F487186

General Info

Members Datasets Scaffolds Average Seq Length
973 390 971 279

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10204586|Ga0207648_102045861
Length 319
Sequence MTELVDVVLGGTFHAAVLFLVAAGLQLVFGVQKIVNLACGSFYALGAYFGITAVGMALKLGMPAPLFFPVLTLAGLAIGLVGLPIERVLRTIYRRDESYQLLITFGFLLMFQDVFRFLWGATPRSMDNVYMAYGTTQIWGVRVPTYNLLVIAASLGIAIALGLLLERTRTGRIVRATAENRDMAEGLGVNASKIFALVFTVGCMLGTVGGALVVPSSAASLDMAVELVVEAFAVVVIGGLGSMRGALVGALIVGLMPRPVAWTGLVIAGIAELTTLVLIWPGLSPLLPLARFTGLIWLIVAGALLPLRRPNKQEATARS

Samples

Sample ID Description Type Environment
1 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
244 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
378 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
379 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
380 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
381 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
382 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
383 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
384 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
385 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
386 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
387 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
390 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0.21
Rhizoplane 6.89
Rhizosphere 88.9
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10012259 3300002075 Bacteria 1873
2 JGI24749J21850_1008546 3300002076 Bacteria 1428
3 JGI24751J29686_10002801 3300002459 Bacteria 3508
4 JGI25406J46586_10000019 3300003203 Bacteria 87589
5 JGI25153J46596_10000711 3300003215 Bacteria 20338
6 rootL2_10036865 3300003322 Bacteria 7236
7 Ga0065704_10152474 3300005289 Bacteria 1418
8 Ga0065712_10076134 3300005290 Unclassified 3721
9 Ga0065715_10001776 3300005293 Bacteria 6518
10 Ga0065707_10202224 3300005295 Bacteria 1305
11 Ga0070658_10078278 3300005327 Bacteria 2713
12 Ga0070658_10170943 3300005327 Bacteria 1826
13 Ga0070658_10204275 3300005327 Bacteria 1668
14 Ga0070676_10038120 3300005328 Bacteria 2775
15 Ga0070676_10069034 3300005328 Bacteria 2118
16 Ga0070676_10078929 3300005328 Bacteria 1992
17 Ga0070683_100315892 3300005329 Bacteria 1487
18 Ga0070690_100004954 3300005330 Bacteria 7448
19 Ga0070690_100018630 3300005330 Bacteria 4196
20 Ga0070670_100020041 3300005331 Bacteria 5744
21 Ga0070670_100087005 3300005331 Bacteria 2685
22 Ga0070670_100106383 3300005331 Bacteria 2417
23 Ga0070677_10051262 3300005333 Bacteria 1670
24 Ga0068869_100000346 3300005334 Bacteria 24854
25 Ga0068869_100009169 3300005334 Bacteria 6412
26 Ga0068869_100065766 3300005334 Bacteria 2670
27 Ga0068869_100104219 3300005334 Bacteria 2150
28 Ga0070666_10042811 3300005335 Bacteria 3030
29 Ga0070666_10065004 3300005335 Unclassified 2475
30 Ga0070666_10185721 3300005335 Bacteria 1459
31 Ga0070680_100040085 3300005336 Bacteria 3790
32 Ga0070680_100137540 3300005336 Bacteria 2047
33 Ga0070680_100199183 3300005336 Bacteria 1688
34 Ga0070680_100519073 3300005336 Bacteria 1020
35 Ga0070682_100058339 3300005337 Bacteria 2434
36 Ga0068868_100055287 3300005338 Bacteria 3131
37 Ga0070660_100003286 3300005339 Bacteria 11107
38 Ga0070660_100081795 3300005339 Bacteria 2535
39 Ga0070689_100120850 3300005340 Bacteria 2092
40 Ga0070689_100191353 3300005340 Unclassified 1666
41 Ga0070691_10023195 3300005341 Bacteria 2881
42 Ga0070661_100041809 3300005344 Bacteria 3345
43 Ga0070661_100130576 3300005344 Bacteria 1886
44 Ga0070661_100222353 3300005344 Bacteria 1449
45 Ga0070661_100222369 3300005344 Bacteria 1449
46 Ga0070668_100000210 3300005347 Bacteria 38311
47 Ga0070668_100022042 3300005347 Bacteria 4815
48 Ga0070668_100110689 3300005347 Bacteria 2186
49 Ga0070669_100000370 3300005353 Bacteria 34811
50 Ga0070669_100004359 3300005353 Bacteria 10215
51 Ga0070669_100060846 3300005353 Bacteria 2774
52 Ga0070675_100222603 3300005354 Bacteria 1644
53 Ga0070675_100321944 3300005354 Bacteria 1366
54 Ga0070671_100119489 3300005355 Bacteria 2217
55 Ga0070671_100220413 3300005355 Bacteria 1609
56 Ga0070671_100485053 3300005355 Bacteria 1062
57 Ga0070674_100000760 3300005356 Bacteria 16580
58 Ga0070674_100010572 3300005356 Bacteria 5585
59 Ga0070674_100012006 3300005356 Bacteria 5304
60 Ga0070674_100121181 3300005356 Unclassified 1937
61 Ga0070674_100271568 3300005356 Bacteria 1340
62 Ga0070673_100382113 3300005364 Bacteria 1256
63 Ga0070688_100040618 3300005365 Bacteria 2852
64 Ga0070688_100086126 3300005365 Bacteria 2043
65 Ga0070659_100032761 3300005366 Bacteria 4033
66 Ga0070659_100051064 3300005366 Bacteria 3251
67 Ga0070659_100052852 3300005366 Bacteria 3196
68 Ga0070667_100000294 3300005367 Bacteria 56218
69 Ga0070667_100208915 3300005367 Bacteria 1734
70 Ga0070667_100234809 3300005367 Bacteria 1636
71 Ga0070709_10002615 3300005434 Bacteria 9721
72 Ga0070709_10003717 3300005434 Bacteria 8199
73 Ga0070709_10007744 3300005434 Bacteria 5898
74 Ga0070714_100027177 3300005435 Bacteria 4735
75 Ga0070714_100055382 3300005435 Bacteria 3389
76 Ga0070714_100105021 3300005435 Bacteria 2493
77 Ga0070714_100108194 3300005435 Bacteria 2458
78 Ga0070714_100376131 3300005435 Bacteria 1338
79 Ga0070713_100001463 3300005436 Bacteria 15084
80 Ga0070713_100004110 3300005436 Bacteria 9698
81 Ga0070713_100036719 3300005436 Bacteria 3956
82 Ga0070713_100141866 3300005436 Bacteria 2129
83 Ga0070710_10009433 3300005437 Bacteria 4773
84 Ga0070710_10024133 3300005437 Bacteria 3205
85 Ga0070710_10024443 3300005437 Bacteria 3187
86 Ga0070701_10015036 3300005438 Bacteria 3562
87 Ga0070711_100007657 3300005439 Bacteria 6577
88 Ga0070711_100036310 3300005439 Bacteria 3301
89 Ga0070711_100110807 3300005439 Bacteria 2014
90 Ga0070711_100116241 3300005439 Bacteria 1971
91 Ga0070705_100240835 3300005440 Bacteria 1264
92 Ga0070700_100080640 3300005441 Bacteria 2100
93 Ga0070663_100005311 3300005455 Bacteria 7643
94 Ga0070663_100007370 3300005455 Bacteria 6692
95 Ga0070678_100023471 3300005456 Bacteria 4111
96 Ga0070678_100041389 3300005456 Bacteria 3266
97 Ga0070678_100044465 3300005456 Bacteria 3171
98 Ga0070662_100037565 3300005457 Bacteria 3434
99 Ga0070662_100067780 3300005457 Bacteria 2621
100 Ga0070681_10217230 3300005458 Bacteria 1827
101 Ga0070681_10244749 3300005458 Bacteria 1706
102 Ga0068867_100000733 3300005459 Bacteria 21968
103 Ga0068867_100086002 3300005459 Bacteria 2378
104 Ga0070685_10024707 3300005466 Bacteria 3302
105 Ga0070685_10051277 3300005466 Bacteria 2386
106 Ga0070679_100044872 3300005530 Bacteria 4404
107 Ga0070679_100187101 3300005530 Bacteria 2041
108 Ga0070679_100597948 3300005530 Bacteria 1046
109 Ga0070684_100024421 3300005535 Bacteria 5071
110 Ga0070684_100196582 3300005535 Bacteria 1836
111 Ga0070684_100408354 3300005535 Bacteria 1253
112 Ga0070697_100050149 3300005536 Bacteria 3388
113 Ga0068853_100046500 3300005539 Bacteria 3721
114 Ga0068853_100248155 3300005539 Bacteria 1633
115 Ga0070672_100086960 3300005543 Bacteria 2514
116 Ga0070686_100002924 3300005544 Bacteria 9379
117 Ga0070686_100079914 3300005544 Bacteria 2162
118 Ga0070686_100163859 3300005544 Bacteria 1568
119 Ga0070696_100070177 3300005546 Bacteria 2464
120 Ga0070693_100066807 3300005547 Bacteria 2105
121 Ga0070693_100088862 3300005547 Bacteria 1859
122 Ga0070665_100003364 3300005548 Bacteria 17099
123 Ga0070665_100044335 3300005548 Bacteria 4467
124 Ga0070665_100047642 3300005548 Bacteria 4301
125 Ga0070665_100124409 3300005548 Bacteria 2581
126 Ga0070665_100158932 3300005548 Bacteria 2261
127 Ga0070665_100301619 3300005548 Bacteria 1605
128 Ga0068855_100055487 3300005563 Bacteria 4653
129 Ga0068855_100247231 3300005563 Bacteria 1990
130 Ga0070664_100250895 3300005564 Bacteria 1591
131 Ga0068857_100004552 3300005577 Bacteria 11731
132 Ga0068857_100094423 3300005577 Bacteria 2678
133 Ga0068857_100203609 3300005577 Bacteria 1804
134 Ga0068854_100008701 3300005578 Bacteria 6531
135 Ga0068856_100177795 3300005614 Bacteria 2140
136 Ga0068852_100010696 3300005616 Bacteria 6869
137 Ga0068852_100183605 3300005616 Bacteria 1968
138 Ga0068852_100209211 3300005616 Bacteria 1850
139 Ga0068852_100368002 3300005616 Bacteria 1407
140 Ga0068859_100003865 3300005617 Bacteria 15303
141 Ga0068859_100176333 3300005617 Bacteria 2219
142 Ga0068859_100661817 3300005617 Bacteria 1136
143 Ga0068864_100038105 3300005618 Bacteria 4103
144 Ga0068864_100076599 3300005618 Bacteria 2923
145 Ga0068864_100103511 3300005618 Bacteria 2527
146 Ga0068864_100155339 3300005618 Bacteria 2076
147 Ga0068866_10003219 3300005718 Bacteria 6735
148 Ga0068866_10014236 3300005718 Bacteria 3508
149 Ga0068861_100000398 3300005719 Bacteria 25148
150 Ga0068861_100089269 3300005719 Bacteria 2429
151 Ga0068861_100294129 3300005719 Bacteria 1403
152 Ga0068851_10098544 3300005834 Bacteria 1548
153 Ga0068870_10005414 3300005840 Bacteria 5573
154 Ga0068870_10017388 3300005840 Bacteria 3453
155 Ga0068870_10080575 3300005840 Unclassified 1799
156 Ga0068863_100000638 3300005841 Bacteria 35489
157 Ga0068863_100035661 3300005841 Bacteria 4736
158 Ga0068863_100209675 3300005841 Unclassified 1876
159 Ga0068863_100221703 3300005841 Bacteria 1822
160 Ga0068863_100374033 3300005841 Bacteria 1391
161 Ga0068863_100412796 3300005841 Bacteria 1322
162 Ga0068858_100007648 3300005842 Bacteria 10439
163 Ga0068858_100009999 3300005842 Bacteria 9011
164 Ga0068858_100249737 3300005842 Bacteria 1685
165 Ga0068858_100318988 3300005842 Bacteria 1485
166 Ga0068858_100421150 3300005842 Bacteria 1284
167 Ga0068860_100008930 3300005843 Bacteria 9986
168 Ga0068860_100059707 3300005843 Bacteria 3625
169 Ga0068860_100083470 3300005843 Bacteria 3038
170 Ga0068860_100092944 3300005843 Bacteria 2875
171 Ga0068860_100728347 3300005843 Bacteria 1002
172 Ga0068862_100129090 3300005844 Bacteria 2234
173 Ga0081455_10006120 3300005937 Bacteria 13004
174 Ga0081455_10012424 3300005937 Bacteria 8497
175 Ga0081455_10047972 3300005937 Bacteria 3694
176 Ga0081538_10096002 3300005981 Bacteria 1512
177 Ga0081540_1000008 3300005983 Bacteria 203702
178 Ga0081540_1003105 3300005983 Bacteria 13306
179 Ga0081540_1005076 3300005983 Bacteria 9876
180 Ga0081540_1017499 3300005983 Bacteria 4435
181 Ga0081540_1023500 3300005983 Bacteria 3602
182 Ga0081539_10000003 3300005985 Bacteria 594833
183 Ga0070717_10002524 3300006028 Bacteria 12888
184 Ga0070717_10012428 3300006028 Bacteria 6492
185 Ga0070717_10031971 3300006028 Bacteria 4237
186 Ga0070717_10208411 3300006028 Bacteria 1715
187 Ga0075365_10017764 3300006038 Bacteria 4360
188 Ga0075365_10038394 3300006038 Bacteria 3112
189 Ga0075365_10245986 3300006038 Bacteria 1256
190 Ga0075364_10114070 3300006051 Bacteria 1805
191 Ga0075432_10007333 3300006058 Bacteria 3754
192 Ga0070715_10008284 3300006163 Bacteria 3618
193 Ga0070715_10014381 3300006163 Bacteria 2930
194 Ga0070715_10014395 3300006163 Bacteria 2929
195 Ga0070716_100042164 3300006173 Bacteria 2547
196 Ga0070716_100052846 3300006173 Bacteria 2314
197 Ga0070712_100001737 3300006175 Bacteria 13337
198 Ga0070712_100142422 3300006175 Bacteria 1831
199 Ga0070712_100154823 3300006175 Bacteria 1764
200 Ga0070712_100297804 3300006175 Bacteria 1304
201 Ga0075369_10142926 3300006186 Bacteria 1092
202 Ga0075427_10000105 3300006194 Bacteria 7158
203 Ga0097621_100126007 3300006237 Bacteria 2175
204 Ga0097621_100187058 3300006237 Bacteria 1792
205 Ga0097621_100288817 3300006237 Bacteria 1445
206 Ga0097621_100342140 3300006237 Bacteria 1328
207 Ga0068871_100002011 3300006358 Bacteria 13758
208 Ga0068871_100066365 3300006358 Bacteria 2958
209 Ga0068871_100088464 3300006358 Bacteria 2577
210 Ga0068871_100134682 3300006358 Bacteria 2097
211 Ga0075428_100000244 3300006844 Bacteria 53263
212 Ga0075428_100002840 3300006844 Bacteria 18885
213 Ga0075428_100013853 3300006844 Bacteria 8979
214 Ga0075428_100023662 3300006844 Bacteria 6799
215 Ga0075428_100067864 3300006844 Bacteria 3902
216 Ga0075428_100106548 3300006844 Unclassified 3056
217 Ga0075428_100136009 3300006844 Bacteria 2672
218 Ga0075428_100168119 3300006844 Bacteria 2378
219 Ga0075428_100192007 3300006844 Unclassified 2208
220 Ga0075428_100204891 3300006844 Bacteria 2132
221 Ga0075428_100451071 3300006844 Bacteria 1378
222 Ga0075428_100756315 3300006844 Bacteria 1034
223 Ga0075430_100000582 3300006846 Bacteria 27770
224 Ga0075430_100002360 3300006846 Bacteria 15686
225 Ga0075430_100062300 3300006846 Bacteria 3134
226 Ga0075430_100105691 3300006846 Unclassified 2349
227 Ga0075430_100106543 3300006846 Bacteria 2338
228 Ga0075431_100001060 3300006847 Bacteria 24615
229 Ga0075431_100001610 3300006847 Bacteria 21067
230 Ga0075431_100008071 3300006847 Bacteria 10507
231 Ga0075431_100055227 3300006847 Bacteria 4096
232 Ga0075431_100058589 3300006847 Bacteria 3975
233 Ga0075431_100096289 3300006847 Unclassified 3055
234 Ga0075431_100159175 3300006847 Bacteria 2322
235 Ga0075433_10000619 3300006852 Bacteria 23718
236 Ga0075433_10001774 3300006852 Bacteria 16162
237 Ga0075433_10030597 3300006852 Bacteria 4594
238 Ga0075433_10144931 3300006852 Bacteria 2111
239 Ga0075434_100004079 3300006871 Bacteria 13090
240 Ga0075434_100004936 3300006871 Bacteria 12093
241 Ga0075434_100017701 3300006871 Bacteria 6869
242 Ga0075434_100073139 3300006871 Bacteria 3420
243 Ga0075434_100091925 3300006871 Bacteria 3036
244 Ga0075429_100001525 3300006880 Bacteria 19055
245 Ga0075429_100002092 3300006880 Bacteria 16659
246 Ga0075429_100002359 3300006880 Bacteria 15888
247 Ga0075429_100049786 3300006880 Bacteria 3644
248 Ga0075429_100075628 3300006880 Bacteria 2934
249 Ga0075429_100077270 3300006880 Bacteria 2900
250 Ga0075429_100346210 3300006880 Unclassified 1301
251 Ga0068865_100000504 3300006881 Bacteria 21850
252 Ga0068865_100010433 3300006881 Bacteria 5782
