F487186
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 973 | 390 | 971 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10204586|Ga0207648_102045861 |
| Length | 319 |
| Sequence | MTELVDVVLGGTFHAAVLFLVAAGLQLVFGVQKIVNLACGSFYALGAYFGITAVGMALKLGMPAPLFFPVLTLAGLAIGLVGLPIERVLRTIYRRDESYQLLITFGFLLMFQDVFRFLWGATPRSMDNVYMAYGTTQIWGVRVPTYNLLVIAASLGIAIALGLLLERTRTGRIVRATAENRDMAEGLGVNASKIFALVFTVGCMLGTVGGALVVPSSAASLDMAVELVVEAFAVVVIGGLGSMRGALVGALIVGLMPRPVAWTGLVIAGIAELTTLVLIWPGLSPLLPLARFTGLIWLIVAGALLPLRRPNKQEATARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 218 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 244 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 378 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 380 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 382 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 383 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 386 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 388 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 390 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.88 |
| Nodule | 0.21 |
| Rhizoplane | 6.89 |
| Rhizosphere | 88.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10012259 | 3300002075 | Bacteria | 1873 |
| 2 | JGI24749J21850_1008546 | 3300002076 | Bacteria | 1428 |
| 3 | JGI24751J29686_10002801 | 3300002459 | Bacteria | 3508 |
| 4 | JGI25406J46586_10000019 | 3300003203 | Bacteria | 87589 |
| 5 | JGI25153J46596_10000711 | 3300003215 | Bacteria | 20338 |
| 6 | rootL2_10036865 | 3300003322 | Bacteria | 7236 |
| 7 | Ga0065704_10152474 | 3300005289 | Bacteria | 1418 |
| 8 | Ga0065712_10076134 | 3300005290 | Unclassified | 3721 |
| 9 | Ga0065715_10001776 | 3300005293 | Bacteria | 6518 |
| 10 | Ga0065707_10202224 | 3300005295 | Bacteria | 1305 |
| 11 | Ga0070658_10078278 | 3300005327 | Bacteria | 2713 |
| 12 | Ga0070658_10170943 | 3300005327 | Bacteria | 1826 |
| 13 | Ga0070658_10204275 | 3300005327 | Bacteria | 1668 |
| 14 | Ga0070676_10038120 | 3300005328 | Bacteria | 2775 |
| 15 | Ga0070676_10069034 | 3300005328 | Bacteria | 2118 |
| 16 | Ga0070676_10078929 | 3300005328 | Bacteria | 1992 |
| 17 | Ga0070683_100315892 | 3300005329 | Bacteria | 1487 |
| 18 | Ga0070690_100004954 | 3300005330 | Bacteria | 7448 |
| 19 | Ga0070690_100018630 | 3300005330 | Bacteria | 4196 |
| 20 | Ga0070670_100020041 | 3300005331 | Bacteria | 5744 |
| 21 | Ga0070670_100087005 | 3300005331 | Bacteria | 2685 |
| 22 | Ga0070670_100106383 | 3300005331 | Bacteria | 2417 |
| 23 | Ga0070677_10051262 | 3300005333 | Bacteria | 1670 |
| 24 | Ga0068869_100000346 | 3300005334 | Bacteria | 24854 |
| 25 | Ga0068869_100009169 | 3300005334 | Bacteria | 6412 |
| 26 | Ga0068869_100065766 | 3300005334 | Bacteria | 2670 |
| 27 | Ga0068869_100104219 | 3300005334 | Bacteria | 2150 |
| 28 | Ga0070666_10042811 | 3300005335 | Bacteria | 3030 |
| 29 | Ga0070666_10065004 | 3300005335 | Unclassified | 2475 |
| 30 | Ga0070666_10185721 | 3300005335 | Bacteria | 1459 |
| 31 | Ga0070680_100040085 | 3300005336 | Bacteria | 3790 |
| 32 | Ga0070680_100137540 | 3300005336 | Bacteria | 2047 |
| 33 | Ga0070680_100199183 | 3300005336 | Bacteria | 1688 |
| 34 | Ga0070680_100519073 | 3300005336 | Bacteria | 1020 |
| 35 | Ga0070682_100058339 | 3300005337 | Bacteria | 2434 |
| 36 | Ga0068868_100055287 | 3300005338 | Bacteria | 3131 |
| 37 | Ga0070660_100003286 | 3300005339 | Bacteria | 11107 |
| 38 | Ga0070660_100081795 | 3300005339 | Bacteria | 2535 |
| 39 | Ga0070689_100120850 | 3300005340 | Bacteria | 2092 |
| 40 | Ga0070689_100191353 | 3300005340 | Unclassified | 1666 |
| 41 | Ga0070691_10023195 | 3300005341 | Bacteria | 2881 |
| 42 | Ga0070661_100041809 | 3300005344 | Bacteria | 3345 |
| 43 | Ga0070661_100130576 | 3300005344 | Bacteria | 1886 |
| 44 | Ga0070661_100222353 | 3300005344 | Bacteria | 1449 |
| 45 | Ga0070661_100222369 | 3300005344 | Bacteria | 1449 |
| 46 | Ga0070668_100000210 | 3300005347 | Bacteria | 38311 |
| 47 | Ga0070668_100022042 | 3300005347 | Bacteria | 4815 |
| 48 | Ga0070668_100110689 | 3300005347 | Bacteria | 2186 |
| 49 | Ga0070669_100000370 | 3300005353 | Bacteria | 34811 |
| 50 | Ga0070669_100004359 | 3300005353 | Bacteria | 10215 |
| 51 | Ga0070669_100060846 | 3300005353 | Bacteria | 2774 |
| 52 | Ga0070675_100222603 | 3300005354 | Bacteria | 1644 |
| 53 | Ga0070675_100321944 | 3300005354 | Bacteria | 1366 |
| 54 | Ga0070671_100119489 | 3300005355 | Bacteria | 2217 |
| 55 | Ga0070671_100220413 | 3300005355 | Bacteria | 1609 |
| 56 | Ga0070671_100485053 | 3300005355 | Bacteria | 1062 |
| 57 | Ga0070674_100000760 | 3300005356 | Bacteria | 16580 |
| 58 | Ga0070674_100010572 | 3300005356 | Bacteria | 5585 |
| 59 | Ga0070674_100012006 | 3300005356 | Bacteria | 5304 |
| 60 | Ga0070674_100121181 | 3300005356 | Unclassified | 1937 |
| 61 | Ga0070674_100271568 | 3300005356 | Bacteria | 1340 |
| 62 | Ga0070673_100382113 | 3300005364 | Bacteria | 1256 |
| 63 | Ga0070688_100040618 | 3300005365 | Bacteria | 2852 |
| 64 | Ga0070688_100086126 | 3300005365 | Bacteria | 2043 |
| 65 | Ga0070659_100032761 | 3300005366 | Bacteria | 4033 |
| 66 | Ga0070659_100051064 | 3300005366 | Bacteria | 3251 |
| 67 | Ga0070659_100052852 | 3300005366 | Bacteria | 3196 |
| 68 | Ga0070667_100000294 | 3300005367 | Bacteria | 56218 |
| 69 | Ga0070667_100208915 | 3300005367 | Bacteria | 1734 |
| 70 | Ga0070667_100234809 | 3300005367 | Bacteria | 1636 |
| 71 | Ga0070709_10002615 | 3300005434 | Bacteria | 9721 |
| 72 | Ga0070709_10003717 | 3300005434 | Bacteria | 8199 |
| 73 | Ga0070709_10007744 | 3300005434 | Bacteria | 5898 |
| 74 | Ga0070714_100027177 | 3300005435 | Bacteria | 4735 |
| 75 | Ga0070714_100055382 | 3300005435 | Bacteria | 3389 |
| 76 | Ga0070714_100105021 | 3300005435 | Bacteria | 2493 |
| 77 | Ga0070714_100108194 | 3300005435 | Bacteria | 2458 |
| 78 | Ga0070714_100376131 | 3300005435 | Bacteria | 1338 |
| 79 | Ga0070713_100001463 | 3300005436 | Bacteria | 15084 |
| 80 | Ga0070713_100004110 | 3300005436 | Bacteria | 9698 |
| 81 | Ga0070713_100036719 | 3300005436 | Bacteria | 3956 |
| 82 | Ga0070713_100141866 | 3300005436 | Bacteria | 2129 |
| 83 | Ga0070710_10009433 | 3300005437 | Bacteria | 4773 |
| 84 | Ga0070710_10024133 | 3300005437 | Bacteria | 3205 |
| 85 | Ga0070710_10024443 | 3300005437 | Bacteria | 3187 |
| 86 | Ga0070701_10015036 | 3300005438 | Bacteria | 3562 |
| 87 | Ga0070711_100007657 | 3300005439 | Bacteria | 6577 |
| 88 | Ga0070711_100036310 | 3300005439 | Bacteria | 3301 |
| 89 | Ga0070711_100110807 | 3300005439 | Bacteria | 2014 |
| 90 | Ga0070711_100116241 | 3300005439 | Bacteria | 1971 |
| 91 | Ga0070705_100240835 | 3300005440 | Bacteria | 1264 |
| 92 | Ga0070700_100080640 | 3300005441 | Bacteria | 2100 |
| 93 | Ga0070663_100005311 | 3300005455 | Bacteria | 7643 |
| 94 | Ga0070663_100007370 | 3300005455 | Bacteria | 6692 |
| 95 | Ga0070678_100023471 | 3300005456 | Bacteria | 4111 |
| 96 | Ga0070678_100041389 | 3300005456 | Bacteria | 3266 |
| 97 | Ga0070678_100044465 | 3300005456 | Bacteria | 3171 |
| 98 | Ga0070662_100037565 | 3300005457 | Bacteria | 3434 |
| 99 | Ga0070662_100067780 | 3300005457 | Bacteria | 2621 |
| 100 | Ga0070681_10217230 | 3300005458 | Bacteria | 1827 |
| 101 | Ga0070681_10244749 | 3300005458 | Bacteria | 1706 |
| 102 | Ga0068867_100000733 | 3300005459 | Bacteria | 21968 |
| 103 | Ga0068867_100086002 | 3300005459 | Bacteria | 2378 |
| 104 | Ga0070685_10024707 | 3300005466 | Bacteria | 3302 |
| 105 | Ga0070685_10051277 | 3300005466 | Bacteria | 2386 |
| 106 | Ga0070679_100044872 | 3300005530 | Bacteria | 4404 |
| 107 | Ga0070679_100187101 | 3300005530 | Bacteria | 2041 |
| 108 | Ga0070679_100597948 | 3300005530 | Bacteria | 1046 |
| 109 | Ga0070684_100024421 | 3300005535 | Bacteria | 5071 |
| 110 | Ga0070684_100196582 | 3300005535 | Bacteria | 1836 |
| 111 | Ga0070684_100408354 | 3300005535 | Bacteria | 1253 |
| 112 | Ga0070697_100050149 | 3300005536 | Bacteria | 3388 |
| 113 | Ga0068853_100046500 | 3300005539 | Bacteria | 3721 |
| 114 | Ga0068853_100248155 | 3300005539 | Bacteria | 1633 |
| 115 | Ga0070672_100086960 | 3300005543 | Bacteria | 2514 |
| 116 | Ga0070686_100002924 | 3300005544 | Bacteria | 9379 |
| 117 | Ga0070686_100079914 | 3300005544 | Bacteria | 2162 |
| 118 | Ga0070686_100163859 | 3300005544 | Bacteria | 1568 |
| 119 | Ga0070696_100070177 | 3300005546 | Bacteria | 2464 |
| 120 | Ga0070693_100066807 | 3300005547 | Bacteria | 2105 |
| 121 | Ga0070693_100088862 | 3300005547 | Bacteria | 1859 |
| 122 | Ga0070665_100003364 | 3300005548 | Bacteria | 17099 |
| 123 | Ga0070665_100044335 | 3300005548 | Bacteria | 4467 |
| 124 | Ga0070665_100047642 | 3300005548 | Bacteria | 4301 |
| 125 | Ga0070665_100124409 | 3300005548 | Bacteria | 2581 |
| 126 | Ga0070665_100158932 | 3300005548 | Bacteria | 2261 |
| 127 | Ga0070665_100301619 | 3300005548 | Bacteria | 1605 |
| 128 | Ga0068855_100055487 | 3300005563 | Bacteria | 4653 |
| 129 | Ga0068855_100247231 | 3300005563 | Bacteria | 1990 |
| 130 | Ga0070664_100250895 | 3300005564 | Bacteria | 1591 |
| 131 | Ga0068857_100004552 | 3300005577 | Bacteria | 11731 |
| 132 | Ga0068857_100094423 | 3300005577 | Bacteria | 2678 |
| 133 | Ga0068857_100203609 | 3300005577 | Bacteria | 1804 |
| 134 | Ga0068854_100008701 | 3300005578 | Bacteria | 6531 |
| 135 | Ga0068856_100177795 | 3300005614 | Bacteria | 2140 |
| 136 | Ga0068852_100010696 | 3300005616 | Bacteria | 6869 |
| 137 | Ga0068852_100183605 | 3300005616 | Bacteria | 1968 |
| 138 | Ga0068852_100209211 | 3300005616 | Bacteria | 1850 |
| 139 | Ga0068852_100368002 | 3300005616 | Bacteria | 1407 |
| 140 | Ga0068859_100003865 | 3300005617 | Bacteria | 15303 |
| 141 | Ga0068859_100176333 | 3300005617 | Bacteria | 2219 |
| 142 | Ga0068859_100661817 | 3300005617 | Bacteria | 1136 |
| 143 | Ga0068864_100038105 | 3300005618 | Bacteria | 4103 |
| 144 | Ga0068864_100076599 | 3300005618 | Bacteria | 2923 |
| 145 | Ga0068864_100103511 | 3300005618 | Bacteria | 2527 |
| 146 | Ga0068864_100155339 | 3300005618 | Bacteria | 2076 |
| 147 | Ga0068866_10003219 | 3300005718 | Bacteria | 6735 |
| 148 | Ga0068866_10014236 | 3300005718 | Bacteria | 3508 |
| 149 | Ga0068861_100000398 | 3300005719 | Bacteria | 25148 |
| 150 | Ga0068861_100089269 | 3300005719 | Bacteria | 2429 |
| 151 | Ga0068861_100294129 | 3300005719 | Bacteria | 1403 |
| 152 | Ga0068851_10098544 | 3300005834 | Bacteria | 1548 |
| 153 | Ga0068870_10005414 | 3300005840 | Bacteria | 5573 |
| 154 | Ga0068870_10017388 | 3300005840 | Bacteria | 3453 |
| 155 | Ga0068870_10080575 | 3300005840 | Unclassified | 1799 |
| 156 | Ga0068863_100000638 | 3300005841 | Bacteria | 35489 |
| 157 | Ga0068863_100035661 | 3300005841 | Bacteria | 4736 |
| 158 | Ga0068863_100209675 | 3300005841 | Unclassified | 1876 |
| 159 | Ga0068863_100221703 | 3300005841 | Bacteria | 1822 |
| 160 | Ga0068863_100374033 | 3300005841 | Bacteria | 1391 |
| 161 | Ga0068863_100412796 | 3300005841 | Bacteria | 1322 |
| 162 | Ga0068858_100007648 | 3300005842 | Bacteria | 10439 |
| 163 | Ga0068858_100009999 | 3300005842 | Bacteria | 9011 |
| 164 | Ga0068858_100249737 | 3300005842 | Bacteria | 1685 |
| 165 | Ga0068858_100318988 | 3300005842 | Bacteria | 1485 |
| 166 | Ga0068858_100421150 | 3300005842 | Bacteria | 1284 |
| 167 | Ga0068860_100008930 | 3300005843 | Bacteria | 9986 |
| 168 | Ga0068860_100059707 | 3300005843 | Bacteria | 3625 |
| 169 | Ga0068860_100083470 | 3300005843 | Bacteria | 3038 |
| 170 | Ga0068860_100092944 | 3300005843 | Bacteria | 2875 |
| 171 | Ga0068860_100728347 | 3300005843 | Bacteria | 1002 |
| 172 | Ga0068862_100129090 | 3300005844 | Bacteria | 2234 |
| 173 | Ga0081455_10006120 | 3300005937 | Bacteria | 13004 |
| 174 | Ga0081455_10012424 | 3300005937 | Bacteria | 8497 |
| 175 | Ga0081455_10047972 | 3300005937 | Bacteria | 3694 |
| 176 | Ga0081538_10096002 | 3300005981 | Bacteria | 1512 |
| 177 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 178 | Ga0081540_1003105 | 3300005983 | Bacteria | 13306 |
| 179 | Ga0081540_1005076 | 3300005983 | Bacteria | 9876 |
| 180 | Ga0081540_1017499 | 3300005983 | Bacteria | 4435 |
| 181 | Ga0081540_1023500 | 3300005983 | Bacteria | 3602 |
| 182 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 183 | Ga0070717_10002524 | 3300006028 | Bacteria | 12888 |
| 184 | Ga0070717_10012428 | 3300006028 | Bacteria | 6492 |
| 185 | Ga0070717_10031971 | 3300006028 | Bacteria | 4237 |
| 186 | Ga0070717_10208411 | 3300006028 | Bacteria | 1715 |
| 187 | Ga0075365_10017764 | 3300006038 | Bacteria | 4360 |
| 188 | Ga0075365_10038394 | 3300006038 | Bacteria | 3112 |
| 189 | Ga0075365_10245986 | 3300006038 | Bacteria | 1256 |
| 190 | Ga0075364_10114070 | 3300006051 | Bacteria | 1805 |
| 191 | Ga0075432_10007333 | 3300006058 | Bacteria | 3754 |
| 192 | Ga0070715_10008284 | 3300006163 | Bacteria | 3618 |
| 193 | Ga0070715_10014381 | 3300006163 | Bacteria | 2930 |
| 194 | Ga0070715_10014395 | 3300006163 | Bacteria | 2929 |
| 195 | Ga0070716_100042164 | 3300006173 | Bacteria | 2547 |
| 196 | Ga0070716_100052846 | 3300006173 | Bacteria | 2314 |
| 197 | Ga0070712_100001737 | 3300006175 | Bacteria | 13337 |
| 198 | Ga0070712_100142422 | 3300006175 | Bacteria | 1831 |
| 199 | Ga0070712_100154823 | 3300006175 | Bacteria | 1764 |
| 200 | Ga0070712_100297804 | 3300006175 | Bacteria | 1304 |
| 201 | Ga0075369_10142926 | 3300006186 | Bacteria | 1092 |
| 202 | Ga0075427_10000105 | 3300006194 | Bacteria | 7158 |
| 203 | Ga0097621_100126007 | 3300006237 | Bacteria | 2175 |
| 204 | Ga0097621_100187058 | 3300006237 | Bacteria | 1792 |
| 205 | Ga0097621_100288817 | 3300006237 | Bacteria | 1445 |
| 206 | Ga0097621_100342140 | 3300006237 | Bacteria | 1328 |
| 207 | Ga0068871_100002011 | 3300006358 | Bacteria | 13758 |
| 208 | Ga0068871_100066365 | 3300006358 | Bacteria | 2958 |
| 209 | Ga0068871_100088464 | 3300006358 | Bacteria | 2577 |
| 210 | Ga0068871_100134682 | 3300006358 | Bacteria | 2097 |
| 211 | Ga0075428_100000244 | 3300006844 | Bacteria | 53263 |
| 212 | Ga0075428_100002840 | 3300006844 | Bacteria | 18885 |
| 213 | Ga0075428_100013853 | 3300006844 | Bacteria | 8979 |
| 214 | Ga0075428_100023662 | 3300006844 | Bacteria | 6799 |
| 215 | Ga0075428_100067864 | 3300006844 | Bacteria | 3902 |
| 216 | Ga0075428_100106548 | 3300006844 | Unclassified | 3056 |
| 217 | Ga0075428_100136009 | 3300006844 | Bacteria | 2672 |
| 218 | Ga0075428_100168119 | 3300006844 | Bacteria | 2378 |
| 219 | Ga0075428_100192007 | 3300006844 | Unclassified | 2208 |
| 220 | Ga0075428_100204891 | 3300006844 | Bacteria | 2132 |
| 221 | Ga0075428_100451071 | 3300006844 | Bacteria | 1378 |
| 222 | Ga0075428_100756315 | 3300006844 | Bacteria | 1034 |
