F487170

General Info

Members Datasets Scaffolds Average Seq Length
972 495 1944 269

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904690495|2904696288
Length 292
Sequence EAARAAAEAAPEPAKHASEAASEQGSRNLVMRVVAALVLAPVAIMLAYVGGIAWTLLVTLAAIGLFVEWLMVTDVGRELRVVGPGVAALLLAGLGLIAGRIDAALIVLAIGAVAVALTSGERRNWATAGLLYAAAAEVASVLVRLDTAKGFGALMFVLLVVWVTDIGGYFAGRSIGGPKLWVRISPKKTWAGAIGGFAASLLVAAGFAAFEIGSTAPLLVLGALLSVVSQLGDLFESAVKRRFGVKDSSHIIPGHGGVLDRLDGFVAAVIVAAILGFVRGGADGVGRGLMVW

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
66 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
92 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
93 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
94 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
342 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
343 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
346 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
347 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
348 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
349 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
352 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
353 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
354 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
355 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
356 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
357 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
358 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
359 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
360 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
364 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
365 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
366 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
371 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
372 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
373 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
374 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
375 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
376 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
377 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
378 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
382 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
383 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
384 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
385 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
386 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
387 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
388 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
389 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
390 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
391 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
392 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
393 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
394 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
395 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
396 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
397 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
398 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
399 2643221651 Afipia sp. Root123D2 Isolate Unclassified
400 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
401 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
402 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
403 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
404 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
405 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
406 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
407 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
408 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
409 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
410 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
411 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
412 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
413 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
414 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
415 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
416 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
417 2791355256 Rhizobium sp. M10 Isolate Nodule
418 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
419 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
420 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
421 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
422 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
423 2838048938 Rhizobium pisi 27/80 Isolate Nodule
424 2838061910 Rhizobium phaseoli L15 Isolate Nodule
425 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
426 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
427 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
428 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
429 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
430 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
431 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
432 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
433 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
434 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
435 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
436 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
437 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
438 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
439 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
440 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
441 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
442 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
443 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
444 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
445 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
446 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
447 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
448 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
449 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
450 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
451 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
452 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
453 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
454 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
455 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
456 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
457 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
458 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
459 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
460 2904699407
461 2906610324
462 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
463 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
464 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
465 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
466 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
467 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
468 2922425934
469 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
470 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
471 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
472 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
473 2933599457 Rhizobium phaseoli M3 Isolate Nodule
474 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
475 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
476 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
477 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
478 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
479 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
480 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
481 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
482 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
483 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
484 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
485 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
486 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
487 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
488 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
489 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
490 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
491 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
492 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
493 8024501048 Rhizobium sp. H4 Isolate Nodule
494 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
495 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.34
Metatranscriptomes 0.1
Isolates 11.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.98
Nodule 11.42
Rhizoplane 5.76
Rhizosphere 63.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000011 3300002704 Bacteria 207685
2 JGI25156J39149_1000027 3300002705 Bacteria 127396
3 JGI25156J39149_1000030 3300002705 Bacteria 126029
4 JGI25162J39368_1002279 3300002737 Bacteria 7737
5 JGI25154J39366_1000057 3300002738 Bacteria 110584
6 JGI25157J39369_1000010 3300002741 Bacteria 207685
7 JGI25406J46586_10000070 3300003203 Bacteria 46611
8 JGI25406J46586_10003047 3300003203 Bacteria 7890
9 JGI25406J46586_10018431 3300003203 Bacteria 2868
10 JGI25165J46597_1001792 3300003214 Bacteria 9172
11 JGI25153J46596_10010551 3300003215 Bacteria 4168
12 JGI25160J50197_1008364 3300003354 Bacteria 3948
13 JGI25160J50197_1008754 3300003354 Bacteria 3829
14 JGI25404J52841_10000116 3300003659 Bacteria 8083
15 JGI25404J52841_10001163 3300003659 Bacteria 4475
16 Ga0055524_1016278 3300003775 Bacteria 2674
17 Ga0055524_1019303 3300003775 Bacteria 2335