253 Ga0068865_100040866 3300006881 Unclassified 3154
254 Ga0068865_100233043 3300006881 Bacteria 1445
255 Ga0068865_100321681 3300006881 Bacteria 1244
256 Ga0097620_100003865 3300006931 Bacteria 15303
257 Ga0097620_100176333 3300006931 Bacteria 2219
258 Ga0097620_100661747 3300006931 Bacteria 1136
259 Ga0075435_100060707 3300007076 Bacteria 3066
260 Ga0075435_100170727 3300007076 Bacteria 1834
261 Ga0099794_10000524 3300007265 Bacteria 12817
262 Ga0099795_10043052 3300007788 Bacteria 1614
263 Ga0105251_10069951 3300009011 Bacteria 1636
264 Ga0105240_10012684 3300009093 Bacteria 11613
265 Ga0105240_10061980 3300009093 Bacteria 4658
266 Ga0105240_10268559 3300009093 Bacteria 1965
267 Ga0111539_10003049 3300009094 Bacteria 22198
268 Ga0111539_10007565 3300009094 Bacteria 13889
269 Ga0111539_10015670 3300009094 Bacteria 9422
270 Ga0111539_10031703 3300009094 Bacteria 6420
271 Ga0111539_10046315 3300009094 Bacteria 5202
272 Ga0111539_10064679 3300009094 Bacteria 4326
273 Ga0111539_10068805 3300009094 Bacteria 4180
274 Ga0111539_10111192 3300009094 Bacteria 3215
275 Ga0111539_10125407 3300009094 Bacteria 3009
276 Ga0111539_10253350 3300009094 Bacteria 2050
277 Ga0111539_10511063 3300009094 Unclassified 1399
278 Ga0105247_10086596 3300009101 Bacteria 1983
279 Ga0105247_10143347 3300009101 Bacteria 1568
280 Ga0105247_10210022 3300009101 Bacteria 1313
281 Ga0105247_10411801 3300009101 Bacteria 966
282 Ga0114129_10001163 3300009147 Bacteria 34882
283 Ga0114129_10016497 3300009147 Bacteria 10517
284 Ga0114129_10019842 3300009147 Bacteria 9566
285 Ga0114129_10032283 3300009147 Bacteria 7399
286 Ga0114129_10038350 3300009147 Bacteria 6760
287 Ga0114129_10128515 3300009147 Bacteria 3482
288 Ga0114129_10145803 3300009147 Bacteria 3243
289 Ga0114129_10170392 3300009147 Bacteria 2969
290 Ga0114129_10182472 3300009147 Bacteria 2855
291 Ga0114129_10182921 3300009147 Bacteria 2851
292 Ga0114129_10284554 3300009147 Bacteria 2208
293 Ga0114129_10397129 3300009147 Bacteria 1818
294 Ga0114129_10466053 3300009147 Bacteria 1655
295 Ga0105243_10001632 3300009148 Bacteria 19479
296 Ga0105243_10030731 3300009148 Bacteria 4137
297 Ga0105243_10037473 3300009148 Bacteria 3769
298 Ga0105243_10201667 3300009148 Bacteria 1745
299 Ga0105241_10067576 3300009174 Bacteria 2767
300 Ga0105241_10101215 3300009174 Bacteria 2290
301 Ga0105242_10012556 3300009176 Bacteria 6522
302 Ga0105242_10042947 3300009176 Bacteria 3654
303 Ga0105242_10043444 3300009176 Bacteria 3636
304 Ga0105242_10061477 3300009176 Bacteria 3089
305 Ga0105242_10069220 3300009176 Bacteria 2922
306 Ga0105242_10654619 3300009176 Bacteria 1022
307 Ga0105248_10024215 3300009177 Bacteria 6748
308 Ga0105248_10032843 3300009177 Bacteria 5799
309 Ga0105248_10066106 3300009177 Bacteria 4060
310 Ga0105248_10316575 3300009177 Bacteria 1757
311 Ga0105237_10004654 3300009545 Bacteria 15804
312 Ga0105237_10597590 3300009545 Bacteria 1110
313 Ga0105238_10004089 3300009551 Bacteria 14471
314 Ga0105238_10026812 3300009551 Bacteria 5874
315 Ga0105238_10031549 3300009551 Bacteria 5395
316 Ga0105249_10002139 3300009553 Bacteria 17118
317 Ga0105249_10009865 3300009553 Bacteria 8371
318 Ga0105249_10196045 3300009553 Bacteria 1974
319 Ga0105249_10325947 3300009553 Bacteria 1548
320 Ga0105249_10329397 3300009553 Bacteria 1540
321 Ga0105239_10097319 3300010375 Bacteria 3252
322 Ga0105246_10024343 3300011119 Bacteria 3932
323 Ga0105246_10114805 3300011119 Bacteria 1985
324 Ga0157336_1001002 3300012477 Bacteria 1391
325 Ga0157370_10021990 3300013104 Bacteria 6351
326 Ga0157370_10037071 3300013104 Bacteria 4728
327 Ga0157370_10322076 3300013104 Bacteria 1426
328 Ga0157369_10004796 3300013105 Bacteria 15899
329 Ga0157369_10072617 3300013105 Bacteria 3693
330 Ga0157369_10356553 3300013105 Bacteria 1519
331 Ga0157369_10489916 3300013105 Bacteria 1272
332 Ga0157374_10018578 3300013296 Bacteria 6139
333 Ga0157378_10066262 3300013297 Bacteria 3234
334 Ga0157378_10654492 3300013297 Bacteria 1066
335 Ga0163162_10015033 3300013306 Bacteria 7561
336 Ga0163162_10119627 3300013306 Bacteria 2737
337 Ga0163162_10152076 3300013306 Bacteria 2433
338 Ga0163162_10443461 3300013306 Bacteria 1430
339 Ga0163162_10536343 3300013306 Bacteria 1299
340 Ga0163162_11017046 3300013306 Bacteria 937
341 Ga0157372_10018051 3300013307 Bacteria 7584
342 Ga0157372_10107300 3300013307 Bacteria 3195
343 Ga0157372_10258347 3300013307 Bacteria 2022
344 Ga0157372_10330930 3300013307 Bacteria 1774
345 Ga0157375_10100905 3300013308 Bacteria 2968
346 Ga0157375_10200132 3300013308 Bacteria 2153
347 Ga0157375_10286285 3300013308 Bacteria 1811
348 Ga0163163_10014193 3300014325 Bacteria 7317
349 Ga0163163_10056522 3300014325 Bacteria 3879
350 Ga0163163_10615495 3300014325 Bacteria 1149
351 Ga0157380_10002614 3300014326 Bacteria 12184
352 Ga0157380_10012071 3300014326 Bacteria 6253
353 Ga0157380_10087071 3300014326 Bacteria 2568
354 Ga0157380_10092975 3300014326 Bacteria 2493
355 Ga0157380_10285891 3300014326 Unclassified 1512
356 Ga0157377_10084215 3300014745 Bacteria 1865
357 Ga0157379_10030677 3300014968 Bacteria 4788
358 Ga0157379_10121826 3300014968 Bacteria 2346
359 Ga0157379_10350427 3300014968 Bacteria 1352
360 Ga0157379_10508921 3300014968 Bacteria 1117
361 Ga0157376_10064786 3300014969 Bacteria 3083
362 Ga0157376_10076025 3300014969 Bacteria 2868
363 Ga0157376_10140446 3300014969 Bacteria 2166
364 Ga0157376_10262362 3300014969 Bacteria 1619
365 Ga0163161_10032774 3300017792 Bacteria 3711
366 Ga0163161_10032991 3300017792 Bacteria 3700
367 Ga0209758_1000373 3300025297 Bacteria 78698
368 Ga0209758_1023242 3300025297 Bacteria 2810
369 Ga0207697_10002429 3300025315 Bacteria 9654
370 Ga0207697_10007292 3300025315 Bacteria 4938
371 Ga0207682_10002055 3300025893 Bacteria 9109
372 Ga0207682_10012922 3300025893 Bacteria 3256
373 Ga0207692_10004754 3300025898 Bacteria 5397
374 Ga0207692_10004787 3300025898 Bacteria 5379
375 Ga0207692_10096591 3300025898 Bacteria 1614
376 Ga0207692_10151303 3300025898 Bacteria 1329
377 Ga0207642_10008483 3300025899 Bacteria 3529
378 Ga0207642_10044876 3300025899 Unclassified 1959
379 Ga0207642_10053452 3300025899 Bacteria 1837
380 Ga0207710_10009032 3300025900 Bacteria 4196
381 Ga0207710_10053662 3300025900 Bacteria 1814
382 Ga0207710_10082403 3300025900 Bacteria 1494
383 Ga0207710_10129303 3300025900 Unclassified 1212
384 Ga0207688_10002892 3300025901 Bacteria 9334
385 Ga0207688_10004006 3300025901 Bacteria 8024
386 Ga0207688_10143405 3300025901 Bacteria 1407
387 Ga0207680_10005944 3300025903 Bacteria 5866
388 Ga0207680_10118308 3300025903 Unclassified 1729
389 Ga0207680_10122953 3300025903 Bacteria 1700
390 Ga0207680_10156667 3300025903 Bacteria 1523
391 Ga0207680_10231916 3300025903 Bacteria 1269
392 Ga0207680_10319584 3300025903 Bacteria 1085
393 Ga0207685_10016102 3300025905 Bacteria 2385
394 Ga0207699_10001254 3300025906 Bacteria 12078
395 Ga0207699_10024353 3300025906 Bacteria 3309
396 Ga0207699_10315940 3300025906 Bacteria 1094
397 Ga0207645_10004635 3300025907 Bacteria 10124
398 Ga0207645_10006777 3300025907 Bacteria 8179
399 Ga0207645_10046861 3300025907 Bacteria 2761
400 Ga0207645_10324923 3300025907 Bacteria 1027
401 Ga0207643_10004233 3300025908 Bacteria 7729
402 Ga0207705_10026102 3300025909 Bacteria 4169
403 Ga0207705_10044247 3300025909 Bacteria 3200
404 Ga0207684_10132634 3300025910 Bacteria 2138
405 Ga0207654_10033105 3300025911 Bacteria 2862
406 Ga0207707_10215136 3300025912 Bacteria 1673
407 Ga0207707_10414085 3300025912 Bacteria 1156
408 Ga0207707_10489246 3300025912 Bacteria 1050
409 Ga0207695_10160634 3300025913 Bacteria 2179
410 Ga0207695_10351999 3300025913 Bacteria 1360
411 Ga0207695_10414877 3300025913 Bacteria 1231
412 Ga0207695_10610617 3300025913 Bacteria 972
413 Ga0207671_10124734 3300025914 Bacteria 1971
414 Ga0207693_10004014 3300025915 Bacteria 12508
415 Ga0207693_10006308 3300025915 Bacteria 9836
416 Ga0207693_10019706 3300025915 Bacteria 5365
417 Ga0207693_10033262 3300025915 Bacteria 4069
418 Ga0207693_10051854 3300025915 Bacteria 3218
419 Ga0207693_10093265 3300025915 Bacteria 2360
420 Ga0207663_10002097 3300025916 Bacteria 9499
421 Ga0207663_10070063 3300025916 Bacteria 2258
422 Ga0207660_10110321 3300025917 Bacteria 2069
423 Ga0207660_10266723 3300025917 Bacteria 1355
424 Ga0207662_10037024 3300025918 Bacteria 2854
425 Ga0207662_10060614 3300025918 Bacteria 2270
426 Ga0207657_10005846 3300025919 Bacteria 12820
427 Ga0207649_10242119 3300025920 Bacteria 1295
428 Ga0207652_10036535 3300025921 Bacteria 4153
429 Ga0207652_10084286 3300025921 Bacteria 2784
430 Ga0207652_10112556 3300025921 Bacteria 2415
431 Ga0207652_10162631 3300025921 Bacteria 2001
432 Ga0207646_10310692 3300025922 Bacteria 1424
433 Ga0207646_10372346 3300025922 Bacteria 1290
434 Ga0207681_10000420 3300025923 Bacteria 29486
435 Ga0207681_10065445 3300025923 Bacteria 2513
436 Ga0207681_10078532 3300025923 Bacteria 2323
437 Ga0207681_10112004 3300025923 Bacteria 1986
438 Ga0207694_10082472 3300025924 Bacteria 2528
439 Ga0207694_10107621 3300025924 Bacteria 2215
440 Ga0207650_10048613 3300025925 Bacteria 3129
441 Ga0207650_10430096 3300025925 Bacteria 1096
442 Ga0207659_10149167 3300025926 Unclassified 1824
443 Ga0207659_10162446 3300025926 Bacteria 1755
444 Ga0207659_10169865 3300025926 Bacteria 1719
445 Ga0207659_10265039 3300025926 Bacteria 1399
446 Ga0207687_10020291 3300025927 Bacteria 4408
447 Ga0207687_10042809 3300025927 Bacteria 3118
448 Ga0207687_10320339 3300025927 Bacteria 1255
449 Ga0207700_10001346 3300025928 Bacteria 13937
450 Ga0207700_10003896 3300025928 Bacteria 8712
451 Ga0207700_10008355 3300025928 Bacteria 6408
452 Ga0207700_10138066 3300025928 Bacteria 2000
453 Ga0207700_10275792 3300025928 Bacteria 1445
454 Ga0207664_10021740 3300025929 Bacteria 4779
455 Ga0207664_10028334 3300025929 Bacteria 4255
456 Ga0207664_10242666 3300025929 Bacteria 1569
457 Ga0207664_10604645 3300025929 Bacteria 985
458 Ga0207644_10012365 3300025931 Bacteria 5666
459 Ga0207644_10062623 3300025931 Bacteria 2699
460 Ga0207644_10095966 3300025931 Bacteria 2218
461 Ga0207644_10240050 3300025931 Bacteria 1442
462 Ga0207690_10138669 3300025932 Bacteria 1789
463 Ga0207706_10002734 3300025933 Bacteria 17184
464 Ga0207706_10010909 3300025933 Bacteria 8292
465 Ga0207706_10012641 3300025933 Bacteria 7684
466 Ga0207706_10023556 3300025933 Bacteria 5527
467 Ga0207706_10303313 3300025933 Bacteria 1391
468 Ga0207686_10015040 3300025934 Bacteria 4319
469 Ga0207686_10043987 3300025934 Bacteria 2739
470 Ga0207686_10097532 3300025934 Bacteria 1955
471 Ga0207709_10002614 3300025935 Bacteria 11215
472 Ga0207709_10033747 3300025935 Bacteria 3009
473 Ga0207670_10033572 3300025936 Bacteria 3308
474 Ga0207670_10053580 3300025936 Bacteria 2718
475 Ga0207670_10232701 3300025936 Bacteria 1416
476 Ga0207669_10002041 3300025937 Bacteria 8551
477 Ga0207669_10006797 3300025937 Bacteria 5257
478 Ga0207669_10053543 3300025937 Bacteria 2432
479 Ga0207704_10028850 3300025938 Bacteria 3085
480 Ga0207704_10076001 3300025938 Bacteria 2150
481 Ga0207704_10098360 3300025938 Bacteria 1943
482 Ga0207665_10025953 3300025939 Bacteria 3866
483 Ga0207691_10014799 3300025940 Bacteria 7433
484 Ga0207691_10123539 3300025940 Unclassified 2291
485 Ga0207711_10018835 3300025941 Bacteria 5739
486 Ga0207711_10111731 3300025941 Bacteria 2431
487 Ga0207711_10153129 3300025941 Bacteria 2082
488 Ga0207689_10002645 3300025942 Bacteria 16574
489 Ga0207689_10005334 3300025942 Bacteria 11519
490 Ga0207689_10036466 3300025942 Bacteria 4082
491 Ga0207689_10036515 3300025942 Bacteria 4078
492 Ga0207661_10143539 3300025944 Bacteria 2057
493 Ga0207667_10072152 3300025949 Bacteria 3589
494 Ga0207667_10138991 3300025949 Bacteria 2501
495 Ga0207651_10036110 3300025960 Bacteria 3222
496 Ga0207651_10116405 3300025960 Bacteria 2017
497 Ga0207712_10002298 3300025961 Bacteria 12410
498 Ga0207712_10014268 3300025961 Bacteria 5106
499 Ga0207668_10012133 3300025972 Bacteria 5265
500 Ga0207668_10018130 3300025972 Bacteria 4422
501 Ga0207668_10071273 3300025972 Bacteria 2482
502 Ga0207668_10072923 3300025972 Bacteria 2459
503 Ga0207668_10131723 3300025972 Bacteria 1910
504 Ga0207668_10400750 3300025972 Bacteria 1160
505 Ga0207640_10145498 3300025981 Bacteria 1734
506 Ga0207640_10146462 3300025981 Bacteria 1729
507 Ga0207640_10302565 3300025981 Bacteria 1266
508 Ga0207658_10000212 3300025986 Bacteria 60851
509 Ga0207658_10049243 3300025986 Bacteria 3095
510 Ga0207658_10084714 3300025986 Bacteria 2440
511 Ga0207658_10184189 3300025986 Bacteria 1730
512 Ga0207677_10010957 3300026023 Bacteria 5150
513 Ga0207677_10065649 3300026023 Bacteria 2533
514 Ga0207677_10390125 3300026023 Bacteria 1178
515 Ga0207677_10443960 3300026023 Bacteria 1110
516 Ga0207677_10450255 3300026023 Bacteria 1103
517 Ga0207677_10635575 3300026023 Bacteria 940
518 Ga0207703_10008468 3300026035 Bacteria 8128
519 Ga0207703_10089906 3300026035 Bacteria 2579
520 Ga0207703_10197611 3300026035 Bacteria 1785
521 Ga0207703_10223286 3300026035 Bacteria 1686
522 Ga0207639_10019008 3300026041 Bacteria 4892
523 Ga0207639_10287161 3300026041 Bacteria 1449
524 Ga0207678_10001842 3300026067 Bacteria 19436
525 Ga0207678_10011624 3300026067 Bacteria 7733
526 Ga0207678_10110386 3300026067 Bacteria 2346
527 Ga0207678_10443642 3300026067 Bacteria 1127
528 Ga0207708_10009553 3300026075 Bacteria 7191
529 Ga0207708_10093574 3300026075 Bacteria 2320
530 Ga0207708_10164477 3300026075 Unclassified 1754
531 Ga0207702_10037988 3300026078 Bacteria 4033
532 Ga0207641_10001060 3300026088 Bacteria 27782
533 Ga0207641_10059943 3300026088 Bacteria 3243
534 Ga0207641_10066656 3300026088 Bacteria 3081
535 Ga0207648_10008257 3300026089 Bacteria 10108