| 223 | Ga0075430_100000582 | 3300006846 | Bacteria | 27770 |
| 224 | Ga0075430_100002360 | 3300006846 | Bacteria | 15686 |
| 225 | Ga0075430_100062300 | 3300006846 | Bacteria | 3134 |
| 226 | Ga0075430_100105691 | 3300006846 | Unclassified | 2349 |
| 227 | Ga0075430_100106543 | 3300006846 | Bacteria | 2338 |
| 228 | Ga0075431_100001060 | 3300006847 | Bacteria | 24615 |
| 229 | Ga0075431_100001610 | 3300006847 | Bacteria | 21067 |
| 230 | Ga0075431_100008071 | 3300006847 | Bacteria | 10507 |
| 231 | Ga0075431_100055227 | 3300006847 | Bacteria | 4096 |
| 232 | Ga0075431_100058589 | 3300006847 | Bacteria | 3975 |
| 233 | Ga0075431_100096289 | 3300006847 | Unclassified | 3055 |
| 234 | Ga0075431_100159175 | 3300006847 | Bacteria | 2322 |
| 235 | Ga0075433_10000619 | 3300006852 | Bacteria | 23718 |
| 236 | Ga0075433_10001774 | 3300006852 | Bacteria | 16162 |
| 237 | Ga0075433_10030597 | 3300006852 | Bacteria | 4594 |
| 238 | Ga0075433_10144931 | 3300006852 | Bacteria | 2111 |
| 239 | Ga0075434_100004079 | 3300006871 | Bacteria | 13090 |
| 240 | Ga0075434_100004936 | 3300006871 | Bacteria | 12093 |
| 241 | Ga0075434_100017701 | 3300006871 | Bacteria | 6869 |
| 242 | Ga0075434_100073139 | 3300006871 | Bacteria | 3420 |
| 243 | Ga0075434_100091925 | 3300006871 | Bacteria | 3036 |
| 244 | Ga0075429_100001525 | 3300006880 | Bacteria | 19055 |
| 245 | Ga0075429_100002092 | 3300006880 | Bacteria | 16659 |
| 246 | Ga0075429_100002359 | 3300006880 | Bacteria | 15888 |
| 247 | Ga0075429_100049786 | 3300006880 | Bacteria | 3644 |
| 248 | Ga0075429_100075628 | 3300006880 | Bacteria | 2934 |
| 249 | Ga0075429_100077270 | 3300006880 | Bacteria | 2900 |
| 250 | Ga0075429_100346210 | 3300006880 | Unclassified | 1301 |
| 251 | Ga0068865_100000504 | 3300006881 | Bacteria | 21850 |
| 252 | Ga0068865_100010433 | 3300006881 | Bacteria | 5782 |
| 253 | Ga0068865_100040866 | 3300006881 | Unclassified | 3154 |
| 254 | Ga0068865_100233043 | 3300006881 | Bacteria | 1445 |
| 255 | Ga0068865_100321681 | 3300006881 | Bacteria | 1244 |
| 256 | Ga0097620_100003865 | 3300006931 | Bacteria | 15303 |
| 257 | Ga0097620_100176333 | 3300006931 | Bacteria | 2219 |
| 258 | Ga0097620_100661747 | 3300006931 | Bacteria | 1136 |
| 259 | Ga0075435_100060707 | 3300007076 | Bacteria | 3066 |
| 260 | Ga0075435_100170727 | 3300007076 | Bacteria | 1834 |
| 261 | Ga0099794_10000524 | 3300007265 | Bacteria | 12817 |
| 262 | Ga0099795_10043052 | 3300007788 | Bacteria | 1614 |
| 263 | Ga0105251_10069951 | 3300009011 | Bacteria | 1636 |
| 264 | Ga0105240_10012684 | 3300009093 | Bacteria | 11613 |
| 265 | Ga0105240_10061980 | 3300009093 | Bacteria | 4658 |
| 266 | Ga0105240_10268559 | 3300009093 | Bacteria | 1965 |
| 267 | Ga0111539_10003049 | 3300009094 | Bacteria | 22198 |
| 268 | Ga0111539_10007565 | 3300009094 | Bacteria | 13889 |
| 269 | Ga0111539_10015670 | 3300009094 | Bacteria | 9422 |
| 270 | Ga0111539_10031703 | 3300009094 | Bacteria | 6420 |
| 271 | Ga0111539_10046315 | 3300009094 | Bacteria | 5202 |
| 272 | Ga0111539_10064679 | 3300009094 | Bacteria | 4326 |
| 273 | Ga0111539_10068805 | 3300009094 | Bacteria | 4180 |
| 274 | Ga0111539_10111192 | 3300009094 | Bacteria | 3215 |
| 275 | Ga0111539_10125407 | 3300009094 | Bacteria | 3009 |
| 276 | Ga0111539_10253350 | 3300009094 | Bacteria | 2050 |
| 277 | Ga0111539_10511063 | 3300009094 | Unclassified | 1399 |
| 278 | Ga0105247_10086596 | 3300009101 | Bacteria | 1983 |
| 279 | Ga0105247_10143347 | 3300009101 | Bacteria | 1568 |
| 280 | Ga0105247_10210022 | 3300009101 | Bacteria | 1313 |
| 281 | Ga0105247_10411801 | 3300009101 | Bacteria | 966 |
| 282 | Ga0114129_10001163 | 3300009147 | Bacteria | 34882 |
| 283 | Ga0114129_10016497 | 3300009147 | Bacteria | 10517 |
| 284 | Ga0114129_10019842 | 3300009147 | Bacteria | 9566 |
| 285 | Ga0114129_10032283 | 3300009147 | Bacteria | 7399 |
| 286 | Ga0114129_10038350 | 3300009147 | Bacteria | 6760 |
| 287 | Ga0114129_10128515 | 3300009147 | Bacteria | 3482 |
| 288 | Ga0114129_10145803 | 3300009147 | Bacteria | 3243 |
| 289 | Ga0114129_10170392 | 3300009147 | Bacteria | 2969 |
| 290 | Ga0114129_10182472 | 3300009147 | Bacteria | 2855 |
| 291 | Ga0114129_10182921 | 3300009147 | Bacteria | 2851 |
| 292 | Ga0114129_10284554 | 3300009147 | Bacteria | 2208 |
| 293 | Ga0114129_10397129 | 3300009147 | Bacteria | 1818 |
| 294 | Ga0114129_10466053 | 3300009147 | Bacteria | 1655 |
| 295 | Ga0105243_10001632 | 3300009148 | Bacteria | 19479 |
| 296 | Ga0105243_10030731 | 3300009148 | Bacteria | 4137 |
| 297 | Ga0105243_10037473 | 3300009148 | Bacteria | 3769 |
| 298 | Ga0105243_10201667 | 3300009148 | Bacteria | 1745 |
| 299 | Ga0105241_10067576 | 3300009174 | Bacteria | 2767 |
| 300 | Ga0105241_10101215 | 3300009174 | Bacteria | 2290 |
| 301 | Ga0105242_10012556 | 3300009176 | Bacteria | 6522 |
| 302 | Ga0105242_10042947 | 3300009176 | Bacteria | 3654 |
| 303 | Ga0105242_10043444 | 3300009176 | Bacteria | 3636 |
| 304 | Ga0105242_10061477 | 3300009176 | Bacteria | 3089 |
| 305 | Ga0105242_10069220 | 3300009176 | Bacteria | 2922 |
| 306 | Ga0105242_10654619 | 3300009176 | Bacteria | 1022 |
| 307 | Ga0105248_10024215 | 3300009177 | Bacteria | 6748 |
| 308 | Ga0105248_10032843 | 3300009177 | Bacteria | 5799 |
| 309 | Ga0105248_10066106 | 3300009177 | Bacteria | 4060 |
| 310 | Ga0105248_10316575 | 3300009177 | Bacteria | 1757 |
| 311 | Ga0105237_10004654 | 3300009545 | Bacteria | 15804 |
| 312 | Ga0105237_10597590 | 3300009545 | Bacteria | 1110 |
| 313 | Ga0105238_10004089 | 3300009551 | Bacteria | 14471 |
| 314 | Ga0105238_10026812 | 3300009551 | Bacteria | 5874 |
| 315 | Ga0105238_10031549 | 3300009551 | Bacteria | 5395 |
| 316 | Ga0105249_10002139 | 3300009553 | Bacteria | 17118 |
| 317 | Ga0105249_10009865 | 3300009553 | Bacteria | 8371 |
| 318 | Ga0105249_10196045 | 3300009553 | Bacteria | 1974 |
| 319 | Ga0105249_10325947 | 3300009553 | Bacteria | 1548 |
| 320 | Ga0105249_10329397 | 3300009553 | Bacteria | 1540 |
| 321 | Ga0105239_10097319 | 3300010375 | Bacteria | 3252 |
| 322 | Ga0105246_10024343 | 3300011119 | Bacteria | 3932 |
| 323 | Ga0105246_10114805 | 3300011119 | Bacteria | 1985 |
| 324 | Ga0157336_1001002 | 3300012477 | Bacteria | 1391 |
| 325 | Ga0157370_10021990 | 3300013104 | Bacteria | 6351 |
| 326 | Ga0157370_10037071 | 3300013104 | Bacteria | 4728 |
| 327 | Ga0157370_10322076 | 3300013104 | Bacteria | 1426 |
| 328 | Ga0157369_10004796 | 3300013105 | Bacteria | 15899 |
| 329 | Ga0157369_10072617 | 3300013105 | Bacteria | 3693 |
| 330 | Ga0157369_10356553 | 3300013105 | Bacteria | 1519 |
| 331 | Ga0157369_10489916 | 3300013105 | Bacteria | 1272 |
| 332 | Ga0157374_10018578 | 3300013296 | Bacteria | 6139 |
| 333 | Ga0157378_10066262 | 3300013297 | Bacteria | 3234 |
| 334 | Ga0157378_10654492 | 3300013297 | Bacteria | 1066 |
| 335 | Ga0163162_10015033 | 3300013306 | Bacteria | 7561 |
| 336 | Ga0163162_10119627 | 3300013306 | Bacteria | 2737 |
| 337 | Ga0163162_10152076 | 3300013306 | Bacteria | 2433 |
| 338 | Ga0163162_10443461 | 3300013306 | Bacteria | 1430 |
| 339 | Ga0163162_10536343 | 3300013306 | Bacteria | 1299 |
| 340 | Ga0163162_11017046 | 3300013306 | Bacteria | 937 |
| 341 | Ga0157372_10018051 | 3300013307 | Bacteria | 7584 |
| 342 | Ga0157372_10107300 | 3300013307 | Bacteria | 3195 |
| 343 | Ga0157372_10258347 | 3300013307 | Bacteria | 2022 |
| 344 | Ga0157372_10330930 | 3300013307 | Bacteria | 1774 |
| 345 | Ga0157375_10100905 | 3300013308 | Bacteria | 2968 |
| 346 | Ga0157375_10200132 | 3300013308 | Bacteria | 2153 |
| 347 | Ga0157375_10286285 | 3300013308 | Bacteria | 1811 |
| 348 | Ga0163163_10014193 | 3300014325 | Bacteria | 7317 |
| 349 | Ga0163163_10056522 | 3300014325 | Bacteria | 3879 |
| 350 | Ga0163163_10615495 | 3300014325 | Bacteria | 1149 |
| 351 | Ga0157380_10002614 | 3300014326 | Bacteria | 12184 |
| 352 | Ga0157380_10012071 | 3300014326 | Bacteria | 6253 |
| 353 | Ga0157380_10087071 | 3300014326 | Bacteria | 2568 |
| 354 | Ga0157380_10092975 | 3300014326 | Bacteria | 2493 |
| 355 | Ga0157380_10285891 | 3300014326 | Unclassified | 1512 |
| 356 | Ga0157377_10084215 | 3300014745 | Bacteria | 1865 |
| 357 | Ga0157379_10030677 | 3300014968 | Bacteria | 4788 |
| 358 | Ga0157379_10121826 | 3300014968 | Bacteria | 2346 |
| 359 | Ga0157379_10350427 | 3300014968 | Bacteria | 1352 |
| 360 | Ga0157379_10508921 | 3300014968 | Bacteria | 1117 |
| 361 | Ga0157376_10064786 | 3300014969 | Bacteria | 3083 |
| 362 | Ga0157376_10076025 | 3300014969 | Bacteria | 2868 |
| 363 | Ga0157376_10140446 | 3300014969 | Bacteria | 2166 |
| 364 | Ga0157376_10262362 | 3300014969 | Bacteria | 1619 |
| 365 | Ga0163161_10032774 | 3300017792 | Bacteria | 3711 |
| 366 | Ga0163161_10032991 | 3300017792 | Bacteria | 3700 |
| 367 | Ga0209758_1000373 | 3300025297 | Bacteria | 78698 |
| 368 | Ga0209758_1023242 | 3300025297 | Bacteria | 2810 |
| 369 | Ga0207697_10002429 | 3300025315 | Bacteria | 9654 |
| 370 | Ga0207697_10007292 | 3300025315 | Bacteria | 4938 |
| 371 | Ga0207682_10002055 | 3300025893 | Bacteria | 9109 |
| 372 | Ga0207682_10012922 | 3300025893 | Bacteria | 3256 |
| 373 | Ga0207692_10004754 | 3300025898 | Bacteria | 5397 |
| 374 | Ga0207692_10004787 | 3300025898 | Bacteria | 5379 |
| 375 | Ga0207692_10096591 | 3300025898 | Bacteria | 1614 |
| 376 | Ga0207692_10151303 | 3300025898 | Bacteria | 1329 |
| 377 | Ga0207642_10008483 | 3300025899 | Bacteria | 3529 |
| 378 | Ga0207642_10044876 | 3300025899 | Unclassified | 1959 |
| 379 | Ga0207642_10053452 | 3300025899 | Bacteria | 1837 |
| 380 | Ga0207710_10009032 | 3300025900 | Bacteria | 4196 |
| 381 | Ga0207710_10053662 | 3300025900 | Bacteria | 1814 |
| 382 | Ga0207710_10082403 | 3300025900 | Bacteria | 1494 |
| 383 | Ga0207710_10129303 | 3300025900 | Unclassified | 1212 |
| 384 | Ga0207688_10002892 | 3300025901 | Bacteria | 9334 |
| 385 | Ga0207688_10004006 | 3300025901 | Bacteria | 8024 |
| 386 | Ga0207688_10143405 | 3300025901 | Bacteria | 1407 |
| 387 | Ga0207680_10005944 | 3300025903 | Bacteria | 5866 |
| 388 | Ga0207680_10118308 | 3300025903 | Unclassified | 1729 |
| 389 | Ga0207680_10122953 | 3300025903 | Bacteria | 1700 |
| 390 | Ga0207680_10156667 | 3300025903 | Bacteria | 1523 |
| 391 | Ga0207680_10231916 | 3300025903 | Bacteria | 1269 |
| 392 | Ga0207680_10319584 | 3300025903 | Bacteria | 1085 |
| 393 | Ga0207685_10016102 | 3300025905 | Bacteria | 2385 |
| 394 | Ga0207699_10001254 | 3300025906 | Bacteria | 12078 |
| 395 | Ga0207699_10024353 | 3300025906 | Bacteria | 3309 |
| 396 | Ga0207699_10315940 | 3300025906 | Bacteria | 1094 |
| 397 | Ga0207645_10004635 | 3300025907 | Bacteria | 10124 |
| 398 | Ga0207645_10006777 | 3300025907 | Bacteria | 8179 |
| 399 | Ga0207645_10046861 | 3300025907 | Bacteria | 2761 |
| 400 | Ga0207645_10324923 | 3300025907 | Bacteria | 1027 |
| 401 | Ga0207643_10004233 | 3300025908 | Bacteria | 7729 |
| 402 | Ga0207705_10026102 | 3300025909 | Bacteria | 4169 |
| 403 | Ga0207705_10044247 | 3300025909 | Bacteria | 3200 |
| 404 | Ga0207684_10132634 | 3300025910 | Bacteria | 2138 |
| 405 | Ga0207654_10033105 | 3300025911 | Bacteria | 2862 |
| 406 | Ga0207707_10215136 | 3300025912 | Bacteria | 1673 |
| 407 | Ga0207707_10414085 | 3300025912 | Bacteria | 1156 |
| 408 | Ga0207707_10489246 | 3300025912 | Bacteria | 1050 |
| 409 | Ga0207695_10160634 | 3300025913 | Bacteria | 2179 |
| 410 | Ga0207695_10351999 | 3300025913 | Bacteria | 1360 |
| 411 | Ga0207695_10414877 | 3300025913 | Bacteria | 1231 |
| 412 | Ga0207695_10610617 | 3300025913 | Bacteria | 972 |
| 413 | Ga0207671_10124734 | 3300025914 | Bacteria | 1971 |
| 414 | Ga0207693_10004014 | 3300025915 | Bacteria | 12508 |
| 415 | Ga0207693_10006308 | 3300025915 | Bacteria | 9836 |
| 416 | Ga0207693_10019706 | 3300025915 | Bacteria | 5365 |
| 417 | Ga0207693_10033262 | 3300025915 | Bacteria | 4069 |
| 418 | Ga0207693_10051854 | 3300025915 | Bacteria | 3218 |
| 419 | Ga0207693_10093265 | 3300025915 | Bacteria | 2360 |
| 420 | Ga0207663_10002097 | 3300025916 | Bacteria | 9499 |
| 421 | Ga0207663_10070063 | 3300025916 | Bacteria | 2258 |
| 422 | Ga0207660_10110321 | 3300025917 | Bacteria | 2069 |
| 423 | Ga0207660_10266723 | 3300025917 | Bacteria | 1355 |
| 424 | Ga0207662_10037024 | 3300025918 | Bacteria | 2854 |
| 425 | Ga0207662_10060614 | 3300025918 | Bacteria | 2270 |
| 426 | Ga0207657_10005846 | 3300025919 | Bacteria | 12820 |
| 427 | Ga0207649_10242119 | 3300025920 | Bacteria | 1295 |
| 428 | Ga0207652_10036535 | 3300025921 | Bacteria | 4153 |
| 429 | Ga0207652_10084286 | 3300025921 | Bacteria | 2784 |
| 430 | Ga0207652_10112556 | 3300025921 | Bacteria | 2415 |
| 431 | Ga0207652_10162631 | 3300025921 | Bacteria | 2001 |
| 432 | Ga0207646_10310692 | 3300025922 | Bacteria | 1424 |
| 433 | Ga0207646_10372346 | 3300025922 | Bacteria | 1290 |
| 434 | Ga0207681_10000420 | 3300025923 | Bacteria | 29486 |
| 435 | Ga0207681_10065445 | 3300025923 | Bacteria | 2513 |
| 436 | Ga0207681_10078532 | 3300025923 | Bacteria | 2323 |
| 437 | Ga0207681_10112004 | 3300025923 | Bacteria | 1986 |
| 438 | Ga0207694_10082472 | 3300025924 | Bacteria | 2528 |
| 439 | Ga0207694_10107621 | 3300025924 | Bacteria | 2215 |
| 440 | Ga0207650_10048613 | 3300025925 | Bacteria | 3129 |
| 441 | Ga0207650_10430096 | 3300025925 | Bacteria | 1096 |
| 442 | Ga0207659_10149167 | 3300025926 | Unclassified | 1824 |
| 443 | Ga0207659_10162446 | 3300025926 | Bacteria | 1755 |
| 444 | Ga0207659_10169865 | 3300025926 | Bacteria | 1719 |
| 445 | Ga0207659_10265039 | 3300025926 | Bacteria | 1399 |
| 446 | Ga0207687_10020291 | 3300025927 | Bacteria | 4408 |
| 447 | Ga0207687_10042809 | 3300025927 | Bacteria | 3118 |
| 448 | Ga0207687_10320339 | 3300025927 | Bacteria | 1255 |
| 449 | Ga0207700_10001346 | 3300025928 | Bacteria | 13937 |
| 450 | Ga0207700_10003896 | 3300025928 | Bacteria | 8712 |
| 451 | Ga0207700_10008355 | 3300025928 | Bacteria | 6408 |
| 452 | Ga0207700_10138066 | 3300025928 | Bacteria | 2000 |
| 453 | Ga0207700_10275792 | 3300025928 | Bacteria | 1445 |
| 454 | Ga0207664_10021740 | 3300025929 | Bacteria | 4779 |
| 455 | Ga0207664_10028334 | 3300025929 | Bacteria | 4255 |
| 456 | Ga0207664_10242666 | 3300025929 | Bacteria | 1569 |
| 457 | Ga0207664_10604645 | 3300025929 | Bacteria | 985 |
| 458 | Ga0207644_10012365 | 3300025931 | Bacteria | 5666 |
| 459 | Ga0207644_10062623 | 3300025931 | Bacteria | 2699 |
| 460 | Ga0207644_10095966 | 3300025931 | Bacteria | 2218 |
| 461 | Ga0207644_10240050 | 3300025931 | Bacteria | 1442 |
| 462 | Ga0207690_10138669 | 3300025932 | Bacteria | 1789 |
| 463 | Ga0207706_10002734 | 3300025933 | Bacteria | 17184 |
| 464 | Ga0207706_10010909 | 3300025933 | Bacteria | 8292 |
