4 Uncharacterized protein 0.8258 39 145
AF-A0A1L8MKA6-F1-model_v4 LSM domain protein 0.818 49 109
AF-A0A371IQ45-F1-model_v4 Uncharacterized protein 0.8172 52 109
AF-A0A840DR02-F1-model_v4 LSM domain protein 0.8157 49 108

Map