536 Ga0207648_10012760 3300026089 Bacteria 7852
537 Ga0207648_10045089 3300026089 Bacteria 3869
538 Ga0207648_10204586 3300026089 Bacteria 1752
539 Ga0207676_10032372 3300026095 Bacteria 3939
540 Ga0207676_10117611 3300026095 Bacteria 2236
541 Ga0207676_10182050 3300026095 Bacteria 1841
542 Ga0207676_10182386 3300026095 Bacteria 1839
543 Ga0207674_10003900 3300026116 Bacteria 18146
544 Ga0207674_10109359 3300026116 Bacteria 2740
545 Ga0207675_100001130 3300026118 Bacteria 26475
546 Ga0207675_100002876 3300026118 Bacteria 16923
547 Ga0207675_100068525 3300026118 Bacteria 3316
548 Ga0207675_100246021 3300026118 Bacteria 1729
549 Ga0207683_10039992 3300026121 Bacteria 4090
550 Ga0207683_10051823 3300026121 Bacteria 3595
551 Ga0207683_10103293 3300026121 Bacteria 2546
552 Ga0207683_10164940 3300026121 Bacteria 2004
553 Ga0207698_10097677 3300026142 Bacteria 2424
554 Ga0207698_10495866 3300026142 Bacteria 1187
555 Ga0209179_1011904 3300027512 Bacteria 1552
556 Ga0209588_1021054 3300027671 Bacteria 2045
557 Ga0209813_10005178 3300027866 Bacteria 3152
558 Ga0209974_10020612 3300027876 Bacteria 2184
559 Ga0207428_10000618 3300027907 Bacteria 41972
560 Ga0207428_10000920 3300027907 Bacteria 32881
561 Ga0207428_10002825 3300027907 Bacteria 17234
562 Ga0207428_10005326 3300027907 Bacteria 11998
563 Ga0207428_10067274 3300027907 Bacteria 2821
564 Ga0207428_10259916 3300027907 Bacteria 1293
565 Ga0268266_10001037 3300028379 Bacteria 34914
566 Ga0268266_10044601 3300028379 Bacteria 3791
567 Ga0268266_10118260 3300028379 Bacteria 2356
568 Ga0268266_10321543 3300028379 Bacteria 1448
569 Ga0268265_10007719 3300028380 Bacteria 7259
570 Ga0268265_10160764 3300028380 Bacteria 1907
571 Ga0268265_10257308 3300028380 Unclassified 1550
572 Ga0268264_10001043 3300028381 Bacteria 27736
573 Ga0268264_10076481 3300028381 Bacteria 2848
574 Ga0268264_10116220 3300028381 Bacteria 2351
575 Ga0268264_10168115 3300028381 Bacteria 1981
576 Ga0268264_10201501 3300028381 Bacteria 1821
577 Ga0268264_10234732 3300028381 Bacteria 1695
578 Ga0307515_10231400 3300028794 Bacteria 1640
579 Ga0265338_10255062 3300028800 Bacteria 1292
580 Ga0307511_10115747 3300030521 Bacteria 1683
581 Ga0265340_10015435 3300031247 Bacteria 3968
582 Ga0307509_10110955 3300031507 Bacteria 2747
583 Ga0307408_100072743 3300031548 Bacteria 2546
584 Ga0307408_100236869 3300031548 Bacteria 1498
585 Ga0307408_100252836 3300031548 Bacteria 1454
586 Ga0265314_10054838 3300031711 Bacteria 2756
587 Ga0265342_10058879 3300031712 Bacteria 2270
588 Ga0307405_10144213 3300031731 Bacteria 1665
589 Ga0307410_10098212 3300031852 Bacteria 2094
590 Ga0307406_10036509 3300031901 Bacteria 3029
591 Ga0307406_10270176 3300031901 Bacteria 1291
592 Ga0307412_10163678 3300031911 Bacteria 1656
593 Ga0307409_100000528 3300031995 Bacteria 16509
594 Ga0307416_100007106 3300032002 Bacteria 7078
595 Ga0307416_100310363 3300032002 Bacteria 1573
596 Ga0307416_100311974 3300032002 Bacteria 1570
597 Ga0307415_100085227 3300032126 Bacteria 2269
598 Ga0307415_100200038 3300032126 Bacteria 1585
599 Ga0373926_0006770 3300035083 Bacteria 3808
600 Ga0373926_0029833 3300035083 Bacteria 1918
601 Ga0373926_0037056 3300035083 Bacteria 1734
602 Ga0373926_0048917 3300035083 Bacteria 1522
603 Ga0373940_0006960 3300035088 Bacteria 2535
604 Ga0373944_0076517 3300035089 Bacteria 1099
605 Ga0373936_0003385 3300035113 Bacteria 5976
606 Ga0373936_0028966 3300035113 Bacteria 2179
607 Ga0373945_0016385 3300035116 Bacteria 2499
608 Ga0373945_0023201 3300035116 Bacteria 2142
609 Ga0373953_0030732 3300035117 Bacteria 2084
610 Ga0373954_0051215 3300035118 Bacteria 1938
611 Ga0373943_0030064 3300035170 Bacteria 2569
612 Ga0373946_0001521 3300035171 Bacteria 8060
613 Ga0373946_0031099 3300035171 Bacteria 2135
614 Ga0373946_0066571 3300035171 Bacteria 1545
615 Ga0373955_0031668 3300035172 Bacteria 2771
616 Ga0373955_0119222 3300035172 Bacteria 1532
617 Ga0373962_0011114 3300035242 Bacteria 2253
618 Ga0373924_0002712 3300035410 Bacteria 5976
619 Ga0373935_0001406 3300035692 Bacteria 13337
620 Ga0373927_0003933 3300035695 Bacteria 10535
621 Ga0373927_0005396 3300035695 Bacteria 8827
622 Ga0373927_0036489 3300035695 Bacteria 3196
623 Ga0373933_0021159 3300035724 Bacteria 3692
624 Ga0373933_0245769 3300035724 Bacteria 1151
625 Ga0373947_0001456 3300035725 Bacteria 14556
626 Ga0373947_0002425 3300035725 Bacteria 11251
627 Ga0373947_0003263 3300035725 Bacteria 9619
628 Ga0373947_0007599 3300035725 Bacteria 6272
629 Ga0373947_0068416 3300035725 Bacteria 2172
630 Ga0373937_0447383 3300036401 Bacteria 1227
631 Ga0373937_0492283 3300036401 Bacteria 1165
632 Ga0373925_0017252 3300037068 Bacteria 5229
633 Ga0373925_0017905 3300037068 Bacteria 5142
634 Ga0373925_0333701 3300037068 Bacteria 1229
635 Ga0395899_0115555 3300037312 Bacteria 1926
636 Ga0395900_0040758 3300037418 Bacteria 4786
637 Ga0395900_0657009 3300037418 Bacteria 985
638 Ga0395898_0017111 3300037466 Bacteria 7405
639 Ga0395898_0107327 3300037466 Bacteria 2677
640 Ga0395905_0091441 3300037471 Bacteria 2853
641 Ga0395901_0076535 3300038443 Bacteria 3491
642 Ga0436365_0731126 3300039437 Bacteria 1309
643 Ga0436361_0100673 3300039447 Bacteria 13066
644 Ga0436362_0192500 3300039453 Bacteria 1328
645 Ga0451851_0622210 3300041507 Bacteria 1333
646 Ga0439435_0000980 3300042436 Bacteria 4992
647 Ga0439435_0012266 3300042436 Bacteria 2073
648 Ga0466961_0092505 3300044693 Bacteria 1909
649 Ga0466957_0002234 3300044842 Bacteria 10386
650 Ga0466957_0323690 3300044842 Bacteria 1041
651 Ga0451576_0102334 3300045051 Bacteria 2979
652 Ga0495617_014008 3300046452 Bacteria 2725
653 Ga0495592_0012664 3300046454 Bacteria 6410
654 Ga0495603_0005454 3300046455 Bacteria 7592
655 Ga0495603_0008659 3300046455 Bacteria 6148
656 Ga0495603_0145736 3300046455 Unclassified 1376
657 Ga0495590_0046292 3300046457 Bacteria 1517
658 Ga0495629_0001360 3300046459 Bacteria 19275
659 Ga0495629_0014941 3300046459 Bacteria 5579
660 Ga0495629_0026104 3300046459 Bacteria 4151
661 Ga0495629_0051236 3300046459 Unclassified 2889
662 Ga0495629_0274364 3300046459 Bacteria 1158
663 Ga0495629_0290239 3300046459 Bacteria 1121
664 Ga0495638_0016736 3300046460 Bacteria 4902
665 Ga0495641_0017298 3300046461 Bacteria 3761
666 Ga0495651_0012806 3300046462 Bacteria 6475
667 Ga0495651_0016437 3300046462 Bacteria 5731
668 Ga0495582_0027436 3300046473 Bacteria 3122
669 Ga0495605_0040726 3300046474 Bacteria 2318
670 Ga0495605_0085743 3300046474 Bacteria 1466
671 Ga0495605_0129399 3300046474 Unclassified 1139
672 Ga0495639_0005083 3300046475 Bacteria 5652
673 Ga0495639_0073620 3300046475 Bacteria 1582
674 Ga0495662_0052717 3300046476 Bacteria 1964
675 Ga0495664_0001034 3300046477 Bacteria 14381
676 Ga0495664_0022730 3300046477 Bacteria 3637
677 Ga0495664_0023262 3300046477 Bacteria 3596
678 Ga0495584_0010382 3300046491 Bacteria 4787
679 Ga0495585_0002702 3300046492 Bacteria 12423
680 Ga0495585_0042158 3300046492 Bacteria 2558
681 Ga0495585_0072054 3300046492 Bacteria 1883
682 Ga0495594_0005195 3300046499 Bacteria 6690
683 Ga0495594_0038110 3300046499 Bacteria 2624
684 Ga0495596_0049139 3300046500 Bacteria 1654
685 Ga0495596_0061973 3300046500 Bacteria 1456
686 Ga0495606_0000753 3300046507 Bacteria 50074
687 Ga0495608_0050053 3300046511 Bacteria 2772
688 Ga0495610_0052743 3300046512 Bacteria 1973
689 Ga0495618_0005416 3300046514 Bacteria 7782
690 Ga0495618_0009681 3300046514 Bacteria 5818
691 Ga0495618_0017145 3300046514 Bacteria 4438
692 Ga0495628_0064674 3300046516 Bacteria 2863
693 Ga0495632_0031806 3300046519 Bacteria 2724
694 Ga0495644_0000510 3300046523 Bacteria 16598
695 Ga0495666_0004543 3300046526 Bacteria 7014
696 Ga0495666_0059828 3300046526 Bacteria 1822
697 Ga0495652_0012180 3300046529 Bacteria 7768
698 Ga0495652_0013306 3300046529 Bacteria 7405
699 Ga0495652_0018127 3300046529 Bacteria 6283
700 Ga0495665_0002324 3300046531 Bacteria 10269
701 Ga0495640_0008356 3300046533 Bacteria 8120
702 Ga0495640_0016234 3300046533 Bacteria 5574
703 Ga0495640_0021657 3300046533 Bacteria 4711
704 Ga0495640_0032820 3300046533 Bacteria 3694
705 Ga0495640_0048856 3300046533 Bacteria 2920
706 Ga0495586_0245654 3300046535 Bacteria 1021
707 Ga0495598_0007871 3300046537 Bacteria 2462
708 Ga0495645_0053978 3300046543 Bacteria 2920
709 Ga0495622_0006380 3300046557 Bacteria 5475
710 Ga0495633_0088933 3300046558 Bacteria 1436
711 Ga0495667_0004324 3300046559 Bacteria 9586
712 Ga0495667_0058318 3300046559 Bacteria 2536
713 Ga0495667_0116614 3300046559 Bacteria 1725
714 Ga0495656_0000296 3300046615 Bacteria 17268
715 Ga0495656_0007959 3300046615 Bacteria 3769
716 Ga0495656_0037023 3300046615 Unclassified 2013
717 Ga0495668_0019264 3300046616 Bacteria 3936
718 Ga0495668_0176715 3300046616 Bacteria 1170
719 Ga0495634_0007278 3300046642 Bacteria 8338
720 Ga0495634_0018647 3300046642 Bacteria 4936
721 Ga0495611_0004254 3300046648 Bacteria 6229
722 Ga0495635_0007226 3300046663 Bacteria 7758
723 Ga0495635_0040366 3300046663 Bacteria 3225
724 Ga0495635_0089010 3300046663 Bacteria 2112
725 Ga0495659_0002362 3300046664 Bacteria 6095
726 Ga0495588_0037901 3300046674 Bacteria 2450
727 Ga0495599_0020720 3300046678 Bacteria 4097
728 Ga0495599_0054040 3300046678 Bacteria 2516
729 Ga0495623_0081074 3300046679 Bacteria 2007
730 Ga0495646_0010909 3300046680 Bacteria 5772
731 Ga0495646_0015832 3300046680 Bacteria 4788
732 Ga0495647_0001487 3300046681 Bacteria 7272
733 Ga0495647_0035432 3300046681 Bacteria 1874
734 Ga0495647_0044751 3300046681 Bacteria 1698
735 Ga0495658_0001084 3300046683 Bacteria 14340
736 Ga0495658_0019732 3300046683 Bacteria 3523
737 Ga0495658_0216767 3300046683 Bacteria 1197
738 Ga0495669_0024557 3300046684 Bacteria 2624
739 Ga0495669_0173737 3300046684 Bacteria 1025
740 Ga0495613_0005417 3300046689 Bacteria 9586
741 Ga0495613_0248653 3300046689 Bacteria 1241
742 Ga0495624_0002012 3300046690 Bacteria 15492
743 Ga0495670_0003427 3300046691 Bacteria 7793
744 Ga0495671_0074954 3300046692 Bacteria 1660
745 Ga0495671_0077704 3300046692 Bacteria 1627
746 Ga0495589_0092592 3300046794 Bacteria 1467
747 Ga0495589_0106405 3300046794 Bacteria 1355
748 Ga0495600_0069402 3300046809 Bacteria 2303
749 Ga0495581_0002122 3300047315 Bacteria 11179
750 Ga0495581_0148930 3300047315 Bacteria 1366
751 Ga0495604_0216908 3300047317 Unclassified 1319
752 Ga0495674_0003621 3300047319 Bacteria 15039
753 Ga0495674_0025009 3300047319 Bacteria 5479
754 Ga0495674_0025024 3300047319 Bacteria 5478
755 Ga0495674_0037448 3300047319 Bacteria 4359
756 Ga0495672_0018735 3300047320 Bacteria 4585
757 Ga0495672_0056188 3300047320 Bacteria 2292
758 Ga0495676_0007996 3300047321 Bacteria 9697
759 Ga0495676_0156369 3300047321 Bacteria 1617
760 Ga0495680_0006335 3300047322 Bacteria 11014
761 Ga0495680_0041682 3300047322 Bacteria 3649
762 Ga0495680_0055426 3300047322 Bacteria 3075
763 Ga0495675_0031629 3300047444 Bacteria 3378
764 Ga0495677_0027186 3300047445 Bacteria 2076
765 Ga0495679_019109 3300047446 Bacteria 2416
766 Ga0495684_0002702 3300047471 Bacteria 14043
767 Ga0495684_0044442 3300047471 Bacteria 3401
768 Ga0495684_0095324 3300047471 Bacteria 2252
769 Ga0495686_0121046 3300047472 Bacteria 1560
770 Ga0495686_0201318 3300047472 Bacteria 1143
771 Ga0495593_0007998 3300047673 Bacteria 6155
772 Ga0495593_0080666 3300047673 Bacteria 1683
773 Ga0495593_0163728 3300047673 Bacteria 1122
774 Ga0495602_0078230 3300048088 Bacteria 2794
775 Ga0496100_0018910 3300048903 Bacteria 4099
776 Ga0496100_0022574 3300048903 Bacteria 3809
777 Ga0496100_0265393 3300048903 Bacteria 1274
778 Ga0496101_0000139 3300048904 Bacteria 63989
779 Ga0496101_0013918 3300048904 Bacteria 5401
780 Ga0496101_0022121 3300048904 Bacteria 4374
781 Ga0496102_0006168 3300048905 Bacteria 10220
782 Ga0496102_0089486 3300048905 Bacteria 2848
783 Ga0496102_0167897 3300048905 Bacteria 2065
784 Ga0496102_0183714 3300048905 Bacteria 1970
785 Ga0496102_0194395 3300048905 Bacteria 1912
786 Ga0496102_0325901 3300048905 Bacteria 1447
787 Ga0496102_0579705 3300048905 Bacteria 1045
788 Ga0496103_0244019 3300048906 Bacteria 1156
789 Ga0496104_0004028 3300048907 Bacteria 12739
790 Ga0496104_0038299 3300048907 Bacteria 4486
791 Ga0496104_0081014 3300048907 Unclassified 3095
792 Ga0496104_0133112 3300048907 Bacteria 2388
793 Ga0496104_0289065 3300048907 Bacteria 1551
794 Ga0496105_0017587 3300048908 Bacteria 5734
795 Ga0496105_0028853 3300048908 Bacteria 4540
796 Ga0496105_0054150 3300048908 Bacteria 3313
797 Ga0496105_0071518 3300048908 Bacteria 2866
798 Ga0496105_0173044 3300048908 Bacteria 1769
799 Ga0496106_0010418 3300048909 Bacteria 6864
800 Ga0496106_0101339 3300048909 Bacteria 2233
801 Ga0496106_0102701 3300048909 Bacteria 2218
802 Ga0496107_0035694 3300048910 Bacteria 3565
803 Ga0496107_0049231 3300048910 Bacteria 3036
804 Ga0496107_0061329 3300048910 Bacteria 2723
805 Ga0496107_0285265 3300048910 Bacteria 1229
806 Ga0496108_0013377 3300048911 Bacteria 6692
807 Ga0496108_0053569 3300048911 Bacteria 3383
808 Ga0496108_0084322 3300048911 Bacteria 2696
809 Ga0496108_0184333 3300048911 Bacteria 1808
810 Ga0496109_0003355 3300048912 Bacteria 13395
811 Ga0496109_0006466 3300048912 Bacteria 9867
812 Ga0496109_0013309 3300048912 Bacteria 7128
813 Ga0496109_0133766 3300048912 Bacteria 2316
814 Ga0496110_0029303 3300048913 Bacteria 4736
815 Ga0496110_0046287 3300048913 Bacteria 3805
816 Ga0496110_0050288 3300048913 Bacteria 3659
817 Ga0496110_0061092 3300048913 Bacteria 3325
818 Ga0496110_0094477 3300048913 Bacteria 2677
819 Ga0496110_0186778 3300048913 Bacteria 1882
820 Ga0496110_0266420 3300048913 Bacteria 1560
821 Ga0496110_0395143 3300048913 Bacteria 1260
822 Ga0496110_0633882 3300048913 Bacteria 968
823 Ga0496111_0027590 3300048914 Bacteria 4018