| 465 | Ga0207706_10012641 | 3300025933 | Bacteria | 7684 |
| 466 | Ga0207706_10023556 | 3300025933 | Bacteria | 5527 |
| 467 | Ga0207706_10303313 | 3300025933 | Bacteria | 1391 |
| 468 | Ga0207686_10015040 | 3300025934 | Bacteria | 4319 |
| 469 | Ga0207686_10043987 | 3300025934 | Bacteria | 2739 |
| 470 | Ga0207686_10097532 | 3300025934 | Bacteria | 1955 |
| 471 | Ga0207709_10002614 | 3300025935 | Bacteria | 11215 |
| 472 | Ga0207709_10033747 | 3300025935 | Bacteria | 3009 |
| 473 | Ga0207670_10033572 | 3300025936 | Bacteria | 3308 |
| 474 | Ga0207670_10053580 | 3300025936 | Bacteria | 2718 |
| 475 | Ga0207670_10232701 | 3300025936 | Bacteria | 1416 |
| 476 | Ga0207669_10002041 | 3300025937 | Bacteria | 8551 |
| 477 | Ga0207669_10006797 | 3300025937 | Bacteria | 5257 |
| 478 | Ga0207669_10053543 | 3300025937 | Bacteria | 2432 |
| 479 | Ga0207704_10028850 | 3300025938 | Bacteria | 3085 |
| 480 | Ga0207704_10076001 | 3300025938 | Bacteria | 2150 |
| 481 | Ga0207704_10098360 | 3300025938 | Bacteria | 1943 |
| 482 | Ga0207665_10025953 | 3300025939 | Bacteria | 3866 |
| 483 | Ga0207691_10014799 | 3300025940 | Bacteria | 7433 |
| 484 | Ga0207691_10123539 | 3300025940 | Unclassified | 2291 |
| 485 | Ga0207711_10018835 | 3300025941 | Bacteria | 5739 |
| 486 | Ga0207711_10111731 | 3300025941 | Bacteria | 2431 |
| 487 | Ga0207711_10153129 | 3300025941 | Bacteria | 2082 |
| 488 | Ga0207689_10002645 | 3300025942 | Bacteria | 16574 |
| 489 | Ga0207689_10005334 | 3300025942 | Bacteria | 11519 |
| 490 | Ga0207689_10036466 | 3300025942 | Bacteria | 4082 |
| 491 | Ga0207689_10036515 | 3300025942 | Bacteria | 4078 |
| 492 | Ga0207661_10143539 | 3300025944 | Bacteria | 2057 |
| 493 | Ga0207667_10072152 | 3300025949 | Bacteria | 3589 |
| 494 | Ga0207667_10138991 | 3300025949 | Bacteria | 2501 |
| 495 | Ga0207651_10036110 | 3300025960 | Bacteria | 3222 |
| 496 | Ga0207651_10116405 | 3300025960 | Bacteria | 2017 |
| 497 | Ga0207712_10002298 | 3300025961 | Bacteria | 12410 |
| 498 | Ga0207712_10014268 | 3300025961 | Bacteria | 5106 |
| 499 | Ga0207668_10012133 | 3300025972 | Bacteria | 5265 |
| 500 | Ga0207668_10018130 | 3300025972 | Bacteria | 4422 |
| 501 | Ga0207668_10071273 | 3300025972 | Bacteria | 2482 |
| 502 | Ga0207668_10072923 | 3300025972 | Bacteria | 2459 |
| 503 | Ga0207668_10131723 | 3300025972 | Bacteria | 1910 |
| 504 | Ga0207668_10400750 | 3300025972 | Bacteria | 1160 |
| 505 | Ga0207640_10145498 | 3300025981 | Bacteria | 1734 |
| 506 | Ga0207640_10146462 | 3300025981 | Bacteria | 1729 |
| 507 | Ga0207640_10302565 | 3300025981 | Bacteria | 1266 |
| 508 | Ga0207658_10000212 | 3300025986 | Bacteria | 60851 |
| 509 | Ga0207658_10049243 | 3300025986 | Bacteria | 3095 |
| 510 | Ga0207658_10084714 | 3300025986 | Bacteria | 2440 |
| 511 | Ga0207658_10184189 | 3300025986 | Bacteria | 1730 |
| 512 | Ga0207677_10010957 | 3300026023 | Bacteria | 5150 |
| 513 | Ga0207677_10065649 | 3300026023 | Bacteria | 2533 |
| 514 | Ga0207677_10390125 | 3300026023 | Bacteria | 1178 |
| 515 | Ga0207677_10443960 | 3300026023 | Bacteria | 1110 |
| 516 | Ga0207677_10450255 | 3300026023 | Bacteria | 1103 |
| 517 | Ga0207677_10635575 | 3300026023 | Bacteria | 940 |
| 518 | Ga0207703_10008468 | 3300026035 | Bacteria | 8128 |
| 519 | Ga0207703_10089906 | 3300026035 | Bacteria | 2579 |
| 520 | Ga0207703_10197611 | 3300026035 | Bacteria | 1785 |
| 521 | Ga0207703_10223286 | 3300026035 | Bacteria | 1686 |
| 522 | Ga0207639_10019008 | 3300026041 | Bacteria | 4892 |
| 523 | Ga0207639_10287161 | 3300026041 | Bacteria | 1449 |
| 524 | Ga0207678_10001842 | 3300026067 | Bacteria | 19436 |
| 525 | Ga0207678_10011624 | 3300026067 | Bacteria | 7733 |
| 526 | Ga0207678_10110386 | 3300026067 | Bacteria | 2346 |
| 527 | Ga0207678_10443642 | 3300026067 | Bacteria | 1127 |
| 528 | Ga0207708_10009553 | 3300026075 | Bacteria | 7191 |
| 529 | Ga0207708_10093574 | 3300026075 | Bacteria | 2320 |
| 530 | Ga0207708_10164477 | 3300026075 | Unclassified | 1754 |
| 531 | Ga0207702_10037988 | 3300026078 | Bacteria | 4033 |
| 532 | Ga0207641_10001060 | 3300026088 | Bacteria | 27782 |
| 533 | Ga0207641_10059943 | 3300026088 | Bacteria | 3243 |
| 534 | Ga0207641_10066656 | 3300026088 | Bacteria | 3081 |
| 535 | Ga0207648_10008257 | 3300026089 | Bacteria | 10108 |
| 536 | Ga0207648_10012760 | 3300026089 | Bacteria | 7852 |
| 537 | Ga0207648_10045089 | 3300026089 | Bacteria | 3869 |
| 538 | Ga0207648_10204586 | 3300026089 | Bacteria | 1752 |
| 539 | Ga0207676_10032372 | 3300026095 | Bacteria | 3939 |
| 540 | Ga0207676_10117611 | 3300026095 | Bacteria | 2236 |
| 541 | Ga0207676_10182050 | 3300026095 | Bacteria | 1841 |
| 542 | Ga0207676_10182386 | 3300026095 | Bacteria | 1839 |
| 543 | Ga0207674_10003900 | 3300026116 | Bacteria | 18146 |
| 544 | Ga0207674_10109359 | 3300026116 | Bacteria | 2740 |
| 545 | Ga0207675_100001130 | 3300026118 | Bacteria | 26475 |
| 546 | Ga0207675_100002876 | 3300026118 | Bacteria | 16923 |
| 547 | Ga0207675_100068525 | 3300026118 | Bacteria | 3316 |
| 548 | Ga0207675_100246021 | 3300026118 | Bacteria | 1729 |
| 549 | Ga0207683_10039992 | 3300026121 | Bacteria | 4090 |
| 550 | Ga0207683_10051823 | 3300026121 | Bacteria | 3595 |
| 551 | Ga0207683_10103293 | 3300026121 | Bacteria | 2546 |
| 552 | Ga0207683_10164940 | 3300026121 | Bacteria | 2004 |
| 553 | Ga0207698_10097677 | 3300026142 | Bacteria | 2424 |
| 554 | Ga0207698_10495866 | 3300026142 | Bacteria | 1187 |
| 555 | Ga0209179_1011904 | 3300027512 | Bacteria | 1552 |
| 556 | Ga0209588_1021054 | 3300027671 | Bacteria | 2045 |
| 557 | Ga0209813_10005178 | 3300027866 | Bacteria | 3152 |
| 558 | Ga0209974_10020612 | 3300027876 | Bacteria | 2184 |
| 559 | Ga0207428_10000618 | 3300027907 | Bacteria | 41972 |
| 560 | Ga0207428_10000920 | 3300027907 | Bacteria | 32881 |
| 561 | Ga0207428_10002825 | 3300027907 | Bacteria | 17234 |
| 562 | Ga0207428_10005326 | 3300027907 | Bacteria | 11998 |
| 563 | Ga0207428_10067274 | 3300027907 | Bacteria | 2821 |
| 564 | Ga0207428_10259916 | 3300027907 | Bacteria | 1293 |
| 565 | Ga0268266_10001037 | 3300028379 | Bacteria | 34914 |
| 566 | Ga0268266_10044601 | 3300028379 | Bacteria | 3791 |
| 567 | Ga0268266_10118260 | 3300028379 | Bacteria | 2356 |
| 568 | Ga0268266_10321543 | 3300028379 | Bacteria | 1448 |
| 569 | Ga0268265_10007719 | 3300028380 | Bacteria | 7259 |
| 570 | Ga0268265_10160764 | 3300028380 | Bacteria | 1907 |
| 571 | Ga0268265_10257308 | 3300028380 | Unclassified | 1550 |
| 572 | Ga0268264_10001043 | 3300028381 | Bacteria | 27736 |
| 573 | Ga0268264_10076481 | 3300028381 | Bacteria | 2848 |
| 574 | Ga0268264_10116220 | 3300028381 | Bacteria | 2351 |
| 575 | Ga0268264_10168115 | 3300028381 | Bacteria | 1981 |
| 576 | Ga0268264_10201501 | 3300028381 | Bacteria | 1821 |
| 577 | Ga0268264_10234732 | 3300028381 | Bacteria | 1695 |
| 578 | Ga0307515_10231400 | 3300028794 | Bacteria | 1640 |
| 579 | Ga0265338_10255062 | 3300028800 | Bacteria | 1292 |
| 580 | Ga0307511_10115747 | 3300030521 | Bacteria | 1683 |
| 581 | Ga0265340_10015435 | 3300031247 | Bacteria | 3968 |
| 582 | Ga0307509_10110955 | 3300031507 | Bacteria | 2747 |
| 583 | Ga0307408_100072743 | 3300031548 | Bacteria | 2546 |
| 584 | Ga0307408_100236869 | 3300031548 | Bacteria | 1498 |
| 585 | Ga0307408_100252836 | 3300031548 | Bacteria | 1454 |
| 586 | Ga0265314_10054838 | 3300031711 | Bacteria | 2756 |
| 587 | Ga0265342_10058879 | 3300031712 | Bacteria | 2270 |
| 588 | Ga0307405_10144213 | 3300031731 | Bacteria | 1665 |
| 589 | Ga0307410_10098212 | 3300031852 | Bacteria | 2094 |
| 590 | Ga0307406_10036509 | 3300031901 | Bacteria | 3029 |
| 591 | Ga0307406_10270176 | 3300031901 | Bacteria | 1291 |
| 592 | Ga0307412_10163678 | 3300031911 | Bacteria | 1656 |
| 593 | Ga0307409_100000528 | 3300031995 | Bacteria | 16509 |
| 594 | Ga0307416_100007106 | 3300032002 | Bacteria | 7078 |
| 595 | Ga0307416_100310363 | 3300032002 | Bacteria | 1573 |
| 596 | Ga0307416_100311974 | 3300032002 | Bacteria | 1570 |
| 597 | Ga0307415_100085227 | 3300032126 | Bacteria | 2269 |
| 598 | Ga0307415_100200038 | 3300032126 | Bacteria | 1585 |
| 599 | Ga0373926_0006770 | 3300035083 | Bacteria | 3808 |
| 600 | Ga0373926_0029833 | 3300035083 | Bacteria | 1918 |
| 601 | Ga0373926_0037056 | 3300035083 | Bacteria | 1734 |
| 602 | Ga0373926_0048917 | 3300035083 | Bacteria | 1522 |
| 603 | Ga0373940_0006960 | 3300035088 | Bacteria | 2535 |
| 604 | Ga0373944_0076517 | 3300035089 | Bacteria | 1099 |
| 605 | Ga0373936_0003385 | 3300035113 | Bacteria | 5976 |
| 606 | Ga0373936_0028966 | 3300035113 | Bacteria | 2179 |
| 607 | Ga0373945_0016385 | 3300035116 | Bacteria | 2499 |
| 608 | Ga0373945_0023201 | 3300035116 | Bacteria | 2142 |
| 609 | Ga0373953_0030732 | 3300035117 | Bacteria | 2084 |
| 610 | Ga0373954_0051215 | 3300035118 | Bacteria | 1938 |
| 611 | Ga0373943_0030064 | 3300035170 | Bacteria | 2569 |
| 612 | Ga0373946_0001521 | 3300035171 | Bacteria | 8060 |
| 613 | Ga0373946_0031099 | 3300035171 | Bacteria | 2135 |
| 614 | Ga0373946_0066571 | 3300035171 | Bacteria | 1545 |
| 615 | Ga0373955_0031668 | 3300035172 | Bacteria | 2771 |
| 616 | Ga0373955_0119222 | 3300035172 | Bacteria | 1532 |
| 617 | Ga0373962_0011114 | 3300035242 | Bacteria | 2253 |
| 618 | Ga0373924_0002712 | 3300035410 | Bacteria | 5976 |
| 619 | Ga0373935_0001406 | 3300035692 | Bacteria | 13337 |
| 620 | Ga0373927_0003933 | 3300035695 | Bacteria | 10535 |
| 621 | Ga0373927_0005396 | 3300035695 | Bacteria | 8827 |
| 622 | Ga0373927_0036489 | 3300035695 | Bacteria | 3196 |
| 623 | Ga0373933_0021159 | 3300035724 | Bacteria | 3692 |
| 624 | Ga0373933_0245769 | 3300035724 | Bacteria | 1151 |
| 625 | Ga0373947_0001456 | 3300035725 | Bacteria | 14556 |
| 626 | Ga0373947_0002425 | 3300035725 | Bacteria | 11251 |
| 627 | Ga0373947_0003263 | 3300035725 | Bacteria | 9619 |
| 628 | Ga0373947_0007599 | 3300035725 | Bacteria | 6272 |
| 629 | Ga0373947_0068416 | 3300035725 | Bacteria | 2172 |
| 630 | Ga0373937_0447383 | 3300036401 | Bacteria | 1227 |
| 631 | Ga0373937_0492283 | 3300036401 | Bacteria | 1165 |
| 632 | Ga0373925_0017252 | 3300037068 | Bacteria | 5229 |
| 633 | Ga0373925_0017905 | 3300037068 | Bacteria | 5142 |
| 634 | Ga0373925_0333701 | 3300037068 | Bacteria | 1229 |
| 635 | Ga0395899_0115555 | 3300037312 | Bacteria | 1926 |
| 636 | Ga0395900_0040758 | 3300037418 | Bacteria | 4786 |
| 637 | Ga0395900_0657009 | 3300037418 | Bacteria | 985 |
| 638 | Ga0395898_0017111 | 3300037466 | Bacteria | 7405 |
| 639 | Ga0395898_0107327 | 3300037466 | Bacteria | 2677 |
| 640 | Ga0395905_0091441 | 3300037471 | Bacteria | 2853 |
| 641 | Ga0395901_0076535 | 3300038443 | Bacteria | 3491 |
| 642 | Ga0436365_0731126 | 3300039437 | Bacteria | 1309 |
| 643 | Ga0436361_0100673 | 3300039447 | Bacteria | 13066 |
| 644 | Ga0436362_0192500 | 3300039453 | Bacteria | 1328 |
| 645 | Ga0451851_0622210 | 3300041507 | Bacteria | 1333 |
| 646 | Ga0439435_0000980 | 3300042436 | Bacteria | 4992 |
| 647 | Ga0439435_0012266 | 3300042436 | Bacteria | 2073 |
| 648 | Ga0466961_0092505 | 3300044693 | Bacteria | 1909 |
| 649 | Ga0466957_0002234 | 3300044842 | Bacteria | 10386 |
| 650 | Ga0466957_0323690 | 3300044842 | Bacteria | 1041 |
| 651 | Ga0451576_0102334 | 3300045051 | Bacteria | 2979 |
| 652 | Ga0495617_014008 | 3300046452 | Bacteria | 2725 |
| 653 | Ga0495592_0012664 | 3300046454 | Bacteria | 6410 |
| 654 | Ga0495603_0005454 | 3300046455 | Bacteria | 7592 |
| 655 | Ga0495603_0008659 | 3300046455 | Bacteria | 6148 |
| 656 | Ga0495603_0145736 | 3300046455 | Unclassified | 1376 |
| 657 | Ga0495590_0046292 | 3300046457 | Bacteria | 1517 |
| 658 | Ga0495629_0001360 | 3300046459 | Bacteria | 19275 |
| 659 | Ga0495629_0014941 | 3300046459 | Bacteria | 5579 |
| 660 | Ga0495629_0026104 | 3300046459 | Bacteria | 4151 |
| 661 | Ga0495629_0051236 | 3300046459 | Unclassified | 2889 |
| 662 | Ga0495629_0274364 | 3300046459 | Bacteria | 1158 |
| 663 | Ga0495629_0290239 | 3300046459 | Bacteria | 1121 |
| 664 | Ga0495638_0016736 | 3300046460 | Bacteria | 4902 |
| 665 | Ga0495641_0017298 | 3300046461 | Bacteria | 3761 |
| 666 | Ga0495651_0012806 | 3300046462 | Bacteria | 6475 |
| 667 | Ga0495651_0016437 | 3300046462 | Bacteria | 5731 |
| 668 | Ga0495582_0027436 | 3300046473 | Bacteria | 3122 |
| 669 | Ga0495605_0040726 | 3300046474 | Bacteria | 2318 |
| 670 | Ga0495605_0085743 | 3300046474 | Bacteria | 1466 |
| 671 | Ga0495605_0129399 | 3300046474 | Unclassified | 1139 |
| 672 | Ga0495639_0005083 | 3300046475 | Bacteria | 5652 |
| 673 | Ga0495639_0073620 | 3300046475 | Bacteria | 1582 |
| 674 | Ga0495662_0052717 | 3300046476 | Bacteria | 1964 |
| 675 | Ga0495664_0001034 | 3300046477 | Bacteria | 14381 |
| 676 | Ga0495664_0022730 | 3300046477 | Bacteria | 3637 |
| 677 | Ga0495664_0023262 | 3300046477 | Bacteria | 3596 |
| 678 | Ga0495584_0010382 | 3300046491 | Bacteria | 4787 |
| 679 | Ga0495585_0002702 | 3300046492 | Bacteria | 12423 |
| 680 | Ga0495585_0042158 | 3300046492 | Bacteria | 2558 |
| 681 | Ga0495585_0072054 | 3300046492 | Bacteria | 1883 |
| 682 | Ga0495594_0005195 | 3300046499 | Bacteria | 6690 |
| 683 | Ga0495594_0038110 | 3300046499 | Bacteria | 2624 |
| 684 | Ga0495596_0049139 | 3300046500 | Bacteria | 1654 |
| 685 | Ga0495596_0061973 | 3300046500 | Bacteria | 1456 |
| 686 | Ga0495606_0000753 | 3300046507 | Bacteria | 50074 |
| 687 | Ga0495608_0050053 | 3300046511 | Bacteria | 2772 |
| 688 | Ga0495610_0052743 | 3300046512 | Bacteria | 1973 |
| 689 | Ga0495618_0005416 | 3300046514 | Bacteria | 7782 |
| 690 | Ga0495618_0009681 | 3300046514 | Bacteria | 5818 |
| 691 | Ga0495618_0017145 | 3300046514 | Bacteria | 4438 |
| 692 | Ga0495628_0064674 | 3300046516 | Bacteria | 2863 |
| 693 | Ga0495632_0031806 | 3300046519 | Bacteria | 2724 |
| 694 | Ga0495644_0000510 | 3300046523 | Bacteria | 16598 |
| 695 | Ga0495666_0004543 | 3300046526 | Bacteria | 7014 |
| 696 | Ga0495666_0059828 | 3300046526 | Bacteria | 1822 |
| 697 | Ga0495652_0012180 | 3300046529 | Bacteria | 7768 |
| 698 | Ga0495652_0013306 | 3300046529 | Bacteria | 7405 |
| 699 | Ga0495652_0018127 | 3300046529 | Bacteria | 6283 |
| 700 | Ga0495665_0002324 | 3300046531 | Bacteria | 10269 |
| 701 | Ga0495640_0008356 | 3300046533 | Bacteria | 8120 |
| 702 | Ga0495640_0016234 | 3300046533 | Bacteria | 5574 |
| 703 | Ga0495640_0021657 | 3300046533 | Bacteria | 4711 |
| 704 | Ga0495640_0032820 | 3300046533 | Bacteria | 3694 |
| 705 | Ga0495640_0048856 | 3300046533 | Bacteria | 2920 |
| 706 | Ga0495586_0245654 | 3300046535 | Bacteria | 1021 |
| 707 | Ga0495598_0007871 | 3300046537 | Bacteria | 2462 |
| 708 | Ga0495645_0053978 | 3300046543 | Bacteria | 2920 |
