F487162

General Info

Members Datasets Scaffolds Average Seq Length
972 346 1944 195

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0120798|Ga0495608_0120798_959_1621
Length 220
Sequence MEDRMSTPPDSTPLAASRPDGADAPRAASIERKTGETDVRLSLALDGAGEGARDTGVGFLDHMLDLLARHGKIDLDVAVAGDLQTGAHHTAEDTAIVLGQALDRALGDRRGIHRYGHFVVPMDEARASCAIDISGRPHTVFHADLPSGSTGGFDHELTEEFFRALATAAKLTLHLEVQAGTNAHHMIEAAFKAFARALRQAVAVDPGEKGVPSTKGTLTS

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
177 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
178 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
179 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
182 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 9.88
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0120798 3300046511 Bacteria 1680
2 LJQas_1007430 3300000549 Bacteria 1347
3 JGI25406J46586_10037679 3300003203 Unclassified 1740
4 JGI25407J50210_10007614 3300003373 Bacteria 2715
5 JGI25407J50210_10046016 3300003373 Bacteria 1111
6 Ga0070683_100017940 3300005329 Bacteria 6257
7 Ga0070683_100035511 3300005329 Bacteria 4556
8 Ga0070683_100051889 3300005329 Bacteria 3798
9 Ga0070683_100165130 3300005329 Bacteria 2100
10 Ga0070690_100243518 3300005330 Bacteria 1269
11 Ga0070670_100256191 3300005331 Bacteria 1525
12 Ga0070670_101056036 3300005331 Bacteria 740
13 Ga0068869_100019169 3300005334 Bacteria 4670
14 Ga0068869_100186159 3300005334 Bacteria 1630
15 Ga0070666_10549680 3300005335 Bacteria 840
16 Ga0070680_100810565 3300005336 Bacteria 807
17 Ga0070682_100023170 3300005337 Bacteria 3686
18 Ga0070682_100376757 3300005337 Bacteria 1066
19 Ga0070682_100399027 3300005337 Bacteria 1040
20 Ga0068868_100003173 3300005338 Bacteria 11441
21 Ga0068868_100027776 3300005338 Bacteria 4319
22 Ga0068868_100293943 3300005338 Bacteria 1378
23 Ga0068868_100340411 3300005338 Bacteria 1282
24 Ga0068868_100380266 3300005338 Bacteria 1215
25 Ga0068868_100887103 3300005338 Bacteria 810
26 Ga0070660_100003619 3300005339 Bacteria 10672
27 Ga0070660_100046597 3300005339 Bacteria 3323
28 Ga0070660_100068013 3300005339 Bacteria 2776
29 Ga0070660_100561430 3300005339 Bacteria 953
30 Ga0070689_100060626 3300005340 Bacteria 2942
31 Ga0070689_100158234 3300005340 Bacteria 1830
32 Ga0070689_100399760 3300005340 Bacteria 1161
33 Ga0070691_10158276 3300005341 Bacteria 1166
34 Ga0070687_100104910 3300005343 Bacteria 1589
35 Ga0070687_100478350 3300005343 Bacteria 834
36 Ga0070661_100019340 3300005344 Bacteria 4854
37 Ga0070661_100581806 3300005344 Bacteria 903
38 Ga0070692_10017574 3300005345 Bacteria 3423
39 Ga0070692_10090842 3300005345 Bacteria 1660
40 Ga0070692_10134710 3300005345 Bacteria 1392
41 Ga0070668_100042153 3300005347 Bacteria 3498
42 Ga0070668_100470612 3300005347 Bacteria 1084
43 Ga0070669_100020911 3300005353 Bacteria 4675
44 Ga0070669_100359311 3300005353 Bacteria 1184
45 Ga0070669_100385917 3300005353 Bacteria 1143
46 Ga0070675_100001160 3300005354 Bacteria 19040
47 Ga0070675_100413797 3300005354 Bacteria 1205
48 Ga0070671_100235319 3300005355 Bacteria 1554
49 Ga0070671_100488975 3300005355 Bacteria 1058
50 Ga0070674_100031861 3300005356 Bacteria 3498
51 Ga0070674_100481091 3300005356 Bacteria 1030
52 Ga0070674_101162445 3300005356 Bacteria 684
53 Ga0070673_100871895 3300005364 Bacteria 834
54 Ga0070688_100000027 3300005365 Bacteria 67477
55 Ga0070688_100004986 3300005365 Bacteria 6947
56 Ga0070688_100257611 3300005365 Bacteria 1244
57 Ga0070659_100000037 3300005366 Bacteria 113379
58 Ga0070659_100002687 3300005366 Bacteria 12638
59 Ga0070659_100476154 3300005366 Bacteria 1062
60 Ga0070659_100757011 3300005366 Bacteria 843
61 Ga0070667_100042334 3300005367 Bacteria 3822
62 Ga0070667_100811593 3300005367 Bacteria 869
63 Ga0070709_10053487 3300005434 Bacteria 2542
64 Ga0070714_100000860 3300005435 Bacteria 21534
65 Ga0070714_100010038 3300005435 Bacteria 7470
66 Ga0070714_100021490 3300005435 Bacteria 5280
67 Ga0070714_100069618 3300005435 Bacteria 3040
68 Ga0070714_100104971 3300005435 Bacteria 2494
69 Ga0070714_100113289 3300005435 Bacteria 2405
70 Ga0070714_100837573 3300005435 Bacteria 892
71 Ga0070713_100324287 3300005436 Bacteria 1423
72 Ga0070710_10000050 3300005437 Bacteria 56781
73 Ga0070710_10097718 3300005437 Bacteria 1743
74 Ga0070710_10201511 3300005437 Bacteria 1257
75 Ga0070710_10423514 3300005437 Bacteria 897
76 Ga0070701_10192589 3300005438 Bacteria 1200
77 Ga0070711_100001237 3300005439 Bacteria 13806
78 Ga0070711_100289029 3300005439 Bacteria 1300
79 Ga0070705_100005024 3300005440 Bacteria 6435
80 Ga0070705_100950972 3300005440 Bacteria 694
81 Ga0070705_100995940 3300005440 Bacteria 680
82 Ga0070700_100013649 3300005441 Bacteria 4567
83 Ga0070700_100029613 3300005441 Bacteria 3266
84 Ga0070700_100034667 3300005441 Bacteria 3049
85 Ga0070700_100188362 3300005441 Bacteria 1441
86 Ga0070700_100307524 3300005441 Bacteria 1159
87 Ga0070694_100314453 3300005444 Bacteria 1203
88 Ga0070708_100428217 3300005445 Bacteria 1248
89 Ga0070663_100009051 3300005455 Bacteria 6152
90 Ga0070678_100025608 3300005456 Bacteria 3973
91 Ga0070678_100284954 3300005456 Bacteria 1398
92 Ga0070662_100001035 3300005457 Bacteria 16981
93 Ga0070662_100294176 3300005457 Bacteria 1317
94 Ga0070662_100441662 3300005457 Bacteria 1079
95 Ga0070681_10003066 3300005458 Bacteria 15497
96 Ga0070681_10303916 3300005458 Bacteria 1505
97 Ga0070685_10000665 3300005466 Bacteria 18706
98 Ga0070685_10000791 3300005466 Bacteria 17160
99 Ga0070685_10031977 3300005466 Bacteria 2944
100 Ga0070685_10284096 3300005466 Bacteria 1109
101 Ga0070685_10663639 3300005466 Bacteria 757
102 Ga0070698_100623824 3300005471 Bacteria 1019
103 Ga0070679_100035983 3300005530 Bacteria 4913
104 Ga0070679_100043251 3300005530 Bacteria 4487
105 Ga0070679_100070872 3300005530 Bacteria 3476
106 Ga0070679_100151311 3300005530 Bacteria 2297
107 Ga0070679_100436883 3300005530 Bacteria 1254
108 Ga0070684_100035155 3300005535 Bacteria 4288
109 Ga0070684_100035948 3300005535 Bacteria 4242
110 Ga0070684_100106959 3300005535 Bacteria 2505
111 Ga0070684_100216967 3300005535 Bacteria 1745
112 Ga0070697_100407681 3300005536 Bacteria 1180
113 Ga0070697_100509609 3300005536 Bacteria 1053
114 Ga0068853_100390091 3300005539 Bacteria 1302
115 Ga0070686_100224047 3300005544 Bacteria 1360
116 Ga0070686_100229411 3300005544 Bacteria 1346
117 Ga0070695_100191180 3300005545 Bacteria 1457
118 Ga0070696_100021133 3300005546 Bacteria 4413
119 Ga0070696_100407601 3300005546 Bacteria 1065
120 Ga0070665_100036567 3300005548 Bacteria 4939
121 Ga0070665_100075544 3300005548 Bacteria 3376
122 Ga0070665_100113050 3300005548 Bacteria 2718
123 Ga0070665_100485083 3300005548 Bacteria 1247
124 Ga0070665_100515985 3300005548 Bacteria 1207
125 Ga0070665_100600571 3300005548 Bacteria 1113
126 Ga0070704_100223325 3300005549 Bacteria 1533
127 Ga0068855_100452939 3300005563 Bacteria 1400
128 Ga0068855_100960053 3300005563 Bacteria 900
129 Ga0070664_100012431 3300005564 Bacteria 6919
130 Ga0070664_100076082 3300005564 Bacteria 2883
131 Ga0070664_100153674 3300005564 Bacteria 2033
132 Ga0068857_100276104 3300005577 Bacteria 1545
133 Ga0068857_100317982 3300005577 Bacteria 1437
134 Ga0068854_100000116 3300005578 Bacteria 54986
135 Ga0068854_100075637 3300005578 Bacteria 2473
136 Ga0068854_100131953 3300005578 Bacteria 1908
137 Ga0068854_100882361 3300005578 Bacteria 785
138 Ga0068856_100000336 3300005614 Bacteria 51580
139 Ga0068856_100002016 3300005614 Bacteria 21154
140 Ga0068856_100032534 3300005614 Bacteria 5106
141 Ga0068856_100114684 3300005614 Bacteria 2694
142 Ga0070702_100050153 3300005615 Bacteria 2383
143 Ga0068852_100805384 3300005616 Bacteria 954
144 Ga0068859_100050092 3300005617 Bacteria 4195
145 Ga0068859_100119046 3300005617 Bacteria 2707
146 Ga0068861_100008771 3300005719 Bacteria 6963
147 Ga0068861_100049050 3300005719 Bacteria 3195
148 Ga0068851_10007756 3300005834 Bacteria 4938
149 Ga0068851_10057798 3300005834 Bacteria 1981
150 Ga0068870_10031616 3300005840 Bacteria 2683
151 Ga0068863_100111984 3300005841 Bacteria 2599
152 Ga0068863_100324115 3300005841 Bacteria 1497
153 Ga0068858_100081388 3300005842 Bacteria 3010
154 Ga0068858_100211186 3300005842 Bacteria 1837
155 Ga0068862_100042359 3300005844 Bacteria 3878
156 Ga0081455_10043405 3300005937 Bacteria 3933
157 Ga0081455_10097642 3300005937 Bacteria 2366
158 Ga0081455_10325138 3300005937 Bacteria 1094
159 Ga0081538_10000044 3300005981 Bacteria 115394
160 Ga0081538_10000766 3300005981 Bacteria 35083
161 Ga0081538_10001436 3300005981 Bacteria 24497
162 Ga0081538_10002073 3300005981 Bacteria 19976
163 Ga0081538_10002254 3300005981 Bacteria 19094
164 Ga0081538_10003695 3300005981 Bacteria 14357
165 Ga0081538_10004173 3300005981 Bacteria 13410
166 Ga0081538_10006143 3300005981 Bacteria 10654
167 Ga0081538_10025048 3300005981 Bacteria 4226
168 Ga0081538_10042073 3300005981 Bacteria 2889
169 Ga0081538_10050518 3300005981 Bacteria 2510
170 Ga0081538_10066379 3300005981 Bacteria 2023
171 Ga0081538_10096064 3300005981 Bacteria 1511