824 Ga0496111_0048931 3300048914 Bacteria 3047
825 Ga0496111_0173165 3300048914 Bacteria 1604
826 Ga0496112_0000039 3300048915 Bacteria 91123
827 Ga0496112_0005830 3300048915 Bacteria 10724
828 Ga0496112_0011666 3300048915 Bacteria 8038
829 Ga0496112_0102285 3300048915 Bacteria 2835
830 Ga0496112_0125331 3300048915 Bacteria 2539
831 Ga0496113_0008638 3300048916 Bacteria 6645
832 Ga0496113_0061886 3300048916 Bacteria 2825
833 Ga0496113_0075442 3300048916 Bacteria 2573
834 Ga0496113_0143458 3300048916 Bacteria 1880
835 Ga0496113_0259607 3300048916 Bacteria 1388
836 Ga0496114_0000302 3300048917 Bacteria 36280
837 Ga0496114_0025657 3300048917 Bacteria 4819
838 Ga0496114_0152975 3300048917 Bacteria 2002
839 Ga0496115_0053257 3300048918 Bacteria 3247
840 Ga0496115_0150511 3300048918 Bacteria 1921
841 Ga0496115_0220930 3300048918 Bacteria 1563
842 Ga0496121_0001073 3300048924 Bacteria 48396
843 Ga0496121_0114438 3300048924 Bacteria 2050
844 Ga0496125_0000487 3300048928 Bacteria 69494
845 Ga0496125_0188717 3300048928 Bacteria 1364
846 Ga0496126_0072057 3300048929 Bacteria 3074
847 Ga0495682_0048274 3300049460 Bacteria 1552
848 Ga0501032_0022579 3300049569 Bacteria 4360
849 Ga0501032_0164855 3300049569 Bacteria 1454
850 Ga0501034_0000032 3300049571 Bacteria 243763
851 Ga0501034_0010326 3300049571 Bacteria 9733
852 Ga0501034_0015121 3300049571 Bacteria 7932
853 Ga0501036_0119007 3300049572 Bacteria 2230
854 Ga0501037_0230003 3300049573 Bacteria 1302
855 Ga0501038_0084930 3300049574 Bacteria 2663
856 Ga0501040_0011176 3300049576 Bacteria 5871
857 Ga0501040_0082719 3300049576 Bacteria 2226
858 Ga0501042_0006967 3300049578 Bacteria 7376
859 Ga0501042_0327750 3300049578 Unclassified 1107
860 Ga0501043_0022339 3300049579 Bacteria 4963
861 Ga0501046_0139165 3300049580 Bacteria 1838
862 Ga0501047_0000100 3300049581 Bacteria 105717
863 Ga0501048_0000083 3300049582 Bacteria 49621
864 Ga0501068_0238973 3300049584 Bacteria 1156
865 Ga0501070_0009312 3300049586 Bacteria 8307
866 Ga0501070_0301098 3300049586 Bacteria 1306
867 Ga0501070_0352593 3300049586 Bacteria 1194
868 Ga0501071_0004387 3300049587 Bacteria 8949
869 Ga0501072_0013202 3300049588 Bacteria 6325
870 Ga0501072_0030716 3300049588 Bacteria 4203
871 Ga0501073_0038845 3300049589 Bacteria 3375
872 Ga0501074_0089797 3300049590 Bacteria 2201
873 Ga0501075_0000528 3300049591 Bacteria 23105
874 Ga0501076_0000391 3300049592 Bacteria 27401
875 Ga0501079_0114129 3300049741 Bacteria 2100
876 Ga0501080_0000030 3300049742 Bacteria 87736
877 Ga0501080_0193879 3300049742 Bacteria 1866
878 Ga0501081_0001914 3300049743 Bacteria 12917
879 Ga0501081_0035321 3300049743 Bacteria 3403
880 Ga0501083_0002641 3300049744 Bacteria 12337
881 Ga0501083_0245162 3300049744 Bacteria 1166
882 Ga0501044_0000587 3300049823 Bacteria 44137
883 Ga0501044_0087165 3300049823 Bacteria 3153
884 Ga0501045_0010164 3300049824 Bacteria 6586
885 Ga0501045_0093853 3300049824 Bacteria 2219
886 nmdc:mga03n38_2690_c1 3300050490 Bacteria 5550
887 nmdc:mga0yw44_125239_c1 3300050492 Bacteria 1659
888 nmdc:mga0yw44_1925_c1 3300050492 Bacteria 8582
889 nmdc:mga0yw44_37220_c1 3300050492 Bacteria 2872
890 nmdc:mga0yw44_64664_c1 3300050492 Bacteria 2252
891 nmdc:mga06z11_59921_c1 3300050494 Bacteria 1980
892 nmdc:mga05p37_139679_c1 3300050507 Bacteria 2969
893 nmdc:mga05p37_150209_c1 3300050507 Bacteria 2850
894 nmdc:mga05p37_19242_c1 3300050507 Bacteria 8259
895 nmdc:mga05p37_28900_c1 3300050507 Bacteria 6763
896 nmdc:mga05p37_31225_c1 3300050507 Bacteria 6507
897 nmdc:mga05p37_335080_c1 3300050507 Bacteria 1786
898 nmdc:mga05p37_612563_c1 3300050507 Bacteria 1227
899 nmdc:mga05p37_8481_c1 3300050507 Bacteria 12149
900 nmdc:mga05p37_88171_c1 3300050507 Bacteria 3825
901 nmdc:mga05p37_928_c1 3300050507 Bacteria 33059
902 nmdc:mga09592_13720_c1 3300050508 Bacteria 6621
903 nmdc:mga09592_16225_c1 3300050508 Bacteria 6088
904 nmdc:mga09592_2676_c1 3300050508 Bacteria 14409
905 nmdc:mga09592_327286_c1 3300050508 Unclassified 1327
906 nmdc:mga09592_7590_c1 3300050508 Bacteria 8822
907 nmdc:mga09592_81234_c1 3300050508 Bacteria 2762
908 nmdc:mga0qj67_131855_c1 3300050509 Bacteria 2024
909 nmdc:mga0qj67_160443_c1 3300050509 Unclassified 1825
910 nmdc:mga0qj67_276337_c1 3300050509 Bacteria 1362
911 nmdc:mga0qj67_2917_c1 3300050509 Bacteria 12275
912 nmdc:mga0qj67_6794_c1 3300050509 Bacteria 8411
913 nmdc:mga0qj67_68754_c1 3300050509 Bacteria 2823
914 nmdc:mga0qj67_800_c1 3300050509 Bacteria 18117
915 nmdc:mga06r32_117187_c1 3300050510 Bacteria 2625
916 nmdc:mga06r32_3325_c1 3300050510 Bacteria 14409
917 nmdc:mga06r32_379315_c1 3300050510 Bacteria 1397
918 nmdc:mga06r32_4226_c1 3300050510 Bacteria 12870
919 nmdc:mga06r32_795_c1 3300050510 Bacteria 27918
920 nmdc:mga06r32_9128_c1 3300050510 Bacteria 6385
921 nmdc:mga08y16_13516_c1 3300050511 Bacteria 8590
922 nmdc:mga08y16_137515_c1 3300050511 Bacteria 2540
923 nmdc:mga08y16_147897_c1 3300050511 Bacteria 2442
924 nmdc:mga08y16_185410_c1 3300050511 Bacteria 2160
925 nmdc:mga08y16_191454_c1 3300050511 Bacteria 2122
926 nmdc:mga08y16_2587_c1 3300050511 Bacteria 18610
927 nmdc:mga08y16_262197_c1 3300050511 Unclassified 1785
928 nmdc:mga08y16_356917_c1 3300050511 Bacteria 1501
929 nmdc:mga08y16_50496_c1 3300050511 Bacteria 4353
930 nmdc:mga0n895_16020_c1 3300050512 Bacteria 6865
931 nmdc:mga0n895_2399_c1 3300050512 Bacteria 14608
932 nmdc:mga0n895_590_c1 3300050512 Bacteria 25063
933 nmdc:mga0rr50_6545_c1 3300050513 Bacteria 7108
934 nmdc:mga0rr50_9580_c1 3300050513 Bacteria 6099
935 nmdc:mga08x19_280107_c1 3300050514 Bacteria 1155
936 nmdc:mga0a205_254_c1 3300050515 Bacteria 38196
937 nmdc:mga0a205_3143_c1 3300050515 Bacteria 14646
938 nmdc:mga0a205_437363_c1 3300050515 Bacteria 1169
939 nmdc:mga0a205_5139_c1 3300050515 Bacteria 11772
940 nmdc:mga0a205_67829_c1 3300050515 Bacteria 3445
941 Ga0495601_0000489 3300053077 Bacteria 20787
942 Ga0495601_0000889 3300053077 Bacteria 16315
943 Ga0495601_0011239 3300053077 Bacteria 5348
944 Ga0495601_0036436 3300053077 Bacteria 3071
945 Ga0495612_0003322 3300053078 Bacteria 6669
946 Ga0495612_0019714 3300053078 Bacteria 2702
947 Ga0495595_0005839 3300053084 Bacteria 4986
948 Ga0495595_0185451 3300053084 Bacteria 1033
949 Ga0495619_0000918 3300053085 Bacteria 19328
950 Ga0495619_0007637 3300053085 Bacteria 6844
951 Ga0495619_0028393 3300053085 Bacteria 3608
952 Ga0495619_0047385 3300053085 Bacteria 2830
953 Ga0495619_0149708 3300053085 Bacteria 1610
954 Ga0500583_0149936 3300053092 Bacteria 1160
955 Ga0500566_0006739 3300053094 Bacteria 6803
956 Ga0500554_022940 3300053102 Bacteria 1749
957 Ga0500595_000151 3300053119 Bacteria 45478
958 Ga0500595_017033 3300053119 Bacteria 2694
959 Ga0500642_0019890 3300053130 Bacteria 2628
960 Ga0500658_0031645 3300053134 Bacteria 2070
961 Ga0500561_0017452 3300053137 Bacteria 1629
962 Ga0500568_0034603 3300053139 Bacteria 2066
963 Ga0500603_051690 3300053150 Bacteria 1126
964 Ga0500627_0060088 3300053158 Bacteria 1671
965 Ga0500637_0001169 3300053178 Bacteria 10912
966 Ga0501084_0011673 3300054114 Bacteria 7274
967 Ga0500661_000174 3300055283 Bacteria 11204
968 Ga0501082_0001012 3300060353 Bacteria 24853
969 Ga0530510_0001725 3300061734 Bacteria 14858
970 Ga0530510_0011633 3300061734 Bacteria 6175
971 Ga0530510_0411754 3300061734 Bacteria 1020

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10144931 Ga0075433_101449312 227
2 3300006871 Ga0075434_100073139 Ga0075434_1000731393 227
3 3300009147 Ga0114129_10170392 Ga0114129_101703922 228
4 3300046526 Ga0495666_0059828 Ga0495666_0059828_20_853 230
5 3300005577 Ga0068857_100203609 Ga0068857_1002036092 232
6 3300009174 Ga0105241_10101215 Ga0105241_101012152 232
7 3300012477 Ga0157336_1001002 Ga0157336_10010022 232
8 3300009094 Ga0111539_10253350 Ga0111539_102533502 233
9 3300025942 Ga0207689_10036515 Ga0207689_100365153 234
10 3300048928 Ga0496125_0188717 Ga0496125_0188717_11_892 234
11 3300005290 Ga0065712_10076134 Ga0065712_100761343 235
12 3300005331 Ga0070670_100020041 Ga0070670_1000200413 235
13 3300005334 Ga0068869_100104219 Ga0068869_1001042192 235
14 3300005340 Ga0070689_100191353 Ga0070689_1001913531 235
15 3300005365 Ga0070688_100040618 Ga0070688_1000406182 235
16 3300005543 Ga0070672_100086960 Ga0070672_1000869603 235
17 3300005544 Ga0070686_100163859 Ga0070686_1001638592 235
18 3300005840 Ga0068870_10080575 Ga0068870_100805751 235
19 3300006881 Ga0068865_100040866 Ga0068865_1000408664 235
20 3300009553 Ga0105249_10325947 Ga0105249_103259472 235
21 3300025901 Ga0207688_10002892 Ga0207688_100028929 235
22 3300025903 Ga0207680_10156667 Ga0207680_101566672 235
23 3300025925 Ga0207650_10430096 Ga0207650_104300961 235
24 3300025926 Ga0207659_10149167 Ga0207659_101491671 235
25 3300025940 Ga0207691_10014799 Ga0207691_100147995 235
26 3300026075 Ga0207708_10164477 Ga0207708_101644772 235
27 3300046615 Ga0495656_0037023 Ga0495656_0037023_1083_1937 235
28 3300005841 Ga0068863_100209675 Ga0068863_1002096752 236
29 3300025972 Ga0207668_10400750 Ga0207668_104007502 236
30 3300014745 Ga0157377_10084215 Ga0157377_100842152 239
31 3300027876 Ga0209974_10020612 Ga0209974_100206122 239
32 3300009147 Ga0114129_10038350 Ga0114129_100383502 240
33 3300050507 nmdc:mga05p37_19242_c1 nmdc:mga05p37_19242_c1_1067_1921 240
34 3300005439 Ga0070711_100116241 Ga0070711_1001162412 244
35 3300025981 Ga0207640_10302565 Ga0207640_103025652 244
36 3300035083 Ga0373926_0037056 Ga0373926_0037056_814_1695 244
37 3300035088 Ga0373940_0006960 Ga0373940_0006960_324_1205 244
38 3300035170 Ga0373943_0030064 Ga0373943_0030064_912_1793 244
39 3300035172 Ga0373955_0119222 Ga0373955_0119222_214_1095 244
40 3300035692 Ga0373935_0001406 Ga0373935_0001406_5928_6809 244
41 3300035695 Ga0373927_0003933 Ga0373927_0003933_5160_6041 244
42 3300035725 Ga0373947_0003263 Ga0373947_0003263_5084_5965 244
43 3300037068 Ga0373925_0017905 Ga0373925_0017905_2699_3580 244
44 3300046459 Ga0495629_0014941 Ga0495629_0014941_4240_5121 244
45 3300046477 Ga0495664_0001034 Ga0495664_0001034_4995_5876 244
46 3300046514 Ga0495618_0009681 Ga0495618_0009681_2215_3096 244
47 3300046529 Ga0495652_0018127 Ga0495652_0018127_2928_3809 244
48 3300046533 Ga0495640_0008356 Ga0495640_0008356_3941_4822 244
49 3300046642 Ga0495634_0018647 Ga0495634_0018647_2201_3082 244
50 3300046663 Ga0495635_0040366 Ga0495635_0040366_1381_2262 244
51 3300046678 Ga0495599_0054040 Ga0495599_0054040_1106_1987 244
52 3300047319 Ga0495674_0003621 Ga0495674_0003621_12996_13877 244
53 3300047322 Ga0495680_0041682 Ga0495680_0041682_301_1182 244
54 3300047673 Ga0495593_0080666 Ga0495593_0080666_746_1627 244
55 3300053077 Ga0495601_0000489 Ga0495601_0000489_9338_10219 244
56 3300053078 Ga0495612_0003322 Ga0495612_0003322_701_1582 244
57 3300053084 Ga0495595_0185451 Ga0495595_0185451_27_908 244
58 3300053085 Ga0495619_0000918 Ga0495619_0000918_7142_8023 244
59 3300026116 Ga0207674_10109359 Ga0207674_101093593 246
60 3300035083 Ga0373926_0029833 Ga0373926_0029833_1023_1904 246
61 3300035116 Ga0373945_0016385 Ga0373945_0016385_88_969 246
62 3300035695 Ga0373927_0005396 Ga0373927_0005396_2745_3626 246
63 3300035725 Ga0373947_0002425 Ga0373947_0002425_3269_4150 246
64 3300046455 Ga0495603_0005454 Ga0495603_0005454_5426_6307 246
65 3300046459 Ga0495629_0001360 Ga0495629_0001360_8371_9252 246
66 3300046461 Ga0495641_0017298 Ga0495641_0017298_553_1434 246
67 3300046473 Ga0495582_0027436 Ga0495582_0027436_1362_2243 246
68 3300046499 Ga0495594_0005195 Ga0495594_0005195_2351_3232 246
69 3300046681 Ga0495647_0001487 Ga0495647_0001487_3603_4484 246
70 3300046683 Ga0495658_0001084 Ga0495658_0001084_7880_8761 246
71 3300046689 Ga0495613_0005417 Ga0495613_0005417_6726_7607 246
72 3300047321 Ga0495676_0007996 Ga0495676_0007996_3249_4130 246
73 3300047322 Ga0495680_0055426 Ga0495680_0055426_1773_2654 246
74 3300047673 Ga0495593_0007998 Ga0495593_0007998_4429_5310 246
75 3300053085 Ga0495619_0007637 Ga0495619_0007637_3984_4865 246
76 3300025931 Ga0207644_10062623 Ga0207644_100626233 247
77 3300006175 Ga0070712_100154823 Ga0070712_1001548232 248
78 3300007265 Ga0099794_10000524 Ga0099794_100005242 248
79 3300009094 Ga0111539_10015670 Ga0111539_100156707 248
80 3300025910 Ga0207684_10132634 Ga0207684_101326342 248
81 3300025915 Ga0207693_10019706 Ga0207693_100197064 248
82 3300025922 Ga0207646_10310692 Ga0207646_103106922 248
83 3300025928 Ga0207700_10275792 Ga0207700_102757922 248
84 3300027671 Ga0209588_1021054 Ga0209588_10210542 248
85 3300027907 Ga0207428_10000618 Ga0207428_100006186 248
86 3300039447 Ga0436361_0100673 Ga0436361_0100673_9823_10707 248
87 3300039453 Ga0436362_0192500 Ga0436362_0192500_276_1160 248
88 3300048913 Ga0496110_0061092 Ga0496110_0061092_645_1529 248
89 3300048914 Ga0496111_0173165 Ga0496111_0173165_553_1437 248
90 3300050511 nmdc:mga08y16_262197_c1 nmdc:mga08y16_262197_c1_479_1351 248
91 3300050515 nmdc:mga0a205_437363_c1 nmdc:mga0a205_437363_c1_125_1009 248
92 3300035171 Ga0373946_0031099 Ga0373946_0031099_304_1185 249
93 3300050515 nmdc:mga0a205_67829_c1 nmdc:mga0a205_67829_c1_394_1185 249
94 3300005328 Ga0070676_10038120 Ga0070676_100381203 250
95 3300005331 Ga0070670_100106383 Ga0070670_1001063832 250
96 3300005434 Ga0070709_10003717 Ga0070709_100037173 250
97 3300005435 Ga0070714_100027177 Ga0070714_1000271775 250
98 3300005436 Ga0070713_100004110 Ga0070713_1000041108 250
99 3300005437 Ga0070710_10009433 Ga0070710_100094332 250
100 3300005466 Ga0070685_10051277 Ga0070685_100512772 250
101 3300005535 Ga0070684_100196582 Ga0070684_1001965822 250
102 3300005618 Ga0068864_100103511 Ga0068864_1001035112 250
103 3300005834 Ga0068851_10098544 Ga0068851_100985442 250
104 3300005841 Ga0068863_100221703 Ga0068863_1002217032 250
105 3300005843 Ga0068860_100059707 Ga0068860_1000597072 250