18 Ga0055524_1029987 3300003775 Bacteria 1595
19 Ga0055528_1006461 3300003790 Bacteria 5317
20 Ga0055531_10007514 3300003794 Bacteria 5927
21 Ga0055543_1005252 3300004625 Bacteria 3340
22 Ga0065165_1007304 3300005262 Bacteria 5476
23 Ga0065165_1022430 3300005262 Bacteria 2164
24 Ga0070658_10137963 3300005327 Bacteria 2036
25 Ga0070658_10569759 3300005327 Bacteria 980
26 Ga0070683_100006551 3300005329 Bacteria 9780
27 Ga0070683_100013368 3300005329 Bacteria 7157
28 Ga0070683_100014283 3300005329 Bacteria 6943
29 Ga0068869_100189427 3300005334 Bacteria 1617
30 Ga0070680_100011442 3300005336 Bacteria 6865
31 Ga0070680_100023908 3300005336 Bacteria 4877
32 Ga0070680_100306071 3300005336 Bacteria 1348
33 Ga0070682_100138662 3300005337 Bacteria 1655
34 Ga0070682_100149109 3300005337 Bacteria 1603
35 Ga0068868_100024123 3300005338 Bacteria 4611
36 Ga0070660_100008040 3300005339 Bacteria 7373
37 Ga0070660_100103114 3300005339 Bacteria 2262
38 Ga0070691_10221549 3300005341 Bacteria 1003
39 Ga0070661_100470866 3300005344 Bacteria 1002
40 Ga0070668_100005342 3300005347 Bacteria 9534
41 Ga0070671_100086709 3300005355 Bacteria 2620
42 Ga0070671_100100233 3300005355 Bacteria 2430
43 Ga0070673_100286700 3300005364 Bacteria 1446
44 Ga0070709_10000310 3300005434 Bacteria 30908
45 Ga0070709_10031725 3300005434 Bacteria 3180
46 Ga0070709_10182392 3300005434 Bacteria 1475
47 Ga0070714_100008130 3300005435 Bacteria 8175
48 Ga0070714_100042796 3300005435 Bacteria 3828
49 Ga0070713_100021728 3300005436 Bacteria 4943
50 Ga0070713_100030030 3300005436 Bacteria 4311
51 Ga0070713_100115699 3300005436 Bacteria 2344
52 Ga0070713_100150200 3300005436 Bacteria 2072
53 Ga0070713_100204497 3300005436 Bacteria 1785
54 Ga0070713_100266642 3300005436 Bacteria 1567
55 Ga0070713_100375896 3300005436 Bacteria 1323
56 Ga0070710_10003001 3300005437 Bacteria 8024
57 Ga0070710_10005946 3300005437 Bacteria 5826
58 Ga0070710_10013542 3300005437 Bacteria 4088
59 Ga0070710_10013756 3300005437 Bacteria 4060
60 Ga0070711_100007725 3300005439 Bacteria 6551
61 Ga0070711_100014986 3300005439 Bacteria 4898
62 Ga0070711_100066115 3300005439 Bacteria 2531
63 Ga0070708_100349258 3300005445 Bacteria 1394
64 Ga0070663_100038934 3300005455 Bacteria 3320
65 Ga0070663_100091183 3300005455 Bacteria 2258
66 Ga0070678_100233421 3300005456 Bacteria 1535
67 Ga0070678_100376999 3300005456 Bacteria 1226
68 Ga0070681_10062013 3300005458 Bacteria 3713
69 Ga0070681_10120655 3300005458 Bacteria 2556
70 Ga0070681_10361193 3300005458 Bacteria 1362
71 Ga0070698_100336120 3300005471 Bacteria 1442
72 Ga0070679_100023927 3300005530 Bacteria 5984
73 Ga0070679_100378437 3300005530 Bacteria 1362
74 Ga0070684_100012368 3300005535 Bacteria 6837
75 Ga0070684_100106419 3300005535 Bacteria 2511
76 Ga0070684_100176277 3300005535 Bacteria 1943
77 Ga0070697_100412396 3300005536 Bacteria 1173
78 Ga0068853_100010883 3300005539 Bacteria 7368
79 Ga0068853_100011456 3300005539 Bacteria 7207
80 Ga0068853_100102014 3300005539 Bacteria 2539
81 Ga0068853_100246035 3300005539 Bacteria 1640
82 Ga0070693_100081143 3300005547 Bacteria 1934
83 Ga0070665_100149718 3300005548 Bacteria 2337
84 Ga0070665_100398255 3300005548 Bacteria 1384
85 Ga0068855_100038066 3300005563 Bacteria 5716
86 Ga0068855_100083944 3300005563 Bacteria 3689
87 Ga0068855_100105358 3300005563 Bacteria 3242
88 Ga0068855_100235270 3300005563 Bacteria 2049
89 Ga0068855_100283484 3300005563 Bacteria 1839
90 Ga0068855_100492181 3300005563 Bacteria 1334
91 Ga0068857_100006838 3300005577 Bacteria 9816
92 Ga0068857_100052409 3300005577 Bacteria 3620
93 Ga0068854_100027544 3300005578 Bacteria 3918
94 Ga0068856_100006824 3300005614 Bacteria 11171
95 Ga0068852_100007152 3300005616 Bacteria 8132
96 Ga0068852_100327976 3300005616 Bacteria 1488
97 Ga0068852_100449513 3300005616 Bacteria 1275
98 Ga0068851_10009128 3300005834 Bacteria 4606
99 Ga0068858_100154655 3300005842 Bacteria 2157
100 Ga0068860_100000469 3300005843 Bacteria 50219
101 Ga0081455_10005182 3300005937 Bacteria 14347
102 Ga0081455_10010602 3300005937 Bacteria 9323
103 Ga0081455_10020599 3300005937 Bacteria 6205
104 Ga0081540_1000194 3300005983 Bacteria 62934
105 Ga0081540_1004830 3300005983 Bacteria 10155
106 Ga0081540_1044943 3300005983 Bacteria 2249
107 Ga0081539_10000250 3300005985 Bacteria 125352
108 Ga0081539_10000269 3300005985 Bacteria 119082
109 Ga0070717_10002902 3300006028 Bacteria 12176
110 Ga0070717_10211271 3300006028 Bacteria 1703
111 Ga0075364_10073751 3300006051 Bacteria 2250
112 Ga0070712_100010474 3300006175 Bacteria 5852
113 Ga0070712_100016083 3300006175 Bacteria 4827
114 Ga0070712_100069625 3300006175 Bacteria 2511
115 Ga0070712_100083278 3300006175 Bacteria 2322
116 Ga0070712_100194091 3300006175 Bacteria 1591
117 Ga0075367_10348013 3300006178 Bacteria 935
118 Ga0075369_10000673 3300006186 Bacteria 10899
119 Ga0075369_10003758 3300006186 Bacteria 5552
120 Ga0075369_10027572 3300006186 Bacteria 2375
121 Ga0097621_100098471 3300006237 Bacteria 2456
122 Ga0075434_100026275 3300006871 Bacteria 5702
123 Ga0075434_100048322 3300006871 Bacteria 4222
124 Ga0068865_100262939 3300006881 Bacteria 1367
125 Ga0075436_100012308 3300006914 Bacteria 5862
126 Ga0099824_1024504 3300006942 Bacteria 3514
127 Ga0099822_1001268 3300006943 Bacteria 28825
128 Ga0099823_1033009 3300006944 Bacteria 4179
129 Ga0099794_10018633 3300007265 Bacteria 3115
130 Ga0099794_10074857 3300007265 Bacteria 1663
131 Ga0099795_10007245 3300007788 Bacteria 3082
132 Ga0099795_10022566 3300007788 Bacteria 2079
133 Ga0099795_10135524 3300007788 Bacteria 997
134 Ga0105250_10048216 3300009092 Bacteria 1709
135 Ga0105240_10013520 3300009093 Bacteria 11205
136 Ga0105240_10083717 3300009093 Bacteria 3913
137 Ga0105240_10210667 3300009093 Bacteria 2271
138 Ga0105240_10250326 3300009093 Bacteria 2049
139 Ga0105245_10033536 3300009098 Bacteria 4552
140 Ga0105245_10192066 3300009098 Bacteria 1956
141 Ga0105245_10655061 3300009098 Bacteria 1081
142 Ga0105247_10204573 3300009101 Bacteria 1328
143 Ga0105247_10392264 3300009101 Bacteria 987
144 Ga0105247_10417599 3300009101 Bacteria 960
145 Ga0105241_10047312 3300009174 Bacteria 3271
146 Ga0105241_10096542 3300009174 Bacteria 2342
147 Ga0105241_10325928 3300009174 Bacteria 1326
148 Ga0105242_10102162 3300009176 Bacteria 2431
149 Ga0105242_10122393 3300009176 Bacteria 2235
150 Ga0105248_10071650 3300009177 Bacteria 3893
151 Ga0105248_10298507 3300009177 Bacteria 1814
152 Ga0105248_10332398 3300009177 Bacteria 1711
153 Ga0105237_10013053 3300009545 Bacteria 8723
154 Ga0105237_10078218 3300009545 Bacteria 3297
155 Ga0105237_10128390 3300009545 Bacteria 2529
156 Ga0105237_10152321 3300009545 Bacteria 2309
157 Ga0105237_10177506 3300009545 Bacteria 2130
158 Ga0105238_10013890 3300009551 Bacteria 8143
159 Ga0105238_10040291 3300009551 Bacteria 4734
160 Ga0105238_10061026 3300009551 Bacteria 3774
161 Ga0105238_10178225 3300009551 Bacteria 2102
162 Ga0105249_10237164 3300009553 Bacteria 1802
163 Ga0123342_1010917 3300009766 Bacteria 10193
164 Ga0099796_10019663 3300010159 Bacteria 2051
165 Ga0099796_10027048 3300010159 Bacteria 1828
166 Ga0099796_10062739 3300010159 Bacteria 1322
167 Ga0105239_10006580 3300010375 Bacteria 13459
168 Ga0105239_10137458 3300010375 Bacteria 2721
169 Ga0105239_10296739 3300010375 Bacteria 1820
170 Ga0105239_10321912 3300010375 Bacteria 1744
171 Ga0105246_10001020 3300011119 Bacteria 16085
172 Ga0105246_10049935 3300011119 Bacteria 2867
173 Ga0157370_10060974 3300013104 Bacteria 3580
174 Ga0157370_10095170 3300013104 Bacteria 2794
175 Ga0157369_10010618 3300013105 Bacteria 10482
176 Ga0157369_10013468 3300013105 Bacteria 9243
177 Ga0157369_10016315 3300013105 Bacteria 8360
178 Ga0157374_10014119 3300013296 Bacteria 6982
179 Ga0163162_10058709 3300013306 Bacteria 3877
180 Ga0163162_10253578 3300013306 Bacteria 1891
181 Ga0163162_10572396 3300013306 Bacteria 1257
182 Ga0157375_10007265 3300013308 Bacteria 9691
183 Ga0157375_10093773 3300013308 Bacteria 3068
184 Ga0163163_10039525 3300014325 Bacteria 4604
185 Ga0163163_10060338 3300014325 Bacteria 3755
186 Ga0163163_10082533 3300014325 Bacteria 3218
187 Ga0163163_10244970 3300014325 Bacteria 1842
188 Ga0157379_10117978 3300014968 Bacteria 2387
189 Ga0157379_10214304 3300014968 Bacteria 1744
190 Ga0157376_10003464 3300014969 Bacteria 10870
191 Ga0214544_1000009 3300021320 Bacteria 285865
192 Ga0214542_1000002 3300021321 Bacteria 720798
193 Ga0214545_1000002 3300021324 Bacteria 727485
194 Ga0214543_1000011 3300021327 Bacteria 344093
195 Ga0214543_1000013 3300021327 Bacteria 329117
196 Ga0213874_10004378 3300021377 Bacteria 3218
197 Ga0213876_10004782 3300021384 Bacteria 7524
198 Ga0209435_100022 3300025206 Bacteria 207766
199 Ga0209437_100310 3300025233 Bacteria 65905
200 Ga0209646_1000078 3300025246 Bacteria 207766
201 Ga0209026_1000065 3300025250 Bacteria 207766
202 Ga0209759_1000055 3300025256 Bacteria 207766
203 Ga0209233_1000594 3300025261 Bacteria 18858
204 Ga0209233_1013319 3300025261 Bacteria 2351
205 Ga0209673_1018254 3300025273 Bacteria 2559
206 Ga0209673_1024757 3300025273 Bacteria 2010
207 Ga0209130_1009475 3300025284 Bacteria 2770
208 Ga0209025_1011109 3300025294 Bacteria 5994
209 Ga0209025_1027154 3300025294 Bacteria 2848
210 Ga0209564_1004055 3300025295 Bacteria 9237
211 Ga0209564_1009468 3300025295 Bacteria 4631
212 Ga0209564_1021588 3300025295 Bacteria 2307
213 Ga0209564_1045525 3300025295 Bacteria 1128
214 Ga0209758_1000021 3300025297 Bacteria 697691
215 Ga0209758_1012306 3300025297 Bacteria 4803
216 Ga0209256_1006335 3300025299 Bacteria 6316
217 Ga0209256_1007922 3300025299 Bacteria 5075
218 Ga0209256_1016885 3300025299 Bacteria 2458
219 Ga0209256_1034176 3300025299 Bacteria 1357
220 Ga0207426_1000352 3300025302 Bacteria 84141