172 Ga0081540_1002481 3300005983 Bacteria 15029
173 Ga0081540_1084827 3300005983 Bacteria 1412
174 Ga0081539_10011326 3300005985 Bacteria 7075
175 Ga0081539_10012198 3300005985 Bacteria 6669
176 Ga0070717_10000019 3300006028 Bacteria 178051
177 Ga0070717_10036330 3300006028 Bacteria 3995
178 Ga0075365_10320280 3300006038 Bacteria 1092
179 Ga0075363_100047743 3300006048 Bacteria 2275
180 Ga0075363_100210420 3300006048 Bacteria 1113
181 Ga0075432_10008412 3300006058 Bacteria 3519
182 Ga0070716_100333012 3300006173 Bacteria 1068
183 Ga0070712_100000004 3300006175 Bacteria 215464
184 Ga0070712_100024256 3300006175 Bacteria 4017
185 Ga0070712_100073145 3300006175 Bacteria 2458
186 Ga0070712_100167367 3300006175 Bacteria 1703
187 Ga0070712_100545950 3300006175 Bacteria 976
188 Ga0068871_100396671 3300006358 Bacteria 1228
189 Ga0075428_100172045 3300006844 Bacteria 2347
190 Ga0075428_100281113 3300006844 Bacteria 1791
191 Ga0075428_100407972 3300006844 Bacteria 1456
192 Ga0075428_100417523 3300006844 Bacteria 1437
193 Ga0075430_100001606 3300006846 Bacteria 18450
194 Ga0075430_100125867 3300006846 Bacteria 2136
195 Ga0075430_100159561 3300006846 Bacteria 1877
196 Ga0075430_100174316 3300006846 Bacteria 1789
197 Ga0075431_100014397 3300006847 Bacteria 7999
198 Ga0075431_100102356 3300006847 Bacteria 2956
199 Ga0075431_100244726 3300006847 Bacteria 1823
200 Ga0075433_10069242 3300006852 Bacteria 3099
201 Ga0075433_10224928 3300006852 Bacteria 1667
202 Ga0075433_10389984 3300006852 Bacteria 1229
203 Ga0075434_100074065 3300006871 Bacteria 3398
204 Ga0075434_100434120 3300006871 Bacteria 1334
205 Ga0075429_100031400 3300006880 Bacteria 4616
206 Ga0075429_100090493 3300006880 Bacteria 2669
207 Ga0075429_100260198 3300006880 Bacteria 1519
208 Ga0068865_100081249 3300006881 Bacteria 2327
209 Ga0068865_100490241 3300006881 Bacteria 1023
210 Ga0075436_100069538 3300006914 Bacteria 2433
211 Ga0097620_100050092 3300006931 Bacteria 4195
212 Ga0097620_100119045 3300006931 Bacteria 2707
213 Ga0075435_100012265 3300007076 Bacteria 6338
214 Ga0075435_100220646 3300007076 Bacteria 1610
215 Ga0105240_10206274 3300009093 Bacteria 2300
216 Ga0105240_10370303 3300009093 Bacteria 1620
217 Ga0105240_10596443 3300009093 Bacteria 1217
218 Ga0111539_10004783 3300009094 Bacteria 17670
219 Ga0111539_10012635 3300009094 Bacteria 10578
220 Ga0111539_10039470 3300009094 Bacteria 5689
221 Ga0111539_10050074 3300009094 Bacteria 4977
222 Ga0111539_10129885 3300009094 Bacteria 2951
223 Ga0111539_10641360 3300009094 Bacteria 1237
224 Ga0111539_10954648 3300009094 Bacteria 997
225 Ga0111539_11452804 3300009094 Bacteria 795
226 Ga0105245_10000141 3300009098 Bacteria 68413
227 Ga0105245_10002406 3300009098 Bacteria 16922
228 Ga0105245_10003314 3300009098 Bacteria 14460
229 Ga0105245_10014806 3300009098 Bacteria 6793
230 Ga0105245_10015314 3300009098 Bacteria 6683
231 Ga0105245_10066571 3300009098 Bacteria 3261
232 Ga0105245_10358819 3300009098 Bacteria 1446
233 Ga0105245_10588679 3300009098 Bacteria 1138
234 Ga0105245_10688910 3300009098 Bacteria 1054
235 Ga0105245_10971783 3300009098 Bacteria 893
236 Ga0105247_10047392 3300009101 Bacteria 2638
237 Ga0105247_10625075 3300009101 Bacteria 801
238 Ga0114129_10019151 3300009147 Bacteria 9749
239 Ga0114129_10059944 3300009147 Bacteria 5322
240 Ga0114129_10183598 3300009147 Bacteria 2845
241 Ga0114129_10195494 3300009147 Bacteria 2743
242 Ga0114129_10315827 3300009147 Bacteria 2078
243 Ga0114129_11136682 3300009147 Bacteria 976
244 Ga0114129_12314265 3300009147 Bacteria 645
245 Ga0105243_10011687 3300009148 Bacteria 6640
246 Ga0105243_10012300 3300009148 Bacteria 6473
247 Ga0105243_10079736 3300009148 Bacteria 2669
248 Ga0105243_10576404 3300009148 Bacteria 1079
249 Ga0105243_10795080 3300009148 Bacteria 932
250 Ga0105243_11187265 3300009148 Bacteria 776
251 Ga0105242_10103250 3300009176 Bacteria 2418
252 Ga0105242_10358859 3300009176 Bacteria 1348
253 Ga0105242_10409502 3300009176 Bacteria 1268
254 Ga0105242_11390958 3300009176 Bacteria 729
255 Ga0105248_10000020 3300009177 Bacteria 284637
256 Ga0105248_10141614 3300009177 Bacteria 2713
257 Ga0105248_10312768 3300009177 Bacteria 1769
258 Ga0105237_10009091 3300009545 Bacteria 10677
259 Ga0105237_10207990 3300009545 Bacteria 1957
260 Ga0105237_10338998 3300009545 Bacteria 1508
261 Ga0105237_10486205 3300009545 Bacteria 1241
262 Ga0105238_10032231 3300009551 Bacteria 5333
263 Ga0105249_10018376 3300009553 Bacteria 6217
264 Ga0105249_10332398 3300009553 Bacteria 1534
265 Ga0105239_10019100 3300010375 Bacteria 7575
266 Ga0105239_10164107 3300010375 Bacteria 2483
267 Ga0105239_10217741 3300010375 Bacteria 2141
268 Ga0105239_10315601 3300010375 Bacteria 1762
269 Ga0105239_10685949 3300010375 Bacteria 1171
270 Ga0105239_11017158 3300010375 Bacteria 953
271 Ga0105246_10236010 3300011119 Bacteria 1443
272 Ga0157371_10011110 3300013102 Bacteria 6970
273 Ga0157371_10230312 3300013102 Bacteria 1331
274 Ga0157370_10013982 3300013104 Bacteria 8242
275 Ga0157370_10327615 3300013104 Bacteria 1412
276 Ga0157369_10004884 3300013105 Bacteria 15723
277 Ga0157369_10203624 3300013105 Bacteria 2077
278 Ga0157369_10390815 3300013105 Bacteria 1443
279 Ga0157369_10677369 3300013105 Bacteria 1063
280 Ga0157369_11298606 3300013105 Bacteria 742
281 Ga0157374_10470627 3300013296 Bacteria 1259
282 Ga0157374_10585624 3300013296 Bacteria 1125
283 Ga0163162_10027306 3300013306 Bacteria 5644
284 Ga0163162_10137792 3300013306 Bacteria 2552
285 Ga0163162_10603452 3300013306 Bacteria 1224
286 Ga0157372_10006642 3300013307 Bacteria 12311
287 Ga0157372_10023168 3300013307 Bacteria 6729
288 Ga0157372_10183403 3300013307 Bacteria 2423
289 Ga0157372_10411817 3300013307 Bacteria 1575
290 Ga0157375_10085478 3300013308 Bacteria 3204
291 Ga0157375_10673008 3300013308 Bacteria 1190
292 Ga0157375_11016385 3300013308 Bacteria 968
293 Ga0157375_11683226 3300013308 Bacteria 751
294 Ga0163163_10314158 3300014325 Bacteria 1620
295 Ga0163163_10484790 3300014325 Bacteria 1298
296 Ga0163163_11856857 3300014325 Bacteria 663
297 Ga0157380_10006499 3300014326 Bacteria 8241
298 Ga0157380_11273185 3300014326 Bacteria 782
299 Ga0182008_10245237 3300014497 Bacteria 923
300 Ga0157377_10011697 3300014745 Bacteria 4388
301 Ga0157377_10086770 3300014745 Bacteria 1840
302 Ga0157379_10148164 3300014968 Bacteria 2117
303 Ga0157379_10497759 3300014968 Bacteria 1129
304 Ga0157376_10028909 3300014969 Bacteria 4412
305 Ga0157376_10928289 3300014969 Bacteria 890
306 Ga0163161_10085718 3300017792 Bacteria 2323
307 Ga0206354_10513831 3300020081 Bacteria 1601
308 Ga0206353_10159166 3300020082 Bacteria 1368
309 Ga0206353_10352119 3300020082 Bacteria 950
310 Ga0206353_11218525 3300020082 Bacteria 1211
311 Ga0213873_10054893 3300021358 Bacteria 1064
312 Ga0213875_10032735 3300021388 Bacteria 2456
313 Ga0224712_10103572 3300022467 Bacteria 1211
314 Ga0207426_1013197 3300025302 Bacteria 3070
315 Ga0207656_10039832 3300025321 Bacteria 1990
316 Ga0207656_10193740 3300025321 Bacteria 979
317 Ga0207692_10000022 3300025898 Bacteria 56680
318 Ga0207692_10041897 3300025898 Bacteria 2270
319 Ga0207692_10152908 3300025898 Bacteria 1323
320 Ga0207688_10000813 3300025901 Bacteria 15626
321 Ga0207688_10034319 3300025901 Bacteria 2809
322 Ga0207688_10039540 3300025901 Bacteria 2619
323 Ga0207688_10063504 3300025901 Bacteria 2083
324 Ga0207688_10064925 3300025901 Bacteria 2062
325 Ga0207688_10198878 3300025901 Bacteria 1201
326 Ga0207680_10323462 3300025903 Bacteria 1079
327 Ga0207699_10056789 3300025906 Bacteria 2335
328 Ga0207645_10074921 3300025907 Bacteria 2167
329 Ga0207643_10575587 3300025908 Bacteria 724
330 Ga0207707_10148415 3300025912 Bacteria 2050
331 Ga0207695_10139811 3300025913 Bacteria 2371
332 Ga0207695_10180841 3300025913 Bacteria 2029
333 Ga0207695_10513266 3300025913 Bacteria 1080
334 Ga0207695_10551251 3300025913 Bacteria 1034
335 Ga0207695_10657218 3300025913 Bacteria 929
336 Ga0207671_10001526 3300025914 Bacteria 26567
337 Ga0207693_10000017 3300025915 Bacteria 139308
338 Ga0207693_10004599 3300025915 Bacteria 11642
339 Ga0207693_10008005 3300025915 Bacteria 8678
340 Ga0207693_10049193 3300025915 Bacteria 3311
341 Ga0207693_10710466 3300025915 Bacteria 778
342 Ga0207663_10002190 3300025916 Bacteria 9339
343 Ga0207663_10055324 3300025916 Bacteria 2489
344 Ga0207663_10058625 3300025916 Bacteria 2431
345 Ga0207663_10309526 3300025916 Bacteria 1183
346 Ga0207660_10006020 3300025917 Bacteria 7873
347 Ga0207662_10077621 3300025918 Bacteria 2020
348 Ga0207657_10006359 3300025919 Bacteria 12271
349 Ga0207657_10057000 3300025919 Bacteria 3369
350 Ga0207657_10417286 3300025919 Bacteria 1055
351 Ga0207649_10176847 3300025920 Bacteria 1491
352 Ga0207649_10327925 3300025920 Bacteria 1127
353 Ga0207652_10008802 3300025921 Bacteria 8129
354 Ga0207652_10094266 3300025921 Bacteria 2636
355 Ga0207652_10095849 3300025921 Bacteria 2614
356 Ga0207652_10127154 3300025921 Bacteria 2270
357 Ga0207652_10812437 3300025921 Bacteria 830