106 3300006028 Ga0070717_10002524 Ga0070717_100025249 250
107 3300006163 Ga0070715_10014381 Ga0070715_100143812 250
108 3300006358 Ga0068871_100066365 Ga0068871_1000663652 250
109 3300006846 Ga0075430_100106543 Ga0075430_1001065433 250
110 3300006847 Ga0075431_100055227 Ga0075431_1000552275 250
111 3300006880 Ga0075429_100077270 Ga0075429_1000772702 250
112 3300009176 Ga0105242_10042947 Ga0105242_100429472 250
113 3300009551 Ga0105238_10026812 Ga0105238_100268127 250
114 3300013306 Ga0163162_10443461 Ga0163162_104434611 250
115 3300014968 Ga0157379_10121826 Ga0157379_101218261 250
116 3300050508 nmdc:mga09592_81234_c1 nmdc:mga09592_81234_c1_1273_2127 250
117 3300050509 nmdc:mga0qj67_6794_c1 nmdc:mga0qj67_6794_c1_1050_1904 250
118 3300050510 nmdc:mga06r32_9128_c1 nmdc:mga06r32_9128_c1_1620_2474 250
119 3300005347 Ga0070668_100110689 Ga0070668_1001106893 251
120 3300005440 Ga0070705_100240835 Ga0070705_1002408352 251
121 3300005441 Ga0070700_100080640 Ga0070700_1000806402 251
122 3300009011 Ga0105251_10069951 Ga0105251_100699512 251
123 3300009101 Ga0105247_10143347 Ga0105247_101433472 251
124 3300025901 Ga0207688_10004006 Ga0207688_100040067 251
125 3300017792 Ga0163161_10032774 Ga0163161_100327742 252
126 3300025898 Ga0207692_10004754 Ga0207692_100047542 252
127 3300025900 Ga0207710_10009032 Ga0207710_100090322 252
128 3300025905 Ga0207685_10016102 Ga0207685_100161022 252
129 3300025906 Ga0207699_10001254 Ga0207699_100012549 252
130 3300025914 Ga0207671_10124734 Ga0207671_101247342 252
131 3300025915 Ga0207693_10033262 Ga0207693_100332623 252
132 3300025916 Ga0207663_10070063 Ga0207663_100700633 252
133 3300025928 Ga0207700_10001346 Ga0207700_100013468 252
134 3300025931 Ga0207644_10012365 Ga0207644_100123652 252
135 3300025972 Ga0207668_10071273 Ga0207668_100712732 252
136 3300025986 Ga0207658_10049243 Ga0207658_100492432 252
137 3300026078 Ga0207702_10037988 Ga0207702_100379885 252
138 3300026118 Ga0207675_100068525 Ga0207675_1000685254 252
139 3300026121 Ga0207683_10039992 Ga0207683_100399923 252
140 3300048903 Ga0496100_0018910 Ga0496100_0018910_607_1488 252
141 3300048904 Ga0496101_0022121 Ga0496101_0022121_2800_3681 252
142 3300048908 Ga0496105_0071518 Ga0496105_0071518_1731_2612 252
143 3300048909 Ga0496106_0010418 Ga0496106_0010418_4742_5623 252
144 3300048910 Ga0496107_0049231 Ga0496107_0049231_607_1488 252
145 3300048911 Ga0496108_0084322 Ga0496108_0084322_22_903 252
146 3300048912 Ga0496109_0013309 Ga0496109_0013309_3448_4329 252
147 3300048915 Ga0496112_0125331 Ga0496112_0125331_1603_2484 252
148 3300048917 Ga0496114_0025657 Ga0496114_0025657_255_1136 252
149 3300050509 nmdc:mga0qj67_276337_c1 nmdc:mga0qj67_276337_c1_245_1099 252
150 3300009147 Ga0114129_10128515 Ga0114129_101285152 253
151 3300050507 nmdc:mga05p37_139679_c1 nmdc:mga05p37_139679_c1_32_886 253
152 3300025922 Ga0207646_10372346 Ga0207646_103723462 254
153 3300026023 Ga0207677_10450255 Ga0207677_104502552 255
154 3300049586 Ga0501070_0352593 Ga0501070_0352593_198_1079 255
155 3300049823 Ga0501044_0087165 Ga0501044_0087165_640_1521 255
156 3300046531 Ga0495665_0002324 Ga0495665_0002324_8865_9746 256
157 3300049569 Ga0501032_0164855 Ga0501032_0164855_98_979 256
158 3300049571 Ga0501034_0010326 Ga0501034_0010326_2990_3871 256
159 3300049580 Ga0501046_0139165 Ga0501046_0139165_95_976 256
160 3300049586 Ga0501070_0301098 Ga0501070_0301098_152_1033 256
161 3300006038 Ga0075365_10038394 Ga0075365_100383943 258
162 3300013296 Ga0157374_10018578 Ga0157374_100185784 259
163 3300042436 Ga0439435_0012266 Ga0439435_0012266_117_971 259
164 3300053077 Ga0495601_0011239 Ga0495601_0011239_22_843 259
165 3300005843 Ga0068860_100083470 Ga0068860_1000834703 260
166 3300013297 Ga0157378_10654492 Ga0157378_106544922 260
167 3300025927 Ga0207687_10020291 Ga0207687_100202916 260
168 3300028381 Ga0268264_10116220 Ga0268264_101162202 260
169 3300048911 Ga0496108_0013377 Ga0496108_0013377_4874_5755 260
170 3300048916 Ga0496113_0061886 Ga0496113_0061886_393_1274 260
171 3300048918 Ga0496115_0220930 Ga0496115_0220930_14_838 260
172 3300006237 Ga0097621_100342140 Ga0097621_1003421402 261
173 3300006844 Ga0075428_100023662 Ga0075428_1000236624 261
174 3300036401 Ga0373937_0492283 Ga0373937_0492283_48_902 261
175 3300046459 Ga0495629_0274364 Ga0495629_0274364_41_895 261
176 3300046683 Ga0495658_0216767 Ga0495658_0216767_228_1082 261
177 3300048904 Ga0496101_0000139 Ga0496101_0000139_52537_53391 261
178 3300048907 Ga0496104_0081014 Ga0496104_0081014_61_915 261
179 3300048908 Ga0496105_0028853 Ga0496105_0028853_2511_3365 261
180 3300048910 Ga0496107_0035694 Ga0496107_0035694_249_1103 261
181 3300048917 Ga0496114_0000302 Ga0496114_0000302_12694_13548 261
182 3300005289 Ga0065704_10152474 Ga0065704_101524741 262
183 3300005295 Ga0065707_10202224 Ga0065707_102022241 262
184 3300025899 Ga0207642_10044876 Ga0207642_100448761 262
185 3300047315 Ga0495581_0148930 Ga0495581_0148930_27_902 262
186 3300026089 Ga0207648_10008257 Ga0207648_100082574 263
187 3300009147 Ga0114129_10145803 Ga0114129_101458033 264
188 3300050507 nmdc:mga05p37_612563_c1 nmdc:mga05p37_612563_c1_157_1011 264
189 3300005536 Ga0070697_100050149 Ga0070697_1000501493 265
190 3300005546 Ga0070696_100070177 Ga0070696_1000701772 265
191 3300009093 Ga0105240_10061980 Ga0105240_100619806 265
192 3300035113 Ga0373936_0003385 Ga0373936_0003385_3394_4275 265
193 3300035116 Ga0373945_0023201 Ga0373945_0023201_806_1687 265
194 3300035171 Ga0373946_0001521 Ga0373946_0001521_1728_2609 265
195 3300035410 Ga0373924_0002712 Ga0373924_0002712_2139_3020 265
196 3300035695 Ga0373927_0036489 Ga0373927_0036489_2037_2918 265
197 3300035725 Ga0373947_0007599 Ga0373947_0007599_524_1405 265
198 3300046452 Ga0495617_014008 Ga0495617_014008_1486_2367 265
199 3300046455 Ga0495603_0145736 Ga0495603_0145736_456_1337 265
200 3300046474 Ga0495605_0129399 Ga0495605_0129399_107_988 265
201 3300046475 Ga0495639_0005083 Ga0495639_0005083_3819_4700 265
202 3300046491 Ga0495584_0010382 Ga0495584_0010382_1369_2250 265
203 3300046492 Ga0495585_0002702 Ga0495585_0002702_4879_5760 265
204 3300046516 Ga0495628_0064674 Ga0495628_0064674_1346_2227 265
205 3300046523 Ga0495644_0000510 Ga0495644_0000510_7500_8381 265
206 3300046526 Ga0495666_0004543 Ga0495666_0004543_5333_6214 265
207 3300046557 Ga0495622_0006380 Ga0495622_0006380_329_1210 265
208 3300046559 Ga0495667_0004324 Ga0495667_0004324_3954_4835 265
209 3300046615 Ga0495656_0000296 Ga0495656_0000296_5938_6819 265
210 3300046648 Ga0495611_0004254 Ga0495611_0004254_964_1845 265
211 3300046663 Ga0495635_0007226 Ga0495635_0007226_6354_7235 265
212 3300046664 Ga0495659_0002362 Ga0495659_0002362_3692_4573 265
213 3300046674 Ga0495588_0037901 Ga0495588_0037901_1053_1934 265
214 3300046680 Ga0495646_0015832 Ga0495646_0015832_138_1019 265
215 3300046681 Ga0495647_0044751 Ga0495647_0044751_524_1405 265
216 3300046691 Ga0495670_0003427 Ga0495670_0003427_5512_6393 265
217 3300047315 Ga0495581_0002122 Ga0495581_0002122_8865_9746 265
218 3300047317 Ga0495604_0216908 Ga0495604_0216908_299_1180 265
219 3300047446 Ga0495679_019109 Ga0495679_019109_1519_2400 265
220 3300047471 Ga0495684_0002702 Ga0495684_0002702_12639_13520 265
221 3300048088 Ga0495602_0078230 Ga0495602_0078230_529_1410 265
222 3300035083 Ga0373926_0006770 Ga0373926_0006770_805_1686 266
223 3300046459 Ga0495629_0026104 Ga0495629_0026104_524_1405 266
224 3300046462 Ga0495651_0016437 Ga0495651_0016437_3766_4647 266
225 3300046514 Ga0495618_0017145 Ga0495618_0017145_460_1341 266
226 3300046529 Ga0495652_0012180 Ga0495652_0012180_5784_6665 266
227 3300046533 Ga0495640_0021657 Ga0495640_0021657_605_1486 266
228 3300046683 Ga0495658_0019732 Ga0495658_0019732_2374_3255 266
229 3300046690 Ga0495624_0002012 Ga0495624_0002012_14503_15384 266
230 3300047319 Ga0495674_0025009 Ga0495674_0025009_1724_2605 266
231 3300047322 Ga0495680_0006335 Ga0495680_0006335_948_1829 266
232 3300053084 Ga0495595_0005839 Ga0495595_0005839_524_1405 266
233 3300053085 Ga0495619_0028393 Ga0495619_0028393_1575_2456 266
234 3300013306 Ga0163162_10119627 Ga0163162_101196272 267
235 3300031548 Ga0307408_100252836 Ga0307408_1002528362 267
236 3300031901 Ga0307406_10270176 Ga0307406_102701762 267
237 3300031911 Ga0307412_10163678 Ga0307412_101636782 267
238 3300031995 Ga0307409_100000528 Ga0307409_1000005283 267
239 3300032002 Ga0307416_100007106 Ga0307416_1000071062 267
240 3300032126 Ga0307415_100085227 Ga0307415_1000852273 267
241 3300025926 Ga0207659_10169865 Ga0207659_101698652 268
242 3300049571 Ga0501034_0000032 Ga0501034_0000032_50969_51829 268
243 3300049744 Ga0501083_0245162 Ga0501083_0245162_181_1041 268
244 3300005437 Ga0070710_10024133 Ga0070710_100241332 269
245 3300005578 Ga0068854_100008701 Ga0068854_1000087017 269
246 3300006175 Ga0070712_100001737 Ga0070712_10000173713 269
247 3300025898 Ga0207692_10004787 Ga0207692_100047872 269
248 3300025915 Ga0207693_10006308 Ga0207693_100063083 269
249 3300025981 Ga0207640_10146462 Ga0207640_101464622 269
250 3300026067 Ga0207678_10110386 Ga0207678_101103862 269
251 3300044842 Ga0466957_0323690 Ga0466957_0323690_53_934 269
252 3300046455 Ga0495603_0008659 Ga0495603_0008659_2516_3397 269
253 3300002076 JGI24749J21850_1008546 JGI24749J21850_10085462 270
254 3300005293 Ga0065715_10001776 Ga0065715_100017766 270
255 3300005328 Ga0070676_10078929 Ga0070676_100789292 270
256 3300005330 Ga0070690_100004954 Ga0070690_1000049547 270
257 3300005333 Ga0070677_10051262 Ga0070677_100512622 270
258 3300005334 Ga0068869_100009169 Ga0068869_1000091693 270
259 3300005334 Ga0068869_100065766 Ga0068869_1000657663 270
260 3300005335 Ga0070666_10042811 Ga0070666_100428111 270
261 3300005335 Ga0070666_10065004 Ga0070666_100650043 270
262 3300005335 Ga0070666_10185721 Ga0070666_101857212 270
263 3300005336 Ga0070680_100137540 Ga0070680_1001375402 270
264 3300005338 Ga0068868_100055287 Ga0068868_1000552873 270
265 3300005344 Ga0070661_100041809 Ga0070661_1000418094 270
266 3300005353 Ga0070669_100004359 Ga0070669_1000043599 270
267 3300005353 Ga0070669_100060846 Ga0070669_1000608463 270
268 3300005354 Ga0070675_100321944 Ga0070675_1003219442 270
269 3300005355 Ga0070671_100220413 Ga0070671_1002204132 270
270 3300005356 Ga0070674_100010572 Ga0070674_1000105726 270
271 3300005356 Ga0070674_100121181 Ga0070674_1001211812 270
272 3300005365 Ga0070688_100086126 Ga0070688_1000861262 270
273 3300005366 Ga0070659_100052852 Ga0070659_1000528523 270
274 3300005367 Ga0070667_100208915 Ga0070667_1002089152 270
275 3300005456 Ga0070678_100041389 Ga0070678_1000413892 270
276 3300005456 Ga0070678_100044465 Ga0070678_1000444653 270
277 3300005457 Ga0070662_100067780 Ga0070662_1000677803 270
278 3300005459 Ga0068867_100086002 Ga0068867_1000860022 270
279 3300005466 Ga0070685_10024707 Ga0070685_100247071 270
280 3300005544 Ga0070686_100002924 Ga0070686_1000029241 270
281 3300005548 Ga0070665_100003364 Ga0070665_10000336414 270
282 3300005548 Ga0070665_100301619 Ga0070665_1003016192 270
283 3300005564 Ga0070664_100250895 Ga0070664_1002508951 270
284 3300005616 Ga0068852_100209211 Ga0068852_1002092112 270
285 3300005617 Ga0068859_100176333 Ga0068859_1001763333 270
286 3300005617 Ga0068859_100661817 Ga0068859_1006618171 270
287 3300005618 Ga0068864_100076599 Ga0068864_1000765992 270
288 3300005840 Ga0068870_10005414 Ga0068870_100054146 270
289 3300005840 Ga0068870_10017388 Ga0068870_100173884 270
290 3300005841 Ga0068863_100035661 Ga0068863_1000356614 270
291 3300005841 Ga0068863_100412796 Ga0068863_1004127962 270
292 3300005842 Ga0068858_100009999 Ga0068858_1000099993 270
293 3300005844 Ga0068862_100129090 Ga0068862_1001290903 270
294 3300006237 Ga0097621_100126007 Ga0097621_1001260071 270
295 3300006358 Ga0068871_100002011 Ga0068871_1000020115 270
296 3300006358 Ga0068871_100134682 Ga0068871_1001346822 270
297 3300006844 Ga0075428_100000244 Ga0075428_10000024412 270
298 3300006844 Ga0075428_100106548 Ga0075428_1001065482 270
299 3300006844 Ga0075428_100136009 Ga0075428_1001360092 270
300 3300006844 Ga0075428_100192007 Ga0075428_1001920072 270
301 3300006846 Ga0075430_100000582 Ga0075430_1000005827 270
302 3300006846 Ga0075430_100062300 Ga0075430_1000623002 270
303 3300006846 Ga0075430_100105691 Ga0075430_1001056912 270
304 3300006847 Ga0075431_100001060 Ga0075431_10000106012 270
305 3300006847 Ga0075431_100096289 Ga0075431_1000962893 270
306 3300006852 Ga0075433_10000619 Ga0075433_100006199 270
307 3300006852 Ga0075433_10030597 Ga0075433_100305974 270
308 3300006871 Ga0075434_100004079 Ga0075434_1000040796 270
309 3300006871 Ga0075434_100017701 Ga0075434_1000177014 270
310 3300006880 Ga0075429_100002092 Ga0075429_1000020928 270
311 3300006880 Ga0075429_100075628 Ga0075429_1000756283 270
312 3300006880 Ga0075429_100346210 Ga0075429_1003462102 270
313 3300006881 Ga0068865_100010433 Ga0068865_1000104332 270
314 3300006931 Ga0097620_100176333 Ga0097620_1001763333 270
315 3300006931 Ga0097620_100661747 Ga0097620_1006617471 270
316 3300007076 Ga0075435_100060707 Ga0075435_1000607073 270
317 3300009094 Ga0111539_10031703 Ga0111539_100317034 270
318 3300009094 Ga0111539_10068805 Ga0111539_100688054 270
319 3300009094 Ga0111539_10111192 Ga0111539_101111921 270
320 3300009101 Ga0105247_10086596 Ga0105247_100865963 270
321 3300009101 Ga0105247_10411801 Ga0105247_104118011 270
322 3300009147 Ga0114129_10182472 Ga0114129_101824722 270
323 3300009147 Ga0114129_10182921 Ga0114129_101829213 270
324 3300009147 Ga0114129_10397129 Ga0114129_103971292 270
325 3300009176 Ga0105242_10043444 Ga0105242_100434443 270
326 3300009176 Ga0105242_10069220 Ga0105242_100692202 270
327 3300009177 Ga0105248_10024215 Ga0105248_100242155 270
328 3300009177 Ga0105248_10066106 Ga0105248_100661064 270