221 Ga0207426_1000854 3300025302 Bacteria 32034
222 Ga0207426_1019301 3300025302 Bacteria 2386
223 Ga0207656_10036565 3300025321 Bacteria 2062
224 Ga0207682_10167539 3300025893 Bacteria 998
225 Ga0207692_10010453 3300025898 Bacteria 3911
226 Ga0207692_10014687 3300025898 Bacteria 3427
227 Ga0207710_10179528 3300025900 Bacteria 1038
228 Ga0207688_10182726 3300025901 Bacteria 1251
229 Ga0207699_10002283 3300025906 Bacteria 9057
230 Ga0207699_10050465 3300025906 Bacteria 2453
231 Ga0207699_10282184 3300025906 Bacteria 1154
232 Ga0207643_10124029 3300025908 Bacteria 1532
233 Ga0207705_10112367 3300025909 Bacteria 2014
234 Ga0207654_10001822 3300025911 Bacteria 11062
235 Ga0207654_10100216 3300025911 Bacteria 1783
236 Ga0207707_10001692 3300025912 Bacteria 20292
237 Ga0207707_10010614 3300025912 Bacteria 7999
238 Ga0207695_10000402 3300025913 Bacteria 96771
239 Ga0207695_10047854 3300025913 Bacteria 4521
240 Ga0207695_10111595 3300025913 Bacteria 2713
241 Ga0207671_10011788 3300025914 Bacteria 7077
242 Ga0207671_10331047 3300025914 Bacteria 1206
243 Ga0207671_10401098 3300025914 Bacteria 1091
244 Ga0207693_10009963 3300025915 Bacteria 7727
245 Ga0207693_10019275 3300025915 Bacteria 5429
246 Ga0207693_10023378 3300025915 Bacteria 4908
247 Ga0207693_10025304 3300025915 Bacteria 4707
248 Ga0207693_10036543 3300025915 Bacteria 3872
249 Ga0207693_10044359 3300025915 Bacteria 3495
250 Ga0207663_10001328 3300025916 Bacteria 11435
251 Ga0207663_10111235 3300025916 Bacteria 1859
252 Ga0207660_10132693 3300025917 Bacteria 1897
253 Ga0207657_10003043 3300025919 Bacteria 17943
254 Ga0207657_10018606 3300025919 Bacteria 6621
255 Ga0207657_10180860 3300025919 Bacteria 1704
256 Ga0207657_10270483 3300025919 Bacteria 1351
257 Ga0207652_10014144 3300025921 Bacteria 6461
258 Ga0207652_10203913 3300025921 Bacteria 1780
259 Ga0207646_10540065 3300025922 Bacteria 1049
260 Ga0207694_10001125 3300025924 Bacteria 23154
261 Ga0207694_10007985 3300025924 Bacteria 8001
262 Ga0207694_10013513 3300025924 Bacteria 6150
263 Ga0207694_10068895 3300025924 Bacteria 2764
264 Ga0207659_10057139 3300025926 Bacteria 2797
265 Ga0207687_10394115 3300025927 Bacteria 1137
266 Ga0207700_10061785 3300025928 Bacteria 2842
267 Ga0207700_10093155 3300025928 Bacteria 2383
268 Ga0207700_10205203 3300025928 Bacteria 1663
269 Ga0207700_10247016 3300025928 Bacteria 1523
270 Ga0207664_10029111 3300025929 Bacteria 4204
271 Ga0207664_10095350 3300025929 Bacteria 2447
272 Ga0207644_10105416 3300025931 Bacteria 2124
273 Ga0207704_10047009 3300025938 Bacteria 2577
274 Ga0207704_10237674 3300025938 Bacteria 1359
275 Ga0207665_10016296 3300025939 Bacteria 4879
276 Ga0207665_10067322 3300025939 Bacteria 2439
277 Ga0207665_10074733 3300025939 Bacteria 2320
278 Ga0207665_10147109 3300025939 Bacteria 1684
279 Ga0207665_10199248 3300025939 Bacteria 1458
280 Ga0207665_10289180 3300025939 Bacteria 1222
281 Ga0207691_10368920 3300025940 Bacteria 1226
282 Ga0207711_10389757 3300025941 Bacteria 1293
283 Ga0207689_10186246 3300025942 Bacteria 1712
284 Ga0207661_10002409 3300025944 Bacteria 12880
285 Ga0207661_10010713 3300025944 Bacteria 6608
286 Ga0207661_10117278 3300025944 Bacteria 2261
287 Ga0207667_10011695 3300025949 Bacteria 10183
288 Ga0207667_10028182 3300025949 Bacteria 6101
289 Ga0207667_10351139 3300025949 Bacteria 1504
290 Ga0207667_10387139 3300025949 Bacteria 1424
291 Ga0207651_10271838 3300025960 Bacteria 1396
292 Ga0207712_10345666 3300025961 Bacteria 1235
293 Ga0207640_10031645 3300025981 Bacteria 3272
294 Ga0207640_10051574 3300025981 Bacteria 2675
295 Ga0207640_10540288 3300025981 Bacteria 977
296 Ga0207677_10048467 3300026023 Bacteria 2861
297 Ga0207639_10018267 3300026041 Bacteria 4982
298 Ga0207639_10048165 3300026041 Bacteria 3224
299 Ga0207639_10171061 3300026041 Bacteria 1840
300 Ga0207678_10024581 3300026067 Bacteria 5262
301 Ga0207678_10110444 3300026067 Bacteria 2346
302 Ga0207702_10000025 3300026078 Bacteria 186312
303 Ga0207702_10000075 3300026078 Bacteria 112303
304 Ga0207702_10122437 3300026078 Bacteria 2330
305 Ga0207702_10391099 3300026078 Bacteria 1339
306 Ga0207676_10021699 3300026095 Bacteria 4713
307 Ga0207674_10003345 3300026116 Bacteria 19680
308 Ga0207674_10008172 3300026116 Bacteria 12134
309 Ga0207674_10059101 3300026116 Bacteria 3881
310 Ga0207674_10197480 3300026116 Bacteria 1961
311 Ga0207683_10008466 3300026121 Bacteria 8802
312 Ga0207683_10018149 3300026121 Bacteria 6001
313 Ga0207683_10343157 3300026121 Bacteria 1370
314 Ga0207698_10031132 3300026142 Bacteria 3847
315 Ga0207698_10036174 3300026142 Bacteria 3621
316 Ga0207698_10073533 3300026142 Bacteria 2722
317 Ga0207698_10090063 3300026142 Bacteria 2508
318 Ga0207698_10101166 3300026142 Bacteria 2389
319 Ga0209389_1000026 3300027296 Bacteria 147580
320 Ga0209389_1000117 3300027296 Bacteria 71506
321 Ga0209589_1000003 3300027357 Bacteria 629130
322 Ga0209589_1000022 3300027357 Bacteria 180757
323 Ga0209489_100003 3300027361 Bacteria 663105
324 Ga0209489_100058 3300027361 Bacteria 147117
325 Ga0209489_105776 3300027361 Bacteria 20900
326 Ga0209700_100003 3300027363 Bacteria 663105
327 Ga0209700_100021 3300027363 Bacteria 230859
328 Ga0209179_1000519 3300027512 Bacteria 3975
329 Ga0209588_1027652 3300027671 Bacteria 1805
330 Ga0209588_1039063 3300027671 Bacteria 1530
331 Ga0268266_10040338 3300028379 Bacteria 3979
332 Ga0268266_10108521 3300028379 Bacteria 2456
333 Ga0268266_10196336 3300028379 Bacteria 1845
334 Ga0268266_10247313 3300028379 Bacteria 1648
335 Ga0268264_10000022 3300028381 Bacteria 476624
336 Ga0307517_10000111 3300028786 Bacteria 120304
337 Ga0307515_10001215 3300028794 Bacteria 58879
338 Ga0265332_10015585 3300031238 Bacteria 3356
339 Ga0265325_10003304 3300031241 Bacteria 10607
340 Ga0265340_10011918 3300031247 Bacteria 4604
341 Ga0265339_10041083 3300031249 Bacteria 2569
342 Ga0307513_10459117 3300031456 Bacteria 997
343 Ga0307509_10041596 3300031507 Bacteria 4986
344 Ga0307509_10073995 3300031507 Bacteria 3545
345 Ga0307508_10000515 3300031616 Bacteria 46360
346 Ga0307508_10139942 3300031616 Bacteria 2023
347 Ga0307508_10187206 3300031616 Bacteria 1672
348 Ga0265314_10023185 3300031711 Bacteria 4739
349 Ga0265314_10037042 3300031711 Bacteria 3537
350 Ga0265314_10049893 3300031711 Bacteria 2927
351 Ga0265314_10183469 3300031711 Bacteria 1251
352 Ga0265342_10018556 3300031712 Bacteria 4502
353 Ga0265342_10028442 3300031712 Bacteria 3482
354 Ga0265342_10131712 3300031712 Bacteria 1400
355 Ga0265342_10185106 3300031712 Bacteria 1139
356 Ga0307516_10018947 3300031730 Bacteria 7142
357 Ga0307507_10118283 3300033179 Bacteria 2131
358 Ga0307507_10264310 3300033179 Bacteria 1095
359 Ga0307510_10019345 3300033180 Bacteria 7988
360 Ga0315911_1000001 3300033442 Bacteria 1088602
361 Ga0373926_0030368 3300035083 Bacteria 1903
362 Ga0373926_0083654 3300035083 Bacteria 1182
363 Ga0373929_0024203 3300035085 Bacteria 1253
364 Ga0373934_0004274 3300035086 Bacteria 5272
365 Ga0373934_0113757 3300035086 Bacteria 1099
366 Ga0373923_0000310 3300035111 Bacteria 10856
367 Ga0373936_0005876 3300035113 Bacteria 4619
368 Ga0373936_0015755 3300035113 Bacteria 2899
369 Ga0373945_0002999 3300035116 Bacteria 5309
370 Ga0373953_0002273 3300035117 Bacteria 5776
371 Ga0373954_0000035 3300035118 Bacteria 51266
372 Ga0373954_0021760 3300035118 Bacteria 2904
373 Ga0373954_0029454 3300035118 Bacteria 2527
374 Ga0373954_0066288 3300035118 Bacteria 1710
375 Ga0373956_0000798 3300035119 Bacteria 13105
376 Ga0373956_0006725 3300035119 Bacteria 4611
377 Ga0373957_0007552 3300035120 Bacteria 3482
378 Ga0373957_0048788 3300035120 Bacteria 1614
379 Ga0373946_0007829 3300035171 Bacteria 3922
380 Ga0373946_0027108 3300035171 Bacteria 2264
381 Ga0373955_0010436 3300035172 Bacteria 4387
382 Ga0373955_0015377 3300035172 Bacteria 3745
383 Ga0373955_0022680 3300035172 Bacteria 3187
384 Ga0373924_0011073 3300035410 Bacteria 3342
385 Ga0373931_0023783 3300035691 Bacteria 3096
386 Ga0373931_0025759 3300035691 Bacteria 2987
387 Ga0373935_0199533 3300035692 Bacteria 1382
388 Ga0373935_0217665 3300035692 Bacteria 1325
389 Ga0373927_0000055 3300035695 Bacteria 81098
390 Ga0373927_0007107 3300035695 Bacteria 7595
391 Ga0373927_0009804 3300035695 Bacteria 6421
392 Ga0373927_0010862 3300035695 Bacteria 6066
393 Ga0373927_0020113 3300035695 Bacteria 4377
394 Ga0373927_0225088 3300035695 Bacteria 1232
395 Ga0373933_0000037 3300035724 Bacteria 81092
396 Ga0373947_0003833 3300035725 Bacteria 8854
397 Ga0373947_0014430 3300035725 Bacteria 4532
398 Ga0373947_0015479 3300035725 Bacteria 4380
399 Ga0373947_0065428 3300035725 Bacteria 2218
400 Ga0373947_0228706 3300035725 Bacteria 1224
401 Ga0373937_0064445 3300036401 Bacteria 3370
402 Ga0373937_0093056 3300036401 Bacteria 2794
403 Ga0373937_0209747 3300036401 Bacteria 1833
404 Ga0373937_0519163 3300036401 Bacteria 1132
405 Ga0372808_002270 3300036459 Bacteria 2189
406 Ga0373925_0002732 3300037068 Bacteria 13961
407 Ga0373925_0022291 3300037068 Bacteria 4619
408 Ga0373925_0041570 3300037068 Bacteria 3408
409 Ga0373925_0066477 3300037068 Bacteria 2718
410 Ga0373925_0283568 3300037068 Bacteria 1334
411 Ga0395900_0004044 3300037418 Bacteria 15647
412 Ga0395900_0252112 3300037418 Bacteria 1766
413 Ga0395900_0777142 3300037418 Bacteria 887
414 Ga0395898_0014868 3300037466 Bacteria 7990
415 Ga0395905_0015125 3300037471 Bacteria 7343
416 Ga0395905_0054406 3300037471 Bacteria 3746
417 Ga0395905_0170896 3300037471 Bacteria 2042
418 Ga0395905_0236109 3300037471 Bacteria 1709
419 Ga0436364_0713413 3300037853 Bacteria 9562
420 Ga0436364_1207970 3300037853 Bacteria 1361
421 Ga0395901_0026961 3300038443 Bacteria 5900
422 Ga0395901_0078519 3300038443 Bacteria 3447
423 Ga0395901_0436649 3300038443 Bacteria 1341
424 Ga0436365_0816602 3300039437 Bacteria 6220