358 Ga0207681_10016814 3300025923 Bacteria 4585
359 Ga0207681_10152625 3300025923 Bacteria 1733
360 Ga0207694_10247360 3300025924 Bacteria 1458
361 Ga0207650_10698466 3300025925 Bacteria 857
362 Ga0207659_10000553 3300025926 Bacteria 22395
363 Ga0207659_10035380 3300025926 Bacteria 3452
364 Ga0207659_10372296 3300025926 Bacteria 1189
365 Ga0207687_10000036 3300025927 Bacteria 121934
366 Ga0207687_10002476 3300025927 Bacteria 12542
367 Ga0207687_10039782 3300025927 Bacteria 3220
368 Ga0207687_10324237 3300025927 Bacteria 1248
369 Ga0207687_10547004 3300025927 Bacteria 971
370 Ga0207700_10371009 3300025928 Bacteria 1250
371 Ga0207700_10462839 3300025928 Bacteria 1119
372 Ga0207664_10000004 3300025929 Bacteria 493014
373 Ga0207664_10002049 3300025929 Bacteria 13273
374 Ga0207664_10082008 3300025929 Bacteria 2626
375 Ga0207664_10382024 3300025929 Bacteria 1250
376 Ga0207644_10041237 3300025931 Bacteria 3265
377 Ga0207644_10359468 3300025931 Bacteria 1184
378 Ga0207690_10000268 3300025932 Bacteria 37289
379 Ga0207690_10098395 3300025932 Bacteria 2084
380 Ga0207690_10141496 3300025932 Bacteria 1773
381 Ga0207690_10151916 3300025932 Bacteria 1717
382 Ga0207706_10003294 3300025933 Bacteria 15460
383 Ga0207706_10401597 3300025933 Bacteria 1188
384 Ga0207686_10093501 3300025934 Bacteria 1991
385 Ga0207686_10237332 3300025934 Bacteria 1325
386 Ga0207669_10164059 3300025937 Bacteria 1573
387 Ga0207669_10204345 3300025937 Bacteria 1437
388 Ga0207669_10315406 3300025937 Bacteria 1194
389 Ga0207669_10317918 3300025937 Bacteria 1190
390 Ga0207669_10520656 3300025937 Bacteria 955
391 Ga0207704_10034396 3300025938 Bacteria 2891
392 Ga0207704_10242885 3300025938 Bacteria 1347
393 Ga0207691_10078503 3300025940 Bacteria 2972
394 Ga0207711_10000006 3300025941 Bacteria 792692
395 Ga0207711_10210392 3300025941 Bacteria 1776
396 Ga0207689_10041401 3300025942 Bacteria 3811
397 Ga0207689_10254294 3300025942 Bacteria 1453
398 Ga0207661_10000312 3300025944 Bacteria 30978
399 Ga0207661_10028815 3300025944 Bacteria 4257
400 Ga0207661_10131491 3300025944 Bacteria 2144
401 Ga0207661_10248948 3300025944 Bacteria 1579
402 Ga0207661_10915826 3300025944 Bacteria 807
403 Ga0207679_10023802 3300025945 Bacteria 4193
404 Ga0207679_10074750 3300025945 Bacteria 2568
405 Ga0207679_10120470 3300025945 Bacteria 2088
406 Ga0207651_10687143 3300025960 Bacteria 901
407 Ga0207712_10008255 3300025961 Bacteria 6582
408 Ga0207712_10157106 3300025961 Bacteria 1763
409 Ga0207668_10012672 3300025972 Bacteria 5169
410 Ga0207668_10089592 3300025972 Bacteria 2256
411 Ga0207668_10454504 3300025972 Bacteria 1094
412 Ga0207640_10000134 3300025981 Bacteria 54961
413 Ga0207640_10102975 3300025981 Bacteria 2006
414 Ga0207640_10460067 3300025981 Bacteria 1051
415 Ga0207658_10029416 3300025986 Bacteria 3880
416 Ga0207677_10000374 3300026023 Bacteria 31092
417 Ga0207677_10138916 3300026023 Bacteria 1857
418 Ga0207677_10180365 3300026023 Bacteria 1660
419 Ga0207677_10240977 3300026023 Bacteria 1463
420 Ga0207677_10369646 3300026023 Bacteria 1207
421 Ga0207677_10756946 3300026023 Bacteria 866
422 Ga0207639_10079844 3300026041 Bacteria 2586
423 Ga0207678_10009806 3300026067 Bacteria 8420
424 Ga0207678_10058133 3300026067 Bacteria 3327
425 Ga0207678_10219814 3300026067 Bacteria 1626
426 Ga0207708_10000937 3300026075 Bacteria 21842
427 Ga0207708_10005784 3300026075 Bacteria 9140
428 Ga0207708_10011942 3300026075 Bacteria 6469
429 Ga0207708_10018439 3300026075 Bacteria 5256
430 Ga0207708_10035246 3300026075 Bacteria 3808
431 Ga0207702_10000368 3300026078 Bacteria 51559
432 Ga0207702_10025200 3300026078 Bacteria 4936
433 Ga0207702_10144487 3300026078 Bacteria 2157
434 Ga0207702_11075611 3300026078 Bacteria 798
435 Ga0207641_10054928 3300026088 Bacteria 3382
436 Ga0207641_10505971 3300026088 Bacteria 1174
437 Ga0207648_10204819 3300026089 Bacteria 1751
438 Ga0207648_10302058 3300026089 Bacteria 1436
439 Ga0207648_10385306 3300026089 Bacteria 1268
440 Ga0207676_10062035 3300026095 Bacteria 2963
441 Ga0207676_10566343 3300026095 Bacteria 1087
442 Ga0207674_10141397 3300026116 Bacteria 2366
443 Ga0207674_10152988 3300026116 Bacteria 2263
444 Ga0207674_10349889 3300026116 Bacteria 1429
445 Ga0207675_100004816 3300026118 Bacteria 12997
446 Ga0207675_100033107 3300026118 Bacteria 4816
447 Ga0207675_100101877 3300026118 Bacteria 2705
448 Ga0207675_100657539 3300026118 Bacteria 1054
449 Ga0207675_100733035 3300026118 Bacteria 999
450 Ga0207683_10084011 3300026121 Bacteria 2830
451 Ga0207683_11173117 3300026121 Bacteria 712
452 Ga0207698_10086179 3300026142 Bacteria 2553
453 Ga0207698_10243788 3300026142 Bacteria 1640
454 Ga0207428_10055052 3300027907 Bacteria 3165
455 Ga0207428_10201634 3300027907 Bacteria 1497
456 Ga0207428_10273695 3300027907 Bacteria 1255
457 Ga0268266_10010879 3300028379 Bacteria 7925
458 Ga0268266_10063353 3300028379 Bacteria 3192
459 Ga0268266_10365342 3300028379 Bacteria 1359
460 Ga0268266_10366927 3300028379 Bacteria 1355
461 Ga0268264_10563193 3300028381 Bacteria 1119
462 Ga0265337_1012291 3300028556 Bacteria 2916
463 Ga0265337_1079678 3300028556 Bacteria 897
464 Ga0265326_10000630 3300028558 Bacteria 13168
465 Ga0265326_10000833 3300028558 Bacteria 11353
466 Ga0265319_1000353 3300028563 Bacteria 33333
467 Ga0265319_1001381 3300028563 Bacteria 14593
468 Ga0265319_1009072 3300028563 Bacteria 4285
469 Ga0265334_10000002 3300028573 Bacteria 325014
470 Ga0265318_10001586 3300028577 Bacteria 13166
471 Ga0265318_10005786 3300028577 Bacteria 5769
472 Ga0265318_10047329 3300028577 Bacteria 1622
473 Ga0265318_10075213 3300028577 Bacteria 1250
474 Ga0265323_10120796 3300028653 Bacteria 854
475 Ga0265336_10000005 3300028666 Bacteria 399349
476 Ga0265336_10002183 3300028666 Bacteria 8258
477 Ga0265338_10000001 3300028800 Bacteria 1177449
478 Ga0265338_10024856 3300028800 Bacteria 6104
479 Ga0265338_10147335 3300028800 Bacteria 1834
480 Ga0265338_10386672 3300028800 Bacteria 1000
481 Ga0265320_10008105 3300031240 Bacteria 6458
482 Ga0265320_10047466 3300031240 Bacteria 2100
483 Ga0265325_10085887 3300031241 Bacteria 1558
484 Ga0265340_10000001 3300031247 Bacteria 1647668
485 Ga0265327_10121611 3300031251 Bacteria 1236
486 Ga0265327_10211865 3300031251 Bacteria 874
487 Ga0265316_10129048 3300031344 Bacteria 1905
488 Ga0307408_100149363 3300031548 Bacteria 1843
489 Ga0307408_100270750 3300031548 Bacteria 1410
490 Ga0307408_100272361 3300031548 Bacteria 1406
491 Ga0307408_100614185 3300031548 Bacteria 968
492 Ga0265314_10273943 3300031711 Bacteria 958
493 Ga0307405_10047556 3300031731 Bacteria 2642
494 Ga0307405_10071547 3300031731 Bacteria 2232
495 Ga0307405_10158330 3300031731 Bacteria 1601
496 Ga0307413_10067704 3300031824 Bacteria 2234
497 Ga0307413_10084903 3300031824 Bacteria 2042
498 Ga0307413_10961614 3300031824 Bacteria 729
499 Ga0307410_10020116 3300031852 Bacteria 4076
500 Ga0307410_10035996 3300031852 Bacteria 3220
501 Ga0307410_10050510 3300031852 Bacteria 2797
502 Ga0307410_10853731 3300031852 Bacteria 777
503 Ga0307410_10983725 3300031852 Bacteria 727
504 Ga0326468_10011767 3300031889 Bacteria 909
505 Ga0307406_10027100 3300031901 Bacteria 3449
506 Ga0307406_10131462 3300031901 Bacteria 1758
507 Ga0307407_10098143 3300031903 Bacteria 1812
508 Ga0307407_10358508 3300031903 Bacteria 1035
509 Ga0307412_10131209 3300031911 Bacteria 1820
510 Ga0307412_11013148 3300031911 Bacteria 734
511 Ga0307409_100011229 3300031995 Bacteria 5631
512 Ga0307409_100017566 3300031995 Bacteria 4774
513 Ga0307409_100056097 3300031995 Bacteria 3045
514 Ga0307409_100066444 3300031995 Bacteria 2844
515 Ga0307409_100091978 3300031995 Bacteria 2488
516 Ga0307409_100182248 3300031995 Bacteria 1860
517 Ga0307409_100357287 3300031995 Bacteria 1381
518 Ga0307416_100028146 3300032002 Bacteria 4175
519 Ga0307416_100060399 3300032002 Bacteria 3087
520 Ga0307416_100240649 3300032002 Bacteria 1753
521 Ga0307416_100309296 3300032002 Bacteria 1576
522 Ga0307416_100348654 3300032002 Bacteria 1497
523 Ga0307416_100379049 3300032002 Bacteria 1444
524 Ga0307416_100401692 3300032002 Bacteria 1408
525 Ga0307416_100982852 3300032002 Bacteria 947
526 Ga0307416_101021688 3300032002 Bacteria 930
527 Ga0307416_101285132 3300032002 Bacteria 838
528 Ga0307416_101719263 3300032002 Bacteria 732
529 Ga0307414_10100122 3300032004 Bacteria 2179
530 Ga0307411_10114352 3300032005 Bacteria 1939
531 Ga0307411_10445148 3300032005 Bacteria 1082
532 Ga0307411_10977401 3300032005 Bacteria 757
533 Ga0307415_100003017 3300032126 Bacteria 8473
534 Ga0307415_100069572 3300032126 Bacteria 2469
535 Ga0307415_100132044 3300032126 Bacteria 1892
536 Ga0307415_100133214 3300032126 Bacteria 1885
537 Ga0307415_100218137 3300032126 Bacteria 1527
538 Ga0307415_100318338 3300032126 Bacteria 1296
539 Ga0307415_100363516 3300032126 Bacteria 1223
540 Ga0307415_100514303 3300032126 Bacteria 1049
541 Ga0307415_100794725 3300032126 Bacteria 863
542 Ga0373944_0113250 3300035089 Bacteria 928
543 Ga0373960_0042544 3300035121 Bacteria 1319
544 Ga0373943_0051887 3300035170 Bacteria 2021