| 709 | Ga0495622_0006380 | 3300046557 | Bacteria | 5475 |
| 710 | Ga0495633_0088933 | 3300046558 | Bacteria | 1436 |
| 711 | Ga0495667_0004324 | 3300046559 | Bacteria | 9586 |
| 712 | Ga0495667_0058318 | 3300046559 | Bacteria | 2536 |
| 713 | Ga0495667_0116614 | 3300046559 | Bacteria | 1725 |
| 714 | Ga0495656_0000296 | 3300046615 | Bacteria | 17268 |
| 715 | Ga0495656_0007959 | 3300046615 | Bacteria | 3769 |
| 716 | Ga0495656_0037023 | 3300046615 | Unclassified | 2013 |
| 717 | Ga0495668_0019264 | 3300046616 | Bacteria | 3936 |
| 718 | Ga0495668_0176715 | 3300046616 | Bacteria | 1170 |
| 719 | Ga0495634_0007278 | 3300046642 | Bacteria | 8338 |
| 720 | Ga0495634_0018647 | 3300046642 | Bacteria | 4936 |
| 721 | Ga0495611_0004254 | 3300046648 | Bacteria | 6229 |
| 722 | Ga0495635_0007226 | 3300046663 | Bacteria | 7758 |
| 723 | Ga0495635_0040366 | 3300046663 | Bacteria | 3225 |
| 724 | Ga0495635_0089010 | 3300046663 | Bacteria | 2112 |
| 725 | Ga0495659_0002362 | 3300046664 | Bacteria | 6095 |
| 726 | Ga0495588_0037901 | 3300046674 | Bacteria | 2450 |
| 727 | Ga0495599_0020720 | 3300046678 | Bacteria | 4097 |
| 728 | Ga0495599_0054040 | 3300046678 | Bacteria | 2516 |
| 729 | Ga0495623_0081074 | 3300046679 | Bacteria | 2007 |
| 730 | Ga0495646_0010909 | 3300046680 | Bacteria | 5772 |
| 731 | Ga0495646_0015832 | 3300046680 | Bacteria | 4788 |
| 732 | Ga0495647_0001487 | 3300046681 | Bacteria | 7272 |
| 733 | Ga0495647_0035432 | 3300046681 | Bacteria | 1874 |
| 734 | Ga0495647_0044751 | 3300046681 | Bacteria | 1698 |
| 735 | Ga0495658_0001084 | 3300046683 | Bacteria | 14340 |
| 736 | Ga0495658_0019732 | 3300046683 | Bacteria | 3523 |
| 737 | Ga0495658_0216767 | 3300046683 | Bacteria | 1197 |
| 738 | Ga0495669_0024557 | 3300046684 | Bacteria | 2624 |
| 739 | Ga0495669_0173737 | 3300046684 | Bacteria | 1025 |
| 740 | Ga0495613_0005417 | 3300046689 | Bacteria | 9586 |
| 741 | Ga0495613_0248653 | 3300046689 | Bacteria | 1241 |
| 742 | Ga0495624_0002012 | 3300046690 | Bacteria | 15492 |
| 743 | Ga0495670_0003427 | 3300046691 | Bacteria | 7793 |
| 744 | Ga0495671_0074954 | 3300046692 | Bacteria | 1660 |
| 745 | Ga0495671_0077704 | 3300046692 | Bacteria | 1627 |
| 746 | Ga0495589_0092592 | 3300046794 | Bacteria | 1467 |
| 747 | Ga0495589_0106405 | 3300046794 | Bacteria | 1355 |
| 748 | Ga0495600_0069402 | 3300046809 | Bacteria | 2303 |
| 749 | Ga0495581_0002122 | 3300047315 | Bacteria | 11179 |
| 750 | Ga0495581_0148930 | 3300047315 | Bacteria | 1366 |
| 751 | Ga0495604_0216908 | 3300047317 | Unclassified | 1319 |
| 752 | Ga0495674_0003621 | 3300047319 | Bacteria | 15039 |
| 753 | Ga0495674_0025009 | 3300047319 | Bacteria | 5479 |
| 754 | Ga0495674_0025024 | 3300047319 | Bacteria | 5478 |
| 755 | Ga0495674_0037448 | 3300047319 | Bacteria | 4359 |
| 756 | Ga0495672_0018735 | 3300047320 | Bacteria | 4585 |
| 757 | Ga0495672_0056188 | 3300047320 | Bacteria | 2292 |
| 758 | Ga0495676_0007996 | 3300047321 | Bacteria | 9697 |
| 759 | Ga0495676_0156369 | 3300047321 | Bacteria | 1617 |
| 760 | Ga0495680_0006335 | 3300047322 | Bacteria | 11014 |
| 761 | Ga0495680_0041682 | 3300047322 | Bacteria | 3649 |
| 762 | Ga0495680_0055426 | 3300047322 | Bacteria | 3075 |
| 763 | Ga0495675_0031629 | 3300047444 | Bacteria | 3378 |
| 764 | Ga0495677_0027186 | 3300047445 | Bacteria | 2076 |
| 765 | Ga0495679_019109 | 3300047446 | Bacteria | 2416 |
| 766 | Ga0495684_0002702 | 3300047471 | Bacteria | 14043 |
| 767 | Ga0495684_0044442 | 3300047471 | Bacteria | 3401 |
| 768 | Ga0495684_0095324 | 3300047471 | Bacteria | 2252 |
| 769 | Ga0495686_0121046 | 3300047472 | Bacteria | 1560 |
| 770 | Ga0495686_0201318 | 3300047472 | Bacteria | 1143 |
| 771 | Ga0495593_0007998 | 3300047673 | Bacteria | 6155 |
| 772 | Ga0495593_0080666 | 3300047673 | Bacteria | 1683 |
| 773 | Ga0495593_0163728 | 3300047673 | Bacteria | 1122 |
| 774 | Ga0495602_0078230 | 3300048088 | Bacteria | 2794 |
| 775 | Ga0496100_0018910 | 3300048903 | Bacteria | 4099 |
| 776 | Ga0496100_0022574 | 3300048903 | Bacteria | 3809 |
| 777 | Ga0496100_0265393 | 3300048903 | Bacteria | 1274 |
| 778 | Ga0496101_0000139 | 3300048904 | Bacteria | 63989 |
| 779 | Ga0496101_0013918 | 3300048904 | Bacteria | 5401 |
| 780 | Ga0496101_0022121 | 3300048904 | Bacteria | 4374 |
| 781 | Ga0496102_0006168 | 3300048905 | Bacteria | 10220 |
| 782 | Ga0496102_0089486 | 3300048905 | Bacteria | 2848 |
| 783 | Ga0496102_0167897 | 3300048905 | Bacteria | 2065 |
| 784 | Ga0496102_0183714 | 3300048905 | Bacteria | 1970 |
| 785 | Ga0496102_0194395 | 3300048905 | Bacteria | 1912 |
| 786 | Ga0496102_0325901 | 3300048905 | Bacteria | 1447 |
| 787 | Ga0496102_0579705 | 3300048905 | Bacteria | 1045 |
| 788 | Ga0496103_0244019 | 3300048906 | Bacteria | 1156 |
| 789 | Ga0496104_0004028 | 3300048907 | Bacteria | 12739 |
| 790 | Ga0496104_0038299 | 3300048907 | Bacteria | 4486 |
| 791 | Ga0496104_0081014 | 3300048907 | Unclassified | 3095 |
| 792 | Ga0496104_0133112 | 3300048907 | Bacteria | 2388 |
| 793 | Ga0496104_0289065 | 3300048907 | Bacteria | 1551 |
| 794 | Ga0496105_0017587 | 3300048908 | Bacteria | 5734 |
| 795 | Ga0496105_0028853 | 3300048908 | Bacteria | 4540 |
| 796 | Ga0496105_0054150 | 3300048908 | Bacteria | 3313 |
| 797 | Ga0496105_0071518 | 3300048908 | Bacteria | 2866 |
| 798 | Ga0496105_0173044 | 3300048908 | Bacteria | 1769 |
| 799 | Ga0496106_0010418 | 3300048909 | Bacteria | 6864 |
| 800 | Ga0496106_0101339 | 3300048909 | Bacteria | 2233 |
| 801 | Ga0496106_0102701 | 3300048909 | Bacteria | 2218 |
| 802 | Ga0496107_0035694 | 3300048910 | Bacteria | 3565 |
| 803 | Ga0496107_0049231 | 3300048910 | Bacteria | 3036 |
| 804 | Ga0496107_0061329 | 3300048910 | Bacteria | 2723 |
| 805 | Ga0496107_0285265 | 3300048910 | Bacteria | 1229 |
| 806 | Ga0496108_0013377 | 3300048911 | Bacteria | 6692 |
| 807 | Ga0496108_0053569 | 3300048911 | Bacteria | 3383 |
| 808 | Ga0496108_0084322 | 3300048911 | Bacteria | 2696 |
| 809 | Ga0496108_0184333 | 3300048911 | Bacteria | 1808 |
| 810 | Ga0496109_0003355 | 3300048912 | Bacteria | 13395 |
| 811 | Ga0496109_0006466 | 3300048912 | Bacteria | 9867 |
| 812 | Ga0496109_0013309 | 3300048912 | Bacteria | 7128 |
| 813 | Ga0496109_0133766 | 3300048912 | Bacteria | 2316 |
| 814 | Ga0496110_0029303 | 3300048913 | Bacteria | 4736 |
| 815 | Ga0496110_0046287 | 3300048913 | Bacteria | 3805 |
| 816 | Ga0496110_0050288 | 3300048913 | Bacteria | 3659 |
| 817 | Ga0496110_0061092 | 3300048913 | Bacteria | 3325 |
| 818 | Ga0496110_0094477 | 3300048913 | Bacteria | 2677 |
| 819 | Ga0496110_0186778 | 3300048913 | Bacteria | 1882 |
| 820 | Ga0496110_0266420 | 3300048913 | Bacteria | 1560 |
| 821 | Ga0496110_0395143 | 3300048913 | Bacteria | 1260 |
| 822 | Ga0496110_0633882 | 3300048913 | Bacteria | 968 |
| 823 | Ga0496111_0027590 | 3300048914 | Bacteria | 4018 |
| 824 | Ga0496111_0048931 | 3300048914 | Bacteria | 3047 |
| 825 | Ga0496111_0173165 | 3300048914 | Bacteria | 1604 |
| 826 | Ga0496112_0000039 | 3300048915 | Bacteria | 91123 |
| 827 | Ga0496112_0005830 | 3300048915 | Bacteria | 10724 |
| 828 | Ga0496112_0011666 | 3300048915 | Bacteria | 8038 |
| 829 | Ga0496112_0102285 | 3300048915 | Bacteria | 2835 |
| 830 | Ga0496112_0125331 | 3300048915 | Bacteria | 2539 |
| 831 | Ga0496113_0008638 | 3300048916 | Bacteria | 6645 |
| 832 | Ga0496113_0061886 | 3300048916 | Bacteria | 2825 |
| 833 | Ga0496113_0075442 | 3300048916 | Bacteria | 2573 |
| 834 | Ga0496113_0143458 | 3300048916 | Bacteria | 1880 |
| 835 | Ga0496113_0259607 | 3300048916 | Bacteria | 1388 |
| 836 | Ga0496114_0000302 | 3300048917 | Bacteria | 36280 |
| 837 | Ga0496114_0025657 | 3300048917 | Bacteria | 4819 |
| 838 | Ga0496114_0152975 | 3300048917 | Bacteria | 2002 |
| 839 | Ga0496115_0053257 | 3300048918 | Bacteria | 3247 |
| 840 | Ga0496115_0150511 | 3300048918 | Bacteria | 1921 |
| 841 | Ga0496115_0220930 | 3300048918 | Bacteria | 1563 |
| 842 | Ga0496121_0001073 | 3300048924 | Bacteria | 48396 |
| 843 | Ga0496121_0114438 | 3300048924 | Bacteria | 2050 |
| 844 | Ga0496125_0000487 | 3300048928 | Bacteria | 69494 |
| 845 | Ga0496125_0188717 | 3300048928 | Bacteria | 1364 |
| 846 | Ga0496126_0072057 | 3300048929 | Bacteria | 3074 |
| 847 | Ga0495682_0048274 | 3300049460 | Bacteria | 1552 |
| 848 | Ga0501032_0022579 | 3300049569 | Bacteria | 4360 |
| 849 | Ga0501032_0164855 | 3300049569 | Bacteria | 1454 |
| 850 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 851 | Ga0501034_0010326 | 3300049571 | Bacteria | 9733 |
| 852 | Ga0501034_0015121 | 3300049571 | Bacteria | 7932 |
| 853 | Ga0501036_0119007 | 3300049572 | Bacteria | 2230 |
| 854 | Ga0501037_0230003 | 3300049573 | Bacteria | 1302 |
| 855 | Ga0501038_0084930 | 3300049574 | Bacteria | 2663 |
| 856 | Ga0501040_0011176 | 3300049576 | Bacteria | 5871 |
| 857 | Ga0501040_0082719 | 3300049576 | Bacteria | 2226 |
| 858 | Ga0501042_0006967 | 3300049578 | Bacteria | 7376 |
| 859 | Ga0501042_0327750 | 3300049578 | Unclassified | 1107 |
| 860 | Ga0501043_0022339 | 3300049579 | Bacteria | 4963 |
| 861 | Ga0501046_0139165 | 3300049580 | Bacteria | 1838 |
| 862 | Ga0501047_0000100 | 3300049581 | Bacteria | 105717 |
| 863 | Ga0501048_0000083 | 3300049582 | Bacteria | 49621 |
| 864 | Ga0501068_0238973 | 3300049584 | Bacteria | 1156 |
| 865 | Ga0501070_0009312 | 3300049586 | Bacteria | 8307 |
| 866 | Ga0501070_0301098 | 3300049586 | Bacteria | 1306 |
| 867 | Ga0501070_0352593 | 3300049586 | Bacteria | 1194 |
| 868 | Ga0501071_0004387 | 3300049587 | Bacteria | 8949 |
| 869 | Ga0501072_0013202 | 3300049588 | Bacteria | 6325 |
| 870 | Ga0501072_0030716 | 3300049588 | Bacteria | 4203 |
| 871 | Ga0501073_0038845 | 3300049589 | Bacteria | 3375 |
| 872 | Ga0501074_0089797 | 3300049590 | Bacteria | 2201 |
| 873 | Ga0501075_0000528 | 3300049591 | Bacteria | 23105 |
| 874 | Ga0501076_0000391 | 3300049592 | Bacteria | 27401 |
| 875 | Ga0501079_0114129 | 3300049741 | Bacteria | 2100 |
| 876 | Ga0501080_0000030 | 3300049742 | Bacteria | 87736 |
| 877 | Ga0501080_0193879 | 3300049742 | Bacteria | 1866 |
| 878 | Ga0501081_0001914 | 3300049743 | Bacteria | 12917 |
| 879 | Ga0501081_0035321 | 3300049743 | Bacteria | 3403 |
| 880 | Ga0501083_0002641 | 3300049744 | Bacteria | 12337 |
| 881 | Ga0501083_0245162 | 3300049744 | Bacteria | 1166 |
| 882 | Ga0501044_0000587 | 3300049823 | Bacteria | 44137 |
| 883 | Ga0501044_0087165 | 3300049823 | Bacteria | 3153 |
| 884 | Ga0501045_0010164 | 3300049824 | Bacteria | 6586 |
| 885 | Ga0501045_0093853 | 3300049824 | Bacteria | 2219 |
| 886 | nmdc:mga03n38_2690_c1 | 3300050490 | Bacteria | 5550 |
| 887 | nmdc:mga0yw44_125239_c1 | 3300050492 | Bacteria | 1659 |
| 888 | nmdc:mga0yw44_1925_c1 | 3300050492 | Bacteria | 8582 |
| 889 | nmdc:mga0yw44_37220_c1 | 3300050492 | Bacteria | 2872 |
| 890 | nmdc:mga0yw44_64664_c1 | 3300050492 | Bacteria | 2252 |
| 891 | nmdc:mga06z11_59921_c1 | 3300050494 | Bacteria | 1980 |
| 892 | nmdc:mga05p37_139679_c1 | 3300050507 | Bacteria | 2969 |
| 893 | nmdc:mga05p37_150209_c1 | 3300050507 | Bacteria | 2850 |
| 894 | nmdc:mga05p37_19242_c1 | 3300050507 | Bacteria | 8259 |
| 895 | nmdc:mga05p37_28900_c1 | 3300050507 | Bacteria | 6763 |
| 896 | nmdc:mga05p37_31225_c1 | 3300050507 | Bacteria | 6507 |
| 897 | nmdc:mga05p37_335080_c1 | 3300050507 | Bacteria | 1786 |
| 898 | nmdc:mga05p37_612563_c1 | 3300050507 | Bacteria | 1227 |
| 899 | nmdc:mga05p37_8481_c1 | 3300050507 | Bacteria | 12149 |
| 900 | nmdc:mga05p37_88171_c1 | 3300050507 | Bacteria | 3825 |
| 901 | nmdc:mga05p37_928_c1 | 3300050507 | Bacteria | 33059 |
| 902 | nmdc:mga09592_13720_c1 | 3300050508 | Bacteria | 6621 |
| 903 | nmdc:mga09592_16225_c1 | 3300050508 | Bacteria | 6088 |
| 904 | nmdc:mga09592_2676_c1 | 3300050508 | Bacteria | 14409 |
| 905 | nmdc:mga09592_327286_c1 | 3300050508 | Unclassified | 1327 |
| 906 | nmdc:mga09592_7590_c1 | 3300050508 | Bacteria | 8822 |
| 907 | nmdc:mga09592_81234_c1 | 3300050508 | Bacteria | 2762 |
| 908 | nmdc:mga0qj67_131855_c1 | 3300050509 | Bacteria | 2024 |
| 909 | nmdc:mga0qj67_160443_c1 | 3300050509 | Unclassified | 1825 |
| 910 | nmdc:mga0qj67_276337_c1 | 3300050509 | Bacteria | 1362 |
| 911 | nmdc:mga0qj67_2917_c1 | 3300050509 | Bacteria | 12275 |
| 912 | nmdc:mga0qj67_6794_c1 | 3300050509 | Bacteria | 8411 |
| 913 | nmdc:mga0qj67_68754_c1 | 3300050509 | Bacteria | 2823 |
| 914 | nmdc:mga0qj67_800_c1 | 3300050509 | Bacteria | 18117 |
| 915 | nmdc:mga06r32_117187_c1 | 3300050510 | Bacteria | 2625 |
| 916 | nmdc:mga06r32_3325_c1 | 3300050510 | Bacteria | 14409 |
| 917 | nmdc:mga06r32_379315_c1 | 3300050510 | Bacteria | 1397 |
| 918 | nmdc:mga06r32_4226_c1 | 3300050510 | Bacteria | 12870 |
| 919 | nmdc:mga06r32_795_c1 | 3300050510 | Bacteria | 27918 |
| 920 | nmdc:mga06r32_9128_c1 | 3300050510 | Bacteria | 6385 |
| 921 | nmdc:mga08y16_13516_c1 | 3300050511 | Bacteria | 8590 |
| 922 | nmdc:mga08y16_137515_c1 | 3300050511 | Bacteria | 2540 |
| 923 | nmdc:mga08y16_147897_c1 | 3300050511 | Bacteria | 2442 |
| 924 | nmdc:mga08y16_185410_c1 | 3300050511 | Bacteria | 2160 |
| 925 | nmdc:mga08y16_191454_c1 | 3300050511 | Bacteria | 2122 |
| 926 | nmdc:mga08y16_2587_c1 | 3300050511 | Bacteria | 18610 |
| 927 | nmdc:mga08y16_262197_c1 | 3300050511 | Unclassified | 1785 |
| 928 | nmdc:mga08y16_356917_c1 | 3300050511 | Bacteria | 1501 |
| 929 | nmdc:mga08y16_50496_c1 | 3300050511 | Bacteria | 4353 |
| 930 | nmdc:mga0n895_16020_c1 | 3300050512 | Bacteria | 6865 |
| 931 | nmdc:mga0n895_2399_c1 | 3300050512 | Bacteria | 14608 |
| 932 | nmdc:mga0n895_590_c1 | 3300050512 | Bacteria | 25063 |
| 933 | nmdc:mga0rr50_6545_c1 | 3300050513 | Bacteria | 7108 |
| 934 | nmdc:mga0rr50_9580_c1 | 3300050513 | Bacteria | 6099 |
| 935 | nmdc:mga08x19_280107_c1 | 3300050514 | Bacteria | 1155 |
| 936 | nmdc:mga0a205_254_c1 | 3300050515 | Bacteria | 38196 |
| 937 | nmdc:mga0a205_3143_c1 | 3300050515 | Bacteria | 14646 |
| 938 | nmdc:mga0a205_437363_c1 | 3300050515 | Bacteria | 1169 |
| 939 | nmdc:mga0a205_5139_c1 | 3300050515 | Bacteria | 11772 |
| 940 | nmdc:mga0a205_67829_c1 | 3300050515 | Bacteria | 3445 |
| 941 | Ga0495601_0000489 | 3300053077 | Bacteria | 20787 |
| 942 | Ga0495601_0000889 | 3300053077 | Bacteria | 16315 |
| 943 | Ga0495601_0011239 | 3300053077 | Bacteria | 5348 |
| 944 | Ga0495601_0036436 | 3300053077 | Bacteria | 3071 |
| 945 | Ga0495612_0003322 | 3300053078 | Bacteria | 6669 |
| 946 | Ga0495612_0019714 | 3300053078 | Bacteria | 2702 |
| 947 | Ga0495595_0005839 | 3300053084 | Bacteria | 4986 |
| 948 | Ga0495595_0185451 | 3300053084 | Bacteria | 1033 |
| 949 | Ga0495619_0000918 | 3300053085 | Bacteria | 19328 |
| 950 | Ga0495619_0007637 | 3300053085 | Bacteria | 6844 |