425 Ga0436360_1185964 3300039438 Bacteria 1476
426 Ga0436363_0597393 3300039450 Bacteria 9259
427 Ga0436363_0990757 3300039450 Bacteria 2477
428 Ga0436362_0053894 3300039453 Bacteria 2768
429 Ga0436362_0386716 3300039453 Bacteria 1837
430 Ga0439465_0002663 3300041413 Bacteria 5834
431 Ga0451853_1526884 3300041512 Bacteria 1323
432 Ga0439432_059869 3300042006 Bacteria 1176
433 Ga0439449_0039829 3300042007 Bacteria 1747
434 Ga0439449_0104524 3300042007 Bacteria 1048
435 Ga0466972_0000125 3300044658 Bacteria 65105
436 Ga0466972_0003074 3300044658 Bacteria 8267
437 Ga0466963_0029408 3300044694 Bacteria 3537
438 Ga0466963_0073222 3300044694 Bacteria 2309
439 Ga0466963_0130819 3300044694 Bacteria 1733
440 Ga0466968_0003815 3300044735 Bacteria 5589
441 Ga0466968_0130373 3300044735 Bacteria 1144
442 Ga0466960_0119251 3300044901 Bacteria 1380
443 Ga0466960_0230327 3300044901 Bacteria 1022
444 Ga0466960_0261465 3300044901 Bacteria 964
445 Ga0466967_0008029 3300045976 Bacteria 7692
446 Ga0466967_0110589 3300045976 Bacteria 2524
447 Ga0495592_0000406 3300046454 Bacteria 32823
448 Ga0495592_0020678 3300046454 Bacteria 5008
449 Ga0495592_0029619 3300046454 Bacteria 4145
450 Ga0495592_0029939 3300046454 Bacteria 4118
451 Ga0495603_0000011 3300046455 Bacteria 69832
452 Ga0495603_0008868 3300046455 Bacteria 6080
453 Ga0495603_0023363 3300046455 Bacteria 3742
454 Ga0495603_0341457 3300046455 Bacteria 859
455 Ga0495629_0000382 3300046459 Bacteria 37088
456 Ga0495629_0000678 3300046459 Bacteria 27584
457 Ga0495629_0053747 3300046459 Bacteria 2817
458 Ga0495629_0086335 3300046459 Bacteria 2189
459 Ga0495638_0016433 3300046460 Bacteria 4956
460 Ga0495638_0026451 3300046460 Bacteria 3760
461 Ga0495638_0082443 3300046460 Bacteria 1951
462 Ga0495641_0000910 3300046461 Bacteria 25244
463 Ga0495651_0012419 3300046462 Bacteria 6568
464 Ga0495651_0019954 3300046462 Bacteria 5200
465 Ga0495651_0021239 3300046462 Bacteria 5045
466 Ga0495651_0037905 3300046462 Bacteria 3754
467 Ga0495651_0303209 3300046462 Bacteria 1071
468 Ga0495653_0000161 3300046463 Bacteria 55322
469 Ga0495580_0000174 3300046472 Bacteria 47868
470 Ga0495580_0005823 3300046472 Bacteria 10113
471 Ga0495605_0109787 3300046474 Bacteria 1260
472 Ga0495639_0000017 3300046475 Bacteria 76508
473 Ga0495639_0013479 3300046475 Bacteria 3531
474 Ga0495639_0044661 3300046475 Bacteria 2003
475 Ga0495662_0000549 3300046476 Bacteria 17200
476 Ga0495662_0010116 3300046476 Bacteria 4626
477 Ga0495664_0027870 3300046477 Bacteria 3296
478 Ga0495664_0091289 3300046477 Bacteria 1831
479 Ga0495664_0258601 3300046477 Bacteria 1053
480 Ga0495594_0000445 3300046499 Bacteria 20938
481 Ga0495607_0029223 3300046501 Bacteria 3394
482 Ga0495606_0006147 3300046507 Bacteria 11189
483 Ga0495606_0132410 3300046507 Bacteria 1481
484 Ga0495608_0000403 3300046511 Bacteria 30220
485 Ga0495608_0016022 3300046511 Bacteria 5189
486 Ga0495608_0092943 3300046511 Bacteria 1949
487 Ga0495616_0064932 3300046513 Bacteria 1780
488 Ga0495618_0053124 3300046514 Bacteria 2562
489 Ga0495618_0126789 3300046514 Bacteria 1634
490 Ga0495628_0003039 3300046516 Bacteria 15033
491 Ga0495628_0006463 3300046516 Bacteria 10235
492 Ga0495628_0133077 3300046516 Bacteria 1901
493 Ga0495630_0004919 3300046517 Bacteria 9392
494 Ga0495630_0043783 3300046517 Bacteria 3345
495 Ga0495643_0073713 3300046522 Bacteria 1789
496 Ga0495643_0277262 3300046522 Bacteria 773
497 Ga0495648_0001444 3300046524 Bacteria 23251
498 Ga0495648_0003981 3300046524 Bacteria 12784
499 Ga0495648_0152062 3300046524 Bacteria 1206
500 Ga0495666_0003988 3300046526 Bacteria 7465
501 Ga0495652_0000604 3300046529 Bacteria 42071
502 Ga0495652_0007725 3300046529 Bacteria 9900
503 Ga0495652_0024880 3300046529 Bacteria 5297
504 Ga0495665_0024725 3300046531 Bacteria 3226
505 Ga0495640_0004435 3300046533 Bacteria 11201
506 Ga0495640_0004810 3300046533 Bacteria 10755
507 Ga0495640_0014243 3300046533 Bacteria 6027
508 Ga0495640_0058762 3300046533 Bacteria 2621
509 Ga0495586_0120638 3300046535 Bacteria 1465
510 Ga0495586_0178448 3300046535 Bacteria 1201
511 Ga0495587_0012949 3300046536 Bacteria 5244
512 Ga0495587_0039594 3300046536 Bacteria 2820
513 Ga0495609_0121429 3300046538 Bacteria 1123
514 Ga0495621_0034537 3300046539 Bacteria 1747
515 Ga0495645_0004657 3300046543 Bacteria 9359
516 Ga0495645_0005046 3300046543 Bacteria 9044
517 Ga0495645_0006519 3300046543 Bacteria 8104
518 Ga0495622_0005239 3300046557 Bacteria 6011
519 Ga0495622_0006151 3300046557 Bacteria 5579
520 Ga0495667_0006181 3300046559 Bacteria 8115
521 Ga0495667_0010646 3300046559 Bacteria 6218
522 Ga0495667_0085014 3300046559 Bacteria 2053
523 Ga0495656_0282399 3300046615 Bacteria 846
524 Ga0495668_0062161 3300046616 Bacteria 2058
525 Ga0495634_0001440 3300046642 Bacteria 21158
526 Ga0495634_0035824 3300046642 Bacteria 3396
527 Ga0495634_0068211 3300046642 Bacteria 2350
528 Ga0495611_0105223 3300046648 Bacteria 1312
529 Ga0495625_0245226 3300046660 Bacteria 1165
530 Ga0495625_0300671 3300046660 Bacteria 1027
531 Ga0495635_0000133 3300046663 Bacteria 44583
532 Ga0495635_0083302 3300046663 Bacteria 2188
533 Ga0495635_0144259 3300046663 Bacteria 1621
534 Ga0495661_0047522 3300046665 Bacteria 2613
535 Ga0495588_0027330 3300046674 Bacteria 2852
536 Ga0495588_0125932 3300046674 Bacteria 1351
537 Ga0495657_0030199 3300046675 Bacteria 3797
538 Ga0495657_0039482 3300046675 Bacteria 3242
539 Ga0495657_0052105 3300046675 Bacteria 2745
540 Ga0495599_0005543 3300046678 Bacteria 7566
541 Ga0495599_0021687 3300046678 Bacteria 4008
542 Ga0495599_0097650 3300046678 Bacteria 1831
543 Ga0495599_0116018 3300046678 Bacteria 1666
544 Ga0495623_0011880 3300046679 Bacteria 5642
545 Ga0495623_0043749 3300046679 Bacteria 2847
546 Ga0495623_0072531 3300046679 Bacteria 2141
547 Ga0495623_0210258 3300046679 Bacteria 1114
548 Ga0495646_0000291 3300046680 Bacteria 25624
549 Ga0495646_0053411 3300046680 Bacteria 2436
550 Ga0495646_0135529 3300046680 Bacteria 1382
551 Ga0495647_0002310 3300046681 Bacteria 5986
552 Ga0495658_0000371 3300046683 Bacteria 25211
553 Ga0495658_0159500 3300046683 Bacteria 1390
554 Ga0495658_0171094 3300046683 Bacteria 1344
555 Ga0495669_0221824 3300046684 Bacteria 906
556 Ga0495613_0013181 3300046689 Bacteria 6142
557 Ga0495613_0181733 3300046689 Bacteria 1489
558 Ga0495624_0000384 3300046690 Bacteria 35148
559 Ga0495624_0153750 3300046690 Bacteria 1407
560 Ga0495671_0141834 3300046692 Bacteria 1171
561 Ga0495600_0010426 3300046809 Bacteria 5769
562 Ga0495600_0026213 3300046809 Bacteria 3760
563 Ga0495600_0050610 3300046809 Bacteria 2711
564 Ga0495600_0191323 3300046809 Bacteria 1316
565 Ga0495581_0000361 3300047315 Bacteria 22781
566 Ga0495581_0048972 3300047315 Bacteria 2440
567 Ga0495581_0075233 3300047315 Bacteria 1954
568 Ga0495581_0088964 3300047315 Bacteria 1791
569 Ga0495604_0010123 3300047317 Bacteria 7469
570 Ga0495604_0025605 3300047317 Bacteria 4699
571 Ga0495604_0185100 3300047317 Bacteria 1455
572 Ga0495674_0001034 3300047319 Bacteria 26723
573 Ga0495674_0037678 3300047319 Bacteria 4345
574 Ga0495674_0041943 3300047319 Bacteria 4084
575 Ga0495674_0174811 3300047319 Bacteria 1790
576 Ga0495672_0044951 3300047320 Bacteria 2646
577 Ga0495672_0115352 3300047320 Bacteria 1436
578 Ga0495676_0047317 3300047321 Bacteria 3479
579 Ga0495680_0006723 3300047322 Bacteria 10634
580 Ga0495680_0037759 3300047322 Bacteria 3867
581 Ga0495680_0080400 3300047322 Bacteria 2463
582 Ga0495675_0037589 3300047444 Bacteria 3083
583 Ga0495675_0125446 3300047444 Bacteria 1597
584 Ga0495675_0149928 3300047444 Bacteria 1441
585 Ga0495684_0002274 3300047471 Bacteria 15383
586 Ga0495684_0018553 3300047471 Bacteria 5359
587 Ga0495684_0162408 3300047471 Bacteria 1665
588 Ga0495686_0050929 3300047472 Bacteria 2601
589 Ga0495686_0139342 3300047472 Bacteria 1432
590 Ga0495686_0158587 3300047472 Bacteria 1324
591 Ga0495593_0000077 3300047673 Bacteria 41818
592 Ga0495593_0002962 3300047673 Bacteria 10210
593 Ga0495593_0070275 3300047673 Bacteria 1820
594 Ga0495602_0020070 3300048088 Bacteria 6611
595 Ga0495602_0181878 3300048088 Bacteria 1620
596 Ga0495614_0063156 3300048089 Bacteria 1592
597 Ga0496100_0032337 3300048903 Bacteria 3262
598 Ga0496100_0148449 3300048903 Bacteria 1669
599 Ga0496101_0022694 3300048904 Bacteria 4324
600 Ga0496101_0130228 3300048904 Bacteria 1910
601 Ga0496102_0003232 3300048905 Bacteria 13822
602 Ga0496102_0612786 3300048905 Bacteria 1012
603 Ga0496103_0015633 3300048906 Bacteria 4522
604 Ga0496103_0027535 3300048906 Bacteria 3445
605 Ga0496104_0000169 3300048907 Bacteria 57859
606 Ga0496104_0012033 3300048907 Bacteria 7766
607 Ga0496105_0009216 3300048908 Bacteria 7708
608 Ga0496105_0016624 3300048908 Bacteria 5875
609 Ga0496105_0031207 3300048908 Bacteria 4368
610 Ga0496105_0032167 3300048908 Bacteria 4304
611 Ga0496106_0002592 3300048909 Bacteria 13459
612 Ga0496106_0020768 3300048909 Bacteria 4873
613 Ga0496106_0033696 3300048909 Bacteria 3822
614 Ga0496106_0156780 3300048909 Bacteria 1798
615 Ga0496106_0346089 3300048909 Bacteria 1194
616 Ga0496107_0117099 3300048910 Bacteria 1961
617 Ga0496107_0694773 3300048910 Bacteria 748
618 Ga0496108_0001206 3300048911 Bacteria 20278
619 Ga0496108_0012291 3300048911 Bacteria 6964
620 Ga0496108_0030082 3300048911 Bacteria 4501
621 Ga0496108_0032059 3300048911 Bacteria 4362
622 Ga0496108_0057791 3300048911 Bacteria 3259
623 Ga0496108_0235302 3300048911 Bacteria 1593
624 Ga0496109_0000201 3300048912 Bacteria 59452
625 Ga0496109_0005985 3300048912 Bacteria 10216
626 Ga0496109_0014074 3300048912 Bacteria 6955
627 Ga0496109_0082013 3300048912 Bacteria 2972
628 Ga0496110_0000578 3300048913 Bacteria 25127
629 Ga0496110_0007681 3300048913 Bacteria 8628
630 Ga0496110_0057478 3300048913 Bacteria 3424
631 Ga0496110_0367867 3300048913 Bacteria 1310