545 Ga0373946_0274255 3300035171 Bacteria 828
546 Ga0373955_0624287 3300035172 Bacteria 660
547 Ga0373961_0085827 3300035241 Bacteria 998
548 Ga0373931_0030150 3300035691 Bacteria 2791
549 Ga0373931_0187096 3300035691 Bacteria 1230
550 Ga0373927_0173552 3300035695 Bacteria 1414
551 Ga0373947_0138010 3300035725 Bacteria 1562
552 Ga0373925_0517403 3300037068 Bacteria 980
553 Ga0395899_0204295 3300037312 Bacteria 1376
554 Ga0395900_0717592 3300037418 Bacteria 932
555 Ga0395900_0736322 3300037418 Bacteria 917
556 Ga0395900_1120423 3300037418 Bacteria 704
557 Ga0395898_0047298 3300037466 Bacteria 4223
558 Ga0395898_0181894 3300037466 Bacteria 2009
559 Ga0395898_0384537 3300037466 Bacteria 1338
560 Ga0395898_0421362 3300037466 Bacteria 1272
561 Ga0395898_0445794 3300037466 Bacteria 1233
562 Ga0395905_0441897 3300037471 Bacteria 1198
563 Ga0395905_0492484 3300037471 Bacteria 1126
564 Ga0436364_0069355 3300037853 Bacteria 825
565 Ga0436364_0637349 3300037853 Bacteria 2787
566 Ga0395901_0009771 3300038443 Bacteria 9729
567 Ga0395901_0026246 3300038443 Bacteria 5980
568 Ga0395901_0096926 3300038443 Bacteria 3091
569 Ga0395901_0172676 3300038443 Bacteria 2268
570 Ga0395901_0285448 3300038443 Bacteria 1714
571 Ga0395901_0946536 3300038443 Bacteria 840
572 Ga0395901_0988665 3300038443 Bacteria 818
573 Ga0436365_0367556 3300039437 Bacteria 5407
574 Ga0436365_0869569 3300039437 Bacteria 690
575 Ga0436365_1517862 3300039437 Bacteria 5102
576 Ga0436363_0311232 3300039450 Bacteria 675
577 Ga0436363_1637204 3300039450 Bacteria 1004
578 Ga0436362_0383083 3300039453 Bacteria 1374
579 Ga0436362_0577753 3300039453 Bacteria 820
580 Ga0451853_0704132 3300041512 Bacteria 1834
581 Ga0466969_0030135 3300044656 Bacteria 2766
582 Ga0466965_0101923 3300044683 Bacteria 1469
583 Ga0466965_0641259 3300044683 Bacteria 606
584 Ga0466966_0014445 3300044684 Bacteria 5228
585 Ga0466966_0040633 3300044684 Bacteria 2993
586 Ga0466966_0074139 3300044684 Bacteria 2128
587 Ga0466966_0378420 3300044684 Bacteria 851
588 Ga0466961_0004147 3300044693 Bacteria 9049
589 Ga0466961_0103773 3300044693 Bacteria 1790
590 Ga0466961_0342961 3300044693 Bacteria 910
591 Ga0466963_0016615 3300044694 Bacteria 4578
592 Ga0466963_0251045 3300044694 Bacteria 1241
593 Ga0466963_0565513 3300044694 Bacteria 803
594 Ga0466963_0627894 3300044694 Bacteria 758
595 Ga0466963_0854409 3300044694 Bacteria 642
596 Ga0466964_0091450 3300044706 Bacteria 1325
597 Ga0466964_0214286 3300044706 Bacteria 932
598 Ga0466971_0169199 3300044719 Bacteria 1025
599 Ga0466968_0023973 3300044735 Bacteria 2491
600 Ga0466968_0030132 3300044735 Bacteria 2247
601 Ga0466970_0186309 3300044765 Bacteria 1152
602 Ga0466970_0198559 3300044765 Bacteria 1116
603 Ga0466957_0005022 3300044842 Bacteria 7408
604 Ga0466957_0196176 3300044842 Bacteria 1324
605 Ga0466957_0198208 3300044842 Bacteria 1318
606 Ga0466957_0498444 3300044842 Bacteria 844
607 Ga0466957_0539345 3300044842 Bacteria 812
608 Ga0466957_0561600 3300044842 Bacteria 796
609 Ga0466960_0025275 3300044901 Bacteria 2686
610 Ga0466960_0079028 3300044901 Bacteria 1653
611 Ga0466960_0173092 3300044901 Bacteria 1166
612 Ga0466960_0245859 3300044901 Bacteria 992
613 Ga0466960_0278035 3300044901 Bacteria 937
614 Ga0466959_0025843 3300045049 Bacteria 4354
615 Ga0466959_0029413 3300045049 Bacteria 4070
616 Ga0466959_0189196 3300045049 Bacteria 1437
617 Ga0466958_0008664 3300045836 Bacteria 5648
618 Ga0466958_0036525 3300045836 Bacteria 2941
619 Ga0466958_0052338 3300045836 Bacteria 2475
620 Ga0466958_0137732 3300045836 Bacteria 1536
621 Ga0466967_0005031 3300045976 Bacteria 9059
622 Ga0466967_0023219 3300045976 Bacteria 5079
623 Ga0466967_0027316 3300045976 Bacteria 4746
624 Ga0466967_0132475 3300045976 Bacteria 2315
625 Ga0466967_0215269 3300045976 Bacteria 1823
626 Ga0466967_0225689 3300045976 Bacteria 1782
627 Ga0466967_0251445 3300045976 Bacteria 1688
628 Ga0466967_0297834 3300045976 Bacteria 1551
629 Ga0466967_0494918 3300045976 Bacteria 1199
630 Ga0466967_0523551 3300045976 Bacteria 1165
631 Ga0466967_0572986 3300045976 Bacteria 1112
632 Ga0495603_0144193 3300046455 Bacteria 1385
633 Ga0495603_0406041 3300046455 Bacteria 781
634 Ga0495629_0007258 3300046459 Bacteria 8163
635 Ga0495629_0105003 3300046459 Bacteria 1970
636 Ga0495629_0411793 3300046459 Bacteria 918
637 Ga0495641_0010982 3300046461 Bacteria 5199
638 Ga0495653_0000179 3300046463 Bacteria 52301
639 Ga0495580_0336198 3300046472 Bacteria 1025
640 Ga0495582_0257222 3300046473 Bacteria 1002
641 Ga0495605_0142622 3300046474 Bacteria 1074
642 Ga0495664_0000012 3300046477 Bacteria 226118
643 Ga0495664_0288244 3300046477 Bacteria 992
644 Ga0495594_0000011 3300046499 Bacteria 118444
645 Ga0495606_0000586 3300046507 Bacteria 57795
646 Ga0495618_0000352 3300046514 Bacteria 32977
647 Ga0495628_0370922 3300046516 Bacteria 1050
648 Ga0495630_0000075 3300046517 Bacteria 77378
649 Ga0495630_0011902 3300046517 Bacteria 6307
650 Ga0495644_0123461 3300046523 Bacteria 986
651 Ga0495644_0150753 3300046523 Bacteria 890
652 Ga0495652_0053133 3300046529 Bacteria 3454
653 Ga0495586_0261191 3300046535 Bacteria 989
654 Ga0495586_0307438 3300046535 Bacteria 909
655 Ga0495597_0126169 3300046542 Bacteria 1064
656 Ga0495645_0000012 3300046543 Bacteria 209044
657 Ga0495667_0348810 3300046559 Bacteria 935
658 Ga0495656_0194779 3300046615 Bacteria 1003
659 Ga0495657_0000007 3300046675 Bacteria 222471
660 Ga0495599_0465602 3300046678 Bacteria 747
661 Ga0495647_0000419 3300046681 Bacteria 12163
662 Ga0495624_0000027 3300046690 Bacteria 93611
663 Ga0495600_0028472 3300046809 Bacteria 3615
664 Ga0495660_0055941 3300046810 Bacteria 2134
665 Ga0495674_0207925 3300047319 Bacteria 1622
666 Ga0495672_0054488 3300047320 Bacteria 2337
667 Ga0495676_0019702 3300047321 Bacteria 5930
668 Ga0495676_0227660 3300047321 Bacteria 1282
669 Ga0495680_0055337 3300047322 Bacteria 3078
670 Ga0495677_0134406 3300047445 Bacteria 948
671 Ga0495684_0002969 3300047471 Bacteria 13357
672 Ga0495684_0036602 3300047471 Bacteria 3762
673 Ga0495593_0018850 3300047673 Bacteria 3873
674 Ga0495593_0118145 3300047673 Bacteria 1351
675 Ga0496100_0000001 3300048903 Bacteria 530179
676 Ga0496100_0005518 3300048903 Bacteria 6825
677 Ga0496100_0005686 3300048903 Bacteria 6744
678 Ga0496100_0011761 3300048903 Bacteria 4992
679 Ga0496100_0061411 3300048903 Bacteria 2477
680 Ga0496100_0375744 3300048903 Bacteria 1078
681 Ga0496100_0669049 3300048903 Bacteria 809
682 Ga0496100_0695007 3300048903 Bacteria 794
683 Ga0496101_0000004 3300048904 Bacteria 331599
684 Ga0496101_0005308 3300048904 Bacteria 8206
685 Ga0496101_0011694 3300048904 Bacteria 5832
686 Ga0496101_0243794 3300048904 Bacteria 1399
687 Ga0496102_0000027 3300048905 Bacteria 225466
688 Ga0496102_0001758 3300048905 Bacteria 18871
689 Ga0496102_0012087 3300048905 Bacteria 7460
690 Ga0496102_0076150 3300048905 Bacteria 3085
691 Ga0496102_0081859 3300048905 Bacteria 2977
692 Ga0496102_0138760 3300048905 Bacteria 2279
693 Ga0496103_0001348 3300048906 Bacteria 16570
694 Ga0496103_0007177 3300048906 Bacteria 6644
695 Ga0496103_0009119 3300048906 Bacteria 5875
696 Ga0496103_0086878 3300048906 Bacteria 1971
697 Ga0496104_0000026 3300048907 Bacteria 210098
698 Ga0496104_0003438 3300048907 Bacteria 13654
699 Ga0496104_0015713 3300048907 Bacteria 6866
700 Ga0496104_0065216 3300048907 Bacteria 3455
701 Ga0496104_0194632 3300048907 Bacteria 1940
702 Ga0496104_0450871 3300048907 Bacteria 1198
703 Ga0496104_0877699 3300048907 Bacteria 802
704 Ga0496105_0023481 3300048908 Bacteria 5002
705 Ga0496105_0092970 3300048908 Bacteria 2490
706 Ga0496105_0170169 3300048908 Bacteria 1786
707 Ga0496105_0348997 3300048908 Bacteria 1182
708 Ga0496105_0463918 3300048908 Bacteria 998
709 Ga0496106_0000414 3300048909 Bacteria 30298
710 Ga0496106_0029323 3300048909 Bacteria 4101
711 Ga0496106_0029356 3300048909 Bacteria 4097
712 Ga0496106_0044920 3300048909 Bacteria 3317
713 Ga0496106_0062139 3300048909 Bacteria 2835
714 Ga0496106_0065354 3300048909 Bacteria 2770
715 Ga0496107_0000005 3300048910 Bacteria 281747
716 Ga0496107_0008283 3300048910 Bacteria 7191
717 Ga0496107_0009275 3300048910 Bacteria 6822
718 Ga0496107_0239060 3300048910 Bacteria 1351
719 Ga0496107_0569221 3300048910 Unclassified 838
720 Ga0496107_0608924 3300048910 Bacteria 807
721 Ga0496108_0006662 3300048911 Bacteria 9355
722 Ga0496108_0042757 3300048911 Bacteria 3783
723 Ga0496108_0161303 3300048911 Bacteria 1938
724 Ga0496108_0429061 3300048911 Bacteria 1154
725 Ga0496108_1187811 3300048911 Unclassified 645
726 Ga0496109_0023996 3300048912 Bacteria 5417
727 Ga0496109_0111247 3300048912 Bacteria 2547
728 Ga0496109_0122434 3300048912 Bacteria 2424
729 Ga0496109_0187399 3300048912 Bacteria 1944
730 Ga0496109_0373958 3300048912 Bacteria 1346
731 Ga0496109_0451959 3300048912 Bacteria 1213
732 Ga0496109_0594754 3300048912 Bacteria 1042
733 Ga0496110_0000242 3300048913 Bacteria 35454
734 Ga0496110_0000716 3300048913 Bacteria 22903
735 Ga0496110_0003019 3300048913 Bacteria 12771