329 3300009177 Ga0105248_10316575 Ga0105248_103165752 270
330 3300009553 Ga0105249_10002139 Ga0105249_1000213912 270
331 3300009553 Ga0105249_10329397 Ga0105249_103293972 270
332 3300011119 Ga0105246_10024343 Ga0105246_100243431 270
333 3300013306 Ga0163162_10015033 Ga0163162_100150332 270
334 3300014326 Ga0157380_10092975 Ga0157380_100929752 270
335 3300014326 Ga0157380_10285891 Ga0157380_102858912 270
336 3300014968 Ga0157379_10030677 Ga0157379_100306772 270
337 3300014968 Ga0157379_10508921 Ga0157379_105089212 270
338 3300014969 Ga0157376_10064786 Ga0157376_100647862 270
339 3300014969 Ga0157376_10076025 Ga0157376_100760251 270
340 3300025315 Ga0207697_10002429 Ga0207697_100024299 270
341 3300025893 Ga0207682_10002055 Ga0207682_100020552 270
342 3300025893 Ga0207682_10012922 Ga0207682_100129224 270
343 3300025899 Ga0207642_10053452 Ga0207642_100534522 270
344 3300025900 Ga0207710_10129303 Ga0207710_101293032 270
345 3300025903 Ga0207680_10118308 Ga0207680_101183082 270
346 3300025903 Ga0207680_10231916 Ga0207680_102319161 270
347 3300025903 Ga0207680_10319584 Ga0207680_103195842 270
348 3300025907 Ga0207645_10004635 Ga0207645_100046352 270
349 3300025908 Ga0207643_10004233 Ga0207643_100042337 270
350 3300025917 Ga0207660_10110321 Ga0207660_101103212 270
351 3300025923 Ga0207681_10065445 Ga0207681_100654451 270
352 3300025923 Ga0207681_10112004 Ga0207681_101120042 270
353 3300025926 Ga0207659_10265039 Ga0207659_102650392 270
354 3300025931 Ga0207644_10240050 Ga0207644_102400502 270
355 3300025933 Ga0207706_10023556 Ga0207706_100235563 270
356 3300025933 Ga0207706_10303313 Ga0207706_103033131 270
357 3300025934 Ga0207686_10043987 Ga0207686_100439871 270
358 3300025936 Ga0207670_10033572 Ga0207670_100335723 270
359 3300025937 Ga0207669_10006797 Ga0207669_100067976 270
360 3300025938 Ga0207704_10098360 Ga0207704_100983602 270
361 3300025941 Ga0207711_10111731 Ga0207711_101117313 270
362 3300025942 Ga0207689_10002645 Ga0207689_1000264513 270
363 3300025942 Ga0207689_10036466 Ga0207689_100364664 270
364 3300025960 Ga0207651_10036110 Ga0207651_100361102 270
365 3300025961 Ga0207712_10014268 Ga0207712_100142681 270
366 3300025972 Ga0207668_10072923 Ga0207668_100729232 270
367 3300025972 Ga0207668_10131723 Ga0207668_101317232 270
368 3300025986 Ga0207658_10184189 Ga0207658_101841892 270
369 3300026023 Ga0207677_10390125 Ga0207677_103901252 270
370 3300026023 Ga0207677_10443960 Ga0207677_104439601 270
371 3300026023 Ga0207677_10635575 Ga0207677_106355751 270
372 3300026035 Ga0207703_10197611 Ga0207703_101976111 270
373 3300026075 Ga0207708_10009553 Ga0207708_100095537 270
374 3300026088 Ga0207641_10066656 Ga0207641_100666563 270
375 3300026095 Ga0207676_10182386 Ga0207676_101823862 270
376 3300026121 Ga0207683_10103293 Ga0207683_101032933 270
377 3300027907 Ga0207428_10002825 Ga0207428_100028257 270
378 3300028379 Ga0268266_10321543 Ga0268266_103215431 270
379 3300028380 Ga0268265_10160764 Ga0268265_101607642 270
380 3300028380 Ga0268265_10257308 Ga0268265_102573082 270
381 3300028381 Ga0268264_10168115 Ga0268264_101681152 270
382 3300031548 Ga0307408_100236869 Ga0307408_1002368692 270
383 3300031731 Ga0307405_10144213 Ga0307405_101442131 270
384 3300031852 Ga0307410_10098212 Ga0307410_100982122 270
385 3300032002 Ga0307416_100310363 Ga0307416_1003103632 270
386 3300032126 Ga0307415_100200038 Ga0307415_1002000382 270
387 3300042436 Ga0439435_0000980 Ga0439435_0000980_1721_2575 270
388 3300045051 Ga0451576_0102334 Ga0451576_0102334_245_1099 270
389 3300048907 Ga0496104_0038299 Ga0496104_0038299_1913_2767 270
390 3300049572 Ga0501036_0119007 Ga0501036_0119007_448_1302 270
391 3300049573 Ga0501037_0230003 Ga0501037_0230003_303_1157 270
392 3300049574 Ga0501038_0084930 Ga0501038_0084930_772_1626 270
393 3300049576 Ga0501040_0011176 Ga0501040_0011176_666_1520 270
394 3300049576 Ga0501040_0082719 Ga0501040_0082719_291_1145 270
395 3300049578 Ga0501042_0006967 Ga0501042_0006967_68_922 270
396 3300049578 Ga0501042_0327750 Ga0501042_0327750_145_999 270
397 3300049584 Ga0501068_0238973 Ga0501068_0238973_20_874 270
398 3300049587 Ga0501071_0004387 Ga0501071_0004387_4121_4975 270
399 3300049588 Ga0501072_0013202 Ga0501072_0013202_2316_3170 270
400 3300049588 Ga0501072_0030716 Ga0501072_0030716_3046_3900 270
401 3300049591 Ga0501075_0000528 Ga0501075_0000528_20302_21156 270
402 3300049592 Ga0501076_0000391 Ga0501076_0000391_23322_24176 270
403 3300049741 Ga0501079_0114129 Ga0501079_0114129_1198_2052 270
404 3300049742 Ga0501080_0193879 Ga0501080_0193879_52_906 270
405 3300049743 Ga0501081_0001914 Ga0501081_0001914_6674_7528 270
406 3300049743 Ga0501081_0035321 Ga0501081_0035321_68_922 270
407 3300049824 Ga0501045_0010164 Ga0501045_0010164_4339_5193 270
408 3300049824 Ga0501045_0093853 Ga0501045_0093853_1354_2208 270
409 3300050507 nmdc:mga05p37_150209_c1 nmdc:mga05p37_150209_c1_832_1686 270
410 3300050507 nmdc:mga05p37_335080_c1 nmdc:mga05p37_335080_c1_772_1626 270
411 3300050508 nmdc:mga09592_16225_c1 nmdc:mga09592_16225_c1_983_1837 270
412 3300050508 nmdc:mga09592_327286_c1 nmdc:mga09592_327286_c1_287_1141 270
413 3300050508 nmdc:mga09592_7590_c1 nmdc:mga09592_7590_c1_7088_7942 270
414 3300050509 nmdc:mga0qj67_160443_c1 nmdc:mga0qj67_160443_c1_890_1744 270
415 3300050509 nmdc:mga0qj67_68754_c1 nmdc:mga0qj67_68754_c1_292_1146 270
416 3300050509 nmdc:mga0qj67_800_c1 nmdc:mga0qj67_800_c1_11626_12480 270
417 3300050510 nmdc:mga06r32_117187_c1 nmdc:mga06r32_117187_c1_1615_2469 270
418 3300050510 nmdc:mga06r32_4226_c1 nmdc:mga06r32_4226_c1_5530_6384 270
419 3300050511 nmdc:mga08y16_137515_c1 nmdc:mga08y16_137515_c1_1668_2522 270
420 3300050511 nmdc:mga08y16_191454_c1 nmdc:mga08y16_191454_c1_210_1064 270
421 3300050511 nmdc:mga08y16_356917_c1 nmdc:mga08y16_356917_c1_200_1054 270
422 3300050511 nmdc:mga08y16_50496_c1 nmdc:mga08y16_50496_c1_2523_3377 270
423 3300050512 nmdc:mga0n895_16020_c1 nmdc:mga0n895_16020_c1_3559_4413 270
424 3300050512 nmdc:mga0n895_590_c1 nmdc:mga0n895_590_c1_19955_20809 270
425 3300050513 nmdc:mga0rr50_9580_c1 nmdc:mga0rr50_9580_c1_1021_1875 270
426 3300050515 nmdc:mga0a205_254_c1 nmdc:mga0a205_254_c1_9707_10561 270
427 3300050515 nmdc:mga0a205_5139_c1 nmdc:mga0a205_5139_c1_4152_5006 270
428 3300054114 Ga0501084_0011673 Ga0501084_0011673_3344_4198 270
429 3300060353 Ga0501082_0001012 Ga0501082_0001012_10681_11535 270
430 3300061734 Ga0530510_0001725 Ga0530510_0001725_8430_9284 270
431 3300061734 Ga0530510_0011633 Ga0530510_0011633_2373_3227 270
432 3300061734 Ga0530510_0411754 Ga0530510_0411754_40_894 270
433 3300005355 Ga0070671_100485053 Ga0070671_1004850531 271
434 3300005337 Ga0070682_100058339 Ga0070682_1000583392 272
435 3300005355 Ga0070671_100119489 Ga0070671_1001194892 272
436 3300005842 Ga0068858_100249737 Ga0068858_1002497371 272
437 3300005843 Ga0068860_100092944 Ga0068860_1000929443 272
438 3300006358 Ga0068871_100088464 Ga0068871_1000884642 272
439 3300014969 Ga0157376_10262362 Ga0157376_102623622 272
440 3300025931 Ga0207644_10095966 Ga0207644_100959662 272
441 3300026035 Ga0207703_10223286 Ga0207703_102232862 272
442 3300028381 Ga0268264_10076481 Ga0268264_100764812 272
443 3300005328 Ga0070676_10069034 Ga0070676_100690342 274
444 3300005340 Ga0070689_100120850 Ga0070689_1001208502 274
445 3300005347 Ga0070668_100022042 Ga0070668_1000220426 274
446 3300005354 Ga0070675_100222603 Ga0070675_1002226032 274
447 3300005356 Ga0070674_100012006 Ga0070674_1000120062 274
448 3300005366 Ga0070659_100051064 Ga0070659_1000510642 274
449 3300005367 Ga0070667_100234809 Ga0070667_1002348092 274
450 3300005434 Ga0070709_10007744 Ga0070709_100077446 274
451 3300005435 Ga0070714_100108194 Ga0070714_1001081942 274
452 3300005436 Ga0070713_100036719 Ga0070713_1000367192 274
453 3300005439 Ga0070711_100036310 Ga0070711_1000363104 274
454 3300005439 Ga0070711_100110807 Ga0070711_1001108072 274
455 3300005455 Ga0070663_100007370 Ga0070663_1000073702 274
456 3300005456 Ga0070678_100023471 Ga0070678_1000234714 274
457 3300005530 Ga0070679_100044872 Ga0070679_1000448721 274
458 3300005530 Ga0070679_100597948 Ga0070679_1005979481 274
459 3300005535 Ga0070684_100408354 Ga0070684_1004083542 274
460 3300005548 Ga0070665_100124409 Ga0070665_1001244092 274
461 3300005548 Ga0070665_100158932 Ga0070665_1001589322 274
462 3300005718 Ga0068866_10014236 Ga0068866_100142362 274
463 3300005719 Ga0068861_100089269 Ga0068861_1000892692 274
464 3300005841 Ga0068863_100374033 Ga0068863_1003740332 274
465 3300005842 Ga0068858_100318988 Ga0068858_1003189882 274
466 3300005843 Ga0068860_100728347 Ga0068860_1007283471 274
467 3300005983 Ga0081540_1003105 Ga0081540_100310513 274
468 3300005983 Ga0081540_1023500 Ga0081540_10235002 274
469 3300006028 Ga0070717_10012428 Ga0070717_100124286 274
470 3300006163 Ga0070715_10008284 Ga0070715_100082842 274
471 3300006173 Ga0070716_100042164 Ga0070716_1000421642 274
472 3300006237 Ga0097621_100187058 Ga0097621_1001870582 274
473 3300006844 Ga0075428_100756315 Ga0075428_1007563151 274
474 3300006871 Ga0075434_100091925 Ga0075434_1000919254 274
475 3300007076 Ga0075435_100170727 Ga0075435_1001707272 274
476 3300009093 Ga0105240_10268559 Ga0105240_102685592 274
477 3300009101 Ga0105247_10210022 Ga0105247_102100222 274
478 3300009148 Ga0105243_10030731 Ga0105243_100307312 274
479 3300013105 Ga0157369_10489916 Ga0157369_104899162 274
480 3300013297 Ga0157378_10066262 Ga0157378_100662622 274
481 3300013306 Ga0163162_10152076 Ga0163162_101520762 274
482 3300013306 Ga0163162_10536343 Ga0163162_105363432 274
483 3300013308 Ga0157375_10100905 Ga0157375_101009052 274
484 3300014326 Ga0157380_10012071 Ga0157380_100120717 274
485 3300014968 Ga0157379_10350427 Ga0157379_103504272 274
486 3300014969 Ga0157376_10140446 Ga0157376_101404462 274
487 3300017792 Ga0163161_10032991 Ga0163161_100329913 274
488 3300025899 Ga0207642_10008483 Ga0207642_100084832 274
489 3300025900 Ga0207710_10082403 Ga0207710_100824032 274
490 3300025903 Ga0207680_10122953 Ga0207680_101229532 274
491 3300025918 Ga0207662_10060614 Ga0207662_100606142 274
492 3300025921 Ga0207652_10036535 Ga0207652_100365355 274
493 3300025921 Ga0207652_10112556 Ga0207652_101125563 274
494 3300025924 Ga0207694_10107621 Ga0207694_101076212 274
495 3300025926 Ga0207659_10162446 Ga0207659_101624462 274
496 3300025927 Ga0207687_10320339 Ga0207687_103203391 274
497 3300025928 Ga0207700_10003896 Ga0207700_100038966 274
498 3300025929 Ga0207664_10021740 Ga0207664_100217404 274
499 3300025932 Ga0207690_10138669 Ga0207690_101386692 274
500 3300025933 Ga0207706_10002734 Ga0207706_1000273411 274
501 3300025935 Ga0207709_10033747 Ga0207709_100337472 274
502 3300025939 Ga0207665_10025953 Ga0207665_100259533 274
503 3300025949 Ga0207667_10138991 Ga0207667_101389912 274
504 3300025972 Ga0207668_10018130 Ga0207668_100181303 274
505 3300026023 Ga0207677_10065649 Ga0207677_100656492 274
506 3300026035 Ga0207703_10089906 Ga0207703_100899062 274
507 3300026067 Ga0207678_10001842 Ga0207678_1000184214 274
508 3300026118 Ga0207675_100001130 Ga0207675_10000113027 274
509 3300026121 Ga0207683_10051823 Ga0207683_100518232 274
510 3300028379 Ga0268266_10044601 Ga0268266_100446013 274
511 3300028381 Ga0268264_10234732 Ga0268264_102347321 274
512 3300028794 Ga0307515_10231400 Ga0307515_102314002 274
513 3300030521 Ga0307511_10115747 Ga0307511_101157472 274
514 3300031507 Ga0307509_10110955 Ga0307509_101109552 274
515 3300032002 Ga0307416_100311974 Ga0307416_1003119742 274
516 3300039437 Ga0436365_0731126 Ga0436365_0731126_240_1121 274
517 3300046457 Ga0495590_0046292 Ga0495590_0046292_202_1083 274
518 3300046460 Ga0495638_0016736 Ga0495638_0016736_2287_3168 274
519 3300046474 Ga0495605_0085743 Ga0495605_0085743_474_1355 274
520 3300046492 Ga0495585_0042158 Ga0495585_0042158_43_924 274
521 3300046492 Ga0495585_0072054 Ga0495585_0072054_513_1394 274
522 3300046500 Ga0495596_0049139 Ga0495596_0049139_16_897 274
523 3300046500 Ga0495596_0061973 Ga0495596_0061973_53_934 274
524 3300046519 Ga0495632_0031806 Ga0495632_0031806_731_1612 274
525 3300046615 Ga0495656_0007959 Ga0495656_0007959_61_942 274
526 3300046616 Ga0495668_0019264 Ga0495668_0019264_400_1281 274
527 3300046684 Ga0495669_0024557 Ga0495669_0024557_1004_1885 274
528 3300046684 Ga0495669_0173737 Ga0495669_0173737_122_1003 274
529 3300046692 Ga0495671_0077704 Ga0495671_0077704_482_1363 274
530 3300046794 Ga0495589_0092592 Ga0495589_0092592_515_1396 274
531 3300047445 Ga0495677_0027186 Ga0495677_0027186_520_1401 274
532 3300047472 Ga0495686_0121046 Ga0495686_0121046_520_1401 274
533 3300048903 Ga0496100_0022574 Ga0496100_0022574_1450_2331 274
534 3300048905 Ga0496102_0089486 Ga0496102_0089486_492_1373 274
535 3300048905 Ga0496102_0194395 Ga0496102_0194395_661_1542 274
536 3300048910 Ga0496107_0285265 Ga0496107_0285265_61_942 274
537 3300048913 Ga0496110_0094477 Ga0496110_0094477_1235_2116 274
538 3300048924 Ga0496121_0114438 Ga0496121_0114438_181_1062 274
539 3300048929 Ga0496126_0072057 Ga0496126_0072057_1430_2311 274
540 3300049460 Ga0495682_0048274 Ga0495682_0048274_217_1098 274
541 3300050511 nmdc:mga08y16_147897_c1 nmdc:mga08y16_147897_c1_57_938 274
542 3300053092 Ga0500583_0149936 Ga0500583_0149936_45_926 274
543 3300053130 Ga0500642_0019890 Ga0500642_0019890_77_958 274
544 3300053134 Ga0500658_0031645 Ga0500658_0031645_775_1656 274
545 3300053137 Ga0500561_0017452 Ga0500561_0017452_314_1195 274
546 3300053150 Ga0500603_051690 Ga0500603_051690_91_972 274
547 3300053158 Ga0500627_0060088 Ga0500627_0060088_173_1054 274
548 iso_pu_bacteria 2513237139 2513876325 274
549 3300005336 Ga0070680_100519073 Ga0070680_1005190731 275
550 3300005614 Ga0068856_100177795 Ga0068856_1001777952 275