632 Ga0496111_0034908 3300048914 Bacteria 3592
633 Ga0496111_0073640 3300048914 Bacteria 2487
634 Ga0496111_0176022 3300048914 Bacteria 1590
635 Ga0496111_0310100 3300048914 Bacteria 1169
636 Ga0496112_0000009 3300048915 Bacteria 299708
637 Ga0496112_0002812 3300048915 Bacteria 14129
638 Ga0496112_0012427 3300048915 Bacteria 7828
639 Ga0496112_0101393 3300048915 Bacteria 2848
640 Ga0496112_0547135 3300048915 Bacteria 1091
641 Ga0496113_0001268 3300048916 Bacteria 13916
642 Ga0496113_0001356 3300048916 Bacteria 13562
643 Ga0496113_0045884 3300048916 Bacteria 3243
644 Ga0496113_0055600 3300048916 Bacteria 2967
645 Ga0496114_0031108 3300048917 Bacteria 4391
646 Ga0496115_0000528 3300048918 Bacteria 29725
647 Ga0496115_0011483 3300048918 Bacteria 6641
648 Ga0496115_0032531 3300048918 Bacteria 4114
649 Ga0496115_0082432 3300048918 Bacteria 2620
650 Ga0496115_0137975 3300048918 Bacteria 2011
651 Ga0496116_0035861 3300048919 Bacteria 3479
652 Ga0496116_0081559 3300048919 Bacteria 2005
653 Ga0496117_0008274 3300048920 Bacteria 9903
654 Ga0496117_0009682 3300048920 Bacteria 8913
655 Ga0496117_0041154 3300048920 Bacteria 3389
656 Ga0496117_0134558 3300048920 Bacteria 1492
657 Ga0496118_0006468 3300048921 Bacteria 12866
658 Ga0496118_0213075 3300048921 Bacteria 1132
659 Ga0496120_0013523 3300048923 Bacteria 5491
660 Ga0496120_0052867 3300048923 Bacteria 2311
661 Ga0496121_0000001 3300048924 Bacteria 1830318
662 Ga0496121_0002243 3300048924 Bacteria 30120
663 Ga0496121_0002708 3300048924 Bacteria 26478
664 Ga0496121_0055410 3300048924 Bacteria 3303
665 Ga0496121_0164105 3300048924 Bacteria 1621
666 Ga0496121_0237642 3300048924 Bacteria 1272
667 Ga0496121_0298541 3300048924 Bacteria 1094
668 Ga0496122_0057942 3300048925 Bacteria 2872
669 Ga0496122_0231376 3300048925 Bacteria 1050
670 Ga0496123_0037776 3300048926 Bacteria 3404
671 Ga0496123_0087264 3300048926 Bacteria 1867
672 Ga0496124_0009457 3300048927 Bacteria 10037
673 Ga0496125_0000001 3300048928 Bacteria 1766138
674 Ga0496125_0034392 3300048928 Bacteria 4468
675 Ga0496125_0048127 3300048928 Bacteria 3559
676 Ga0496125_0063266 3300048928 Bacteria 2952
677 Ga0496125_0110227 3300048928 Bacteria 1996
678 Ga0496125_0304680 3300048928 Bacteria 974
679 Ga0496126_0001585 3300048929 Bacteria 34700
680 Ga0496126_0012277 3300048929 Bacteria 8791
681 Ga0496126_0030328 3300048929 Bacteria 5124
682 Ga0496126_0036403 3300048929 Bacteria 4603
683 Ga0496126_0049624 3300048929 Bacteria 3830
684 Ga0496126_0084889 3300048929 Bacteria 2792
685 Ga0496126_0102600 3300048929 Bacteria 2500
686 Ga0496126_0107203 3300048929 Bacteria 2437
687 Ga0496126_0199052 3300048929 Bacteria 1693
688 Ga0496126_0261527 3300048929 Bacteria 1439
689 Ga0496126_0360947 3300048929 Bacteria 1186
690 Ga0496126_0475118 3300048929 Bacteria 1002
691 Ga0495682_0091903 3300049460 Bacteria 1090
692 Ga0501031_0003646 3300049568 Bacteria 9911
693 Ga0501031_0007682 3300049568 Bacteria 7018
694 Ga0501031_0058711 3300049568 Bacteria 2507
695 Ga0501031_0096091 3300049568 Bacteria 1933
696 Ga0501032_0000273 3300049569 Bacteria 43466
697 Ga0501032_0014051 3300049569 Bacteria 5679
698 Ga0501032_0027107 3300049569 Bacteria 3939
699 Ga0501032_0197211 3300049569 Bacteria 1314
700 Ga0501033_0000914 3300049570 Bacteria 26957
701 Ga0501033_0005767 3300049570 Bacteria 9745
702 Ga0501033_0116629 3300049570 Bacteria 1940
703 Ga0501033_0169279 3300049570 Bacteria 1569
704 Ga0501034_0000175 3300049571 Bacteria 119465
705 Ga0501036_0000158 3300049572 Bacteria 44516
706 Ga0501036_0130677 3300049572 Bacteria 2120
707 Ga0501036_0218974 3300049572 Bacteria 1599
708 Ga0501037_0000126 3300049573 Bacteria 71116
709 Ga0501037_0000476 3300049573 Bacteria 32421
710 Ga0501037_0073405 3300049573 Bacteria 2487
711 Ga0501038_0000034 3300049574 Bacteria 128854
712 Ga0501038_0010386 3300049574 Bacteria 8514
713 Ga0501038_0045437 3300049574 Bacteria 3812
714 Ga0501039_0034561 3300049575 Bacteria 3901
715 Ga0501039_0323752 3300049575 Bacteria 1211
716 Ga0501040_0146295 3300049576 Bacteria 1666
717 Ga0501041_0031672 3300049577 Bacteria 3196
718 Ga0501042_0001807 3300049578 Bacteria 12820
719 Ga0501042_0043526 3300049578 Bacteria 3197
720 Ga0501043_0007605 3300049579 Bacteria 8592
721 Ga0501043_0012802 3300049579 Bacteria 6558
722 Ga0501043_0046455 3300049579 Bacteria 3414
723 Ga0501043_0077394 3300049579 Bacteria 2613
724 Ga0501043_0087125 3300049579 Bacteria 2454
725 Ga0501043_0271238 3300049579 Bacteria 1302
726 Ga0501046_0016164 3300049580 Bacteria 6257
727 Ga0501046_0052091 3300049580 Bacteria 3227
728 Ga0501047_0000255 3300049581 Bacteria 62993
729 Ga0501047_0002820 3300049581 Bacteria 16496
730 Ga0501047_0053662 3300049581 Bacteria 3898
731 Ga0501047_0092561 3300049581 Bacteria 2901
732 Ga0501047_0244639 3300049581 Bacteria 1643
733 Ga0501048_0002884 3300049582 Bacteria 13122
734 Ga0501048_0007019 3300049582 Bacteria 8558
735 Ga0501067_0002077 3300049583 Bacteria 11031
736 Ga0501067_0003267 3300049583 Bacteria 8928
737 Ga0501068_0012997 3300049584 Bacteria 4730
738 Ga0501068_0030639 3300049584 Bacteria 3192
739 Ga0501069_0003837 3300049585 Bacteria 7747
740 Ga0501069_0005663 3300049585 Bacteria 6506
741 Ga0501070_0001459 3300049586 Bacteria 21155
742 Ga0501070_0004542 3300049586 Bacteria 11911
743 Ga0501070_0172835 3300049586 Bacteria 1779
744 Ga0501070_0253628 3300049586 Bacteria 1439
745 Ga0501070_0320673 3300049586 Bacteria 1260
746 Ga0501070_0365200 3300049586 Bacteria 1170
747 Ga0501071_0017836 3300049587 Bacteria 4905
748 Ga0501072_0009104 3300049588 Bacteria 7540
749 Ga0501072_0034878 3300049588 Bacteria 3942
750 Ga0501073_0000035 3300049589 Bacteria 94077
751 Ga0501073_0007705 3300049589 Bacteria 7992
752 Ga0501073_0072904 3300049589 Bacteria 2391
753 Ga0501074_0000543 3300049590 Bacteria 23250
754 Ga0501074_0126050 3300049590 Bacteria 1831
755 Ga0501079_0032645 3300049741 Bacteria 4003
756 Ga0501079_0067161 3300049741 Bacteria 2767
757 Ga0501079_0141135 3300049741 Bacteria 1877
758 Ga0501080_0000911 3300049742 Bacteria 24227
759 Ga0501080_0006146 3300049742 Bacteria 10774
760 Ga0501080_0067267 3300049742 Bacteria 3332
761 Ga0501080_0092942 3300049742 Bacteria 2801
762 Ga0501080_0220630 3300049742 Bacteria 1735
763 Ga0501081_0095211 3300049743 Bacteria 2099
764 Ga0501083_0005638 3300049744 Bacteria 8863
765 Ga0501083_0019181 3300049744 Bacteria 4763
766 Ga0501035_0000319 3300049822 Bacteria 55737
767 Ga0501035_0001024 3300049822 Bacteria 29439
768 Ga0501035_0023494 3300049822 Bacteria 5655
769 Ga0501035_0255004 3300049822 Bacteria 1488
770 Ga0501035_0312230 3300049822 Bacteria 1322
771 Ga0501044_0000061 3300049823 Bacteria 133207
772 Ga0501044_0024290 3300049823 Bacteria 6438
773 Ga0501044_0035700 3300049823 Bacteria 5204
774 Ga0501044_0039475 3300049823 Bacteria 4925
775 Ga0501044_0523303 3300049823 Bacteria 1085
776 Ga0501044_0921400 3300049823 Bacteria 748
777 Ga0501045_0046427 3300049824 Bacteria 3163
778 nmdc:mga00v17_38647_c1 3300050491 Bacteria 2855
779 nmdc:mga00v17_71209_c1 3300050491 Bacteria 2155
780 nmdc:mga0rr50_120291_c1 3300050513 Bacteria 2089
781 nmdc:mga08x19_4420_c1 3300050514 Bacteria 8333
782 nmdc:mga0sz30_172352_c1 3300050516 Bacteria 959
783 nmdc:mga0sz30_26303_c1 3300050516 Bacteria 2385
784 Ga0495601_0012797 3300053077 Bacteria 5036
785 Ga0495601_0020511 3300053077 Bacteria 4037
786 Ga0495601_0092187 3300053077 Bacteria 1951
787 Ga0495612_0003344 3300053078 Bacteria 6643
788 Ga0495612_0008915 3300053078 Bacteria 4067
789 Ga0495612_0037453 3300053078 Bacteria 1970
790 Ga0500635_0004071 3300053080 Bacteria 3737
791 Ga0500635_0028962 3300053080 Bacteria 1773
792 Ga0495655_0006946 3300053083 Bacteria 2083
793 Ga0495595_0000225 3300053084 Bacteria 22503
794 Ga0495595_0014528 3300053084 Bacteria 3343
795 Ga0495595_0031315 3300053084 Bacteria 2390
796 Ga0495619_0003532 3300053085 Bacteria 10085
797 Ga0495619_0069038 3300053085 Bacteria 2361
798 Ga0495619_0090951 3300053085 Bacteria 2066
799 Ga0495619_0189124 3300053085 Bacteria 1425
800 Ga0495619_0222557 3300053085 Bacteria 1307
801 Ga0500578_0039793 3300053086 Bacteria 3021
802 Ga0500644_0011834 3300053088 Bacteria 2395
803 Ga0500647_0132385 3300053091 Bacteria 1175
804 Ga0500566_0000951 3300053094 Bacteria 16642
805 Ga0500566_0024630 3300053094 Bacteria 3531
806 Ga0500640_001381 3300053095 Bacteria 7313
807 Ga0500641_0042152 3300053096 Bacteria 1849
808 Ga0500650_0107777 3300053098 Bacteria 1301
809 Ga0500554_003396 3300053102 Bacteria 3256
810 Ga0500554_067289 3300053102 Bacteria 1160
811 Ga0500569_060064 3300053109 Bacteria 1171
812 Ga0500572_000425 3300053111 Bacteria 14822
813 Ga0500595_002192 3300053119 Bacteria 9918
814 Ga0500595_002446 3300053119 Bacteria 9204
815 Ga0500595_006319 3300053119 Bacteria 5041
816 Ga0500595_012858 3300053119 Bacteria 3221
817 Ga0500595_084312 3300053119 Bacteria 926
818 Ga0500608_008861 3300053122 Bacteria 4249
819 Ga0500614_006190 3300053123 Bacteria 2513
820 Ga0500626_105196 3300053128 Bacteria 1226
821 Ga0500642_0027553 3300053130 Bacteria 2334
822 Ga0500655_003338 3300053133 Bacteria 2905
823 Ga0500559_0000574 3300053136 Bacteria 25178
824 Ga0500559_0002746 3300053136 Bacteria 8928
825 Ga0500559_0003351 3300053136 Bacteria 7927
826 Ga0500568_0001771 3300053139 Bacteria 13330
827 Ga0500568_0018059 3300053139 Bacteria 3097
828 Ga0500573_0001192 3300053140 Bacteria 12152
829 Ga0500573_0019429 3300053140 Bacteria 3886
830 Ga0500573_0021180 3300053140 Bacteria 3724
831 Ga0500590_060820 3300053148 Bacteria 1898
832 Ga0500603_000256 3300053150 Bacteria 14013
833 Ga0500603_000419 3300053150 Bacteria 11022
834 Ga0500603_007947 3300053150 Bacteria 2339
835 Ga0500604_0104992 3300053151 Bacteria 934
836 Ga0500616_0021370 3300053153 Bacteria 3630
837 Ga0500619_042928 3300053154 Bacteria 1436