736 Ga0496110_0062723 3300048913 Bacteria 3283
737 Ga0496110_0113433 3300048913 Bacteria 2438
738 Ga0496110_0502409 3300048913 Bacteria 1104
739 Ga0496110_0808958 3300048913 Bacteria 842
740 Ga0496110_0954202 3300048913 Bacteria 764
741 Ga0496111_0000366 3300048914 Bacteria 22446
742 Ga0496111_0001332 3300048914 Bacteria 13911
743 Ga0496111_0004875 3300048914 Bacteria 8519
744 Ga0496111_0011253 3300048914 Bacteria 6023
745 Ga0496111_0032700 3300048914 Bacteria 3709
746 Ga0496111_0066011 3300048914 Bacteria 2627
747 Ga0496111_0284439 3300048914 Unclassified 1227
748 Ga0496111_0310200 3300048914 Bacteria 1169
749 Ga0496112_0000200 3300048915 Bacteria 39289
750 Ga0496112_0007945 3300048915 Bacteria 9459
751 Ga0496112_0025245 3300048915 Bacteria 5704
752 Ga0496112_0045162 3300048915 Bacteria 4318
753 Ga0496112_0124638 3300048915 Bacteria 2547
754 Ga0496112_0180021 3300048915 Bacteria 2078
755 Ga0496112_0511496 3300048915 Bacteria 1136
756 Ga0496112_0554970 3300048915 Bacteria 1082
757 Ga0496112_0617699 3300048915 Bacteria 1015
758 Ga0496112_0821146 3300048915 Bacteria 854
759 Ga0496113_0000027 3300048916 Bacteria 63463
760 Ga0496113_0009548 3300048916 Bacteria 6363
761 Ga0496113_0090241 3300048916 Bacteria 2360
762 Ga0496113_0118977 3300048916 Bacteria 2063
763 Ga0496114_0181378 3300048917 Bacteria 1839
764 Ga0496114_0467708 3300048917 Bacteria 1116
765 Ga0496114_0640806 3300048917 Bacteria 935
766 Ga0496114_0733901 3300048917 Bacteria 864
767 Ga0496115_0000143 3300048918 Bacteria 65909
768 Ga0496115_0055013 3300048918 Bacteria 3196
769 Ga0496115_0411658 3300048918 Bacteria 1096
770 Ga0496115_0468815 3300048918 Bacteria 1015
771 Ga0496116_0000176 3300048919 Bacteria 128426
772 Ga0496117_0012250 3300048920 Bacteria 7582
773 Ga0496118_0005822 3300048921 Bacteria 13815
774 Ga0496118_0189826 3300048921 Bacteria 1230
775 Ga0496119_0022041 3300048922 Bacteria 4578
776 Ga0496119_0045653 3300048922 Bacteria 2744
777 Ga0496120_0008785 3300048923 Bacteria 7261
778 Ga0496121_0128403 3300048924 Bacteria 1902
779 Ga0496121_0193951 3300048924 Bacteria 1454
780 Ga0496124_0017107 3300048927 Bacteria 6855
781 Ga0496126_0373062 3300048929 Bacteria 1163
782 Ga0501291_059373 3300049514 Bacteria 716
783 Ga0501031_0004602 3300049568 Bacteria 8945
784 Ga0501031_0012782 3300049568 Bacteria 5486
785 Ga0501031_0019873 3300049568 Bacteria 4378
786 Ga0501031_0087685 3300049568 Bacteria 2029
787 Ga0501032_0002323 3300049569 Bacteria 14908
788 Ga0501032_0005183 3300049569 Bacteria 9712
789 Ga0501033_0001255 3300049570 Bacteria 22735
790 Ga0501033_0028212 3300049570 Bacteria 4219
791 Ga0501033_0051742 3300049570 Bacteria 3045
792 Ga0501033_0626742 3300049570 Bacteria 736
793 Ga0501034_0016423 3300049571 Bacteria 7598
794 Ga0501034_0174514 3300049571 Bacteria 2116
795 Ga0501034_0367342 3300049571 Bacteria 1365
796 Ga0501034_0710376 3300049571 Bacteria 903
797 Ga0501034_0939652 3300049571 Bacteria 751
798 Ga0501036_0004619 3300049572 Bacteria 11128
799 Ga0501036_0100530 3300049572 Bacteria 2446
800 Ga0501036_0161191 3300049572 Bacteria 1891
801 Ga0501036_0178674 3300049572 Bacteria 1787
802 Ga0501036_0507748 3300049572 Bacteria 1003
803 Ga0501036_0621470 3300049572 Bacteria 895
804 Ga0501037_0002105 3300049573 Bacteria 14423
805 Ga0501037_0084212 3300049573 Bacteria 2303
806 Ga0501038_0003549 3300049574 Bacteria 14517
807 Ga0501038_0028808 3300049574 Bacteria 4929
808 Ga0501038_0339781 3300049574 Bacteria 1171
809 Ga0501039_0015041 3300049575 Bacteria 5920
810 Ga0501039_0016303 3300049575 Bacteria 5693
811 Ga0501039_0051757 3300049575 Bacteria 3177
812 Ga0501039_0551106 3300049575 Bacteria 905
813 Ga0501039_0777105 3300049575 Bacteria 747
814 Ga0501040_0014377 3300049576 Bacteria 5215
815 Ga0501040_0046498 3300049576 Bacteria 2963
816 Ga0501041_0024970 3300049577 Bacteria 3590
817 Ga0501041_0073997 3300049577 Bacteria 2093
818 Ga0501041_0108610 3300049577 Bacteria 1721
819 Ga0501041_0196994 3300049577 Bacteria 1262
820 Ga0501041_0208496 3300049577 Bacteria 1226
821 Ga0501042_0039746 3300049578 Bacteria 3344
822 Ga0501042_0065224 3300049578 Bacteria 2602
823 Ga0501042_0081645 3300049578 Bacteria 2317
824 Ga0501042_0092955 3300049578 Bacteria 2166
825 Ga0501042_0103883 3300049578 Bacteria 2044
826 Ga0501042_0250936 3300049578 Bacteria 1277
827 Ga0501043_0002925 3300049579 Bacteria 14258
828 Ga0501043_0081375 3300049579 Bacteria 2544
829 Ga0501043_0428448 3300049579 Bacteria 997
830 Ga0501046_0003552 3300049580 Bacteria 14279
831 Ga0501046_0009834 3300049580 Bacteria 8247
832 Ga0501046_0100685 3300049580 Bacteria 2217
833 Ga0501046_0291423 3300049580 Bacteria 1194
834 Ga0501046_0483342 3300049580 Bacteria 888
835 Ga0501047_0002361 3300049581 Bacteria 18047
836 Ga0501047_0057684 3300049581 Bacteria 3754
837 Ga0501047_0061159 3300049581 Bacteria 3634
838 Ga0501047_0085868 3300049581 Bacteria 3023
839 Ga0501047_0119545 3300049581 Bacteria 2517
840 Ga0501047_0125226 3300049581 Bacteria 2450
841 Ga0501047_0134553 3300049581 Bacteria 2352
842 Ga0501047_0274239 3300049581 Bacteria 1532
843 Ga0501048_0002577 3300049582 Bacteria 13867
844 Ga0501048_0198898 3300049582 Bacteria 1420
845 Ga0501048_0290307 3300049582 Bacteria 1163
846 Ga0501048_0456802 3300049582 Bacteria 915
847 Ga0501067_0003591 3300049583 Bacteria 8545
848 Ga0501068_0009293 3300049584 Bacteria 5496
849 Ga0501068_0031540 3300049584 Bacteria 3148
850 Ga0501068_0353264 3300049584 Bacteria 945
851 Ga0501069_0003034 3300049585 Bacteria 8625
852 Ga0501069_0047028 3300049585 Bacteria 2394
853 Ga0501069_0079700 3300049585 Bacteria 1843
854 Ga0501069_0218953 3300049585 Bacteria 1106
855 Ga0501070_0000832 3300049586 Bacteria 28030
856 Ga0501070_0009212 3300049586 Bacteria 8349
857 Ga0501070_0338896 3300049586 Bacteria 1221
858 Ga0501071_0041672 3300049587 Bacteria 3288
859 Ga0501071_0053674 3300049587 Bacteria 2907
860 Ga0501071_0076231 3300049587 Bacteria 2449
861 Ga0501072_0007453 3300049588 Bacteria 8299
862 Ga0501072_0016434 3300049588 Bacteria 5682
863 Ga0501072_0121775 3300049588 Bacteria 2079
864 Ga0501072_0247865 3300049588 Bacteria 1418
865 Ga0501072_0561092 3300049588 Bacteria 901
866 Ga0501073_0007834 3300049589 Bacteria 7930
867 Ga0501073_0009603 3300049589 Bacteria 7134
868 Ga0501074_0007166 3300049590 Bacteria 8051
869 Ga0501074_0035154 3300049590 Bacteria 3630
870 Ga0501074_0040709 3300049590 Bacteria 3364
871 Ga0501074_0083958 3300049590 Bacteria 2283
872 Ga0501074_0295117 3300049590 Bacteria 1152
873 Ga0501074_0376689 3300049590 Bacteria 1007
874 Ga0501075_0013118 3300049591 Bacteria 5909
875 Ga0501075_0148563 3300049591 Bacteria 1786
876 Ga0501076_0023338 3300049592 Bacteria 4767
877 Ga0501076_0056905 3300049592 Bacteria 3104
878 Ga0501076_0100517 3300049592 Bacteria 2330
879 Ga0501076_0309229 3300049592 Bacteria 1296
880 Ga0501076_0341570 3300049592 Bacteria 1229
881 Ga0501079_0009011 3300049741 Bacteria 7557
882 Ga0501079_0039174 3300049741 Bacteria 3655
883 Ga0501079_0041381 3300049741 Bacteria 3556
884 Ga0501079_0176701 3300049741 Bacteria 1665
885 Ga0501080_0007024 3300049742 Bacteria 10165
886 Ga0501080_0042368 3300049742 Bacteria 4239
887 Ga0501080_0267252 3300049742 Bacteria 1557
888 Ga0501080_0299224 3300049742 Bacteria 1459
889 Ga0501080_1049355 3300049742 Bacteria 705
890 Ga0501081_0058683 3300049743 Bacteria 2663
891 Ga0501083_0002406 3300049744 Bacteria 12801
892 Ga0501083_0027131 3300049744 Bacteria 3953
893 Ga0501083_0038323 3300049744 Bacteria 3259
894 Ga0501083_0114676 3300049744 Bacteria 1769
895 Ga0501035_0004128 3300049822 Bacteria 13802
896 Ga0501035_0022019 3300049822 Bacteria 5855
897 Ga0501035_0259373 3300049822 Bacteria 1474
898 Ga0501044_0000684 3300049823 Bacteria 40967
899 Ga0501044_0022596 3300049823 Bacteria 6702
900 Ga0501044_0064508 3300049823 Bacteria 3739
901 Ga0501045_0053737 3300049824 Bacteria 2943
902 Ga0501045_0094821 3300049824 Bacteria 2207
903 Ga0501045_0140998 3300049824 Bacteria 1792
904 Ga0501045_0365148 3300049824 Bacteria 1074
905 Ga0501045_0540533 3300049824 Bacteria 864
906 nmdc:mga00v17_165783_c1 3300050491 Bacteria 1423
907 nmdc:mga00v17_387567_c1 3300050491 Bacteria 908
908 nmdc:mga00v17_495179_c1 3300050491 Bacteria 792
909 nmdc:mga05p37_1164634_c1 3300050507 Bacteria 800
910 nmdc:mga05p37_140993_c1 3300050507 Bacteria 2953
911 nmdc:mga05p37_1604883_c1 3300050507 Bacteria 640
912 nmdc:mga05p37_262700_c1 3300050507 Bacteria 2065
913 nmdc:mga05p37_45564_c1 3300050507 Bacteria 5393
914 nmdc:mga05p37_478418_c1 3300050507 Bacteria 1435
915 nmdc:mga05p37_704595_c1 3300050507 Bacteria 1121
916 nmdc:mga09592_163983_c1 3300050508 Bacteria 1920
917 nmdc:mga09592_19237_c1 3300050508 Bacteria 5605
918 nmdc:mga09592_385900_c1 3300050508 Bacteria 1211
919 nmdc:mga09592_390814_c1 3300050508 Bacteria 1202
920 nmdc:mga09592_6990_c1 3300050508 Bacteria 9174
921 nmdc:mga0qj67_334433_c1 3300050509 Bacteria 1225
922 nmdc:mga0qj67_50370_c1 3300050509 Bacteria 3293
923 nmdc:mga0qj67_5408_c1 3300050509 Bacteria 9321
924 nmdc:mga0qj67_70656_c1 3300050509 Bacteria 2785