| 951 | Ga0495619_0028393 | 3300053085 | Bacteria | 3608 |
| 952 | Ga0495619_0047385 | 3300053085 | Bacteria | 2830 |
| 953 | Ga0495619_0149708 | 3300053085 | Bacteria | 1610 |
| 954 | Ga0500583_0149936 | 3300053092 | Bacteria | 1160 |
| 955 | Ga0500566_0006739 | 3300053094 | Bacteria | 6803 |
| 956 | Ga0500554_022940 | 3300053102 | Bacteria | 1749 |
| 957 | Ga0500595_000151 | 3300053119 | Bacteria | 45478 |
| 958 | Ga0500595_017033 | 3300053119 | Bacteria | 2694 |
| 959 | Ga0500642_0019890 | 3300053130 | Bacteria | 2628 |
| 960 | Ga0500658_0031645 | 3300053134 | Bacteria | 2070 |
| 961 | Ga0500561_0017452 | 3300053137 | Bacteria | 1629 |
| 962 | Ga0500568_0034603 | 3300053139 | Bacteria | 2066 |
| 963 | Ga0500603_051690 | 3300053150 | Bacteria | 1126 |
| 964 | Ga0500627_0060088 | 3300053158 | Bacteria | 1671 |
| 965 | Ga0500637_0001169 | 3300053178 | Bacteria | 10912 |
| 966 | Ga0501084_0011673 | 3300054114 | Bacteria | 7274 |
| 967 | Ga0500661_000174 | 3300055283 | Bacteria | 11204 |
| 968 | Ga0501082_0001012 | 3300060353 | Bacteria | 24853 |
| 969 | Ga0530510_0001725 | 3300061734 | Bacteria | 14858 |
| 970 | Ga0530510_0011633 | 3300061734 | Bacteria | 6175 |
| 971 | Ga0530510_0411754 | 3300061734 | Bacteria | 1020 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006852 | Ga0075433_10144931 | Ga0075433_101449312 | 227 |
| 2 | 3300006871 | Ga0075434_100073139 | Ga0075434_1000731393 | 227 |
| 3 | 3300009147 | Ga0114129_10170392 | Ga0114129_101703922 | 228 |
| 4 | 3300046526 | Ga0495666_0059828 | Ga0495666_0059828_20_853 | 230 |
| 5 | 3300005577 | Ga0068857_100203609 | Ga0068857_1002036092 | 232 |
| 6 | 3300009174 | Ga0105241_10101215 | Ga0105241_101012152 | 232 |
| 7 | 3300012477 | Ga0157336_1001002 | Ga0157336_10010022 | 232 |
| 8 | 3300009094 | Ga0111539_10253350 | Ga0111539_102533502 | 233 |
| 9 | 3300025942 | Ga0207689_10036515 | Ga0207689_100365153 | 234 |
| 10 | 3300048928 | Ga0496125_0188717 | Ga0496125_0188717_11_892 | 234 |
| 11 | 3300005290 | Ga0065712_10076134 | Ga0065712_100761343 | 235 |
| 12 | 3300005331 | Ga0070670_100020041 | Ga0070670_1000200413 | 235 |
| 13 | 3300005334 | Ga0068869_100104219 | Ga0068869_1001042192 | 235 |
| 14 | 3300005340 | Ga0070689_100191353 | Ga0070689_1001913531 | 235 |
| 15 | 3300005365 | Ga0070688_100040618 | Ga0070688_1000406182 | 235 |
| 16 | 3300005543 | Ga0070672_100086960 | Ga0070672_1000869603 | 235 |
| 17 | 3300005544 | Ga0070686_100163859 | Ga0070686_1001638592 | 235 |
| 18 | 3300005840 | Ga0068870_10080575 | Ga0068870_100805751 | 235 |
| 19 | 3300006881 | Ga0068865_100040866 | Ga0068865_1000408664 | 235 |
| 20 | 3300009553 | Ga0105249_10325947 | Ga0105249_103259472 | 235 |
| 21 | 3300025901 | Ga0207688_10002892 | Ga0207688_100028929 | 235 |
| 22 | 3300025903 | Ga0207680_10156667 | Ga0207680_101566672 | 235 |
| 23 | 3300025925 | Ga0207650_10430096 | Ga0207650_104300961 | 235 |
| 24 | 3300025926 | Ga0207659_10149167 | Ga0207659_101491671 | 235 |
| 25 | 3300025940 | Ga0207691_10014799 | Ga0207691_100147995 | 235 |
| 26 | 3300026075 | Ga0207708_10164477 | Ga0207708_101644772 | 235 |
| 27 | 3300046615 | Ga0495656_0037023 | Ga0495656_0037023_1083_1937 | 235 |
| 28 | 3300005841 | Ga0068863_100209675 | Ga0068863_1002096752 | 236 |
| 29 | 3300025972 | Ga0207668_10400750 | Ga0207668_104007502 | 236 |
| 30 | 3300014745 | Ga0157377_10084215 | Ga0157377_100842152 | 239 |
| 31 | 3300027876 | Ga0209974_10020612 | Ga0209974_100206122 | 239 |
| 32 | 3300009147 | Ga0114129_10038350 | Ga0114129_100383502 | 240 |
| 33 | 3300050507 | nmdc:mga05p37_19242_c1 | nmdc:mga05p37_19242_c1_1067_1921 | 240 |
| 34 | 3300005439 | Ga0070711_100116241 | Ga0070711_1001162412 | 244 |
| 35 | 3300025981 | Ga0207640_10302565 | Ga0207640_103025652 | 244 |
| 36 | 3300035083 | Ga0373926_0037056 | Ga0373926_0037056_814_1695 | 244 |
| 37 | 3300035088 | Ga0373940_0006960 | Ga0373940_0006960_324_1205 | 244 |
| 38 | 3300035170 | Ga0373943_0030064 | Ga0373943_0030064_912_1793 | 244 |
| 39 | 3300035172 | Ga0373955_0119222 | Ga0373955_0119222_214_1095 | 244 |
| 40 | 3300035692 | Ga0373935_0001406 | Ga0373935_0001406_5928_6809 | 244 |
| 41 | 3300035695 | Ga0373927_0003933 | Ga0373927_0003933_5160_6041 | 244 |
| 42 | 3300035725 | Ga0373947_0003263 | Ga0373947_0003263_5084_5965 | 244 |
| 43 | 3300037068 | Ga0373925_0017905 | Ga0373925_0017905_2699_3580 | 244 |
| 44 | 3300046459 | Ga0495629_0014941 | Ga0495629_0014941_4240_5121 | 244 |
| 45 | 3300046477 | Ga0495664_0001034 | Ga0495664_0001034_4995_5876 | 244 |
| 46 | 3300046514 | Ga0495618_0009681 | Ga0495618_0009681_2215_3096 | 244 |
| 47 | 3300046529 | Ga0495652_0018127 | Ga0495652_0018127_2928_3809 | 244 |
| 48 | 3300046533 | Ga0495640_0008356 | Ga0495640_0008356_3941_4822 | 244 |
| 49 | 3300046642 | Ga0495634_0018647 | Ga0495634_0018647_2201_3082 | 244 |
| 50 | 3300046663 | Ga0495635_0040366 | Ga0495635_0040366_1381_2262 | 244 |
| 51 | 3300046678 | Ga0495599_0054040 | Ga0495599_0054040_1106_1987 | 244 |
| 52 | 3300047319 | Ga0495674_0003621 | Ga0495674_0003621_12996_13877 | 244 |
| 53 | 3300047322 | Ga0495680_0041682 | Ga0495680_0041682_301_1182 | 244 |
| 54 | 3300047673 | Ga0495593_0080666 | Ga0495593_0080666_746_1627 | 244 |
| 55 | 3300053077 | Ga0495601_0000489 | Ga0495601_0000489_9338_10219 | 244 |
| 56 | 3300053078 | Ga0495612_0003322 | Ga0495612_0003322_701_1582 | 244 |
| 57 | 3300053084 | Ga0495595_0185451 | Ga0495595_0185451_27_908 | 244 |
| 58 | 3300053085 | Ga0495619_0000918 | Ga0495619_0000918_7142_8023 | 244 |
| 59 | 3300026116 | Ga0207674_10109359 | Ga0207674_101093593 | 246 |
| 60 | 3300035083 | Ga0373926_0029833 | Ga0373926_0029833_1023_1904 | 246 |
| 61 | 3300035116 | Ga0373945_0016385 | Ga0373945_0016385_88_969 | 246 |
| 62 | 3300035695 | Ga0373927_0005396 | Ga0373927_0005396_2745_3626 | 246 |
| 63 | 3300035725 | Ga0373947_0002425 | Ga0373947_0002425_3269_4150 | 246 |
| 64 | 3300046455 | Ga0495603_0005454 | Ga0495603_0005454_5426_6307 | 246 |
| 65 | 3300046459 | Ga0495629_0001360 | Ga0495629_0001360_8371_9252 | 246 |
| 66 | 3300046461 | Ga0495641_0017298 | Ga0495641_0017298_553_1434 | 246 |
| 67 | 3300046473 | Ga0495582_0027436 | Ga0495582_0027436_1362_2243 | 246 |
| 68 | 3300046499 | Ga0495594_0005195 | Ga0495594_0005195_2351_3232 | 246 |
| 69 | 3300046681 | Ga0495647_0001487 | Ga0495647_0001487_3603_4484 | 246 |
| 70 | 3300046683 | Ga0495658_0001084 | Ga0495658_0001084_7880_8761 | 246 |
| 71 | 3300046689 | Ga0495613_0005417 | Ga0495613_0005417_6726_7607 | 246 |
| 72 | 3300047321 | Ga0495676_0007996 | Ga0495676_0007996_3249_4130 | 246 |
| 73 | 3300047322 | Ga0495680_0055426 | Ga0495680_0055426_1773_2654 | 246 |
| 74 | 3300047673 | Ga0495593_0007998 | Ga0495593_0007998_4429_5310 | 246 |
| 75 | 3300053085 | Ga0495619_0007637 | Ga0495619_0007637_3984_4865 | 246 |
| 76 | 3300025931 | Ga0207644_10062623 | Ga0207644_100626233 | 247 |
| 77 | 3300006175 | Ga0070712_100154823 | Ga0070712_1001548232 | 248 |
| 78 | 3300007265 | Ga0099794_10000524 | Ga0099794_100005242 | 248 |
| 79 | 3300009094 | Ga0111539_10015670 | Ga0111539_100156707 | 248 |
| 80 | 3300025910 | Ga0207684_10132634 | Ga0207684_101326342 | 248 |
| 81 | 3300025915 | Ga0207693_10019706 | Ga0207693_100197064 | 248 |
| 82 | 3300025922 | Ga0207646_10310692 | Ga0207646_103106922 | 248 |
| 83 | 3300025928 | Ga0207700_10275792 | Ga0207700_102757922 | 248 |
| 84 | 3300027671 | Ga0209588_1021054 | Ga0209588_10210542 | 248 |
| 85 | 3300027907 | Ga0207428_10000618 | Ga0207428_100006186 | 248 |
| 86 | 3300039447 | Ga0436361_0100673 | Ga0436361_0100673_9823_10707 | 248 |
| 87 | 3300039453 | Ga0436362_0192500 | Ga0436362_0192500_276_1160 | 248 |
| 88 | 3300048913 | Ga0496110_0061092 | Ga0496110_0061092_645_1529 | 248 |
| 89 | 3300048914 | Ga0496111_0173165 | Ga0496111_0173165_553_1437 | 248 |
| 90 | 3300050511 | nmdc:mga08y16_262197_c1 | nmdc:mga08y16_262197_c1_479_1351 | 248 |
| 91 | 3300050515 | nmdc:mga0a205_437363_c1 | nmdc:mga0a205_437363_c1_125_1009 | 248 |
| 92 | 3300035171 | Ga0373946_0031099 | Ga0373946_0031099_304_1185 | 249 |
| 93 | 3300050515 | nmdc:mga0a205_67829_c1 | nmdc:mga0a205_67829_c1_394_1185 | 249 |
| 94 | 3300005328 | Ga0070676_10038120 | Ga0070676_100381203 | 250 |
| 95 | 3300005331 | Ga0070670_100106383 | Ga0070670_1001063832 | 250 |
| 96 | 3300005434 | Ga0070709_10003717 | Ga0070709_100037173 | 250 |
| 97 | 3300005435 | Ga0070714_100027177 | Ga0070714_1000271775 | 250 |
| 98 | 3300005436 | Ga0070713_100004110 | Ga0070713_1000041108 | 250 |
| 99 | 3300005437 | Ga0070710_10009433 | Ga0070710_100094332 | 250 |
| 100 | 3300005466 | Ga0070685_10051277 | Ga0070685_100512772 | 250 |
| 101 | 3300005535 | Ga0070684_100196582 | Ga0070684_1001965822 | 250 |
| 102 | 3300005618 | Ga0068864_100103511 | Ga0068864_1001035112 | 250 |
| 103 | 3300005834 | Ga0068851_10098544 | Ga0068851_100985442 | 250 |
| 104 | 3300005841 | Ga0068863_100221703 | Ga0068863_1002217032 | 250 |
| 105 | 3300005843 | Ga0068860_100059707 | Ga0068860_1000597072 | 250 |
| 106 | 3300006028 | Ga0070717_10002524 | Ga0070717_100025249 | 250 |
| 107 | 3300006163 | Ga0070715_10014381 | Ga0070715_100143812 | 250 |
| 108 | 3300006358 | Ga0068871_100066365 | Ga0068871_1000663652 | 250 |
| 109 | 3300006846 | Ga0075430_100106543 | Ga0075430_1001065433 | 250 |
| 110 | 3300006847 | Ga0075431_100055227 | Ga0075431_1000552275 | 250 |
| 111 | 3300006880 | Ga0075429_100077270 | Ga0075429_1000772702 | 250 |
| 112 | 3300009176 | Ga0105242_10042947 | Ga0105242_100429472 | 250 |
| 113 | 3300009551 | Ga0105238_10026812 | Ga0105238_100268127 | 250 |
| 114 | 3300013306 | Ga0163162_10443461 | Ga0163162_104434611 | 250 |
| 115 | 3300014968 | Ga0157379_10121826 | Ga0157379_101218261 | 250 |
| 116 | 3300050508 | nmdc:mga09592_81234_c1 | nmdc:mga09592_81234_c1_1273_2127 | 250 |
| 117 | 3300050509 | nmdc:mga0qj67_6794_c1 | nmdc:mga0qj67_6794_c1_1050_1904 | 250 |
| 118 | 3300050510 | nmdc:mga06r32_9128_c1 | nmdc:mga06r32_9128_c1_1620_2474 | 250 |
| 119 | 3300005347 | Ga0070668_100110689 | Ga0070668_1001106893 | 251 |
| 120 | 3300005440 | Ga0070705_100240835 | Ga0070705_1002408352 | 251 |
| 121 | 3300005441 | Ga0070700_100080640 | Ga0070700_1000806402 | 251 |
| 122 | 3300009011 | Ga0105251_10069951 | Ga0105251_100699512 | 251 |
| 123 | 3300009101 | Ga0105247_10143347 | Ga0105247_101433472 | 251 |
| 124 | 3300025901 | Ga0207688_10004006 | Ga0207688_100040067 | 251 |
| 125 | 3300017792 | Ga0163161_10032774 | Ga0163161_100327742 | 252 |
| 126 | 3300025898 | Ga0207692_10004754 | Ga0207692_100047542 | 252 |
| 127 | 3300025900 | Ga0207710_10009032 | Ga0207710_100090322 | 252 |
| 128 | 3300025905 | Ga0207685_10016102 | Ga0207685_100161022 | 252 |
| 129 | 3300025906 | Ga0207699_10001254 | Ga0207699_100012549 | 252 |
| 130 | 3300025914 | Ga0207671_10124734 | Ga0207671_101247342 | 252 |
| 131 | 3300025915 | Ga0207693_10033262 | Ga0207693_100332623 | 252 |
| 132 | 3300025916 | Ga0207663_10070063 | Ga0207663_100700633 | 252 |
| 133 | 3300025928 | Ga0207700_10001346 | Ga0207700_100013468 | 252 |
| 134 | 3300025931 | Ga0207644_10012365 | Ga0207644_100123652 | 252 |
| 135 | 3300025972 | Ga0207668_10071273 | Ga0207668_100712732 | 252 |
| 136 | 3300025986 | Ga0207658_10049243 | Ga0207658_100492432 | 252 |
| 137 | 3300026078 | Ga0207702_10037988 | Ga0207702_100379885 | 252 |
| 138 | 3300026118 | Ga0207675_100068525 | Ga0207675_1000685254 | 252 |
| 139 | 3300026121 | Ga0207683_10039992 | Ga0207683_100399923 | 252 |
| 140 | 3300048903 | Ga0496100_0018910 | Ga0496100_0018910_607_1488 | 252 |
| 141 | 3300048904 | Ga0496101_0022121 | Ga0496101_0022121_2800_3681 | 252 |
| 142 | 3300048908 | Ga0496105_0071518 | Ga0496105_0071518_1731_2612 | 252 |
| 143 | 3300048909 | Ga0496106_0010418 | Ga0496106_0010418_4742_5623 | 252 |
| 144 | 3300048910 | Ga0496107_0049231 | Ga0496107_0049231_607_1488 | 252 |
| 145 | 3300048911 | Ga0496108_0084322 | Ga0496108_0084322_22_903 | 252 |
| 146 | 3300048912 | Ga0496109_0013309 | Ga0496109_0013309_3448_4329 | 252 |
| 147 | 3300048915 | Ga0496112_0125331 | Ga0496112_0125331_1603_2484 | 252 |
| 148 | 3300048917 | Ga0496114_0025657 | Ga0496114_0025657_255_1136 | 252 |
| 149 | 3300050509 | nmdc:mga0qj67_276337_c1 | nmdc:mga0qj67_276337_c1_245_1099 | 252 |
| 150 | 3300009147 | Ga0114129_10128515 | Ga0114129_101285152 | 253 |
| 151 | 3300050507 | nmdc:mga05p37_139679_c1 | nmdc:mga05p37_139679_c1_32_886 | 253 |
| 152 | 3300025922 | Ga0207646_10372346 | Ga0207646_103723462 | 254 |
| 153 | 3300026023 | Ga0207677_10450255 | Ga0207677_104502552 | 255 |
| 154 | 3300049586 | Ga0501070_0352593 | Ga0501070_0352593_198_1079 | 255 |
| 155 | 3300049823 | Ga0501044_0087165 | Ga0501044_0087165_640_1521 | 255 |
| 156 | 3300046531 | Ga0495665_0002324 | Ga0495665_0002324_8865_9746 | 256 |
| 157 | 3300049569 | Ga0501032_0164855 | Ga0501032_0164855_98_979 | 256 |
| 158 | 3300049571 | Ga0501034_0010326 | Ga0501034_0010326_2990_3871 | 256 |
| 159 | 3300049580 | Ga0501046_0139165 | Ga0501046_0139165_95_976 | 256 |
| 160 | 3300049586 | Ga0501070_0301098 | Ga0501070_0301098_152_1033 | 256 |
| 161 | 3300006038 | Ga0075365_10038394 | Ga0075365_100383943 | 258 |
| 162 | 3300013296 | Ga0157374_10018578 | Ga0157374_100185784 | 259 |
| 163 | 3300042436 | Ga0439435_0012266 | Ga0439435_0012266_117_971 | 259 |
| 164 | 3300053077 | Ga0495601_0011239 | Ga0495601_0011239_22_843 | 259 |
| 165 | 3300005843 | Ga0068860_100083470 | Ga0068860_1000834703 | 260 |
| 166 | 3300013297 | Ga0157378_10654492 | Ga0157378_106544922 | 260 |
| 167 | 3300025927 | Ga0207687_10020291 | Ga0207687_100202916 | 260 |
| 168 | 3300028381 | Ga0268264_10116220 | Ga0268264_101162202 | 260 |
| 169 | 3300048911 | Ga0496108_0013377 | Ga0496108_0013377_4874_5755 | 260 |
| 170 | 3300048916 | Ga0496113_0061886 | Ga0496113_0061886_393_1274 | 260 |
| 171 | 3300048918 | Ga0496115_0220930 | Ga0496115_0220930_14_838 | 260 |
| 172 | 3300006237 | Ga0097621_100342140 | Ga0097621_1003421402 | 261 |
| 173 | 3300006844 | Ga0075428_100023662 | Ga0075428_1000236624 | 261 |
| 174 | 3300036401 | Ga0373937_0492283 | Ga0373937_0492283_48_902 | 261 |
| 175 | 3300046459 | Ga0495629_0274364 | Ga0495629_0274364_41_895 | 261 |
| 176 | 3300046683 | Ga0495658_0216767 | Ga0495658_0216767_228_1082 | 261 |
| 177 | 3300048904 | Ga0496101_0000139 | Ga0496101_0000139_52537_53391 | 261 |
| 178 | 3300048907 | Ga0496104_0081014 | Ga0496104_0081014_61_915 | 261 |
| 179 | 3300048908 | Ga0496105_0028853 | Ga0496105_0028853_2511_3365 | 261 |
| 180 | 3300048910 | Ga0496107_0035694 | Ga0496107_0035694_249_1103 | 261 |
| 181 | 3300048917 | Ga0496114_0000302 | Ga0496114_0000302_12694_13548 | 261 |
| 182 | 3300005289 | Ga0065704_10152474 | Ga0065704_101524741 | 262 |