551 3300005983 Ga0081540_1017499 Ga0081540_10174993 275
552 3300006175 Ga0070712_100297804 Ga0070712_1002978042 275
553 3300009174 Ga0105241_10067576 Ga0105241_100675762 275
554 3300013307 Ga0157372_10258347 Ga0157372_102583472 275
555 3300025898 Ga0207692_10096591 Ga0207692_100965912 275
556 3300025911 Ga0207654_10033105 Ga0207654_100331052 275
557 3300025912 Ga0207707_10489246 Ga0207707_104892461 275
558 3300025915 Ga0207693_10051854 Ga0207693_100518544 275
559 3300049569 Ga0501032_0022579 Ga0501032_0022579_17_898 275
560 3300049571 Ga0501034_0015121 Ga0501034_0015121_460_1341 275
561 3300049579 Ga0501043_0022339 Ga0501043_0022339_1629_2510 275
562 3300049581 Ga0501047_0000100 Ga0501047_0000100_41452_42333 275
563 3300049582 Ga0501048_0000083 Ga0501048_0000083_40425_41306 275
564 3300049586 Ga0501070_0009312 Ga0501070_0009312_76_957 275
565 3300049589 Ga0501073_0038845 Ga0501073_0038845_973_1854 275
566 3300049590 Ga0501074_0089797 Ga0501074_0089797_228_1109 275
567 3300049742 Ga0501080_0000030 Ga0501080_0000030_46305_47186 275
568 3300049744 Ga0501083_0002641 Ga0501083_0002641_10983_11864 275
569 3300049823 Ga0501044_0000587 Ga0501044_0000587_27464_28345 275
570 3300050490 nmdc:mga03n38_2690_c1 nmdc:mga03n38_2690_c1_12_881 275
571 iso_pu_bacteria 8056681323 8056686183 275
572 3300035113 Ga0373936_0028966 Ga0373936_0028966_690_1571 276
573 3300053094 Ga0500566_0006739 Ga0500566_0006739_4874_5755 276
574 3300053102 Ga0500554_022940 Ga0500554_022940_649_1530 276
575 3300053119 Ga0500595_000151 Ga0500595_000151_10536_11417 276
576 3300053178 Ga0500637_0001169 Ga0500637_0001169_4875_5756 276
577 3300055283 Ga0500661_000174 Ga0500661_000174_3864_4745 276
578 3300003215 JGI25153J46596_10000711 JGI25153J46596_1000071112 277
579 3300006844 Ga0075428_100002840 Ga0075428_1000028405 277
580 3300006847 Ga0075431_100001610 Ga0075431_1000016105 277
581 3300006847 Ga0075431_100058589 Ga0075431_1000585895 277
582 3300006880 Ga0075429_100002359 Ga0075429_1000023592 277
583 3300009094 Ga0111539_10003049 Ga0111539_100030495 277
584 3300009147 Ga0114129_10001163 Ga0114129_100011635 277
585 3300009147 Ga0114129_10016497 Ga0114129_100164977 277
586 3300025297 Ga0209758_1000373 Ga0209758_100037344 277
587 3300025915 Ga0207693_10093265 Ga0207693_100932652 277
588 3300026089 Ga0207648_10204586 Ga0207648_102045861 277
589 3300027907 Ga0207428_10005326 Ga0207428_1000532612 277
590 3300037466 Ga0395898_0017111 Ga0395898_0017111_1968_2849 277
591 3300038443 Ga0395901_0076535 Ga0395901_0076535_1646_2527 277
592 3300046474 Ga0495605_0040726 Ga0495605_0040726_886_1767 277
593 3300046537 Ga0495598_0007871 Ga0495598_0007871_740_1621 277
594 3300050507 nmdc:mga05p37_928_c1 nmdc:mga05p37_928_c1_3314_4195 277
595 3300050508 nmdc:mga09592_13720_c1 nmdc:mga09592_13720_c1_5417_6298 277
596 3300050510 nmdc:mga06r32_379315_c1 nmdc:mga06r32_379315_c1_125_1006 277
597 3300050510 nmdc:mga06r32_795_c1 nmdc:mga06r32_795_c1_3294_4175 277
598 3300050511 nmdc:mga08y16_2587_c1 nmdc:mga08y16_2587_c1_14416_15297 277
599 3300005356 Ga0070674_100271568 Ga0070674_1002715682 278
600 3300005435 Ga0070714_100055382 Ga0070714_1000553823 278
601 3300005547 Ga0070693_100088862 Ga0070693_1000888622 278
602 3300006844 Ga0075428_100168119 Ga0075428_1001681193 278
603 3300006847 Ga0075431_100159175 Ga0075431_1001591752 278
604 3300006880 Ga0075429_100049786 Ga0075429_1000497862 278
605 3300009147 Ga0114129_10019842 Ga0114129_100198425 278
606 3300009147 Ga0114129_10466053 Ga0114129_104660532 278
607 3300009177 Ga0105248_10032843 Ga0105248_100328432 278
608 3300013104 Ga0157370_10322076 Ga0157370_103220762 278
609 3300014326 Ga0157380_10087071 Ga0157380_100870712 278
610 3300025909 Ga0207705_10026102 Ga0207705_100261022 278
611 3300025917 Ga0207660_10266723 Ga0207660_102667232 278
612 3300025929 Ga0207664_10242666 Ga0207664_102426662 278
613 3300025938 Ga0207704_10076001 Ga0207704_100760012 278
614 3300025940 Ga0207691_10123539 Ga0207691_101235392 278
615 3300025941 Ga0207711_10153129 Ga0207711_101531292 278
616 3300031247 Ga0265340_10015435 Ga0265340_100154353 278
617 3300031712 Ga0265342_10058879 Ga0265342_100588791 278
618 3300035242 Ga0373962_0011114 Ga0373962_0011114_647_1528 278
619 3300037312 Ga0395899_0115555 Ga0395899_0115555_649_1530 278
620 3300037418 Ga0395900_0040758 Ga0395900_0040758_2901_3782 278
621 3300037466 Ga0395898_0107327 Ga0395898_0107327_1676_2557 278
622 3300037471 Ga0395905_0091441 Ga0395905_0091441_1400_2281 278
623 3300048913 Ga0496110_0266420 Ga0496110_0266420_199_1080 278
624 3300050492 nmdc:mga0yw44_37220_c1 nmdc:mga0yw44_37220_c1_1376_2257 278
625 3300050507 nmdc:mga05p37_88171_c1 nmdc:mga05p37_88171_c1_1608_2489 278
626 3300050509 nmdc:mga0qj67_131855_c1 nmdc:mga0qj67_131855_c1_128_1021 278
627 3300002075 JGI24738J21930_10012259 JGI24738J21930_100122592 279
628 3300002459 JGI24751J29686_10002801 JGI24751J29686_100028013 279
629 3300003203 JGI25406J46586_10000019 JGI25406J46586_1000001953 279
630 3300003322 rootL2_10036865 rootL2_100368658 279
631 3300005327 Ga0070658_10078278 Ga0070658_100782782 279
632 3300005327 Ga0070658_10170943 Ga0070658_101709432 279
633 3300005327 Ga0070658_10204275 Ga0070658_102042752 279
634 3300005329 Ga0070683_100315892 Ga0070683_1003158922 279
635 3300005330 Ga0070690_100018630 Ga0070690_1000186304 279
636 3300005331 Ga0070670_100087005 Ga0070670_1000870052 279
637 3300005334 Ga0068869_100000346 Ga0068869_10000034611 279
638 3300005336 Ga0070680_100040085 Ga0070680_1000400852 279
639 3300005336 Ga0070680_100199183 Ga0070680_1001991832 279
640 3300005339 Ga0070660_100003286 Ga0070660_1000032862 279
641 3300005339 Ga0070660_100081795 Ga0070660_1000817952 279
642 3300005341 Ga0070691_10023195 Ga0070691_100231952 279
643 3300005344 Ga0070661_100130576 Ga0070661_1001305762 279
644 3300005344 Ga0070661_100222353 Ga0070661_1002223532 279
645 3300005344 Ga0070661_100222369 Ga0070661_1002223691 279
646 3300005347 Ga0070668_100000210 Ga0070668_10000021032 279
647 3300005353 Ga0070669_100000370 Ga0070669_1000003709 279
648 3300005356 Ga0070674_100000760 Ga0070674_1000007602 279
649 3300005364 Ga0070673_100382113 Ga0070673_1003821131 279
650 3300005366 Ga0070659_100032761 Ga0070659_1000327612 279
651 3300005367 Ga0070667_100000294 Ga0070667_10000029431 279
652 3300005434 Ga0070709_10002615 Ga0070709_100026159 279
653 3300005435 Ga0070714_100105021 Ga0070714_1001050213 279
654 3300005435 Ga0070714_100376131 Ga0070714_1003761311 279
655 3300005436 Ga0070713_100001463 Ga0070713_1000014634 279
656 3300005436 Ga0070713_100141866 Ga0070713_1001418662 279
657 3300005437 Ga0070710_10024443 Ga0070710_100244433 279
658 3300005438 Ga0070701_10015036 Ga0070701_100150363 279
659 3300005439 Ga0070711_100007657 Ga0070711_1000076576 279
660 3300005455 Ga0070663_100005311 Ga0070663_1000053117 279
661 3300005457 Ga0070662_100037565 Ga0070662_1000375654 279
662 3300005458 Ga0070681_10217230 Ga0070681_102172302 279
663 3300005458 Ga0070681_10244749 Ga0070681_102447492 279
664 3300005459 Ga0068867_100000733 Ga0068867_1000007339 279
665 3300005530 Ga0070679_100187101 Ga0070679_1001871012 279
666 3300005535 Ga0070684_100024421 Ga0070684_1000244214 279
667 3300005539 Ga0068853_100046500 Ga0068853_1000465002 279
668 3300005539 Ga0068853_100248155 Ga0068853_1002481552 279
669 3300005544 Ga0070686_100079914 Ga0070686_1000799142 279
670 3300005547 Ga0070693_100066807 Ga0070693_1000668072 279
671 3300005548 Ga0070665_100044335 Ga0070665_1000443352 279
672 3300005548 Ga0070665_100047642 Ga0070665_1000476425 279
673 3300005563 Ga0068855_100055487 Ga0068855_1000554875 279
674 3300005563 Ga0068855_100247231 Ga0068855_1002472312 279
675 3300005577 Ga0068857_100004552 Ga0068857_1000045523 279
676 3300005577 Ga0068857_100094423 Ga0068857_1000944232 279
677 3300005616 Ga0068852_100010696 Ga0068852_1000106968 279
678 3300005616 Ga0068852_100183605 Ga0068852_1001836052 279
679 3300005616 Ga0068852_100368002 Ga0068852_1003680022 279
680 3300005617 Ga0068859_100003865 Ga0068859_1000038653 279
681 3300005618 Ga0068864_100038105 Ga0068864_1000381052 279
682 3300005618 Ga0068864_100155339 Ga0068864_1001553392 279
683 3300005718 Ga0068866_10003219 Ga0068866_100032197 279
684 3300005719 Ga0068861_100000398 Ga0068861_1000003989 279
685 3300005719 Ga0068861_100294129 Ga0068861_1002941292 279
686 3300005841 Ga0068863_100000638 Ga0068863_10000063831 279
687 3300005842 Ga0068858_100007648 Ga0068858_1000076484 279
688 3300005842 Ga0068858_100421150 Ga0068858_1004211502 279
689 3300005843 Ga0068860_100008930 Ga0068860_1000089306 279
690 3300005937 Ga0081455_10006120 Ga0081455_100061202 279
691 3300005937 Ga0081455_10012424 Ga0081455_100124249 279
692 3300005937 Ga0081455_10047972 Ga0081455_100479722 279
693 3300005981 Ga0081538_10096002 Ga0081538_100960021 279
694 3300005983 Ga0081540_1000008 Ga0081540_1000008142 279
695 3300005983 Ga0081540_1005076 Ga0081540_10050767 279
696 3300005985 Ga0081539_10000003 Ga0081539_10000003222 279
697 3300006028 Ga0070717_10031971 Ga0070717_100319711 279
698 3300006028 Ga0070717_10208411 Ga0070717_102084112 279
699 3300006038 Ga0075365_10017764 Ga0075365_100177645 279
700 3300006038 Ga0075365_10245986 Ga0075365_102459862 279
701 3300006051 Ga0075364_10114070 Ga0075364_101140702 279
702 3300006058 Ga0075432_10007333 Ga0075432_100073332 279
703 3300006163 Ga0070715_10014395 Ga0070715_100143954 279
704 3300006173 Ga0070716_100052846 Ga0070716_1000528462 279
705 3300006175 Ga0070712_100142422 Ga0070712_1001424222 279
706 3300006186 Ga0075369_10142926 Ga0075369_101429261 279
707 3300006194 Ga0075427_10000105 Ga0075427_100001055 279
708 3300006237 Ga0097621_100288817 Ga0097621_1002888172 279
709 3300006844 Ga0075428_100013853 Ga0075428_1000138536 279
710 3300006844 Ga0075428_100067864 Ga0075428_1000678643 279
711 3300006844 Ga0075428_100204891 Ga0075428_1002048912 279
712 3300006844 Ga0075428_100451071 Ga0075428_1004510711 279
713 3300006846 Ga0075430_100002360 Ga0075430_10000236018 279
714 3300006847 Ga0075431_100008071 Ga0075431_1000080719 279
715 3300006852 Ga0075433_10001774 Ga0075433_100017745 279
716 3300006871 Ga0075434_100004936 Ga0075434_10000493610 279
717 3300006880 Ga0075429_100001525 Ga0075429_1000015259 279
718 3300006881 Ga0068865_100000504 Ga0068865_1000005046 279
719 3300006881 Ga0068865_100233043 Ga0068865_1002330432 279
720 3300006881 Ga0068865_100321681 Ga0068865_1003216811 279
721 3300006931 Ga0097620_100003865 Ga0097620_1000038653 279
722 3300007788 Ga0099795_10043052 Ga0099795_100430522 279
723 3300009093 Ga0105240_10012684 Ga0105240_100126846 279
724 3300009094 Ga0111539_10007565 Ga0111539_1000756511 279
725 3300009094 Ga0111539_10046315 Ga0111539_100463154 279
726 3300009094 Ga0111539_10064679 Ga0111539_100646793 279
727 3300009094 Ga0111539_10125407 Ga0111539_101254072 279
728 3300009094 Ga0111539_10511063 Ga0111539_105110631 279
729 3300009147 Ga0114129_10032283 Ga0114129_100322837 279
730 3300009147 Ga0114129_10284554 Ga0114129_102845542 279
731 3300009148 Ga0105243_10001632 Ga0105243_100016326 279
732 3300009148 Ga0105243_10037473 Ga0105243_100374734 279
733 3300009148 Ga0105243_10201667 Ga0105243_102016671 279
734 3300009176 Ga0105242_10012556 Ga0105242_100125561 279
735 3300009176 Ga0105242_10061477 Ga0105242_100614774 279
736 3300009176 Ga0105242_10654619 Ga0105242_106546192 279
737 3300009545 Ga0105237_10004654 Ga0105237_100046548 279
738 3300009545 Ga0105237_10597590 Ga0105237_105975901 279
739 3300009551 Ga0105238_10004089 Ga0105238_100040897 279
740 3300009551 Ga0105238_10031549 Ga0105238_100315496 279
741 3300009553 Ga0105249_10009865 Ga0105249_100098658 279
742 3300009553 Ga0105249_10196045 Ga0105249_101960452 279
743 3300010375 Ga0105239_10097319 Ga0105239_100973193 279
744 3300011119 Ga0105246_10114805 Ga0105246_101148052 279
745 3300013104 Ga0157370_10021990 Ga0157370_100219902 279
746 3300013104 Ga0157370_10037071 Ga0157370_100370712 279
747 3300013105 Ga0157369_10004796 Ga0157369_100047962 279
748 3300013105 Ga0157369_10072617 Ga0157369_100726172 279
749 3300013105 Ga0157369_10356553 Ga0157369_103565531 279
750 3300013306 Ga0163162_11017046 Ga0163162_110170461 279
751 3300013307 Ga0157372_10018051 Ga0157372_100180512 279
752 3300013307 Ga0157372_10107300 Ga0157372_101073002 279
753 3300013307 Ga0157372_10330930 Ga0157372_103309302 279
754 3300013308 Ga0157375_10200132 Ga0157375_102001322 279
755 3300013308 Ga0157375_10286285 Ga0157375_102862852 279
756 3300014325 Ga0163163_10014193 Ga0163163_100141932 279
757 3300014325 Ga0163163_10056522 Ga0163163_100565222 279
758 3300014325 Ga0163163_10615495 Ga0163163_106154952 279
759 3300014326 Ga0157380_10002614 Ga0157380_1000261410 279
760 3300025297 Ga0209758_1023242 Ga0209758_10232424 279
761 3300025315 Ga0207697_10007292 Ga0207697_100072925 279
762 3300025898 Ga0207692_10151303 Ga0207692_101513031 279
763 3300025900 Ga0207710_10053662 Ga0207710_100536622 279
764 3300025901 Ga0207688_10143405 Ga0207688_101434051 279
765 3300025903 Ga0207680_10005944 Ga0207680_100059442 279
766 3300025906 Ga0207699_10024353 Ga0207699_100243534 279
767 3300025906 Ga0207699_10315940 Ga0207699_103159401 279
768 3300025907 Ga0207645_10006777 Ga0207645_100067775 279
769 3300025907 Ga0207645_10046861 Ga0207645_100468612 279
770 3300025907 Ga0207645_10324923 Ga0207645_103249232 279
771 3300025909 Ga0207705_10044247 Ga0207705_100442474 279
772 3300025912 Ga0207707_10215136 Ga0207707_102151362 279
773 3300025912 Ga0207707_10414085 Ga0207707_104140851 279
774 3300025913 Ga0207695_10160634 Ga0207695_101606342 279
775 3300025913 Ga0207695_10351999 Ga0207695_103519992 279
776 3300025913 Ga0207695_10414877 Ga0207695_104148772 279
777 3300025913 Ga0207695_10610617 Ga0207695_106106171 279