838 Ga0500622_0002624 3300053156 Bacteria 12786
839 Ga0500622_0013188 3300053156 Bacteria 4461
840 Ga0500624_005422 3300053157 Bacteria 1696
841 Ga0500627_0012577 3300053158 Bacteria 3178
842 Ga0500630_000417 3300053159 Bacteria 18274
843 Ga0500633_0004402 3300053160 Bacteria 3225
844 Ga0500638_000928 3300053162 Bacteria 8341
845 Ga0500638_025774 3300053162 Bacteria 2813
846 Ga0500638_093059 3300053162 Bacteria 1417
847 Ga0500639_000075 3300053163 Bacteria 45979
848 Ga0500636_0073851 3300053177 Bacteria 1974
849 Ga0500636_0231457 3300053177 Bacteria 955
850 Ga0500637_0000344 3300053178 Bacteria 17596
851 Ga0500596_000206 3300053735 Bacteria 9839
852 Ga0500596_002064 3300053735 Bacteria 4000
853 Ga0501084_0017189 3300054114 Bacteria 6009
854 Ga0501084_0077665 3300054114 Bacteria 2783
855 Ga0501082_0003295 3300060353 Bacteria 14092
856 Ga0501082_0031358 3300060353 Bacteria 4582
857 Ga0501082_0547762 3300060353 Bacteria 1012
858 2904696288 2904690495 Bacteria 9412302
859 2511394307 2511231028 Bacteria 8046582
860 2513646710 2513237095 Bacteria 8976980
861 2513656744 2513237096 Bacteria 8722461
862 2513672213 2513237098 Bacteria 9902361
863 2513857930 2513237137 Bacteria 9558895
864 2513892764 2513237141 Bacteria 8496279
865 2513909764 2513237144 Bacteria 7530820
866 2513917929 2513237145 Bacteria 8979722
867 2513926534 2513237146 Bacteria 7166346
868 2514010860 2513237161 Bacteria 8871253
869 2517893028 2517572143 Bacteria 9484767
870 2524465232 2524023210 Bacteria 9029266
871 2524536860 2524023228 Bacteria 10118060
872 2528854807 2528768022 Bacteria 10457665
873 2599418035 2599185170 Bacteria 7295545
874 2603858898 2602042107 Bacteria 6226103
875 2617376416 2617270741 Bacteria 8201522
876 2644288370 2643221651 Bacteria 4798932
877 2671117649 2667528175 Bacteria 7532676
878 2719665237 2718217997 Bacteria 6740740
879 2720491657 2718218199 Bacteria 6740745
880 2720612911 2718218232 Bacteria 6720332
881 2720619770 2718218233 Bacteria 6662049
882 2720631201 2718218235 Bacteria 6630699
883 2720774928 2718218269 Bacteria 6906114
884 2723026565 2721755556 Bacteria 6745503
885 2723560169 2721755684 Bacteria 6859907
886 2723566748 2721755685 Bacteria 6704835
887 2724089535 2721755819 Bacteria 6906405
888 2724104013 2721755822 Bacteria 6726041
889 2724109829 2721755823 Bacteria 6752556
890 2728750406 2728368998 Bacteria 8720350
891 2730107501 2728369352 Bacteria 6745171
892 2776913266 2775507049 Bacteria 6284736
893 2793070136 2791355197 Bacteria 8420563
894 2793297161 2791355256 Bacteria 6798008
895 2805919797 2802429603 Bacteria 8777136
896 2805927592 2802429605 Bacteria 6875453
897 2805936067 2802429606 Bacteria 6346811
898 2838018765 2838016132 Bacteria 6577831
899 2838040973 2838035591 Bacteria 7166484
900 2838052163 2838048938 Bacteria 6044578
901 2838067921 2838061910 Bacteria 6794874
902 2838071332 2838068647 Bacteria 6208656
903 2838666182 2838661181 Bacteria 7385261
904 2838670034 2838668709 Bacteria 6671819
905 2838702406 2838701080 Bacteria 6669771
906 2841864952 2841864319 Bacteria 6742987
907 2842039698 2842038055 Bacteria 8002051
908 2842047356 2842045827 Bacteria 8006841
909 2842147049 2842146304 Bacteria 5957337
910 2842197046 2842192696 Bacteria 6147454
911 2842252114 2842250916 Bacteria 6579627
912 2842267562 2842264693 Bacteria 6472963
913 2842287535 2842285085 Bacteria 6011953
914 2842315389 2842311132 Bacteria 6616990
915 2842318295 2842317721 Bacteria 6793725
916 2842346944 2842341865 Bacteria 7003929
917 2842404936 2842402390 Bacteria 6681310
918 2842411518 2842409023 Bacteria 6687331
919 2842418031 2842415677 Bacteria 6596907
920 2842425011 2842422224 Bacteria 6239196
921 2842431860 2842428310 Bacteria 6767288
922 2842437973 2842434925 Bacteria 6502746
923 2842444787 2842441272 Bacteria 6769273
924 2842451704 2842447887 Bacteria 6754142
925 2842465836 2842462802 Bacteria 6588055
926 2842472590 2842469257 Bacteria 6752936
927 2842492724 2842489311 Bacteria 6620893
928 2842496566 2842495871 Bacteria 6820686
929 2876809084 2876808645 Bacteria 8824342
930 2879118458 2879110137 Bacteria 8907982
931 2885375406 2885374607 Bacteria 8927485
932 2885384981 2885383462 Bacteria 9473874
933 2893068413 2893066018 Bacteria 6158120
934 2899807550 2899803654 Bacteria 5577784
935 2903751932 2903748898 Bacteria 9972761
936 2903776387 2903768456 Bacteria 9749579
937 2904702634
938 2906617969
939 2906642707 2906635258 Bacteria 8601019
940 2906661462 2906660503 Bacteria 8595048
941 2908743418 2908739725 Bacteria 8628932
942 2908760925 2908756301 Bacteria 8864324
943 2919075393 2919073203 Bacteria 6531949
944 2922392451 2922386360 Bacteria 7017218
945 2922429478
946 2929139930 2929138655 Bacteria 5810547
947 2932796564 2932794094 Bacteria 7915132
948 2932803442 2932801729 Bacteria 7987968
949 2933017553 2933016740 Bacteria 6355406
950 2933602131 2933599457 Bacteria 5858799
951 2935633657 2935630451 Bacteria 8169952
952 2935886513 2935883170 Bacteria 7964738
953 2941510548 2941507105 Bacteria 8166816
954 2941517713 2941515067 Bacteria 8166720
955 2941525730 2941523033 Bacteria 8169134
956 3005409675 3005409236 Bacteria 7188837
957 3005479633 3005474847 Bacteria 9259049
958 8005288248 8005282627 Bacteria 6675747
959 8005294771 8005289223 Bacteria 6634003
960 8005436136 8005430974 Bacteria 6689030
961 8005499870 8005497431 Bacteria 6477605
962 8005621238 8005619151 Bacteria 7030230
963 8005631462 8005626139 Bacteria 6534237
964 8005671288 8005668836 Bacteria 6953162
965 8006941486 8006933436 Bacteria 10410654
966 8006981198 8006973647 Bacteria 10679141
967 8019557391 8019555841 Bacteria 9642137
968 8019567910 8019565922 Bacteria 9639779
969 8019601835 8019597564 Bacteria 10041141
970 8024505188 8024501048 Bacteria 6427847
971 8056683359 8056681323 Bacteria 8472857
972 8056690124 8056689827 Bacteria 6712655
973 JGI25155J39150_1000011
974 JGI25156J39149_1000027
975 JGI25156J39149_1000030
976 JGI25162J39368_1002279
977 JGI25154J39366_1000057
978 JGI25157J39369_1000010
979 JGI25406J46586_10000070
980 JGI25406J46586_10003047
981 JGI25406J46586_10018431
982 JGI25165J46597_1001792
983 JGI25153J46596_10010551
984 JGI25160J50197_1008364
985 JGI25160J50197_1008754
986 JGI25404J52841_10000116
987 JGI25404J52841_10001163
988 Ga0055524_1016278
989 Ga0055524_1019303
990 Ga0055524_1029987
991 Ga0055528_1006461
992 Ga0055531_10007514
993 Ga0055543_1005252
994 Ga0065165_1007304
995 Ga0065165_1022430
996 Ga0070658_10137963
997 Ga0070658_10569759
998 Ga0070683_100006551
999 Ga0070683_100013368
1000 Ga0070683_100014283
1001 Ga0068869_100189427
1002 Ga0070680_100011442
1003 Ga0070680_100023908
1004 Ga0070680_100306071
1005 Ga0070682_100138662
1006 Ga0070682_100149109
1007 Ga0068868_100024123
1008 Ga0070660_100008040
1009 Ga0070660_100103114
1010 Ga0070691_10221549
1011 Ga0070661_100470866
1012 Ga0070668_100005342
1013 Ga0070671_100086709
1014 Ga0070671_100100233
1015 Ga0070673_100286700
1016 Ga0070709_10000310
1017 Ga0070709_10031725
1018 Ga0070709_10182392
1019 Ga0070714_100008130
1020 Ga0070714_100042796
1021 Ga0070713_100021728
1022 Ga0070713_100030030
1023 Ga0070713_100115699
1024 Ga0070713_100150200
1025 Ga0070713_100204497
1026 Ga0070713_100266642
1027 Ga0070713_100375896
1028 Ga0070710_10003001
1029 Ga0070710_10005946
1030 Ga0070710_10013542
1031 Ga0070710_10013756
1032 Ga0070711_100007725
1033 Ga0070711_100014986
1034 Ga0070711_100066115
1035 Ga0070708_100349258
1036 Ga0070663_100038934
1037 Ga0070663_100091183
1038 Ga0070678_100233421
1039 Ga0070678_100376999
1040 Ga0070681_10062013
1041 Ga0070681_10120655
1042 Ga0070681_10361193
1043 Ga0070698_100336120
1044 Ga0070679_100023927
1045 Ga0070679_100378437
1046 Ga0070684_100012368
1047 Ga0070684_100106419
1048 Ga0070684_100176277
1049 Ga0070697_100412396
1050 Ga0068853_100010883
1051 Ga0068853_100011456
1052 Ga0068853_100102014
1053 Ga0068853_100246035
1054 Ga0070693_100081143
1055 Ga0070665_100149718
1056 Ga0070665_100398255
1057 Ga0068855_100038066
1058 Ga0068855_100083944
1059 Ga0068855_100105358
1060 Ga0068855_100235270
1061 Ga0068855_100283484
1062 Ga0068855_100492181
1063 Ga0068857_100006838
1064 Ga0068857_100052409
1065 Ga0068854_100027544
1066 Ga0068856_100006824
1067 Ga0068852_100007152
1068 Ga0068852_100327976
1069 Ga0068852_100449513
1070 Ga0068851_10009128
1071 Ga0068858_100154655
1072 Ga0068860_100000469
1073 Ga0081455_10005182
1074 Ga0081455_10010602
1075 Ga0081455_10020599
1076 Ga0081540_1000194
1077 Ga0081540_1004830
1078 Ga0081540_1044943
1079 Ga0081539_10000250
1080 Ga0081539_10000269
1081 Ga0070717_10002902
1082 Ga0070717_10211271
1083 Ga0075364_10073751
1084 Ga0070712_100010474
1085 Ga0070712_100016083
1086 Ga0070712_100069625
1087 Ga0070712_100083278
1088 Ga0070712_100194091
1089 Ga0075367_10348013
1090 Ga0075369_10000673
1091 Ga0075369_10003758
1092 Ga0075369_10027572
1093 Ga0097621_100098471
1094 Ga0075434_100026275
1095 Ga0075434_100048322
1096 Ga0068865_100262939
1097 Ga0075436_100012308
1098 Ga0099824_1024504
1099 Ga0099822_1001268
1100 Ga0099823_1033009
1101 Ga0099794_10018633
1102 Ga0099794_10074857
1103 Ga0099795_10007245
1104 Ga0099795_10022566
1105 Ga0099795_10135524
1106 Ga0105250_10048216
1107 Ga0105240_10013520
1108 Ga0105240_10083717
1109 Ga0105240_10210667
1110 Ga0105240_10250326
1111 Ga0105245_10033536
1112 Ga0105245_10192066
1113 Ga0105245_10655061
1114 Ga0105247_10204573
1115 Ga0105247_10392264
1116 Ga0105247_10417599
1117 Ga0105241_10047312
1118 Ga0105241_10096542
1119 Ga0105241_10325928
1120 Ga0105242_10102162
1121 Ga0105242_10122393
1122 Ga0105248_10071650
1123 Ga0105248_10298507
1124 Ga0105248_10332398
1125 Ga0105237_10013053
1126 Ga0105237_10078218
1127 Ga0105237_10128390
1128 Ga0105237_10152321
1129 Ga0105237_10177506
1130 Ga0105238_10013890
1131 Ga0105238_10040291
1132 Ga0105238_10061026