| 183 | 3300005295 | Ga0065707_10202224 | Ga0065707_102022241 | 262 |
| 184 | 3300025899 | Ga0207642_10044876 | Ga0207642_100448761 | 262 |
| 185 | 3300047315 | Ga0495581_0148930 | Ga0495581_0148930_27_902 | 262 |
| 186 | 3300026089 | Ga0207648_10008257 | Ga0207648_100082574 | 263 |
| 187 | 3300009147 | Ga0114129_10145803 | Ga0114129_101458033 | 264 |
| 188 | 3300050507 | nmdc:mga05p37_612563_c1 | nmdc:mga05p37_612563_c1_157_1011 | 264 |
| 189 | 3300005536 | Ga0070697_100050149 | Ga0070697_1000501493 | 265 |
| 190 | 3300005546 | Ga0070696_100070177 | Ga0070696_1000701772 | 265 |
| 191 | 3300009093 | Ga0105240_10061980 | Ga0105240_100619806 | 265 |
| 192 | 3300035113 | Ga0373936_0003385 | Ga0373936_0003385_3394_4275 | 265 |
| 193 | 3300035116 | Ga0373945_0023201 | Ga0373945_0023201_806_1687 | 265 |
| 194 | 3300035171 | Ga0373946_0001521 | Ga0373946_0001521_1728_2609 | 265 |
| 195 | 3300035410 | Ga0373924_0002712 | Ga0373924_0002712_2139_3020 | 265 |
| 196 | 3300035695 | Ga0373927_0036489 | Ga0373927_0036489_2037_2918 | 265 |
| 197 | 3300035725 | Ga0373947_0007599 | Ga0373947_0007599_524_1405 | 265 |
| 198 | 3300046452 | Ga0495617_014008 | Ga0495617_014008_1486_2367 | 265 |
| 199 | 3300046455 | Ga0495603_0145736 | Ga0495603_0145736_456_1337 | 265 |
| 200 | 3300046474 | Ga0495605_0129399 | Ga0495605_0129399_107_988 | 265 |
| 201 | 3300046475 | Ga0495639_0005083 | Ga0495639_0005083_3819_4700 | 265 |
| 202 | 3300046491 | Ga0495584_0010382 | Ga0495584_0010382_1369_2250 | 265 |
| 203 | 3300046492 | Ga0495585_0002702 | Ga0495585_0002702_4879_5760 | 265 |
| 204 | 3300046516 | Ga0495628_0064674 | Ga0495628_0064674_1346_2227 | 265 |
| 205 | 3300046523 | Ga0495644_0000510 | Ga0495644_0000510_7500_8381 | 265 |
| 206 | 3300046526 | Ga0495666_0004543 | Ga0495666_0004543_5333_6214 | 265 |
| 207 | 3300046557 | Ga0495622_0006380 | Ga0495622_0006380_329_1210 | 265 |
| 208 | 3300046559 | Ga0495667_0004324 | Ga0495667_0004324_3954_4835 | 265 |
| 209 | 3300046615 | Ga0495656_0000296 | Ga0495656_0000296_5938_6819 | 265 |
| 210 | 3300046648 | Ga0495611_0004254 | Ga0495611_0004254_964_1845 | 265 |
| 211 | 3300046663 | Ga0495635_0007226 | Ga0495635_0007226_6354_7235 | 265 |
| 212 | 3300046664 | Ga0495659_0002362 | Ga0495659_0002362_3692_4573 | 265 |
| 213 | 3300046674 | Ga0495588_0037901 | Ga0495588_0037901_1053_1934 | 265 |
| 214 | 3300046680 | Ga0495646_0015832 | Ga0495646_0015832_138_1019 | 265 |
| 215 | 3300046681 | Ga0495647_0044751 | Ga0495647_0044751_524_1405 | 265 |
| 216 | 3300046691 | Ga0495670_0003427 | Ga0495670_0003427_5512_6393 | 265 |
| 217 | 3300047315 | Ga0495581_0002122 | Ga0495581_0002122_8865_9746 | 265 |
| 218 | 3300047317 | Ga0495604_0216908 | Ga0495604_0216908_299_1180 | 265 |
| 219 | 3300047446 | Ga0495679_019109 | Ga0495679_019109_1519_2400 | 265 |
| 220 | 3300047471 | Ga0495684_0002702 | Ga0495684_0002702_12639_13520 | 265 |
| 221 | 3300048088 | Ga0495602_0078230 | Ga0495602_0078230_529_1410 | 265 |
| 222 | 3300035083 | Ga0373926_0006770 | Ga0373926_0006770_805_1686 | 266 |
| 223 | 3300046459 | Ga0495629_0026104 | Ga0495629_0026104_524_1405 | 266 |
| 224 | 3300046462 | Ga0495651_0016437 | Ga0495651_0016437_3766_4647 | 266 |
| 225 | 3300046514 | Ga0495618_0017145 | Ga0495618_0017145_460_1341 | 266 |
| 226 | 3300046529 | Ga0495652_0012180 | Ga0495652_0012180_5784_6665 | 266 |
| 227 | 3300046533 | Ga0495640_0021657 | Ga0495640_0021657_605_1486 | 266 |
| 228 | 3300046683 | Ga0495658_0019732 | Ga0495658_0019732_2374_3255 | 266 |
| 229 | 3300046690 | Ga0495624_0002012 | Ga0495624_0002012_14503_15384 | 266 |
| 230 | 3300047319 | Ga0495674_0025009 | Ga0495674_0025009_1724_2605 | 266 |
| 231 | 3300047322 | Ga0495680_0006335 | Ga0495680_0006335_948_1829 | 266 |
| 232 | 3300053084 | Ga0495595_0005839 | Ga0495595_0005839_524_1405 | 266 |
| 233 | 3300053085 | Ga0495619_0028393 | Ga0495619_0028393_1575_2456 | 266 |
| 234 | 3300013306 | Ga0163162_10119627 | Ga0163162_101196272 | 267 |
| 235 | 3300031548 | Ga0307408_100252836 | Ga0307408_1002528362 | 267 |
| 236 | 3300031901 | Ga0307406_10270176 | Ga0307406_102701762 | 267 |
| 237 | 3300031911 | Ga0307412_10163678 | Ga0307412_101636782 | 267 |
| 238 | 3300031995 | Ga0307409_100000528 | Ga0307409_1000005283 | 267 |
| 239 | 3300032002 | Ga0307416_100007106 | Ga0307416_1000071062 | 267 |
| 240 | 3300032126 | Ga0307415_100085227 | Ga0307415_1000852273 | 267 |
| 241 | 3300025926 | Ga0207659_10169865 | Ga0207659_101698652 | 268 |
| 242 | 3300049571 | Ga0501034_0000032 | Ga0501034_0000032_50969_51829 | 268 |
| 243 | 3300049744 | Ga0501083_0245162 | Ga0501083_0245162_181_1041 | 268 |
| 244 | 3300005437 | Ga0070710_10024133 | Ga0070710_100241332 | 269 |
| 245 | 3300005578 | Ga0068854_100008701 | Ga0068854_1000087017 | 269 |
| 246 | 3300006175 | Ga0070712_100001737 | Ga0070712_10000173713 | 269 |
| 247 | 3300025898 | Ga0207692_10004787 | Ga0207692_100047872 | 269 |
| 248 | 3300025915 | Ga0207693_10006308 | Ga0207693_100063083 | 269 |
| 249 | 3300025981 | Ga0207640_10146462 | Ga0207640_101464622 | 269 |
| 250 | 3300026067 | Ga0207678_10110386 | Ga0207678_101103862 | 269 |
| 251 | 3300044842 | Ga0466957_0323690 | Ga0466957_0323690_53_934 | 269 |
| 252 | 3300046455 | Ga0495603_0008659 | Ga0495603_0008659_2516_3397 | 269 |
| 253 | 3300002076 | JGI24749J21850_1008546 | JGI24749J21850_10085462 | 270 |
| 254 | 3300005293 | Ga0065715_10001776 | Ga0065715_100017766 | 270 |
| 255 | 3300005328 | Ga0070676_10078929 | Ga0070676_100789292 | 270 |
| 256 | 3300005330 | Ga0070690_100004954 | Ga0070690_1000049547 | 270 |
| 257 | 3300005333 | Ga0070677_10051262 | Ga0070677_100512622 | 270 |
| 258 | 3300005334 | Ga0068869_100009169 | Ga0068869_1000091693 | 270 |
| 259 | 3300005334 | Ga0068869_100065766 | Ga0068869_1000657663 | 270 |
| 260 | 3300005335 | Ga0070666_10042811 | Ga0070666_100428111 | 270 |
| 261 | 3300005335 | Ga0070666_10065004 | Ga0070666_100650043 | 270 |
| 262 | 3300005335 | Ga0070666_10185721 | Ga0070666_101857212 | 270 |
| 263 | 3300005336 | Ga0070680_100137540 | Ga0070680_1001375402 | 270 |
| 264 | 3300005338 | Ga0068868_100055287 | Ga0068868_1000552873 | 270 |
| 265 | 3300005344 | Ga0070661_100041809 | Ga0070661_1000418094 | 270 |
| 266 | 3300005353 | Ga0070669_100004359 | Ga0070669_1000043599 | 270 |
| 267 | 3300005353 | Ga0070669_100060846 | Ga0070669_1000608463 | 270 |
| 268 | 3300005354 | Ga0070675_100321944 | Ga0070675_1003219442 | 270 |
| 269 | 3300005355 | Ga0070671_100220413 | Ga0070671_1002204132 | 270 |
| 270 | 3300005356 | Ga0070674_100010572 | Ga0070674_1000105726 | 270 |
| 271 | 3300005356 | Ga0070674_100121181 | Ga0070674_1001211812 | 270 |
| 272 | 3300005365 | Ga0070688_100086126 | Ga0070688_1000861262 | 270 |
| 273 | 3300005366 | Ga0070659_100052852 | Ga0070659_1000528523 | 270 |
| 274 | 3300005367 | Ga0070667_100208915 | Ga0070667_1002089152 | 270 |
| 275 | 3300005456 | Ga0070678_100041389 | Ga0070678_1000413892 | 270 |
| 276 | 3300005456 | Ga0070678_100044465 | Ga0070678_1000444653 | 270 |
| 277 | 3300005457 | Ga0070662_100067780 | Ga0070662_1000677803 | 270 |
| 278 | 3300005459 | Ga0068867_100086002 | Ga0068867_1000860022 | 270 |
| 279 | 3300005466 | Ga0070685_10024707 | Ga0070685_100247071 | 270 |
| 280 | 3300005544 | Ga0070686_100002924 | Ga0070686_1000029241 | 270 |
| 281 | 3300005548 | Ga0070665_100003364 | Ga0070665_10000336414 | 270 |
| 282 | 3300005548 | Ga0070665_100301619 | Ga0070665_1003016192 | 270 |
| 283 | 3300005564 | Ga0070664_100250895 | Ga0070664_1002508951 | 270 |
| 284 | 3300005616 | Ga0068852_100209211 | Ga0068852_1002092112 | 270 |
| 285 | 3300005617 | Ga0068859_100176333 | Ga0068859_1001763333 | 270 |
| 286 | 3300005617 | Ga0068859_100661817 | Ga0068859_1006618171 | 270 |
| 287 | 3300005618 | Ga0068864_100076599 | Ga0068864_1000765992 | 270 |
| 288 | 3300005840 | Ga0068870_10005414 | Ga0068870_100054146 | 270 |
| 289 | 3300005840 | Ga0068870_10017388 | Ga0068870_100173884 | 270 |
| 290 | 3300005841 | Ga0068863_100035661 | Ga0068863_1000356614 | 270 |
| 291 | 3300005841 | Ga0068863_100412796 | Ga0068863_1004127962 | 270 |
| 292 | 3300005842 | Ga0068858_100009999 | Ga0068858_1000099993 | 270 |
| 293 | 3300005844 | Ga0068862_100129090 | Ga0068862_1001290903 | 270 |
| 294 | 3300006237 | Ga0097621_100126007 | Ga0097621_1001260071 | 270 |
| 295 | 3300006358 | Ga0068871_100002011 | Ga0068871_1000020115 | 270 |
| 296 | 3300006358 | Ga0068871_100134682 | Ga0068871_1001346822 | 270 |
| 297 | 3300006844 | Ga0075428_100000244 | Ga0075428_10000024412 | 270 |
| 298 | 3300006844 | Ga0075428_100106548 | Ga0075428_1001065482 | 270 |
| 299 | 3300006844 | Ga0075428_100136009 | Ga0075428_1001360092 | 270 |
| 300 | 3300006844 | Ga0075428_100192007 | Ga0075428_1001920072 | 270 |
| 301 | 3300006846 | Ga0075430_100000582 | Ga0075430_1000005827 | 270 |
| 302 | 3300006846 | Ga0075430_100062300 | Ga0075430_1000623002 | 270 |
| 303 | 3300006846 | Ga0075430_100105691 | Ga0075430_1001056912 | 270 |
| 304 | 3300006847 | Ga0075431_100001060 | Ga0075431_10000106012 | 270 |
| 305 | 3300006847 | Ga0075431_100096289 | Ga0075431_1000962893 | 270 |
| 306 | 3300006852 | Ga0075433_10000619 | Ga0075433_100006199 | 270 |
| 307 | 3300006852 | Ga0075433_10030597 | Ga0075433_100305974 | 270 |
| 308 | 3300006871 | Ga0075434_100004079 | Ga0075434_1000040796 | 270 |
| 309 | 3300006871 | Ga0075434_100017701 | Ga0075434_1000177014 | 270 |
| 310 | 3300006880 | Ga0075429_100002092 | Ga0075429_1000020928 | 270 |
| 311 | 3300006880 | Ga0075429_100075628 | Ga0075429_1000756283 | 270 |
| 312 | 3300006880 | Ga0075429_100346210 | Ga0075429_1003462102 | 270 |
| 313 | 3300006881 | Ga0068865_100010433 | Ga0068865_1000104332 | 270 |
| 314 | 3300006931 | Ga0097620_100176333 | Ga0097620_1001763333 | 270 |
| 315 | 3300006931 | Ga0097620_100661747 | Ga0097620_1006617471 | 270 |
| 316 | 3300007076 | Ga0075435_100060707 | Ga0075435_1000607073 | 270 |
| 317 | 3300009094 | Ga0111539_10031703 | Ga0111539_100317034 | 270 |
| 318 | 3300009094 | Ga0111539_10068805 | Ga0111539_100688054 | 270 |
| 319 | 3300009094 | Ga0111539_10111192 | Ga0111539_101111921 | 270 |
| 320 | 3300009101 | Ga0105247_10086596 | Ga0105247_100865963 | 270 |
| 321 | 3300009101 | Ga0105247_10411801 | Ga0105247_104118011 | 270 |
| 322 | 3300009147 | Ga0114129_10182472 | Ga0114129_101824722 | 270 |
| 323 | 3300009147 | Ga0114129_10182921 | Ga0114129_101829213 | 270 |
| 324 | 3300009147 | Ga0114129_10397129 | Ga0114129_103971292 | 270 |
| 325 | 3300009176 | Ga0105242_10043444 | Ga0105242_100434443 | 270 |
| 326 | 3300009176 | Ga0105242_10069220 | Ga0105242_100692202 | 270 |
| 327 | 3300009177 | Ga0105248_10024215 | Ga0105248_100242155 | 270 |
| 328 | 3300009177 | Ga0105248_10066106 | Ga0105248_100661064 | 270 |
| 329 | 3300009177 | Ga0105248_10316575 | Ga0105248_103165752 | 270 |
| 330 | 3300009553 | Ga0105249_10002139 | Ga0105249_1000213912 | 270 |
| 331 | 3300009553 | Ga0105249_10329397 | Ga0105249_103293972 | 270 |
| 332 | 3300011119 | Ga0105246_10024343 | Ga0105246_100243431 | 270 |
| 333 | 3300013306 | Ga0163162_10015033 | Ga0163162_100150332 | 270 |
| 334 | 3300014326 | Ga0157380_10092975 | Ga0157380_100929752 | 270 |
| 335 | 3300014326 | Ga0157380_10285891 | Ga0157380_102858912 | 270 |
| 336 | 3300014968 | Ga0157379_10030677 | Ga0157379_100306772 | 270 |
| 337 | 3300014968 | Ga0157379_10508921 | Ga0157379_105089212 | 270 |
| 338 | 3300014969 | Ga0157376_10064786 | Ga0157376_100647862 | 270 |
| 339 | 3300014969 | Ga0157376_10076025 | Ga0157376_100760251 | 270 |
| 340 | 3300025315 | Ga0207697_10002429 | Ga0207697_100024299 | 270 |
| 341 | 3300025893 | Ga0207682_10002055 | Ga0207682_100020552 | 270 |
| 342 | 3300025893 | Ga0207682_10012922 | Ga0207682_100129224 | 270 |
| 343 | 3300025899 | Ga0207642_10053452 | Ga0207642_100534522 | 270 |
| 344 | 3300025900 | Ga0207710_10129303 | Ga0207710_101293032 | 270 |
| 345 | 3300025903 | Ga0207680_10118308 | Ga0207680_101183082 | 270 |
| 346 | 3300025903 | Ga0207680_10231916 | Ga0207680_102319161 | 270 |
| 347 | 3300025903 | Ga0207680_10319584 | Ga0207680_103195842 | 270 |
| 348 | 3300025907 | Ga0207645_10004635 | Ga0207645_100046352 | 270 |
| 349 | 3300025908 | Ga0207643_10004233 | Ga0207643_100042337 | 270 |
| 350 | 3300025917 | Ga0207660_10110321 | Ga0207660_101103212 | 270 |
| 351 | 3300025923 | Ga0207681_10065445 | Ga0207681_100654451 | 270 |
| 352 | 3300025923 | Ga0207681_10112004 | Ga0207681_101120042 | 270 |
| 353 | 3300025926 | Ga0207659_10265039 | Ga0207659_102650392 | 270 |
| 354 | 3300025931 | Ga0207644_10240050 | Ga0207644_102400502 | 270 |
| 355 | 3300025933 | Ga0207706_10023556 | Ga0207706_100235563 | 270 |
| 356 | 3300025933 | Ga0207706_10303313 | Ga0207706_103033131 | 270 |
| 357 | 3300025934 | Ga0207686_10043987 | Ga0207686_100439871 | 270 |
| 358 | 3300025936 | Ga0207670_10033572 | Ga0207670_100335723 | 270 |
| 359 | 3300025937 | Ga0207669_10006797 | Ga0207669_100067976 | 270 |
| 360 | 3300025938 | Ga0207704_10098360 | Ga0207704_100983602 | 270 |
| 361 | 3300025941 | Ga0207711_10111731 | Ga0207711_101117313 | 270 |
| 362 | 3300025942 | Ga0207689_10002645 | Ga0207689_1000264513 | 270 |
| 363 | 3300025942 | Ga0207689_10036466 | Ga0207689_100364664 | 270 |
| 364 | 3300025960 | Ga0207651_10036110 | Ga0207651_100361102 | 270 |
| 365 | 3300025961 | Ga0207712_10014268 | Ga0207712_100142681 | 270 |
| 366 | 3300025972 | Ga0207668_10072923 | Ga0207668_100729232 | 270 |
| 367 | 3300025972 | Ga0207668_10131723 | Ga0207668_101317232 | 270 |
| 368 | 3300025986 | Ga0207658_10184189 | Ga0207658_101841892 | 270 |
| 369 | 3300026023 | Ga0207677_10390125 | Ga0207677_103901252 | 270 |
| 370 | 3300026023 | Ga0207677_10443960 | Ga0207677_104439601 | 270 |
| 371 | 3300026023 | Ga0207677_10635575 | Ga0207677_106355751 | 270 |
| 372 | 3300026035 | Ga0207703_10197611 | Ga0207703_101976111 | 270 |
| 373 | 3300026075 | Ga0207708_10009553 | Ga0207708_100095537 | 270 |
| 374 | 3300026088 | Ga0207641_10066656 | Ga0207641_100666563 | 270 |
| 375 | 3300026095 | Ga0207676_10182386 | Ga0207676_101823862 | 270 |
| 376 | 3300026121 | Ga0207683_10103293 | Ga0207683_101032933 | 270 |
| 377 | 3300027907 | Ga0207428_10002825 | Ga0207428_100028257 | 270 |
| 378 | 3300028379 | Ga0268266_10321543 | Ga0268266_103215431 | 270 |
| 379 | 3300028380 | Ga0268265_10160764 | Ga0268265_101607642 | 270 |
| 380 | 3300028380 | Ga0268265_10257308 | Ga0268265_102573082 | 270 |
| 381 | 3300028381 | Ga0268264_10168115 | Ga0268264_101681152 | 270 |
| 382 | 3300031548 | Ga0307408_100236869 | Ga0307408_1002368692 | 270 |
| 383 | 3300031731 | Ga0307405_10144213 | Ga0307405_101442131 | 270 |
| 384 | 3300031852 | Ga0307410_10098212 | Ga0307410_100982122 | 270 |