778 3300025915 Ga0207693_10004014 Ga0207693_100040147 279
779 3300025916 Ga0207663_10002097 Ga0207663_100020979 279
780 3300025918 Ga0207662_10037024 Ga0207662_100370243 279
781 3300025919 Ga0207657_10005846 Ga0207657_100058468 279
782 3300025920 Ga0207649_10242119 Ga0207649_102421192 279
783 3300025921 Ga0207652_10084286 Ga0207652_100842862 279
784 3300025921 Ga0207652_10162631 Ga0207652_101626312 279
785 3300025923 Ga0207681_10000420 Ga0207681_1000042027 279
786 3300025923 Ga0207681_10078532 Ga0207681_100785322 279
787 3300025924 Ga0207694_10082472 Ga0207694_100824722 279
788 3300025925 Ga0207650_10048613 Ga0207650_100486132 279
789 3300025927 Ga0207687_10042809 Ga0207687_100428092 279
790 3300025928 Ga0207700_10008355 Ga0207700_100083556 279
791 3300025928 Ga0207700_10138066 Ga0207700_101380662 279
792 3300025929 Ga0207664_10028334 Ga0207664_100283344 279
793 3300025929 Ga0207664_10604645 Ga0207664_106046451 279
794 3300025933 Ga0207706_10010909 Ga0207706_100109092 279
795 3300025933 Ga0207706_10012641 Ga0207706_100126418 279
796 3300025934 Ga0207686_10015040 Ga0207686_100150405 279
797 3300025934 Ga0207686_10097532 Ga0207686_100975322 279
798 3300025935 Ga0207709_10002614 Ga0207709_100026148 279
799 3300025936 Ga0207670_10053580 Ga0207670_100535802 279
800 3300025936 Ga0207670_10232701 Ga0207670_102327012 279
801 3300025937 Ga0207669_10002041 Ga0207669_100020413 279
802 3300025937 Ga0207669_10053543 Ga0207669_100535433 279
803 3300025938 Ga0207704_10028850 Ga0207704_100288504 279
804 3300025941 Ga0207711_10018835 Ga0207711_100188352 279
805 3300025942 Ga0207689_10005334 Ga0207689_100053343 279
806 3300025944 Ga0207661_10143539 Ga0207661_101435391 279
807 3300025949 Ga0207667_10072152 Ga0207667_100721522 279
808 3300025960 Ga0207651_10116405 Ga0207651_101164052 279
809 3300025961 Ga0207712_10002298 Ga0207712_100022989 279
810 3300025972 Ga0207668_10012133 Ga0207668_100121334 279
811 3300025981 Ga0207640_10145498 Ga0207640_101454982 279
812 3300025986 Ga0207658_10000212 Ga0207658_1000021225 279
813 3300025986 Ga0207658_10084714 Ga0207658_100847142 279
814 3300026023 Ga0207677_10010957 Ga0207677_100109572 279
815 3300026035 Ga0207703_10008468 Ga0207703_100084689 279
816 3300026041 Ga0207639_10019008 Ga0207639_100190082 279
817 3300026041 Ga0207639_10287161 Ga0207639_102871612 279
818 3300026067 Ga0207678_10011624 Ga0207678_100116247 279
819 3300026067 Ga0207678_10443642 Ga0207678_104436422 279
820 3300026075 Ga0207708_10093574 Ga0207708_100935742 279
821 3300026088 Ga0207641_10001060 Ga0207641_1000106023 279
822 3300026088 Ga0207641_10059943 Ga0207641_100599434 279
823 3300026089 Ga0207648_10012760 Ga0207648_100127609 279
824 3300026089 Ga0207648_10045089 Ga0207648_100450893 279
825 3300026095 Ga0207676_10032372 Ga0207676_100323724 279
826 3300026095 Ga0207676_10117611 Ga0207676_101176112 279
827 3300026095 Ga0207676_10182050 Ga0207676_101820502 279
828 3300026116 Ga0207674_10003900 Ga0207674_1000390016 279
829 3300026118 Ga0207675_100002876 Ga0207675_10000287610 279
830 3300026118 Ga0207675_100246021 Ga0207675_1002460212 279
831 3300026121 Ga0207683_10164940 Ga0207683_101649402 279
832 3300026142 Ga0207698_10097677 Ga0207698_100976771 279
833 3300026142 Ga0207698_10495866 Ga0207698_104958661 279
834 3300027512 Ga0209179_1011904 Ga0209179_10119042 279
835 3300027866 Ga0209813_10005178 Ga0209813_100051781 279
836 3300027907 Ga0207428_10000920 Ga0207428_1000092024 279
837 3300027907 Ga0207428_10067274 Ga0207428_100672743 279
838 3300027907 Ga0207428_10259916 Ga0207428_102599162 279
839 3300028379 Ga0268266_10001037 Ga0268266_1000103733 279
840 3300028379 Ga0268266_10118260 Ga0268266_101182602 279
841 3300028380 Ga0268265_10007719 Ga0268265_100077198 279
842 3300028381 Ga0268264_10001043 Ga0268264_100010437 279
843 3300028381 Ga0268264_10201501 Ga0268264_102015012 279
844 3300028800 Ga0265338_10255062 Ga0265338_102550622 279
845 3300031548 Ga0307408_100072743 Ga0307408_1000727432 279
846 3300031711 Ga0265314_10054838 Ga0265314_100548381 279
847 3300031901 Ga0307406_10036509 Ga0307406_100365092 279
848 3300035083 Ga0373926_0048917 Ga0373926_0048917_47_928 279
849 3300035089 Ga0373944_0076517 Ga0373944_0076517_142_1023 279
850 3300035117 Ga0373953_0030732 Ga0373953_0030732_1046_1927 279
851 3300035118 Ga0373954_0051215 Ga0373954_0051215_271_1152 279
852 3300035171 Ga0373946_0066571 Ga0373946_0066571_96_977 279
853 3300035172 Ga0373955_0031668 Ga0373955_0031668_647_1528 279
854 3300035724 Ga0373933_0021159 Ga0373933_0021159_1391_2272 279
855 3300035724 Ga0373933_0245769 Ga0373933_0245769_88_969 279
856 3300035725 Ga0373947_0001456 Ga0373947_0001456_6051_6932 279
857 3300035725 Ga0373947_0068416 Ga0373947_0068416_49_930 279
858 3300036401 Ga0373937_0447383 Ga0373937_0447383_139_1020 279
859 3300037068 Ga0373925_0017252 Ga0373925_0017252_3176_4057 279
860 3300037068 Ga0373925_0333701 Ga0373925_0333701_147_1028 279
861 3300037418 Ga0395900_0657009 Ga0395900_0657009_66_947 279
862 3300041507 Ga0451851_0622210 Ga0451851_0622210_228_1109 279
863 3300044693 Ga0466961_0092505 Ga0466961_0092505_827_1708 279
864 3300044842 Ga0466957_0002234 Ga0466957_0002234_3269_4150 279
865 3300046454 Ga0495592_0012664 Ga0495592_0012664_3423_4304 279
866 3300046459 Ga0495629_0051236 Ga0495629_0051236_363_1244 279
867 3300046459 Ga0495629_0290239 Ga0495629_0290239_29_910 279
868 3300046462 Ga0495651_0012806 Ga0495651_0012806_1806_2687 279
869 3300046475 Ga0495639_0073620 Ga0495639_0073620_61_942 279
870 3300046476 Ga0495662_0052717 Ga0495662_0052717_413_1294 279
871 3300046477 Ga0495664_0022730 Ga0495664_0022730_2293_3174 279
872 3300046477 Ga0495664_0023262 Ga0495664_0023262_499_1380 279
873 3300046499 Ga0495594_0038110 Ga0495594_0038110_887_1768 279
874 3300046507 Ga0495606_0000753 Ga0495606_0000753_46024_46905 279
875 3300046511 Ga0495608_0050053 Ga0495608_0050053_1244_2125 279
876 3300046512 Ga0495610_0052743 Ga0495610_0052743_947_1828 279
877 3300046514 Ga0495618_0005416 Ga0495618_0005416_3674_4555 279
878 3300046529 Ga0495652_0013306 Ga0495652_0013306_6257_7138 279
879 3300046533 Ga0495640_0016234 Ga0495640_0016234_4081_4962 279
880 3300046533 Ga0495640_0032820 Ga0495640_0032820_1834_2715 279
881 3300046533 Ga0495640_0048856 Ga0495640_0048856_1444_2325 279
882 3300046535 Ga0495586_0245654 Ga0495586_0245654_90_971 279
883 3300046543 Ga0495645_0053978 Ga0495645_0053978_1203_2084 279
884 3300046558 Ga0495633_0088933 Ga0495633_0088933_508_1389 279
885 3300046559 Ga0495667_0058318 Ga0495667_0058318_1191_2072 279
886 3300046559 Ga0495667_0116614 Ga0495667_0116614_699_1580 279
887 3300046616 Ga0495668_0176715 Ga0495668_0176715_172_1053 279
888 3300046642 Ga0495634_0007278 Ga0495634_0007278_2967_3848 279
889 3300046663 Ga0495635_0089010 Ga0495635_0089010_700_1581 279
890 3300046678 Ga0495599_0020720 Ga0495599_0020720_638_1519 279
891 3300046679 Ga0495623_0081074 Ga0495623_0081074_1096_1977 279
892 3300046680 Ga0495646_0010909 Ga0495646_0010909_1128_2009 279
893 3300046681 Ga0495647_0035432 Ga0495647_0035432_707_1588 279
894 3300046689 Ga0495613_0248653 Ga0495613_0248653_334_1215 279
895 3300046692 Ga0495671_0074954 Ga0495671_0074954_399_1280 279
896 3300046794 Ga0495589_0106405 Ga0495589_0106405_28_909 279
897 3300046809 Ga0495600_0069402 Ga0495600_0069402_958_1839 279
898 3300047319 Ga0495674_0025024 Ga0495674_0025024_1780_2661 279
899 3300047319 Ga0495674_0037448 Ga0495674_0037448_549_1430 279
900 3300047320 Ga0495672_0018735 Ga0495672_0018735_362_1243 279
901 3300047320 Ga0495672_0056188 Ga0495672_0056188_358_1239 279
902 3300047321 Ga0495676_0156369 Ga0495676_0156369_76_957 279
903 3300047444 Ga0495675_0031629 Ga0495675_0031629_1034_1915 279
904 3300047471 Ga0495684_0044442 Ga0495684_0044442_725_1606 279
905 3300047471 Ga0495684_0095324 Ga0495684_0095324_266_1147 279
906 3300047472 Ga0495686_0201318 Ga0495686_0201318_225_1106 279
907 3300047673 Ga0495593_0163728 Ga0495593_0163728_54_935 279
908 3300048903 Ga0496100_0265393 Ga0496100_0265393_234_1115 279
909 3300048904 Ga0496101_0013918 Ga0496101_0013918_3882_4763 279
910 3300048905 Ga0496102_0006168 Ga0496102_0006168_1226_2107 279
911 3300048905 Ga0496102_0167897 Ga0496102_0167897_534_1415 279
912 3300048905 Ga0496102_0183714 Ga0496102_0183714_864_1745 279
913 3300048905 Ga0496102_0325901 Ga0496102_0325901_274_1155 279
914 3300048905 Ga0496102_0579705 Ga0496102_0579705_41_922 279
915 3300048906 Ga0496103_0244019 Ga0496103_0244019_98_979 279
916 3300048907 Ga0496104_0004028 Ga0496104_0004028_6820_7701 279
917 3300048907 Ga0496104_0133112 Ga0496104_0133112_853_1734 279
918 3300048907 Ga0496104_0289065 Ga0496104_0289065_639_1520 279
919 3300048908 Ga0496105_0017587 Ga0496105_0017587_2849_3730 279
920 3300048908 Ga0496105_0054150 Ga0496105_0054150_421_1302 279
921 3300048908 Ga0496105_0173044 Ga0496105_0173044_250_1131 279
922 3300048909 Ga0496106_0101339 Ga0496106_0101339_662_1543 279
923 3300048909 Ga0496106_0102701 Ga0496106_0102701_593_1474 279
924 3300048910 Ga0496107_0061329 Ga0496107_0061329_418_1299 279
925 3300048911 Ga0496108_0053569 Ga0496108_0053569_802_1683 279
926 3300048911 Ga0496108_0184333 Ga0496108_0184333_491_1372 279
927 3300048912 Ga0496109_0003355 Ga0496109_0003355_11980_12861 279
928 3300048912 Ga0496109_0006466 Ga0496109_0006466_8399_9280 279
929 3300048912 Ga0496109_0133766 Ga0496109_0133766_942_1823 279
930 3300048913 Ga0496110_0029303 Ga0496110_0029303_1750_2631 279
931 3300048913 Ga0496110_0046287 Ga0496110_0046287_2182_3063 279
932 3300048913 Ga0496110_0050288 Ga0496110_0050288_2240_3121 279
933 3300048913 Ga0496110_0186778 Ga0496110_0186778_96_977 279
934 3300048913 Ga0496110_0395143 Ga0496110_0395143_32_913 279
935 3300048913 Ga0496110_0633882 Ga0496110_0633882_19_900 279
936 3300048914 Ga0496111_0027590 Ga0496111_0027590_3123_4004 279
937 3300048914 Ga0496111_0048931 Ga0496111_0048931_435_1316 279
938 3300048915 Ga0496112_0000039 Ga0496112_0000039_17853_18734 279
939 3300048915 Ga0496112_0005830 Ga0496112_0005830_244_1125 279
940 3300048915 Ga0496112_0011666 Ga0496112_0011666_2035_2916 279
941 3300048915 Ga0496112_0102285 Ga0496112_0102285_1317_2198 279
942 3300048916 Ga0496113_0008638 Ga0496113_0008638_638_1519 279
943 3300048916 Ga0496113_0075442 Ga0496113_0075442_712_1593 279
944 3300048916 Ga0496113_0143458 Ga0496113_0143458_965_1846 279
945 3300048916 Ga0496113_0259607 Ga0496113_0259607_372_1253 279
946 3300048917 Ga0496114_0152975 Ga0496114_0152975_669_1550 279
947 3300048918 Ga0496115_0053257 Ga0496115_0053257_69_950 279
948 3300048918 Ga0496115_0150511 Ga0496115_0150511_1009_1890 279
949 3300048924 Ga0496121_0001073 Ga0496121_0001073_28894_29775 279
950 3300048928 Ga0496125_0000487 Ga0496125_0000487_46359_47240 279
951 3300050492 nmdc:mga0yw44_125239_c1 nmdc:mga0yw44_125239_c1_505_1386 279
952 3300050492 nmdc:mga0yw44_1925_c1 nmdc:mga0yw44_1925_c1_761_1642 279
953 3300050492 nmdc:mga0yw44_64664_c1 nmdc:mga0yw44_64664_c1_98_979 279
954 3300050494 nmdc:mga06z11_59921_c1 nmdc:mga06z11_59921_c1_743_1624 279
955 3300050507 nmdc:mga05p37_28900_c1 nmdc:mga05p37_28900_c1_5176_6057 279
956 3300050507 nmdc:mga05p37_31225_c1 nmdc:mga05p37_31225_c1_1073_1954 279
957 3300050507 nmdc:mga05p37_8481_c1 nmdc:mga05p37_8481_c1_5403_6284 279
958 3300050508 nmdc:mga09592_2676_c1 nmdc:mga09592_2676_c1_7277_8158 279
959 3300050509 nmdc:mga0qj67_2917_c1 nmdc:mga0qj67_2917_c1_2740_3621 279
960 3300050510 nmdc:mga06r32_3325_c1 nmdc:mga06r32_3325_c1_6252_7133 279
961 3300050511 nmdc:mga08y16_13516_c1 nmdc:mga08y16_13516_c1_3870_4751 279
962 3300050511 nmdc:mga08y16_185410_c1 nmdc:mga08y16_185410_c1_40_933 279
963 3300050512 nmdc:mga0n895_2399_c1 nmdc:mga0n895_2399_c1_9354_10235 279
964 3300050513 nmdc:mga0rr50_6545_c1 nmdc:mga0rr50_6545_c1_2461_3342 279
965 3300050514 nmdc:mga08x19_280107_c1 nmdc:mga08x19_280107_c1_125_1006 279
966 3300050515 nmdc:mga0a205_3143_c1 nmdc:mga0a205_3143_c1_4379_5260 279
967 3300053077 Ga0495601_0000889 Ga0495601_0000889_9186_10067 279
968 3300053077 Ga0495601_0036436 Ga0495601_0036436_1035_1916 279
969 3300053078 Ga0495612_0019714 Ga0495612_0019714_647_1528 279
970 3300053085 Ga0495619_0047385 Ga0495619_0047385_143_1024 279
971 3300053085 Ga0495619_0149708 Ga0495619_0149708_441_1322 279
972 3300053119 Ga0500595_017033 Ga0500595_017033_782_1663 279
973 3300053139 Ga0500568_0034603 Ga0500568_0034603_566_1447 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

7

305

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5325 16 212
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4975 12 215
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.4821 16 214
5b57-assembly1.cif.gz_A inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.448 6 211
5b58-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.421 6 215
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8551 11 217 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.749 9 214 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.728 12 216 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.726 8 215 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7037 12 216 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3D3QNQ8-F1-model_v4 deleted 0.8824 1 214
AF-A0A535E139-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8823 2 215 GO:0005886
GO:0006865
GO:0022857
AF-A0A522QHU0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8799 1 216 GO:0005886
GO:0006865
GO:0022857
AF-A0A7W0PAZ5-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8751 1 214 GO:0005886
GO:0006865
GO:0022857
AF-X0Q9P1-F1-model_v4 Putative ABC transporter ATP-binding protein 0.8745 1 216 GO:0005524
GO:0005886
GO:0015658
GO:0016887

Feature Viewer

pLDDT pTM Quality
61.82 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map