1133 Ga0105238_10178225
1134 Ga0105249_10237164
1135 Ga0123342_1010917
1136 Ga0099796_10019663
1137 Ga0099796_10027048
1138 Ga0099796_10062739
1139 Ga0105239_10006580
1140 Ga0105239_10137458
1141 Ga0105239_10296739
1142 Ga0105239_10321912
1143 Ga0105246_10001020
1144 Ga0105246_10049935
1145 Ga0157370_10060974
1146 Ga0157370_10095170
1147 Ga0157369_10010618
1148 Ga0157369_10013468
1149 Ga0157369_10016315
1150 Ga0157374_10014119
1151 Ga0163162_10058709
1152 Ga0163162_10253578
1153 Ga0163162_10572396
1154 Ga0157375_10007265
1155 Ga0157375_10093773
1156 Ga0163163_10039525
1157 Ga0163163_10060338
1158 Ga0163163_10082533
1159 Ga0163163_10244970
1160 Ga0157379_10117978
1161 Ga0157379_10214304
1162 Ga0157376_10003464
1163 Ga0214544_1000009
1164 Ga0214542_1000002
1165 Ga0214545_1000002
1166 Ga0214543_1000011
1167 Ga0214543_1000013
1168 Ga0213874_10004378
1169 Ga0213876_10004782
1170 Ga0209435_100022
1171 Ga0209437_100310
1172 Ga0209646_1000078
1173 Ga0209026_1000065
1174 Ga0209759_1000055
1175 Ga0209233_1000594
1176 Ga0209233_1013319
1177 Ga0209673_1018254
1178 Ga0209673_1024757
1179 Ga0209130_1009475
1180 Ga0209025_1011109
1181 Ga0209025_1027154
1182 Ga0209564_1004055
1183 Ga0209564_1009468
1184 Ga0209564_1021588
1185 Ga0209564_1045525
1186 Ga0209758_1000021
1187 Ga0209758_1012306
1188 Ga0209256_1006335
1189 Ga0209256_1007922
1190 Ga0209256_1016885
1191 Ga0209256_1034176
1192 Ga0207426_1000352
1193 Ga0207426_1000854
1194 Ga0207426_1019301
1195 Ga0207656_10036565
1196 Ga0207682_10167539
1197 Ga0207692_10010453
1198 Ga0207692_10014687
1199 Ga0207710_10179528
1200 Ga0207688_10182726
1201 Ga0207699_10002283
1202 Ga0207699_10050465
1203 Ga0207699_10282184
1204 Ga0207643_10124029
1205 Ga0207705_10112367
1206 Ga0207654_10001822
1207 Ga0207654_10100216
1208 Ga0207707_10001692
1209 Ga0207707_10010614
1210 Ga0207695_10000402
1211 Ga0207695_10047854
1212 Ga0207695_10111595
1213 Ga0207671_10011788
1214 Ga0207671_10331047
1215 Ga0207671_10401098
1216 Ga0207693_10009963
1217 Ga0207693_10019275
1218 Ga0207693_10023378
1219 Ga0207693_10025304
1220 Ga0207693_10036543
1221 Ga0207693_10044359
1222 Ga0207663_10001328
1223 Ga0207663_10111235
1224 Ga0207660_10132693
1225 Ga0207657_10003043
1226 Ga0207657_10018606
1227 Ga0207657_10180860
1228 Ga0207657_10270483
1229 Ga0207652_10014144
1230 Ga0207652_10203913
1231 Ga0207646_10540065
1232 Ga0207694_10001125
1233 Ga0207694_10007985
1234 Ga0207694_10013513
1235 Ga0207694_10068895
1236 Ga0207659_10057139
1237 Ga0207687_10394115
1238 Ga0207700_10061785
1239 Ga0207700_10093155
1240 Ga0207700_10205203
1241 Ga0207700_10247016
1242 Ga0207664_10029111
1243 Ga0207664_10095350
1244 Ga0207644_10105416
1245 Ga0207704_10047009
1246 Ga0207704_10237674
1247 Ga0207665_10016296
1248 Ga0207665_10067322
1249 Ga0207665_10074733
1250 Ga0207665_10147109
1251 Ga0207665_10199248
1252 Ga0207665_10289180
1253 Ga0207691_10368920
1254 Ga0207711_10389757
1255 Ga0207689_10186246
1256 Ga0207661_10002409
1257 Ga0207661_10010713
1258 Ga0207661_10117278
1259 Ga0207667_10011695
1260 Ga0207667_10028182
1261 Ga0207667_10351139
1262 Ga0207667_10387139
1263 Ga0207651_10271838
1264 Ga0207712_10345666
1265 Ga0207640_10031645
1266 Ga0207640_10051574
1267 Ga0207640_10540288
1268 Ga0207677_10048467
1269 Ga0207639_10018267
1270 Ga0207639_10048165
1271 Ga0207639_10171061
1272 Ga0207678_10024581
1273 Ga0207678_10110444
1274 Ga0207702_10000025
1275 Ga0207702_10000075
1276 Ga0207702_10122437
1277 Ga0207702_10391099
1278 Ga0207676_10021699
1279 Ga0207674_10003345
1280 Ga0207674_10008172
1281 Ga0207674_10059101
1282 Ga0207674_10197480
1283 Ga0207683_10008466
1284 Ga0207683_10018149
1285 Ga0207683_10343157
1286 Ga0207698_10031132
1287 Ga0207698_10036174
1288 Ga0207698_10073533
1289 Ga0207698_10090063
1290 Ga0207698_10101166
1291 Ga0209389_1000026
1292 Ga0209389_1000117
1293 Ga0209589_1000003
1294 Ga0209589_1000022
1295 Ga0209489_100003
1296 Ga0209489_100058
1297 Ga0209489_105776
1298 Ga0209700_100003
1299 Ga0209700_100021
1300 Ga0209179_1000519
1301 Ga0209588_1027652
1302 Ga0209588_1039063
1303 Ga0268266_10040338
1304 Ga0268266_10108521
1305 Ga0268266_10196336
1306 Ga0268266_10247313
1307 Ga0268264_10000022
1308 Ga0307517_10000111
1309 Ga0307515_10001215
1310 Ga0265332_10015585
1311 Ga0265325_10003304
1312 Ga0265340_10011918
1313 Ga0265339_10041083
1314 Ga0307513_10459117
1315 Ga0307509_10041596
1316 Ga0307509_10073995
1317 Ga0307508_10000515
1318 Ga0307508_10139942
1319 Ga0307508_10187206
1320 Ga0265314_10023185
1321 Ga0265314_10037042
1322 Ga0265314_10049893
1323 Ga0265314_10183469
1324 Ga0265342_10018556
1325 Ga0265342_10028442
1326 Ga0265342_10131712
1327 Ga0265342_10185106
1328 Ga0307516_10018947
1329 Ga0307507_10118283
1330 Ga0307507_10264310
1331 Ga0307510_10019345
1332 Ga0315911_1000001
1333 Ga0373926_0030368
1334 Ga0373926_0083654
1335 Ga0373929_0024203
1336 Ga0373934_0004274
1337 Ga0373934_0113757
1338 Ga0373923_0000310
1339 Ga0373936_0005876
1340 Ga0373936_0015755
1341 Ga0373945_0002999
1342 Ga0373953_0002273
1343 Ga0373954_0000035
1344 Ga0373954_0021760
1345 Ga0373954_0029454
1346 Ga0373954_0066288
1347 Ga0373956_0000798
1348 Ga0373956_0006725
1349 Ga0373957_0007552
1350 Ga0373957_0048788
1351 Ga0373946_0007829
1352 Ga0373946_0027108
1353 Ga0373955_0010436
1354 Ga0373955_0015377
1355 Ga0373955_0022680
1356 Ga0373924_0011073
1357 Ga0373931_0023783
1358 Ga0373931_0025759
1359 Ga0373935_0199533
1360 Ga0373935_0217665
1361 Ga0373927_0000055
1362 Ga0373927_0007107
1363 Ga0373927_0009804
1364 Ga0373927_0010862
1365 Ga0373927_0020113
1366 Ga0373927_0225088
1367 Ga0373933_0000037
1368 Ga0373947_0003833
1369 Ga0373947_0014430
1370 Ga0373947_0015479
1371 Ga0373947_0065428
1372 Ga0373947_0228706
1373 Ga0373937_0064445
1374 Ga0373937_0093056
1375 Ga0373937_0209747
1376 Ga0373937_0519163
1377 Ga0372808_002270
1378 Ga0373925_0002732
1379 Ga0373925_0022291
1380 Ga0373925_0041570
1381 Ga0373925_0066477
1382 Ga0373925_0283568
1383 Ga0395900_0004044
1384 Ga0395900_0252112
1385 Ga0395900_0777142
1386 Ga0395898_0014868
1387 Ga0395905_0015125
1388 Ga0395905_0054406
1389 Ga0395905_0170896
1390 Ga0395905_0236109
1391 Ga0436364_0713413
1392 Ga0436364_1207970
1393 Ga0395901_0026961
1394 Ga0395901_0078519
1395 Ga0395901_0436649
1396 Ga0436365_0816602
1397 Ga0436360_1185964
1398 Ga0436363_0597393
1399 Ga0436363_0990757
1400 Ga0436362_0053894
1401 Ga0436362_0386716
1402 Ga0439465_0002663
1403 Ga0451853_1526884
1404 Ga0439432_059869
1405 Ga0439449_0039829
1406 Ga0439449_0104524
1407 Ga0466972_0000125
1408 Ga0466972_0003074
1409 Ga0466963_0029408
1410 Ga0466963_0073222
1411 Ga0466963_0130819
1412 Ga0466968_0003815
1413 Ga0466968_0130373
1414 Ga0466960_0119251
1415 Ga0466960_0230327
1416 Ga0466960_0261465
1417 Ga0466967_0008029
1418 Ga0466967_0110589
1419 Ga0495592_0000406
1420 Ga0495592_0020678
1421 Ga0495592_0029619
1422 Ga0495592_0029939
1423 Ga0495603_0000011
1424 Ga0495603_0008868
1425 Ga0495603_0023363
1426 Ga0495603_0341457
1427 Ga0495629_0000382
1428 Ga0495629_0000678
1429 Ga0495629_0053747
1430 Ga0495629_0086335
1431 Ga0495638_0016433
1432 Ga0495638_0026451
1433 Ga0495638_0082443
1434 Ga0495641_0000910
1435 Ga0495651_0012419
1436 Ga0495651_0019954
1437 Ga0495651_0021239
1438 Ga0495651_0037905
1439 Ga0495651_0303209
1440 Ga0495653_0000161
1441 Ga0495580_0000174
1442 Ga0495580_0005823
1443 Ga0495605_0109787
1444 Ga0495639_0000017
1445 Ga0495639_0013479
1446 Ga0495639_0044661
1447 Ga0495662_0000549
1448 Ga0495662_0010116
1449 Ga0495664_0027870
1450 Ga0495664_0091289
1451 Ga0495664_0258601
1452 Ga0495594_0000445
1453 Ga0495607_0029223
1454 Ga0495606_0006147
1455 Ga0495606_0132410
1456 Ga0495608_0000403
1457 Ga0495608_0016022
1458 Ga0495608_0092943
1459 Ga0495616_0064932
1460 Ga0495618_0053124
1461 Ga0495618_0126789
1462 Ga0495628_0003039
1463 Ga0495628_0006463
1464 Ga0495628_0133077
1465 Ga0495630_0004919
1466 Ga0495630_0043783
1467 Ga0495643_0073713
1468 Ga0495643_0277262
1469 Ga0495648_0001444
1470 Ga0495648_0003981
1471 Ga0495648_0152062
1472 Ga0495666_0003988
1473 Ga0495652_0000604
1474 Ga0495652_0007725
1475 Ga0495652_0024880
1476 Ga0495665_0024725
1477 Ga0495640_0004435
1478 Ga0495640_0004810
1479 Ga0495640_0014243
1480 Ga0495640_0058762
1481 Ga0495586_0120638
1482 Ga0495586_0178448
1483 Ga0495587_0012949
1484 Ga0495587_0039594
1485 Ga0495609_0121429
1486 Ga0495621_0034537
1487 Ga0495645_0004657
1488 Ga0495645_0005046
1489 Ga0495645_0006519
1490 Ga0495622_0005239
1491 Ga0495622_0006151
1492 Ga0495667_0006181
1493 Ga0495667_0010646
1494 Ga0495667_0085014
1495 Ga0495656_0282399
1496 Ga0495668_0062161
1497 Ga0495634_0001440
1498 Ga0495634_0035824
1499 Ga0495634_0068211
1500 Ga0495611_0105223
1501 Ga0495625_0245226
1502 Ga0495625_0300671
1503 Ga0495635_0000133
1504 Ga0495635_0083302
1505 Ga0495635_0144259
1506 Ga0495661_0047522
1507 Ga0495588_0027330
1508 Ga0495588_0125932
1509 Ga0495657_0030199
1510 Ga0495657_0039482
1511 Ga0495657_0052105
1512 Ga0495599_0005543
1513 Ga0495599_0021687
1514 Ga0495599_0097650
1515 Ga0495599_0116018
1516 Ga0495623_0011880
1517 Ga0495623_0043749
1518 Ga0495623_0072531
1519 Ga0495623_0210258
1520 Ga0495646_0000291
1521 Ga0495646_0053411
1522 Ga0495646_0135529
1523 Ga0495647_0002310
1524 Ga0495658_0000371
1525 Ga0495658_0159500
1526 Ga0495658_0171094
1527 Ga0495669_0221824
1528 Ga0495613_0013181
1529 Ga0495613_0181733
1530 Ga0495624_0000384
1531 Ga0495624_0153750
1532 Ga0495671_0141834
1533 Ga0495600_0010426
1534 Ga0495600_0026213
1535 Ga0495600_0050610
1536 Ga0495600_0191323
1537 Ga0495581_0000361
1538 Ga0495581_0048972
1539 Ga0495581_0075233
1540 Ga0495581_0088964
1541 Ga0495604_0010123
1542 Ga0495604_0025605
1543 Ga0495604_0185100
1544 Ga0495674_0001034
1545 Ga0495674_0037678
1546 Ga0495674_0041943
1547 Ga0495674_0174811
1548 Ga0495672_0044951
1549 Ga0495672_0115352