| 385 | 3300032002 | Ga0307416_100310363 | Ga0307416_1003103632 | 270 |
| 386 | 3300032126 | Ga0307415_100200038 | Ga0307415_1002000382 | 270 |
| 387 | 3300042436 | Ga0439435_0000980 | Ga0439435_0000980_1721_2575 | 270 |
| 388 | 3300045051 | Ga0451576_0102334 | Ga0451576_0102334_245_1099 | 270 |
| 389 | 3300048907 | Ga0496104_0038299 | Ga0496104_0038299_1913_2767 | 270 |
| 390 | 3300049572 | Ga0501036_0119007 | Ga0501036_0119007_448_1302 | 270 |
| 391 | 3300049573 | Ga0501037_0230003 | Ga0501037_0230003_303_1157 | 270 |
| 392 | 3300049574 | Ga0501038_0084930 | Ga0501038_0084930_772_1626 | 270 |
| 393 | 3300049576 | Ga0501040_0011176 | Ga0501040_0011176_666_1520 | 270 |
| 394 | 3300049576 | Ga0501040_0082719 | Ga0501040_0082719_291_1145 | 270 |
| 395 | 3300049578 | Ga0501042_0006967 | Ga0501042_0006967_68_922 | 270 |
| 396 | 3300049578 | Ga0501042_0327750 | Ga0501042_0327750_145_999 | 270 |
| 397 | 3300049584 | Ga0501068_0238973 | Ga0501068_0238973_20_874 | 270 |
| 398 | 3300049587 | Ga0501071_0004387 | Ga0501071_0004387_4121_4975 | 270 |
| 399 | 3300049588 | Ga0501072_0013202 | Ga0501072_0013202_2316_3170 | 270 |
| 400 | 3300049588 | Ga0501072_0030716 | Ga0501072_0030716_3046_3900 | 270 |
| 401 | 3300049591 | Ga0501075_0000528 | Ga0501075_0000528_20302_21156 | 270 |
| 402 | 3300049592 | Ga0501076_0000391 | Ga0501076_0000391_23322_24176 | 270 |
| 403 | 3300049741 | Ga0501079_0114129 | Ga0501079_0114129_1198_2052 | 270 |
| 404 | 3300049742 | Ga0501080_0193879 | Ga0501080_0193879_52_906 | 270 |
| 405 | 3300049743 | Ga0501081_0001914 | Ga0501081_0001914_6674_7528 | 270 |
| 406 | 3300049743 | Ga0501081_0035321 | Ga0501081_0035321_68_922 | 270 |
| 407 | 3300049824 | Ga0501045_0010164 | Ga0501045_0010164_4339_5193 | 270 |
| 408 | 3300049824 | Ga0501045_0093853 | Ga0501045_0093853_1354_2208 | 270 |
| 409 | 3300050507 | nmdc:mga05p37_150209_c1 | nmdc:mga05p37_150209_c1_832_1686 | 270 |
| 410 | 3300050507 | nmdc:mga05p37_335080_c1 | nmdc:mga05p37_335080_c1_772_1626 | 270 |
| 411 | 3300050508 | nmdc:mga09592_16225_c1 | nmdc:mga09592_16225_c1_983_1837 | 270 |
| 412 | 3300050508 | nmdc:mga09592_327286_c1 | nmdc:mga09592_327286_c1_287_1141 | 270 |
| 413 | 3300050508 | nmdc:mga09592_7590_c1 | nmdc:mga09592_7590_c1_7088_7942 | 270 |
| 414 | 3300050509 | nmdc:mga0qj67_160443_c1 | nmdc:mga0qj67_160443_c1_890_1744 | 270 |
| 415 | 3300050509 | nmdc:mga0qj67_68754_c1 | nmdc:mga0qj67_68754_c1_292_1146 | 270 |
| 416 | 3300050509 | nmdc:mga0qj67_800_c1 | nmdc:mga0qj67_800_c1_11626_12480 | 270 |
| 417 | 3300050510 | nmdc:mga06r32_117187_c1 | nmdc:mga06r32_117187_c1_1615_2469 | 270 |
| 418 | 3300050510 | nmdc:mga06r32_4226_c1 | nmdc:mga06r32_4226_c1_5530_6384 | 270 |
| 419 | 3300050511 | nmdc:mga08y16_137515_c1 | nmdc:mga08y16_137515_c1_1668_2522 | 270 |
| 420 | 3300050511 | nmdc:mga08y16_191454_c1 | nmdc:mga08y16_191454_c1_210_1064 | 270 |
| 421 | 3300050511 | nmdc:mga08y16_356917_c1 | nmdc:mga08y16_356917_c1_200_1054 | 270 |
| 422 | 3300050511 | nmdc:mga08y16_50496_c1 | nmdc:mga08y16_50496_c1_2523_3377 | 270 |
| 423 | 3300050512 | nmdc:mga0n895_16020_c1 | nmdc:mga0n895_16020_c1_3559_4413 | 270 |
| 424 | 3300050512 | nmdc:mga0n895_590_c1 | nmdc:mga0n895_590_c1_19955_20809 | 270 |
| 425 | 3300050513 | nmdc:mga0rr50_9580_c1 | nmdc:mga0rr50_9580_c1_1021_1875 | 270 |
| 426 | 3300050515 | nmdc:mga0a205_254_c1 | nmdc:mga0a205_254_c1_9707_10561 | 270 |
| 427 | 3300050515 | nmdc:mga0a205_5139_c1 | nmdc:mga0a205_5139_c1_4152_5006 | 270 |
| 428 | 3300054114 | Ga0501084_0011673 | Ga0501084_0011673_3344_4198 | 270 |
| 429 | 3300060353 | Ga0501082_0001012 | Ga0501082_0001012_10681_11535 | 270 |
| 430 | 3300061734 | Ga0530510_0001725 | Ga0530510_0001725_8430_9284 | 270 |
| 431 | 3300061734 | Ga0530510_0011633 | Ga0530510_0011633_2373_3227 | 270 |
| 432 | 3300061734 | Ga0530510_0411754 | Ga0530510_0411754_40_894 | 270 |
| 433 | 3300005355 | Ga0070671_100485053 | Ga0070671_1004850531 | 271 |
| 434 | 3300005337 | Ga0070682_100058339 | Ga0070682_1000583392 | 272 |
| 435 | 3300005355 | Ga0070671_100119489 | Ga0070671_1001194892 | 272 |
| 436 | 3300005842 | Ga0068858_100249737 | Ga0068858_1002497371 | 272 |
| 437 | 3300005843 | Ga0068860_100092944 | Ga0068860_1000929443 | 272 |
| 438 | 3300006358 | Ga0068871_100088464 | Ga0068871_1000884642 | 272 |
| 439 | 3300014969 | Ga0157376_10262362 | Ga0157376_102623622 | 272 |
| 440 | 3300025931 | Ga0207644_10095966 | Ga0207644_100959662 | 272 |
| 441 | 3300026035 | Ga0207703_10223286 | Ga0207703_102232862 | 272 |
| 442 | 3300028381 | Ga0268264_10076481 | Ga0268264_100764812 | 272 |
| 443 | 3300005328 | Ga0070676_10069034 | Ga0070676_100690342 | 274 |
| 444 | 3300005340 | Ga0070689_100120850 | Ga0070689_1001208502 | 274 |
| 445 | 3300005347 | Ga0070668_100022042 | Ga0070668_1000220426 | 274 |
| 446 | 3300005354 | Ga0070675_100222603 | Ga0070675_1002226032 | 274 |
| 447 | 3300005356 | Ga0070674_100012006 | Ga0070674_1000120062 | 274 |
| 448 | 3300005366 | Ga0070659_100051064 | Ga0070659_1000510642 | 274 |
| 449 | 3300005367 | Ga0070667_100234809 | Ga0070667_1002348092 | 274 |
| 450 | 3300005434 | Ga0070709_10007744 | Ga0070709_100077446 | 274 |
| 451 | 3300005435 | Ga0070714_100108194 | Ga0070714_1001081942 | 274 |
| 452 | 3300005436 | Ga0070713_100036719 | Ga0070713_1000367192 | 274 |
| 453 | 3300005439 | Ga0070711_100036310 | Ga0070711_1000363104 | 274 |
| 454 | 3300005439 | Ga0070711_100110807 | Ga0070711_1001108072 | 274 |
| 455 | 3300005455 | Ga0070663_100007370 | Ga0070663_1000073702 | 274 |
| 456 | 3300005456 | Ga0070678_100023471 | Ga0070678_1000234714 | 274 |
| 457 | 3300005530 | Ga0070679_100044872 | Ga0070679_1000448721 | 274 |
| 458 | 3300005530 | Ga0070679_100597948 | Ga0070679_1005979481 | 274 |
| 459 | 3300005535 | Ga0070684_100408354 | Ga0070684_1004083542 | 274 |
| 460 | 3300005548 | Ga0070665_100124409 | Ga0070665_1001244092 | 274 |
| 461 | 3300005548 | Ga0070665_100158932 | Ga0070665_1001589322 | 274 |
| 462 | 3300005718 | Ga0068866_10014236 | Ga0068866_100142362 | 274 |
| 463 | 3300005719 | Ga0068861_100089269 | Ga0068861_1000892692 | 274 |
| 464 | 3300005841 | Ga0068863_100374033 | Ga0068863_1003740332 | 274 |
| 465 | 3300005842 | Ga0068858_100318988 | Ga0068858_1003189882 | 274 |
| 466 | 3300005843 | Ga0068860_100728347 | Ga0068860_1007283471 | 274 |
| 467 | 3300005983 | Ga0081540_1003105 | Ga0081540_100310513 | 274 |
| 468 | 3300005983 | Ga0081540_1023500 | Ga0081540_10235002 | 274 |
| 469 | 3300006028 | Ga0070717_10012428 | Ga0070717_100124286 | 274 |
| 470 | 3300006163 | Ga0070715_10008284 | Ga0070715_100082842 | 274 |
| 471 | 3300006173 | Ga0070716_100042164 | Ga0070716_1000421642 | 274 |
| 472 | 3300006237 | Ga0097621_100187058 | Ga0097621_1001870582 | 274 |
| 473 | 3300006844 | Ga0075428_100756315 | Ga0075428_1007563151 | 274 |
| 474 | 3300006871 | Ga0075434_100091925 | Ga0075434_1000919254 | 274 |
| 475 | 3300007076 | Ga0075435_100170727 | Ga0075435_1001707272 | 274 |
| 476 | 3300009093 | Ga0105240_10268559 | Ga0105240_102685592 | 274 |
| 477 | 3300009101 | Ga0105247_10210022 | Ga0105247_102100222 | 274 |
| 478 | 3300009148 | Ga0105243_10030731 | Ga0105243_100307312 | 274 |
| 479 | 3300013105 | Ga0157369_10489916 | Ga0157369_104899162 | 274 |
| 480 | 3300013297 | Ga0157378_10066262 | Ga0157378_100662622 | 274 |
| 481 | 3300013306 | Ga0163162_10152076 | Ga0163162_101520762 | 274 |
| 482 | 3300013306 | Ga0163162_10536343 | Ga0163162_105363432 | 274 |
| 483 | 3300013308 | Ga0157375_10100905 | Ga0157375_101009052 | 274 |
| 484 | 3300014326 | Ga0157380_10012071 | Ga0157380_100120717 | 274 |
| 485 | 3300014968 | Ga0157379_10350427 | Ga0157379_103504272 | 274 |
| 486 | 3300014969 | Ga0157376_10140446 | Ga0157376_101404462 | 274 |
| 487 | 3300017792 | Ga0163161_10032991 | Ga0163161_100329913 | 274 |
| 488 | 3300025899 | Ga0207642_10008483 | Ga0207642_100084832 | 274 |
| 489 | 3300025900 | Ga0207710_10082403 | Ga0207710_100824032 | 274 |
| 490 | 3300025903 | Ga0207680_10122953 | Ga0207680_101229532 | 274 |
| 491 | 3300025918 | Ga0207662_10060614 | Ga0207662_100606142 | 274 |
| 492 | 3300025921 | Ga0207652_10036535 | Ga0207652_100365355 | 274 |
| 493 | 3300025921 | Ga0207652_10112556 | Ga0207652_101125563 | 274 |
| 494 | 3300025924 | Ga0207694_10107621 | Ga0207694_101076212 | 274 |
| 495 | 3300025926 | Ga0207659_10162446 | Ga0207659_101624462 | 274 |
| 496 | 3300025927 | Ga0207687_10320339 | Ga0207687_103203391 | 274 |
| 497 | 3300025928 | Ga0207700_10003896 | Ga0207700_100038966 | 274 |
| 498 | 3300025929 | Ga0207664_10021740 | Ga0207664_100217404 | 274 |
| 499 | 3300025932 | Ga0207690_10138669 | Ga0207690_101386692 | 274 |
| 500 | 3300025933 | Ga0207706_10002734 | Ga0207706_1000273411 | 274 |
| 501 | 3300025935 | Ga0207709_10033747 | Ga0207709_100337472 | 274 |
| 502 | 3300025939 | Ga0207665_10025953 | Ga0207665_100259533 | 274 |
| 503 | 3300025949 | Ga0207667_10138991 | Ga0207667_101389912 | 274 |
| 504 | 3300025972 | Ga0207668_10018130 | Ga0207668_100181303 | 274 |
| 505 | 3300026023 | Ga0207677_10065649 | Ga0207677_100656492 | 274 |
| 506 | 3300026035 | Ga0207703_10089906 | Ga0207703_100899062 | 274 |
| 507 | 3300026067 | Ga0207678_10001842 | Ga0207678_1000184214 | 274 |
| 508 | 3300026118 | Ga0207675_100001130 | Ga0207675_10000113027 | 274 |
| 509 | 3300026121 | Ga0207683_10051823 | Ga0207683_100518232 | 274 |
| 510 | 3300028379 | Ga0268266_10044601 | Ga0268266_100446013 | 274 |
| 511 | 3300028381 | Ga0268264_10234732 | Ga0268264_102347321 | 274 |
| 512 | 3300028794 | Ga0307515_10231400 | Ga0307515_102314002 | 274 |
| 513 | 3300030521 | Ga0307511_10115747 | Ga0307511_101157472 | 274 |
| 514 | 3300031507 | Ga0307509_10110955 | Ga0307509_101109552 | 274 |
| 515 | 3300032002 | Ga0307416_100311974 | Ga0307416_1003119742 | 274 |
| 516 | 3300039437 | Ga0436365_0731126 | Ga0436365_0731126_240_1121 | 274 |
| 517 | 3300046457 | Ga0495590_0046292 | Ga0495590_0046292_202_1083 | 274 |
| 518 | 3300046460 | Ga0495638_0016736 | Ga0495638_0016736_2287_3168 | 274 |
| 519 | 3300046474 | Ga0495605_0085743 | Ga0495605_0085743_474_1355 | 274 |
| 520 | 3300046492 | Ga0495585_0042158 | Ga0495585_0042158_43_924 | 274 |
| 521 | 3300046492 | Ga0495585_0072054 | Ga0495585_0072054_513_1394 | 274 |
| 522 | 3300046500 | Ga0495596_0049139 | Ga0495596_0049139_16_897 | 274 |
| 523 | 3300046500 | Ga0495596_0061973 | Ga0495596_0061973_53_934 | 274 |
| 524 | 3300046519 | Ga0495632_0031806 | Ga0495632_0031806_731_1612 | 274 |
| 525 | 3300046615 | Ga0495656_0007959 | Ga0495656_0007959_61_942 | 274 |
| 526 | 3300046616 | Ga0495668_0019264 | Ga0495668_0019264_400_1281 | 274 |
| 527 | 3300046684 | Ga0495669_0024557 | Ga0495669_0024557_1004_1885 | 274 |
| 528 | 3300046684 | Ga0495669_0173737 | Ga0495669_0173737_122_1003 | 274 |
| 529 | 3300046692 | Ga0495671_0077704 | Ga0495671_0077704_482_1363 | 274 |
| 530 | 3300046794 | Ga0495589_0092592 | Ga0495589_0092592_515_1396 | 274 |
| 531 | 3300047445 | Ga0495677_0027186 | Ga0495677_0027186_520_1401 | 274 |
| 532 | 3300047472 | Ga0495686_0121046 | Ga0495686_0121046_520_1401 | 274 |
| 533 | 3300048903 | Ga0496100_0022574 | Ga0496100_0022574_1450_2331 | 274 |
| 534 | 3300048905 | Ga0496102_0089486 | Ga0496102_0089486_492_1373 | 274 |
| 535 | 3300048905 | Ga0496102_0194395 | Ga0496102_0194395_661_1542 | 274 |
| 536 | 3300048910 | Ga0496107_0285265 | Ga0496107_0285265_61_942 | 274 |
| 537 | 3300048913 | Ga0496110_0094477 | Ga0496110_0094477_1235_2116 | 274 |
| 538 | 3300048924 | Ga0496121_0114438 | Ga0496121_0114438_181_1062 | 274 |
| 539 | 3300048929 | Ga0496126_0072057 | Ga0496126_0072057_1430_2311 | 274 |
| 540 | 3300049460 | Ga0495682_0048274 | Ga0495682_0048274_217_1098 | 274 |
| 541 | 3300050511 | nmdc:mga08y16_147897_c1 | nmdc:mga08y16_147897_c1_57_938 | 274 |
| 542 | 3300053092 | Ga0500583_0149936 | Ga0500583_0149936_45_926 | 274 |
| 543 | 3300053130 | Ga0500642_0019890 | Ga0500642_0019890_77_958 | 274 |
| 544 | 3300053134 | Ga0500658_0031645 | Ga0500658_0031645_775_1656 | 274 |
| 545 | 3300053137 | Ga0500561_0017452 | Ga0500561_0017452_314_1195 | 274 |
| 546 | 3300053150 | Ga0500603_051690 | Ga0500603_051690_91_972 | 274 |
| 547 | 3300053158 | Ga0500627_0060088 | Ga0500627_0060088_173_1054 | 274 |
| 548 | iso_pu_bacteria | 2513237139 | 2513876325 | 274 |
| 549 | 3300005336 | Ga0070680_100519073 | Ga0070680_1005190731 | 275 |
| 550 | 3300005614 | Ga0068856_100177795 | Ga0068856_1001777952 | 275 |
| 551 | 3300005983 | Ga0081540_1017499 | Ga0081540_10174993 | 275 |
| 552 | 3300006175 | Ga0070712_100297804 | Ga0070712_1002978042 | 275 |
| 553 | 3300009174 | Ga0105241_10067576 | Ga0105241_100675762 | 275 |
| 554 | 3300013307 | Ga0157372_10258347 | Ga0157372_102583472 | 275 |
| 555 | 3300025898 | Ga0207692_10096591 | Ga0207692_100965912 | 275 |
| 556 | 3300025911 | Ga0207654_10033105 | Ga0207654_100331052 | 275 |
| 557 | 3300025912 | Ga0207707_10489246 | Ga0207707_104892461 | 275 |
| 558 | 3300025915 | Ga0207693_10051854 | Ga0207693_100518544 | 275 |
| 559 | 3300049569 | Ga0501032_0022579 | Ga0501032_0022579_17_898 | 275 |
| 560 | 3300049571 | Ga0501034_0015121 | Ga0501034_0015121_460_1341 | 275 |
| 561 | 3300049579 | Ga0501043_0022339 | Ga0501043_0022339_1629_2510 | 275 |
| 562 | 3300049581 | Ga0501047_0000100 | Ga0501047_0000100_41452_42333 | 275 |
| 563 | 3300049582 | Ga0501048_0000083 | Ga0501048_0000083_40425_41306 | 275 |
| 564 | 3300049586 | Ga0501070_0009312 | Ga0501070_0009312_76_957 | 275 |
| 565 | 3300049589 | Ga0501073_0038845 | Ga0501073_0038845_973_1854 | 275 |
| 566 | 3300049590 | Ga0501074_0089797 | Ga0501074_0089797_228_1109 | 275 |
| 567 | 3300049742 | Ga0501080_0000030 | Ga0501080_0000030_46305_47186 | 275 |
| 568 | 3300049744 | Ga0501083_0002641 | Ga0501083_0002641_10983_11864 | 275 |
| 569 | 3300049823 | Ga0501044_0000587 | Ga0501044_0000587_27464_28345 | 275 |
| 570 | 3300050490 | nmdc:mga03n38_2690_c1 | nmdc:mga03n38_2690_c1_12_881 | 275 |
| 571 | iso_pu_bacteria | 8056681323 | 8056686183 | 275 |
| 572 | 3300035113 | Ga0373936_0028966 | Ga0373936_0028966_690_1571 | 276 |
| 573 | 3300053094 | Ga0500566_0006739 | Ga0500566_0006739_4874_5755 | 276 |
| 574 | 3300053102 | Ga0500554_022940 | Ga0500554_022940_649_1530 | 276 |
| 575 | 3300053119 | Ga0500595_000151 | Ga0500595_000151_10536_11417 | 276 |
| 576 | 3300053178 | Ga0500637_0001169 | Ga0500637_0001169_4875_5756 | 276 |
| 577 | 3300055283 | Ga0500661_000174 | Ga0500661_000174_3864_4745 | 276 |
| 578 | 3300003215 | JGI25153J46596_10000711 | JGI25153J46596_1000071112 | 277 |
| 579 | 3300006844 | Ga0075428_100002840 | Ga0075428_1000028405 | 277 |
| 580 | 3300006847 | Ga0075431_100001610 | Ga0075431_1000016105 | 277 |
| 581 | 3300006847 | Ga0075431_100058589 | Ga0075431_1000585895 | 277 |