925 nmdc:mga06r32_13488_c1 3300050510 Bacteria 7405
926 nmdc:mga06r32_190968_c1 3300050510 Bacteria 2036
927 nmdc:mga06r32_32616_c1 3300050510 Bacteria 4902
928 nmdc:mga08y16_118758_c1 3300050511 Bacteria 2752
929 nmdc:mga08y16_190763_c1 3300050511 Bacteria 2126
930 nmdc:mga08y16_276486_c1 3300050511 Bacteria 1733
931 nmdc:mga08y16_35631_c1 3300050511 Bacteria 5226
932 nmdc:mga08y16_37510_c1 3300050511 Bacteria 5089
933 nmdc:mga08y16_652245_c1 3300050511 Bacteria 1057
934 nmdc:mga0n895_121418_c1 3300050512 Bacteria 2634
935 nmdc:mga0n895_326177_c1 3300050512 Bacteria 1555
936 nmdc:mga0n895_601864_c1 3300050512 Bacteria 1101
937 nmdc:mga0n895_64787_c1 3300050512 Bacteria 3615
938 nmdc:mga0rr50_193863_c1 3300050513 Bacteria 1666
939 nmdc:mga0a205_220706_c1 3300050515 Bacteria 1781
940 nmdc:mga0a205_51769_c1 3300050515 Bacteria 3964
941 nmdc:mga0a205_828417_c1 3300050515 Bacteria 773
942 Ga0495601_0000595 3300053077 Bacteria 19251
943 Ga0495601_0005015 3300053077 Bacteria 7684
944 Ga0495601_0006880 3300053077 Bacteria 6662
945 Ga0495612_0000023 3300053078 Bacteria 118413
946 Ga0495612_0002167 3300053078 Bacteria 8080
947 Ga0495655_0073885 3300053083 Bacteria 959
948 Ga0495655_0080651 3300053083 Bacteria 930
949 Ga0495619_0000047 3300053085 Bacteria 102152
950 Ga0495619_0123674 3300053085 Bacteria 1775
951 Ga0500568_0175941 3300053139 Bacteria 787
952 Ga0500616_0025481 3300053153 Bacteria 3280
953 Ga0500616_0142130 3300053153 Bacteria 1120
954 Ga0501084_0021707 3300054114 Bacteria 5353
955 Ga0501084_0042468 3300054114 Bacteria 3804
956 Ga0501084_0044658 3300054114 Bacteria 3710
957 Ga0501084_0506402 3300054114 Bacteria 1020
958 Ga0587071_045024 3300060344 Bacteria 896
959 Ga0501082_0008369 3300060353 Bacteria 8922
960 Ga0501082_0046329 3300060353 Bacteria 3748
961 Ga0501082_0068822 3300060353 Bacteria 3048
962 Ga0501082_0090176 3300060353 Bacteria 2647
963 Ga0501082_0698602 3300060353 Bacteria 888
964 Ga0501082_0754966 3300060353 Bacteria 851
965 Ga0466962_0054943 3300061719 Bacteria 1903
966 Ga0466962_0086446 3300061719 Bacteria 1501
967 Ga0530510_0009957 3300061734 Bacteria 6668
968 Ga0530510_0093190 3300061734 Bacteria 2199
969 Ga0530510_0213005 3300061734 Bacteria 1435
970 Ga0530510_0434603 3300061734 Bacteria 991
971 Ga0530510_0555932 3300061734 Bacteria 872
972 Ga0530510_0997689 3300061734 Bacteria 641
973 Ga0495608_0120798
974 LJQas_1007430
975 JGI25406J46586_10037679
976 JGI25407J50210_10007614
977 JGI25407J50210_10046016
978 Ga0070683_100017940
979 Ga0070683_100035511
980 Ga0070683_100051889
981 Ga0070683_100165130
982 Ga0070690_100243518
983 Ga0070670_100256191
984 Ga0070670_101056036
985 Ga0068869_100019169
986 Ga0068869_100186159
987 Ga0070666_10549680
988 Ga0070680_100810565
989 Ga0070682_100023170
990 Ga0070682_100376757
991 Ga0070682_100399027
992 Ga0068868_100003173
993 Ga0068868_100027776
994 Ga0068868_100293943
995 Ga0068868_100340411
996 Ga0068868_100380266
997 Ga0068868_100887103
998 Ga0070660_100003619
999 Ga0070660_100046597
1000 Ga0070660_100068013
1001 Ga0070660_100561430
1002 Ga0070689_100060626
1003 Ga0070689_100158234
1004 Ga0070689_100399760
1005 Ga0070691_10158276
1006 Ga0070687_100104910
1007 Ga0070687_100478350
1008 Ga0070661_100019340
1009 Ga0070661_100581806
1010 Ga0070692_10017574
1011 Ga0070692_10090842
1012 Ga0070692_10134710
1013 Ga0070668_100042153
1014 Ga0070668_100470612
1015 Ga0070669_100020911
1016 Ga0070669_100359311
1017 Ga0070669_100385917
1018 Ga0070675_100001160
1019 Ga0070675_100413797
1020 Ga0070671_100235319
1021 Ga0070671_100488975
1022 Ga0070674_100031861
1023 Ga0070674_100481091
1024 Ga0070674_101162445
1025 Ga0070673_100871895
1026 Ga0070688_100000027
1027 Ga0070688_100004986
1028 Ga0070688_100257611
1029 Ga0070659_100000037
1030 Ga0070659_100002687
1031 Ga0070659_100476154
1032 Ga0070659_100757011
1033 Ga0070667_100042334
1034 Ga0070667_100811593
1035 Ga0070709_10053487
1036 Ga0070714_100000860
1037 Ga0070714_100010038
1038 Ga0070714_100021490
1039 Ga0070714_100069618
1040 Ga0070714_100104971
1041 Ga0070714_100113289
1042 Ga0070714_100837573
1043 Ga0070713_100324287
1044 Ga0070710_10000050
1045 Ga0070710_10097718
1046 Ga0070710_10201511
1047 Ga0070710_10423514
1048 Ga0070701_10192589
1049 Ga0070711_100001237
1050 Ga0070711_100289029
1051 Ga0070705_100005024
1052 Ga0070705_100950972
1053 Ga0070705_100995940
1054 Ga0070700_100013649
1055 Ga0070700_100029613
1056 Ga0070700_100034667
1057 Ga0070700_100188362
1058 Ga0070700_100307524
1059 Ga0070694_100314453
1060 Ga0070708_100428217
1061 Ga0070663_100009051
1062 Ga0070678_100025608
1063 Ga0070678_100284954
1064 Ga0070662_100001035
1065 Ga0070662_100294176
1066 Ga0070662_100441662
1067 Ga0070681_10003066
1068 Ga0070681_10303916
1069 Ga0070685_10000665
1070 Ga0070685_10000791
1071 Ga0070685_10031977
1072 Ga0070685_10284096
1073 Ga0070685_10663639
1074 Ga0070698_100623824
1075 Ga0070679_100035983
1076 Ga0070679_100043251
1077 Ga0070679_100070872
1078 Ga0070679_100151311
1079 Ga0070679_100436883
1080 Ga0070684_100035155
1081 Ga0070684_100035948
1082 Ga0070684_100106959
1083 Ga0070684_100216967
1084 Ga0070697_100407681
1085 Ga0070697_100509609
1086 Ga0068853_100390091
1087 Ga0070686_100224047
1088 Ga0070686_100229411
1089 Ga0070695_100191180
1090 Ga0070696_100021133
1091 Ga0070696_100407601
1092 Ga0070665_100036567
1093 Ga0070665_100075544
1094 Ga0070665_100113050
1095 Ga0070665_100485083
1096 Ga0070665_100515985
1097 Ga0070665_100600571
1098 Ga0070704_100223325
1099 Ga0068855_100452939
1100 Ga0068855_100960053
1101 Ga0070664_100012431
1102 Ga0070664_100076082
1103 Ga0070664_100153674
1104 Ga0068857_100276104
1105 Ga0068857_100317982
1106 Ga0068854_100000116
1107 Ga0068854_100075637
1108 Ga0068854_100131953
1109 Ga0068854_100882361
1110 Ga0068856_100000336
1111 Ga0068856_100002016
1112 Ga0068856_100032534
1113 Ga0068856_100114684
1114 Ga0070702_100050153
1115 Ga0068852_100805384
1116 Ga0068859_100050092
1117 Ga0068859_100119046
1118 Ga0068861_100008771
1119 Ga0068861_100049050
1120 Ga0068851_10007756
1121 Ga0068851_10057798
1122 Ga0068870_10031616
1123 Ga0068863_100111984
1124 Ga0068863_100324115
1125 Ga0068858_100081388
1126 Ga0068858_100211186
1127 Ga0068862_100042359
1128 Ga0081455_10043405
1129 Ga0081455_10097642
1130 Ga0081455_10325138
1131 Ga0081538_10000044
1132 Ga0081538_10000766
1133 Ga0081538_10001436
1134 Ga0081538_10002073
1135 Ga0081538_10002254
1136 Ga0081538_10003695
1137 Ga0081538_10004173
1138 Ga0081538_10006143
1139 Ga0081538_10025048
1140 Ga0081538_10042073
1141 Ga0081538_10050518
1142 Ga0081538_10066379
1143 Ga0081538_10096064
1144 Ga0081540_1002481
1145 Ga0081540_1084827
1146 Ga0081539_10011326
1147 Ga0081539_10012198
1148 Ga0070717_10000019
1149 Ga0070717_10036330
1150 Ga0075365_10320280
1151 Ga0075363_100047743
1152 Ga0075363_100210420
1153 Ga0075432_10008412
1154 Ga0070716_100333012
1155 Ga0070712_100000004
1156 Ga0070712_100024256
1157 Ga0070712_100073145
1158 Ga0070712_100167367
1159 Ga0070712_100545950
1160 Ga0068871_100396671
1161 Ga0075428_100172045
1162 Ga0075428_100281113
1163 Ga0075428_100407972
1164 Ga0075428_100417523
1165 Ga0075430_100001606
1166 Ga0075430_100125867
1167 Ga0075430_100159561
1168 Ga0075430_100174316
1169 Ga0075431_100014397
1170 Ga0075431_100102356
1171 Ga0075431_100244726
1172 Ga0075433_10069242
1173 Ga0075433_10224928
1174 Ga0075433_10389984
1175 Ga0075434_100074065
1176 Ga0075434_100434120
1177 Ga0075429_100031400
1178 Ga0075429_100090493
1179 Ga0075429_100260198
1180 Ga0068865_100081249
1181 Ga0068865_100490241
1182 Ga0075436_100069538
1183 Ga0097620_100050092
1184 Ga0097620_100119045
1185 Ga0075435_100012265
1186 Ga0075435_100220646
1187 Ga0105240_10206274
1188 Ga0105240_10370303
1189 Ga0105240_10596443
1190 Ga0111539_10004783
1191 Ga0111539_10012635
1192 Ga0111539_10039470
1193 Ga0111539_10050074
1194 Ga0111539_10129885
1195 Ga0111539_10641360
1196 Ga0111539_10954648
1197 Ga0111539_11452804
1198 Ga0105245_10000141
1199 Ga0105245_10002406
1200 Ga0105245_10003314
1201 Ga0105245_10014806
1202 Ga0105245_10015314
1203 Ga0105245_10066571
1204 Ga0105245_10358819
1205 Ga0105245_10588679
1206 Ga0105245_10688910
1207 Ga0105245_10971783
1208 Ga0105247_10047392
1209 Ga0105247_10625075
1210 Ga0114129_10019151
1211 Ga0114129_10059944
1212 Ga0114129_10183598
1213 Ga0114129_10195494
1214 Ga0114129_10315827
1215 Ga0114129_11136682
1216 Ga0114129_12314265
1217 Ga0105243_10011687
1218 Ga0105243_10012300
1219 Ga0105243_10079736
1220 Ga0105243_10576404
1221 Ga0105243_10795080
1222 Ga0105243_11187265
1223 Ga0105242_10103250
1224 Ga0105242_10358859
1225 Ga0105242_10409502
1226 Ga0105242_11390958
1227 Ga0105248_10000020
1228 Ga0105248_10141614
1229 Ga0105248_10312768
1230 Ga0105237_10009091
1231 Ga0105237_10207990
1232 Ga0105237_10338998
1233 Ga0105237_10486205
1234 Ga0105238_10032231
1235 Ga0105249_10018376
1236 Ga0105249_10332398
1237 Ga0105239_10019100
1238 Ga0105239_10164107
1239 Ga0105239_10217741
1240 Ga0105239_10315601
1241 Ga0105239_10685949
1242 Ga0105239_11017158