1550 Ga0495676_0047317
1551 Ga0495680_0006723
1552 Ga0495680_0037759
1553 Ga0495680_0080400
1554 Ga0495675_0037589
1555 Ga0495675_0125446
1556 Ga0495675_0149928
1557 Ga0495684_0002274
1558 Ga0495684_0018553
1559 Ga0495684_0162408
1560 Ga0495686_0050929
1561 Ga0495686_0139342
1562 Ga0495686_0158587
1563 Ga0495593_0000077
1564 Ga0495593_0002962
1565 Ga0495593_0070275
1566 Ga0495602_0020070
1567 Ga0495602_0181878
1568 Ga0495614_0063156
1569 Ga0496100_0032337
1570 Ga0496100_0148449
1571 Ga0496101_0022694
1572 Ga0496101_0130228
1573 Ga0496102_0003232
1574 Ga0496102_0612786
1575 Ga0496103_0015633
1576 Ga0496103_0027535
1577 Ga0496104_0000169
1578 Ga0496104_0012033
1579 Ga0496105_0009216
1580 Ga0496105_0016624
1581 Ga0496105_0031207
1582 Ga0496105_0032167
1583 Ga0496106_0002592
1584 Ga0496106_0020768
1585 Ga0496106_0033696
1586 Ga0496106_0156780
1587 Ga0496106_0346089
1588 Ga0496107_0117099
1589 Ga0496107_0694773
1590 Ga0496108_0001206
1591 Ga0496108_0012291
1592 Ga0496108_0030082
1593 Ga0496108_0032059
1594 Ga0496108_0057791
1595 Ga0496108_0235302
1596 Ga0496109_0000201
1597 Ga0496109_0005985
1598 Ga0496109_0014074
1599 Ga0496109_0082013
1600 Ga0496110_0000578
1601 Ga0496110_0007681
1602 Ga0496110_0057478
1603 Ga0496110_0367867
1604 Ga0496111_0034908
1605 Ga0496111_0073640
1606 Ga0496111_0176022
1607 Ga0496111_0310100
1608 Ga0496112_0000009
1609 Ga0496112_0002812
1610 Ga0496112_0012427
1611 Ga0496112_0101393
1612 Ga0496112_0547135
1613 Ga0496113_0001268
1614 Ga0496113_0001356
1615 Ga0496113_0045884
1616 Ga0496113_0055600
1617 Ga0496114_0031108
1618 Ga0496115_0000528
1619 Ga0496115_0011483
1620 Ga0496115_0032531
1621 Ga0496115_0082432
1622 Ga0496115_0137975
1623 Ga0496116_0035861
1624 Ga0496116_0081559
1625 Ga0496117_0008274
1626 Ga0496117_0009682
1627 Ga0496117_0041154
1628 Ga0496117_0134558
1629 Ga0496118_0006468
1630 Ga0496118_0213075
1631 Ga0496120_0013523
1632 Ga0496120_0052867
1633 Ga0496121_0000001
1634 Ga0496121_0002243
1635 Ga0496121_0002708
1636 Ga0496121_0055410
1637 Ga0496121_0164105
1638 Ga0496121_0237642
1639 Ga0496121_0298541
1640 Ga0496122_0057942
1641 Ga0496122_0231376
1642 Ga0496123_0037776
1643 Ga0496123_0087264
1644 Ga0496124_0009457
1645 Ga0496125_0000001
1646 Ga0496125_0034392
1647 Ga0496125_0048127
1648 Ga0496125_0063266
1649 Ga0496125_0110227
1650 Ga0496125_0304680
1651 Ga0496126_0001585
1652 Ga0496126_0012277
1653 Ga0496126_0030328
1654 Ga0496126_0036403
1655 Ga0496126_0049624
1656 Ga0496126_0084889
1657 Ga0496126_0102600
1658 Ga0496126_0107203
1659 Ga0496126_0199052
1660 Ga0496126_0261527
1661 Ga0496126_0360947
1662 Ga0496126_0475118
1663 Ga0495682_0091903
1664 Ga0501031_0003646
1665 Ga0501031_0007682
1666 Ga0501031_0058711
1667 Ga0501031_0096091
1668 Ga0501032_0000273
1669 Ga0501032_0014051
1670 Ga0501032_0027107
1671 Ga0501032_0197211
1672 Ga0501033_0000914
1673 Ga0501033_0005767
1674 Ga0501033_0116629
1675 Ga0501033_0169279
1676 Ga0501034_0000175
1677 Ga0501036_0000158
1678 Ga0501036_0130677
1679 Ga0501036_0218974
1680 Ga0501037_0000126
1681 Ga0501037_0000476
1682 Ga0501037_0073405
1683 Ga0501038_0000034
1684 Ga0501038_0010386
1685 Ga0501038_0045437
1686 Ga0501039_0034561
1687 Ga0501039_0323752
1688 Ga0501040_0146295
1689 Ga0501041_0031672
1690 Ga0501042_0001807
1691 Ga0501042_0043526
1692 Ga0501043_0007605
1693 Ga0501043_0012802
1694 Ga0501043_0046455
1695 Ga0501043_0077394
1696 Ga0501043_0087125
1697 Ga0501043_0271238
1698 Ga0501046_0016164
1699 Ga0501046_0052091
1700 Ga0501047_0000255
1701 Ga0501047_0002820
1702 Ga0501047_0053662
1703 Ga0501047_0092561
1704 Ga0501047_0244639
1705 Ga0501048_0002884
1706 Ga0501048_0007019
1707 Ga0501067_0002077
1708 Ga0501067_0003267
1709 Ga0501068_0012997
1710 Ga0501068_0030639
1711 Ga0501069_0003837
1712 Ga0501069_0005663
1713 Ga0501070_0001459
1714 Ga0501070_0004542
1715 Ga0501070_0172835
1716 Ga0501070_0253628
1717 Ga0501070_0320673
1718 Ga0501070_0365200
1719 Ga0501071_0017836
1720 Ga0501072_0009104
1721 Ga0501072_0034878
1722 Ga0501073_0000035
1723 Ga0501073_0007705
1724 Ga0501073_0072904
1725 Ga0501074_0000543
1726 Ga0501074_0126050
1727 Ga0501079_0032645
1728 Ga0501079_0067161
1729 Ga0501079_0141135
1730 Ga0501080_0000911
1731 Ga0501080_0006146
1732 Ga0501080_0067267
1733 Ga0501080_0092942
1734 Ga0501080_0220630
1735 Ga0501081_0095211
1736 Ga0501083_0005638
1737 Ga0501083_0019181
1738 Ga0501035_0000319
1739 Ga0501035_0001024
1740 Ga0501035_0023494
1741 Ga0501035_0255004
1742 Ga0501035_0312230
1743 Ga0501044_0000061
1744 Ga0501044_0024290
1745 Ga0501044_0035700
1746 Ga0501044_0039475
1747 Ga0501044_0523303
1748 Ga0501044_0921400
1749 Ga0501045_0046427
1750 nmdc:mga00v17_38647_c1
1751 nmdc:mga00v17_71209_c1
1752 nmdc:mga0rr50_120291_c1
1753 nmdc:mga08x19_4420_c1
1754 nmdc:mga0sz30_172352_c1
1755 nmdc:mga0sz30_26303_c1
1756 Ga0495601_0012797
1757 Ga0495601_0020511
1758 Ga0495601_0092187
1759 Ga0495612_0003344
1760 Ga0495612_0008915
1761 Ga0495612_0037453
1762 Ga0500635_0004071
1763 Ga0500635_0028962
1764 Ga0495655_0006946
1765 Ga0495595_0000225
1766 Ga0495595_0014528
1767 Ga0495595_0031315
1768 Ga0495619_0003532
1769 Ga0495619_0069038
1770 Ga0495619_0090951
1771 Ga0495619_0189124
1772 Ga0495619_0222557
1773 Ga0500578_0039793
1774 Ga0500644_0011834
1775 Ga0500647_0132385
1776 Ga0500566_0000951
1777 Ga0500566_0024630
1778 Ga0500640_001381
1779 Ga0500641_0042152
1780 Ga0500650_0107777
1781 Ga0500554_003396
1782 Ga0500554_067289
1783 Ga0500569_060064
1784 Ga0500572_000425
1785 Ga0500595_002192
1786 Ga0500595_002446
1787 Ga0500595_006319
1788 Ga0500595_012858
1789 Ga0500595_084312
1790 Ga0500608_008861
1791 Ga0500614_006190
1792 Ga0500626_105196
1793 Ga0500642_0027553
1794 Ga0500655_003338
1795 Ga0500559_0000574
1796 Ga0500559_0002746
1797 Ga0500559_0003351
1798 Ga0500568_0001771
1799 Ga0500568_0018059
1800 Ga0500573_0001192
1801 Ga0500573_0019429
1802 Ga0500573_0021180
1803 Ga0500590_060820
1804 Ga0500603_000256
1805 Ga0500603_000419
1806 Ga0500603_007947
1807 Ga0500604_0104992
1808 Ga0500616_0021370
1809 Ga0500619_042928
1810 Ga0500622_0002624
1811 Ga0500622_0013188
1812 Ga0500624_005422
1813 Ga0500627_0012577
1814 Ga0500630_000417
1815 Ga0500633_0004402
1816 Ga0500638_000928
1817 Ga0500638_025774
1818 Ga0500638_093059
1819 Ga0500639_000075
1820 Ga0500636_0073851
1821 Ga0500636_0231457
1822 Ga0500637_0000344
1823 Ga0500596_000206
1824 Ga0500596_002064
1825 Ga0501084_0017189
1826 Ga0501084_0077665
1827 Ga0501082_0003295
1828 Ga0501082_0031358
1829 Ga0501082_0547762
1830 2904696288
1831 2511394307
1832 2513646710
1833 2513656744
1834 2513672213
1835 2513857930
1836 2513892764
1837 2513909764
1838 2513917929
1839 2513926534
1840 2514010860
1841 2517893028
1842 2524465232
1843 2524536860
1844 2528854807
1845 2599418035
1846 2603858898
1847 2617376416
1848 2644288370
1849 2671117649
1850 2719665237
1851 2720491657
1852 2720612911
1853 2720619770
1854 2720631201
1855 2720774928
1856 2723026565
1857 2723560169
1858 2723566748
1859 2724089535
1860 2724104013
1861 2724109829
1862 2728750406
1863 2730107501
1864 2776913266
1865 2793070136
1866 2793297161
1867 2805919797
1868 2805927592
1869 2805936067
1870 2838018765
1871 2838040973
1872 2838052163
1873 2838067921
1874 2838071332
1875 2838666182
1876 2838670034
1877 2838702406
1878 2841864952
1879 2842039698
1880 2842047356
1881 2842147049
1882 2842197046
1883 2842252114
1884 2842267562
1885 2842287535
1886 2842315389
1887 2842318295
1888 2842346944
1889 2842404936
1890 2842411518
1891 2842418031
1892 2842425011
1893 2842431860
1894 2842437973
1895 2842444787
1896 2842451704
1897 2842465836
1898 2842472590
1899 2842492724
1900 2842496566
1901 2876809084
1902 2879118458
1903 2885375406
1904 2885384981
1905 2893068413
1906 2899807550
1907 2903751932
1908 2903776387
1909 2904702634
1910 2906617969
1911 2906642707
1912 2906661462
1913 2908743418
1914 2908760925
1915 2919075393
1916 2922392451
1917 2922429478
1918 2929139930
1919 2932796564
1920 2932803442
1921 2933017553
1922 2933602131
1923 2935633657
1924 2935886513
1925 2941510548
1926 2941517713
1927 2941525730
1928 3005409675
1929 3005479633
1930 8005288248
1931 8005294771
1932 8005436136
1933 8005499870
1934 8005621238
1935 8005631462
1936 8005671288
1937 8006941486
1938 8006981198
1939 8019557391
1940 8019567910
1941 8019601835
1942 8024505188
1943 8056683359
1944 8056690124

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

30

278

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7694 12 249
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.7317 16 248
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7077 12 249
5guf-assembly1.cif.gz_A-2 structural insight into an intramembrane enzyme for archaeal membrane lipids biosynthesis 0.6713 121 245
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.6589 16 248
ID Description Score Start End Superfamily
af_A0A1D6LI10_12_134_1.20.120.610 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);lithium bound rotor ring of v- atpase 0.3505 20 121 1.20.120.610
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3334 72 267 1.10.357.20
af_Q9VHP1_6_149_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.332 114 257 1.10.1760.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.329 72 267 1.10.357.20
af_Q9VHP1_6_149_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3155 114 257 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A5C7SA61-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9809 131 267 GO:0004605
GO:0005886
GO:0016024
AF-A0A5C7SA61-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.967 131 267 GO:0004605
GO:0005886
GO:0016024
AF-A0A7W5NDI3-F1-model_v4 deleted 0.9653 1 267
AF-A0A257Y219-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9632 108 265 GO:0004605
GO:0005886
GO:0016024
AF-A0A8A3K5P8-F1-model_v4 deleted 0.9618 1 267

Map