1243 Ga0105246_10236010
1244 Ga0157371_10011110
1245 Ga0157371_10230312
1246 Ga0157370_10013982
1247 Ga0157370_10327615
1248 Ga0157369_10004884
1249 Ga0157369_10203624
1250 Ga0157369_10390815
1251 Ga0157369_10677369
1252 Ga0157369_11298606
1253 Ga0157374_10470627
1254 Ga0157374_10585624
1255 Ga0163162_10027306
1256 Ga0163162_10137792
1257 Ga0163162_10603452
1258 Ga0157372_10006642
1259 Ga0157372_10023168
1260 Ga0157372_10183403
1261 Ga0157372_10411817
1262 Ga0157375_10085478
1263 Ga0157375_10673008
1264 Ga0157375_11016385
1265 Ga0157375_11683226
1266 Ga0163163_10314158
1267 Ga0163163_10484790
1268 Ga0163163_11856857
1269 Ga0157380_10006499
1270 Ga0157380_11273185
1271 Ga0182008_10245237
1272 Ga0157377_10011697
1273 Ga0157377_10086770
1274 Ga0157379_10148164
1275 Ga0157379_10497759
1276 Ga0157376_10028909
1277 Ga0157376_10928289
1278 Ga0163161_10085718
1279 Ga0206354_10513831
1280 Ga0206353_10159166
1281 Ga0206353_10352119
1282 Ga0206353_11218525
1283 Ga0213873_10054893
1284 Ga0213875_10032735
1285 Ga0224712_10103572
1286 Ga0207426_1013197
1287 Ga0207656_10039832
1288 Ga0207656_10193740
1289 Ga0207692_10000022
1290 Ga0207692_10041897
1291 Ga0207692_10152908
1292 Ga0207688_10000813
1293 Ga0207688_10034319
1294 Ga0207688_10039540
1295 Ga0207688_10063504
1296 Ga0207688_10064925
1297 Ga0207688_10198878
1298 Ga0207680_10323462
1299 Ga0207699_10056789
1300 Ga0207645_10074921
1301 Ga0207643_10575587
1302 Ga0207707_10148415
1303 Ga0207695_10139811
1304 Ga0207695_10180841
1305 Ga0207695_10513266
1306 Ga0207695_10551251
1307 Ga0207695_10657218
1308 Ga0207671_10001526
1309 Ga0207693_10000017
1310 Ga0207693_10004599
1311 Ga0207693_10008005
1312 Ga0207693_10049193
1313 Ga0207693_10710466
1314 Ga0207663_10002190
1315 Ga0207663_10055324
1316 Ga0207663_10058625
1317 Ga0207663_10309526
1318 Ga0207660_10006020
1319 Ga0207662_10077621
1320 Ga0207657_10006359
1321 Ga0207657_10057000
1322 Ga0207657_10417286
1323 Ga0207649_10176847
1324 Ga0207649_10327925
1325 Ga0207652_10008802
1326 Ga0207652_10094266
1327 Ga0207652_10095849
1328 Ga0207652_10127154
1329 Ga0207652_10812437
1330 Ga0207681_10016814
1331 Ga0207681_10152625
1332 Ga0207694_10247360
1333 Ga0207650_10698466
1334 Ga0207659_10000553
1335 Ga0207659_10035380
1336 Ga0207659_10372296
1337 Ga0207687_10000036
1338 Ga0207687_10002476
1339 Ga0207687_10039782
1340 Ga0207687_10324237
1341 Ga0207687_10547004
1342 Ga0207700_10371009
1343 Ga0207700_10462839
1344 Ga0207664_10000004
1345 Ga0207664_10002049
1346 Ga0207664_10082008
1347 Ga0207664_10382024
1348 Ga0207644_10041237
1349 Ga0207644_10359468
1350 Ga0207690_10000268
1351 Ga0207690_10098395
1352 Ga0207690_10141496
1353 Ga0207690_10151916
1354 Ga0207706_10003294
1355 Ga0207706_10401597
1356 Ga0207686_10093501
1357 Ga0207686_10237332
1358 Ga0207669_10164059
1359 Ga0207669_10204345
1360 Ga0207669_10315406
1361 Ga0207669_10317918
1362 Ga0207669_10520656
1363 Ga0207704_10034396
1364 Ga0207704_10242885
1365 Ga0207691_10078503
1366 Ga0207711_10000006
1367 Ga0207711_10210392
1368 Ga0207689_10041401
1369 Ga0207689_10254294
1370 Ga0207661_10000312
1371 Ga0207661_10028815
1372 Ga0207661_10131491
1373 Ga0207661_10248948
1374 Ga0207661_10915826
1375 Ga0207679_10023802
1376 Ga0207679_10074750
1377 Ga0207679_10120470
1378 Ga0207651_10687143
1379 Ga0207712_10008255
1380 Ga0207712_10157106
1381 Ga0207668_10012672
1382 Ga0207668_10089592
1383 Ga0207668_10454504
1384 Ga0207640_10000134
1385 Ga0207640_10102975
1386 Ga0207640_10460067
1387 Ga0207658_10029416
1388 Ga0207677_10000374
1389 Ga0207677_10138916
1390 Ga0207677_10180365
1391 Ga0207677_10240977
1392 Ga0207677_10369646
1393 Ga0207677_10756946
1394 Ga0207639_10079844
1395 Ga0207678_10009806
1396 Ga0207678_10058133
1397 Ga0207678_10219814
1398 Ga0207708_10000937
1399 Ga0207708_10005784
1400 Ga0207708_10011942
1401 Ga0207708_10018439
1402 Ga0207708_10035246
1403 Ga0207702_10000368
1404 Ga0207702_10025200
1405 Ga0207702_10144487
1406 Ga0207702_11075611
1407 Ga0207641_10054928
1408 Ga0207641_10505971
1409 Ga0207648_10204819
1410 Ga0207648_10302058
1411 Ga0207648_10385306
1412 Ga0207676_10062035
1413 Ga0207676_10566343
1414 Ga0207674_10141397
1415 Ga0207674_10152988
1416 Ga0207674_10349889
1417 Ga0207675_100004816
1418 Ga0207675_100033107
1419 Ga0207675_100101877
1420 Ga0207675_100657539
1421 Ga0207675_100733035
1422 Ga0207683_10084011
1423 Ga0207683_11173117
1424 Ga0207698_10086179
1425 Ga0207698_10243788
1426 Ga0207428_10055052
1427 Ga0207428_10201634
1428 Ga0207428_10273695
1429 Ga0268266_10010879
1430 Ga0268266_10063353
1431 Ga0268266_10365342
1432 Ga0268266_10366927
1433 Ga0268264_10563193
1434 Ga0265337_1012291
1435 Ga0265337_1079678
1436 Ga0265326_10000630
1437 Ga0265326_10000833
1438 Ga0265319_1000353
1439 Ga0265319_1001381
1440 Ga0265319_1009072
1441 Ga0265334_10000002
1442 Ga0265318_10001586
1443 Ga0265318_10005786
1444 Ga0265318_10047329
1445 Ga0265318_10075213
1446 Ga0265323_10120796
1447 Ga0265336_10000005
1448 Ga0265336_10002183
1449 Ga0265338_10000001
1450 Ga0265338_10024856
1451 Ga0265338_10147335
1452 Ga0265338_10386672
1453 Ga0265320_10008105
1454 Ga0265320_10047466
1455 Ga0265325_10085887
1456 Ga0265340_10000001
1457 Ga0265327_10121611
1458 Ga0265327_10211865
1459 Ga0265316_10129048
1460 Ga0307408_100149363
1461 Ga0307408_100270750
1462 Ga0307408_100272361
1463 Ga0307408_100614185
1464 Ga0265314_10273943
1465 Ga0307405_10047556
1466 Ga0307405_10071547
1467 Ga0307405_10158330
1468 Ga0307413_10067704
1469 Ga0307413_10084903
1470 Ga0307413_10961614
1471 Ga0307410_10020116
1472 Ga0307410_10035996
1473 Ga0307410_10050510
1474 Ga0307410_10853731
1475 Ga0307410_10983725
1476 Ga0326468_10011767
1477 Ga0307406_10027100
1478 Ga0307406_10131462
1479 Ga0307407_10098143
1480 Ga0307407_10358508
1481 Ga0307412_10131209
1482 Ga0307412_11013148
1483 Ga0307409_100011229
1484 Ga0307409_100017566
1485 Ga0307409_100056097
1486 Ga0307409_100066444
1487 Ga0307409_100091978
1488 Ga0307409_100182248
1489 Ga0307409_100357287
1490 Ga0307416_100028146
1491 Ga0307416_100060399
1492 Ga0307416_100240649
1493 Ga0307416_100309296
1494 Ga0307416_100348654
1495 Ga0307416_100379049
1496 Ga0307416_100401692
1497 Ga0307416_100982852
1498 Ga0307416_101021688
1499 Ga0307416_101285132
1500 Ga0307416_101719263
1501 Ga0307414_10100122
1502 Ga0307411_10114352
1503 Ga0307411_10445148
1504 Ga0307411_10977401
1505 Ga0307415_100003017
1506 Ga0307415_100069572
1507 Ga0307415_100132044
1508 Ga0307415_100133214
1509 Ga0307415_100218137
1510 Ga0307415_100318338
1511 Ga0307415_100363516
1512 Ga0307415_100514303
1513 Ga0307415_100794725
1514 Ga0373944_0113250
1515 Ga0373960_0042544
1516 Ga0373943_0051887
1517 Ga0373946_0274255
1518 Ga0373955_0624287
1519 Ga0373961_0085827
1520 Ga0373931_0030150
1521 Ga0373931_0187096
1522 Ga0373927_0173552
1523 Ga0373947_0138010
1524 Ga0373925_0517403
1525 Ga0395899_0204295
1526 Ga0395900_0717592
1527 Ga0395900_0736322
1528 Ga0395900_1120423
1529 Ga0395898_0047298
1530 Ga0395898_0181894
1531 Ga0395898_0384537
1532 Ga0395898_0421362
1533 Ga0395898_0445794
1534 Ga0395905_0441897
1535 Ga0395905_0492484
1536 Ga0436364_0069355
1537 Ga0436364_0637349
1538 Ga0395901_0009771
1539 Ga0395901_0026246
1540 Ga0395901_0096926
1541 Ga0395901_0172676
1542 Ga0395901_0285448
1543 Ga0395901_0946536
1544 Ga0395901_0988665
1545 Ga0436365_0367556
1546 Ga0436365_0869569
1547 Ga0436365_1517862
1548 Ga0436363_0311232
1549 Ga0436363_1637204
1550 Ga0436362_0383083
1551 Ga0436362_0577753
1552 Ga0451853_0704132
1553 Ga0466969_0030135
1554 Ga0466965_0101923
1555 Ga0466965_0641259
1556 Ga0466966_0014445
1557 Ga0466966_0040633
1558 Ga0466966_0074139
1559 Ga0466966_0378420
1560 Ga0466961_0004147
1561 Ga0466961_0103773
1562 Ga0466961_0342961
1563 Ga0466963_0016615
1564 Ga0466963_0251045
1565 Ga0466963_0565513
1566 Ga0466963_0627894
1567 Ga0466963_0854409
1568 Ga0466964_0091450
1569 Ga0466964_0214286
1570 Ga0466971_0169199
1571 Ga0466968_0023973
1572 Ga0466968_0030132
1573 Ga0466970_0186309
1574 Ga0466970_0198559
1575 Ga0466957_0005022
1576 Ga0466957_0196176
1577 Ga0466957_0198208
1578 Ga0466957_0498444
1579 Ga0466957_0539345
1580 Ga0466957_0561600
1581 Ga0466960_0025275
1582 Ga0466960_0079028
1583 Ga0466960_0173092
1584 Ga0466960_0245859
1585 Ga0466960_0278035
1586 Ga0466959_0025843
1587 Ga0466959_0029413
1588 Ga0466959_0189196
1589 Ga0466958_0008664
1590 Ga0466958_0036525
1591 Ga0466958_0052338
1592 Ga0466958_0137732
1593 Ga0466967_0005031
1594 Ga0466967_0023219
1595 Ga0466967_0027316
1596 Ga0466967_0132475
1597 Ga0466967_0215269
1598 Ga0466967_0225689
1599 Ga0466967_0251445
1600 Ga0466967_0297834
1601 Ga0466967_0494918
1602 Ga0466967_0523551
1603 Ga0466967_0572986
1604 Ga0495603_0144193
1605 Ga0495603_0406041
1606 Ga0495629_0007258
1607 Ga0495629_0105003
1608 Ga0495629_0411793
1609 Ga0495641_0010982
1610 Ga0495653_0000179
1611 Ga0495580_0336198
1612 Ga0495582_0257222
1613 Ga0495605_0142622
1614 Ga0495664_0000012
1615 Ga0495664_0288244
1616 Ga0495594_0000011
1617 Ga0495606_0000586
1618 Ga0495618_0000352
1619 Ga0495628_0370922
1620 Ga0495630_0000075
1621 Ga0495630_0011902
1622 Ga0495644_0123461
1623 Ga0495644_0150753
1624 Ga0495652_0053133
1625 Ga0495586_0261191
1626 Ga0495586_0307438
1627 Ga0495597_0126169
1628 Ga0495645_0000012
1629 Ga0495667_0348810
1630 Ga0495656_0194779
1631 Ga0495657_0000007
1632 Ga0495599_0465602
1633 Ga0495647_0000419
1634 Ga0495624_0000027
1635 Ga0495600_0028472
1636 Ga0495660_0055941
1637 Ga0495674_0207925
1638 Ga0495672_0054488
1639 Ga0495676_0019702
1640 Ga0495676_0227660
1641 Ga0495680_0055337
1642 Ga0495677_0134406
1643 Ga0495684_0002969
1644 Ga0495684_0036602
1645 Ga0495593_0018850
1646 Ga0495593_0118145
1647 Ga0496100_0000001
1648 Ga0496100_0005518
1649 Ga0496100_0005686
1650 Ga0496100_0011761
1651 Ga0496100_0061411
1652 Ga0496100_0375744
1653 Ga0496100_0669049
1654 Ga0496100_0695007
1655 Ga0496101_0000004
1656 Ga0496101_0005308
1657 Ga0496101_0011694
1658 Ga0496101_0243794
1659 Ga0496102_0000027
1660 Ga0496102_0001758
1661 Ga0496102_0012087
1662 Ga0496102_0076150
1663 Ga0496102_0081859
1664 Ga0496102_0138760
1665 Ga0496103_0001348
1666 Ga0496103_0007177
1667 Ga0496103_0009119
1668 Ga0496103_0086878
1669 Ga0496104_0000026
1670 Ga0496104_0003438
1671 Ga0496104_0015713
1672 Ga0496104_0065216
1673 Ga0496104_0194632
1674 Ga0496104_0450871
1675 Ga0496104_0877699
1676 Ga0496105_0023481
1677 Ga0496105_0092970
1678 Ga0496105_0170169
1679 Ga0496105_0348997
1680 Ga0496105_0463918
1681 Ga0496106_0000414
1682 Ga0496106_0029323
1683 Ga0496106_0029356
1684 Ga0496106_0044920
1685 Ga0496106_0062139
1686 Ga0496106_0065354
1687 Ga0496107_0000005
1688 Ga0496107_0008283
1689 Ga0496107_0009275
1690 Ga0496107_0239060
1691 Ga0496107_0569221
1692 Ga0496107_0608924
1693 Ga0496108_0006662
1694 Ga0496108_0042757
1695 Ga0496108_0161303
1696 Ga0496108_0429061
1697 Ga0496108_1187811
1698 Ga0496109_0023996
1699 Ga0496109_0111247
1700 Ga0496109_0122434
1701 Ga0496109_0187399
1702 Ga0496109_0373958
1703 Ga0496109_0451959
1704 Ga0496109_0594754
1705 Ga0496110_0000242
1706 Ga0496110_0000716
1707 Ga0496110_0003019
1708 Ga0496110_0062723
1709 Ga0496110_0113433
1710 Ga0496110_0502409
1711 Ga0496110_0808958
1712 Ga0496110_0954202
1713 Ga0496111_0000366
1714 Ga0496111_0001332
1715 Ga0496111_0004875
1716 Ga0496111_0011253
1717 Ga0496111_0032700
1718 Ga0496111_0066011
1719 Ga0496111_0284439
1720 Ga0496111_0310200
1721 Ga0496112_0000200
1722 Ga0496112_0007945
1723 Ga0496112_0025245
1724 Ga0496112_0045162
1725 Ga0496112_0124638
1726 Ga0496112_0180021
1727 Ga0496112_0511496
1728 Ga0496112_0554970
1729 Ga0496112_0617699
1730 Ga0496112_0821146
1731 Ga0496113_0000027
1732 Ga0496113_0009548
1733 Ga0496113_0090241
1734 Ga0496113_0118977
1735 Ga0496114_0181378
1736 Ga0496114_0467708
1737 Ga0496114_0640806
1738 Ga0496114_0733901
1739 Ga0496115_0000143
1740 Ga0496115_0055013
1741 Ga0496115_0411658
1742 Ga0496115_0468815
1743 Ga0496116_0000176
1744 Ga0496117_0012250
1745 Ga0496118_0005822
1746 Ga0496118_0189826
1747 Ga0496119_0022041
1748 Ga0496119_0045653
1749 Ga0496120_0008785
1750 Ga0496121_0128403
1751 Ga0496121_0193951
1752 Ga0496124_0017107
1753 Ga0496126_0373062
1754 Ga0501291_059373
1755 Ga0501031_0004602
1756 Ga0501031_0012782
1757 Ga0501031_0019873
1758 Ga0501031_0087685
1759 Ga0501032_0002323
1760 Ga0501032_0005183
1761 Ga0501033_0001255
1762 Ga0501033_0028212
1763 Ga0501033_0051742
1764 Ga0501033_0626742
1765 Ga0501034_0016423
1766 Ga0501034_0174514
1767 Ga0501034_0367342
1768 Ga0501034_0710376
1769 Ga0501034_0939652
1770 Ga0501036_0004619
1771 Ga0501036_0100530
1772 Ga0501036_0161191
1773 Ga0501036_0178674
1774 Ga0501036_0507748
1775 Ga0501036_0621470
1776 Ga0501037_0002105
1777 Ga0501037_0084212
1778 Ga0501038_0003549
1779 Ga0501038_0028808
1780 Ga0501038_0339781
1781 Ga0501039_0015041
1782 Ga0501039_0016303
1783 Ga0501039_0051757
1784 Ga0501039_0551106
1785 Ga0501039_0777105
1786 Ga0501040_0014377
1787 Ga0501040_0046498
1788 Ga0501041_0024970
1789 Ga0501041_0073997
1790 Ga0501041_0108610
1791 Ga0501041_0196994
1792 Ga0501041_0208496
1793 Ga0501042_0039746
1794 Ga0501042_0065224
1795 Ga0501042_0081645
1796 Ga0501042_0092955
1797 Ga0501042_0103883
1798 Ga0501042_0250936
1799 Ga0501043_0002925
1800 Ga0501043_0081375
1801 Ga0501043_0428448
1802 Ga0501046_0003552
1803 Ga0501046_0009834
1804 Ga0501046_0100685
1805 Ga0501046_0291423
1806 Ga0501046_0483342
1807 Ga0501047_0002361
1808 Ga0501047_0057684
1809 Ga0501047_0061159
1810 Ga0501047_0085868
1811 Ga0501047_0119545
1812 Ga0501047_0125226
1813 Ga0501047_0134553
1814 Ga0501047_0274239
1815 Ga0501048_0002577
1816 Ga0501048_0198898
1817 Ga0501048_0290307
1818 Ga0501048_0456802
1819 Ga0501067_0003591
1820 Ga0501068_0009293
1821 Ga0501068_0031540
1822 Ga0501068_0353264
1823 Ga0501069_0003034
1824 Ga0501069_0047028
1825 Ga0501069_0079700
1826 Ga0501069_0218953
1827 Ga0501070_0000832
1828 Ga0501070_0009212
1829 Ga0501070_0338896
1830 Ga0501071_0041672
1831 Ga0501071_0053674
1832 Ga0501071_0076231
1833 Ga0501072_0007453
1834 Ga0501072_0016434
1835 Ga0501072_0121775
1836 Ga0501072_0247865
1837 Ga0501072_0561092
1838 Ga0501073_0007834
1839 Ga0501073_0009603
1840 Ga0501074_0007166
1841 Ga0501074_0035154
1842 Ga0501074_0040709
1843 Ga0501074_0083958
1844 Ga0501074_0295117
1845 Ga0501074_0376689
1846 Ga0501075_0013118
1847 Ga0501075_0148563
1848 Ga0501076_0023338
1849 Ga0501076_0056905
1850 Ga0501076_0100517
1851 Ga0501076_0309229
1852 Ga0501076_0341570
1853 Ga0501079_0009011
1854 Ga0501079_0039174
1855 Ga0501079_0041381
1856 Ga0501079_0176701
1857 Ga0501080_0007024
1858 Ga0501080_0042368
1859 Ga0501080_0267252
1860 Ga0501080_0299224
1861 Ga0501080_1049355
1862 Ga0501081_0058683
1863 Ga0501083_0002406
1864 Ga0501083_0027131
1865 Ga0501083_0038323
1866 Ga0501083_0114676
1867 Ga0501035_0004128
1868 Ga0501035_0022019
1869 Ga0501035_0259373
1870 Ga0501044_0000684
1871 Ga0501044_0022596
1872 Ga0501044_0064508
1873 Ga0501045_0053737
1874 Ga0501045_0094821
1875 Ga0501045_0140998
1876 Ga0501045_0365148
1877 Ga0501045_0540533
1878 nmdc:mga00v17_165783_c1
1879 nmdc:mga00v17_387567_c1
1880 nmdc:mga00v17_495179_c1
1881 nmdc:mga05p37_1164634_c1
1882 nmdc:mga05p37_140993_c1
1883 nmdc:mga05p37_1604883_c1
1884 nmdc:mga05p37_262700_c1
1885 nmdc:mga05p37_45564_c1
1886 nmdc:mga05p37_478418_c1
1887 nmdc:mga05p37_704595_c1
1888 nmdc:mga09592_163983_c1
1889 nmdc:mga09592_19237_c1
1890 nmdc:mga09592_385900_c1
1891 nmdc:mga09592_390814_c1
1892 nmdc:mga09592_6990_c1
1893 nmdc:mga0qj67_334433_c1
1894 nmdc:mga0qj67_50370_c1
1895 nmdc:mga0qj67_5408_c1
1896 nmdc:mga0qj67_70656_c1
1897 nmdc:mga06r32_13488_c1
1898 nmdc:mga06r32_190968_c1
1899 nmdc:mga06r32_32616_c1
1900 nmdc:mga08y16_118758_c1
1901 nmdc:mga08y16_190763_c1
1902 nmdc:mga08y16_276486_c1
1903 nmdc:mga08y16_35631_c1
1904 nmdc:mga08y16_37510_c1
1905 nmdc:mga08y16_652245_c1
1906 nmdc:mga0n895_121418_c1
1907 nmdc:mga0n895_326177_c1
1908 nmdc:mga0n895_601864_c1
1909 nmdc:mga0n895_64787_c1
1910 nmdc:mga0rr50_193863_c1
1911 nmdc:mga0a205_220706_c1
1912 nmdc:mga0a205_51769_c1
1913 nmdc:mga0a205_828417_c1
1914 Ga0495601_0000595
1915 Ga0495601_0005015
1916 Ga0495601_0006880
1917 Ga0495612_0000023
1918 Ga0495612_0002167
1919 Ga0495655_0073885
1920 Ga0495655_0080651
1921 Ga0495619_0000047
1922 Ga0495619_0123674
1923 Ga0500568_0175941
1924 Ga0500616_0025481
1925 Ga0500616_0142130
1926 Ga0501084_0021707
1927 Ga0501084_0042468
1928 Ga0501084_0044658
1929 Ga0501084_0506402
1930 Ga0587071_045024
1931 Ga0501082_0008369
1932 Ga0501082_0046329
1933 Ga0501082_0068822
1934 Ga0501082_0090176
1935 Ga0501082_0698602
1936 Ga0501082_0754966
1937 Ga0466962_0054943
1938 Ga0466962_0086446
1939 Ga0530510_0009957
1940 Ga0530510_0093190
1941 Ga0530510_0213005
1942 Ga0530510_0434603
1943 Ga0530510_0555932
1944 Ga0530510_0997689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

55

198

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9807 3 183
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9806 1 183
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9794 1 183
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9739 3 183
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.9714 1 193
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9793 2 89 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.972 1 89 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9665 91 183 3.30.230.40
af_Q2FUU0_1_87_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9646 4 83 3.30.230.40
af_Q2FUU0_88_192_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9511 91 193 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A2V8ST04-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9951 1 115 GO:0000105
GO:0004424
AF-A0A534WID5-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9949 2 107 GO:0000105
GO:0004424
AF-A0A3C0Y201-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9942 1 99 GO:0000105
GO:0004424
AF-A0A3C0KJQ1-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9937 1 114 GO:0000105
GO:0004424
AF-A0A351J0U9-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9935 3 117 GO:0000105
GO:0004424

Map