| 582 | 3300006880 | Ga0075429_100002359 | Ga0075429_1000023592 | 277 |
| 583 | 3300009094 | Ga0111539_10003049 | Ga0111539_100030495 | 277 |
| 584 | 3300009147 | Ga0114129_10001163 | Ga0114129_100011635 | 277 |
| 585 | 3300009147 | Ga0114129_10016497 | Ga0114129_100164977 | 277 |
| 586 | 3300025297 | Ga0209758_1000373 | Ga0209758_100037344 | 277 |
| 587 | 3300025915 | Ga0207693_10093265 | Ga0207693_100932652 | 277 |
| 588 | 3300026089 | Ga0207648_10204586 | Ga0207648_102045861 | 277 |
| 589 | 3300027907 | Ga0207428_10005326 | Ga0207428_1000532612 | 277 |
| 590 | 3300037466 | Ga0395898_0017111 | Ga0395898_0017111_1968_2849 | 277 |
| 591 | 3300038443 | Ga0395901_0076535 | Ga0395901_0076535_1646_2527 | 277 |
| 592 | 3300046474 | Ga0495605_0040726 | Ga0495605_0040726_886_1767 | 277 |
| 593 | 3300046537 | Ga0495598_0007871 | Ga0495598_0007871_740_1621 | 277 |
| 594 | 3300050507 | nmdc:mga05p37_928_c1 | nmdc:mga05p37_928_c1_3314_4195 | 277 |
| 595 | 3300050508 | nmdc:mga09592_13720_c1 | nmdc:mga09592_13720_c1_5417_6298 | 277 |
| 596 | 3300050510 | nmdc:mga06r32_379315_c1 | nmdc:mga06r32_379315_c1_125_1006 | 277 |
| 597 | 3300050510 | nmdc:mga06r32_795_c1 | nmdc:mga06r32_795_c1_3294_4175 | 277 |
| 598 | 3300050511 | nmdc:mga08y16_2587_c1 | nmdc:mga08y16_2587_c1_14416_15297 | 277 |
| 599 | 3300005356 | Ga0070674_100271568 | Ga0070674_1002715682 | 278 |
| 600 | 3300005435 | Ga0070714_100055382 | Ga0070714_1000553823 | 278 |
| 601 | 3300005547 | Ga0070693_100088862 | Ga0070693_1000888622 | 278 |
| 602 | 3300006844 | Ga0075428_100168119 | Ga0075428_1001681193 | 278 |
| 603 | 3300006847 | Ga0075431_100159175 | Ga0075431_1001591752 | 278 |
| 604 | 3300006880 | Ga0075429_100049786 | Ga0075429_1000497862 | 278 |
| 605 | 3300009147 | Ga0114129_10019842 | Ga0114129_100198425 | 278 |
| 606 | 3300009147 | Ga0114129_10466053 | Ga0114129_104660532 | 278 |
| 607 | 3300009177 | Ga0105248_10032843 | Ga0105248_100328432 | 278 |
| 608 | 3300013104 | Ga0157370_10322076 | Ga0157370_103220762 | 278 |
| 609 | 3300014326 | Ga0157380_10087071 | Ga0157380_100870712 | 278 |
| 610 | 3300025909 | Ga0207705_10026102 | Ga0207705_100261022 | 278 |
| 611 | 3300025917 | Ga0207660_10266723 | Ga0207660_102667232 | 278 |
| 612 | 3300025929 | Ga0207664_10242666 | Ga0207664_102426662 | 278 |
| 613 | 3300025938 | Ga0207704_10076001 | Ga0207704_100760012 | 278 |
| 614 | 3300025940 | Ga0207691_10123539 | Ga0207691_101235392 | 278 |
| 615 | 3300025941 | Ga0207711_10153129 | Ga0207711_101531292 | 278 |
| 616 | 3300031247 | Ga0265340_10015435 | Ga0265340_100154353 | 278 |
| 617 | 3300031712 | Ga0265342_10058879 | Ga0265342_100588791 | 278 |
| 618 | 3300035242 | Ga0373962_0011114 | Ga0373962_0011114_647_1528 | 278 |
| 619 | 3300037312 | Ga0395899_0115555 | Ga0395899_0115555_649_1530 | 278 |
| 620 | 3300037418 | Ga0395900_0040758 | Ga0395900_0040758_2901_3782 | 278 |
| 621 | 3300037466 | Ga0395898_0107327 | Ga0395898_0107327_1676_2557 | 278 |
| 622 | 3300037471 | Ga0395905_0091441 | Ga0395905_0091441_1400_2281 | 278 |
| 623 | 3300048913 | Ga0496110_0266420 | Ga0496110_0266420_199_1080 | 278 |
| 624 | 3300050492 | nmdc:mga0yw44_37220_c1 | nmdc:mga0yw44_37220_c1_1376_2257 | 278 |
| 625 | 3300050507 | nmdc:mga05p37_88171_c1 | nmdc:mga05p37_88171_c1_1608_2489 | 278 |
| 626 | 3300050509 | nmdc:mga0qj67_131855_c1 | nmdc:mga0qj67_131855_c1_128_1021 | 278 |
| 627 | 3300002075 | JGI24738J21930_10012259 | JGI24738J21930_100122592 | 279 |
| 628 | 3300002459 | JGI24751J29686_10002801 | JGI24751J29686_100028013 | 279 |
| 629 | 3300003203 | JGI25406J46586_10000019 | JGI25406J46586_1000001953 | 279 |
| 630 | 3300003322 | rootL2_10036865 | rootL2_100368658 | 279 |
| 631 | 3300005327 | Ga0070658_10078278 | Ga0070658_100782782 | 279 |
| 632 | 3300005327 | Ga0070658_10170943 | Ga0070658_101709432 | 279 |
| 633 | 3300005327 | Ga0070658_10204275 | Ga0070658_102042752 | 279 |
| 634 | 3300005329 | Ga0070683_100315892 | Ga0070683_1003158922 | 279 |
| 635 | 3300005330 | Ga0070690_100018630 | Ga0070690_1000186304 | 279 |
| 636 | 3300005331 | Ga0070670_100087005 | Ga0070670_1000870052 | 279 |
| 637 | 3300005334 | Ga0068869_100000346 | Ga0068869_10000034611 | 279 |
| 638 | 3300005336 | Ga0070680_100040085 | Ga0070680_1000400852 | 279 |
| 639 | 3300005336 | Ga0070680_100199183 | Ga0070680_1001991832 | 279 |
| 640 | 3300005339 | Ga0070660_100003286 | Ga0070660_1000032862 | 279 |
| 641 | 3300005339 | Ga0070660_100081795 | Ga0070660_1000817952 | 279 |
| 642 | 3300005341 | Ga0070691_10023195 | Ga0070691_100231952 | 279 |
| 643 | 3300005344 | Ga0070661_100130576 | Ga0070661_1001305762 | 279 |
| 644 | 3300005344 | Ga0070661_100222353 | Ga0070661_1002223532 | 279 |
| 645 | 3300005344 | Ga0070661_100222369 | Ga0070661_1002223691 | 279 |
| 646 | 3300005347 | Ga0070668_100000210 | Ga0070668_10000021032 | 279 |
| 647 | 3300005353 | Ga0070669_100000370 | Ga0070669_1000003709 | 279 |
| 648 | 3300005356 | Ga0070674_100000760 | Ga0070674_1000007602 | 279 |
| 649 | 3300005364 | Ga0070673_100382113 | Ga0070673_1003821131 | 279 |
| 650 | 3300005366 | Ga0070659_100032761 | Ga0070659_1000327612 | 279 |
| 651 | 3300005367 | Ga0070667_100000294 | Ga0070667_10000029431 | 279 |
| 652 | 3300005434 | Ga0070709_10002615 | Ga0070709_100026159 | 279 |
| 653 | 3300005435 | Ga0070714_100105021 | Ga0070714_1001050213 | 279 |
| 654 | 3300005435 | Ga0070714_100376131 | Ga0070714_1003761311 | 279 |
| 655 | 3300005436 | Ga0070713_100001463 | Ga0070713_1000014634 | 279 |
| 656 | 3300005436 | Ga0070713_100141866 | Ga0070713_1001418662 | 279 |
| 657 | 3300005437 | Ga0070710_10024443 | Ga0070710_100244433 | 279 |
| 658 | 3300005438 | Ga0070701_10015036 | Ga0070701_100150363 | 279 |
| 659 | 3300005439 | Ga0070711_100007657 | Ga0070711_1000076576 | 279 |
| 660 | 3300005455 | Ga0070663_100005311 | Ga0070663_1000053117 | 279 |
| 661 | 3300005457 | Ga0070662_100037565 | Ga0070662_1000375654 | 279 |
| 662 | 3300005458 | Ga0070681_10217230 | Ga0070681_102172302 | 279 |
| 663 | 3300005458 | Ga0070681_10244749 | Ga0070681_102447492 | 279 |
| 664 | 3300005459 | Ga0068867_100000733 | Ga0068867_1000007339 | 279 |
| 665 | 3300005530 | Ga0070679_100187101 | Ga0070679_1001871012 | 279 |
| 666 | 3300005535 | Ga0070684_100024421 | Ga0070684_1000244214 | 279 |
| 667 | 3300005539 | Ga0068853_100046500 | Ga0068853_1000465002 | 279 |
| 668 | 3300005539 | Ga0068853_100248155 | Ga0068853_1002481552 | 279 |
| 669 | 3300005544 | Ga0070686_100079914 | Ga0070686_1000799142 | 279 |
| 670 | 3300005547 | Ga0070693_100066807 | Ga0070693_1000668072 | 279 |
| 671 | 3300005548 | Ga0070665_100044335 | Ga0070665_1000443352 | 279 |
| 672 | 3300005548 | Ga0070665_100047642 | Ga0070665_1000476425 | 279 |
| 673 | 3300005563 | Ga0068855_100055487 | Ga0068855_1000554875 | 279 |
| 674 | 3300005563 | Ga0068855_100247231 | Ga0068855_1002472312 | 279 |
| 675 | 3300005577 | Ga0068857_100004552 | Ga0068857_1000045523 | 279 |
| 676 | 3300005577 | Ga0068857_100094423 | Ga0068857_1000944232 | 279 |
| 677 | 3300005616 | Ga0068852_100010696 | Ga0068852_1000106968 | 279 |
| 678 | 3300005616 | Ga0068852_100183605 | Ga0068852_1001836052 | 279 |
| 679 | 3300005616 | Ga0068852_100368002 | Ga0068852_1003680022 | 279 |
| 680 | 3300005617 | Ga0068859_100003865 | Ga0068859_1000038653 | 279 |
| 681 | 3300005618 | Ga0068864_100038105 | Ga0068864_1000381052 | 279 |
| 682 | 3300005618 | Ga0068864_100155339 | Ga0068864_1001553392 | 279 |
| 683 | 3300005718 | Ga0068866_10003219 | Ga0068866_100032197 | 279 |
| 684 | 3300005719 | Ga0068861_100000398 | Ga0068861_1000003989 | 279 |
| 685 | 3300005719 | Ga0068861_100294129 | Ga0068861_1002941292 | 279 |
| 686 | 3300005841 | Ga0068863_100000638 | Ga0068863_10000063831 | 279 |
| 687 | 3300005842 | Ga0068858_100007648 | Ga0068858_1000076484 | 279 |
| 688 | 3300005842 | Ga0068858_100421150 | Ga0068858_1004211502 | 279 |
| 689 | 3300005843 | Ga0068860_100008930 | Ga0068860_1000089306 | 279 |
| 690 | 3300005937 | Ga0081455_10006120 | Ga0081455_100061202 | 279 |
| 691 | 3300005937 | Ga0081455_10012424 | Ga0081455_100124249 | 279 |
| 692 | 3300005937 | Ga0081455_10047972 | Ga0081455_100479722 | 279 |
| 693 | 3300005981 | Ga0081538_10096002 | Ga0081538_100960021 | 279 |
| 694 | 3300005983 | Ga0081540_1000008 | Ga0081540_1000008142 | 279 |
| 695 | 3300005983 | Ga0081540_1005076 | Ga0081540_10050767 | 279 |
| 696 | 3300005985 | Ga0081539_10000003 | Ga0081539_10000003222 | 279 |
| 697 | 3300006028 | Ga0070717_10031971 | Ga0070717_100319711 | 279 |
| 698 | 3300006028 | Ga0070717_10208411 | Ga0070717_102084112 | 279 |
| 699 | 3300006038 | Ga0075365_10017764 | Ga0075365_100177645 | 279 |
| 700 | 3300006038 | Ga0075365_10245986 | Ga0075365_102459862 | 279 |
| 701 | 3300006051 | Ga0075364_10114070 | Ga0075364_101140702 | 279 |
| 702 | 3300006058 | Ga0075432_10007333 | Ga0075432_100073332 | 279 |
| 703 | 3300006163 | Ga0070715_10014395 | Ga0070715_100143954 | 279 |
| 704 | 3300006173 | Ga0070716_100052846 | Ga0070716_1000528462 | 279 |
| 705 | 3300006175 | Ga0070712_100142422 | Ga0070712_1001424222 | 279 |
| 706 | 3300006186 | Ga0075369_10142926 | Ga0075369_101429261 | 279 |
| 707 | 3300006194 | Ga0075427_10000105 | Ga0075427_100001055 | 279 |
| 708 | 3300006237 | Ga0097621_100288817 | Ga0097621_1002888172 | 279 |
| 709 | 3300006844 | Ga0075428_100013853 | Ga0075428_1000138536 | 279 |
| 710 | 3300006844 | Ga0075428_100067864 | Ga0075428_1000678643 | 279 |
| 711 | 3300006844 | Ga0075428_100204891 | Ga0075428_1002048912 | 279 |
| 712 | 3300006844 | Ga0075428_100451071 | Ga0075428_1004510711 | 279 |
| 713 | 3300006846 | Ga0075430_100002360 | Ga0075430_10000236018 | 279 |
| 714 | 3300006847 | Ga0075431_100008071 | Ga0075431_1000080719 | 279 |
| 715 | 3300006852 | Ga0075433_10001774 | Ga0075433_100017745 | 279 |
| 716 | 3300006871 | Ga0075434_100004936 | Ga0075434_10000493610 | 279 |
| 717 | 3300006880 | Ga0075429_100001525 | Ga0075429_1000015259 | 279 |
| 718 | 3300006881 | Ga0068865_100000504 | Ga0068865_1000005046 | 279 |
| 719 | 3300006881 | Ga0068865_100233043 | Ga0068865_1002330432 | 279 |
| 720 | 3300006881 | Ga0068865_100321681 | Ga0068865_1003216811 | 279 |
| 721 | 3300006931 | Ga0097620_100003865 | Ga0097620_1000038653 | 279 |
| 722 | 3300007788 | Ga0099795_10043052 | Ga0099795_100430522 | 279 |
| 723 | 3300009093 | Ga0105240_10012684 | Ga0105240_100126846 | 279 |
| 724 | 3300009094 | Ga0111539_10007565 | Ga0111539_1000756511 | 279 |
| 725 | 3300009094 | Ga0111539_10046315 | Ga0111539_100463154 | 279 |
| 726 | 3300009094 | Ga0111539_10064679 | Ga0111539_100646793 | 279 |
| 727 | 3300009094 | Ga0111539_10125407 | Ga0111539_101254072 | 279 |
| 728 | 3300009094 | Ga0111539_10511063 | Ga0111539_105110631 | 279 |
| 729 | 3300009147 | Ga0114129_10032283 | Ga0114129_100322837 | 279 |
| 730 | 3300009147 | Ga0114129_10284554 | Ga0114129_102845542 | 279 |
| 731 | 3300009148 | Ga0105243_10001632 | Ga0105243_100016326 | 279 |
| 732 | 3300009148 | Ga0105243_10037473 | Ga0105243_100374734 | 279 |
| 733 | 3300009148 | Ga0105243_10201667 | Ga0105243_102016671 | 279 |
| 734 | 3300009176 | Ga0105242_10012556 | Ga0105242_100125561 | 279 |
| 735 | 3300009176 | Ga0105242_10061477 | Ga0105242_100614774 | 279 |
| 736 | 3300009176 | Ga0105242_10654619 | Ga0105242_106546192 | 279 |
| 737 | 3300009545 | Ga0105237_10004654 | Ga0105237_100046548 | 279 |
| 738 | 3300009545 | Ga0105237_10597590 | Ga0105237_105975901 | 279 |
| 739 | 3300009551 | Ga0105238_10004089 | Ga0105238_100040897 | 279 |
| 740 | 3300009551 | Ga0105238_10031549 | Ga0105238_100315496 | 279 |
| 741 | 3300009553 | Ga0105249_10009865 | Ga0105249_100098658 | 279 |
| 742 | 3300009553 | Ga0105249_10196045 | Ga0105249_101960452 | 279 |
| 743 | 3300010375 | Ga0105239_10097319 | Ga0105239_100973193 | 279 |
| 744 | 3300011119 | Ga0105246_10114805 | Ga0105246_101148052 | 279 |
| 745 | 3300013104 | Ga0157370_10021990 | Ga0157370_100219902 | 279 |
| 746 | 3300013104 | Ga0157370_10037071 | Ga0157370_100370712 | 279 |
| 747 | 3300013105 | Ga0157369_10004796 | Ga0157369_100047962 | 279 |
| 748 | 3300013105 | Ga0157369_10072617 | Ga0157369_100726172 | 279 |
| 749 | 3300013105 | Ga0157369_10356553 | Ga0157369_103565531 | 279 |
| 750 | 3300013306 | Ga0163162_11017046 | Ga0163162_110170461 | 279 |
| 751 | 3300013307 | Ga0157372_10018051 | Ga0157372_100180512 | 279 |
| 752 | 3300013307 | Ga0157372_10107300 | Ga0157372_101073002 | 279 |
| 753 | 3300013307 | Ga0157372_10330930 | Ga0157372_103309302 | 279 |
| 754 | 3300013308 | Ga0157375_10200132 | Ga0157375_102001322 | 279 |
| 755 | 3300013308 | Ga0157375_10286285 | Ga0157375_102862852 | 279 |
| 756 | 3300014325 | Ga0163163_10014193 | Ga0163163_100141932 | 279 |
| 757 | 3300014325 | Ga0163163_10056522 | Ga0163163_100565222 | 279 |
| 758 | 3300014325 | Ga0163163_10615495 | Ga0163163_106154952 | 279 |
| 759 | 3300014326 | Ga0157380_10002614 | Ga0157380_1000261410 | 279 |
| 760 | 3300025297 | Ga0209758_1023242 | Ga0209758_10232424 | 279 |
| 761 | 3300025315 | Ga0207697_10007292 | Ga0207697_100072925 | 279 |
| 762 | 3300025898 | Ga0207692_10151303 | Ga0207692_101513031 | 279 |
| 763 | 3300025900 | Ga0207710_10053662 | Ga0207710_100536622 | 279 |
| 764 | 3300025901 | Ga0207688_10143405 | Ga0207688_101434051 | 279 |
| 765 | 3300025903 | Ga0207680_10005944 | Ga0207680_100059442 | 279 |
| 766 | 3300025906 | Ga0207699_10024353 | Ga0207699_100243534 | 279 |
| 767 | 3300025906 | Ga0207699_10315940 | Ga0207699_103159401 | 279 |
| 768 | 3300025907 | Ga0207645_10006777 | Ga0207645_100067775 | 279 |
| 769 | 3300025907 | Ga0207645_10046861 | Ga0207645_100468612 | 279 |
| 770 | 3300025907 | Ga0207645_10324923 | Ga0207645_103249232 | 279 |
| 771 | 3300025909 | Ga0207705_10044247 | Ga0207705_100442474 | 279 |
| 772 | 3300025912 | Ga0207707_10215136 | Ga0207707_102151362 | 279 |
| 773 | 3300025912 | Ga0207707_10414085 | Ga0207707_104140851 | 279 |
| 774 | 3300025913 | Ga0207695_10160634 | Ga0207695_101606342 | 279 |
| 775 | 3300025913 | Ga0207695_10351999 | Ga0207695_103519992 | 279 |
| 776 | 3300025913 | Ga0207695_10414877 | Ga0207695_104148772 | 279 |
| 777 | 3300025913 | Ga0207695_10610617 | Ga0207695_106106171 | 279 |
| 778 | 3300025915 | Ga0207693_10004014 | Ga0207693_100040147 | 279 |
| 779 | 3300025916 | Ga0207663_10002097 | Ga0207663_100020979 | 279 |
| 780 | 3300025918 | Ga0207662_10037024 | Ga0207662_100370243 | 279 |
| 781 | 3300025919 | Ga0207657_10005846 | Ga0207657_100058468 | 279 |
| 782 | 3300025920 | Ga0207649_10242119 | Ga0207649_102421192 | 279 |
| 783 | 3300025921 | Ga0207652_10084286 | Ga0207652_100842862 | 279 |
| 784 | 3300025921 | Ga0207652_10162631 | Ga0207652_101626312 | 279 |
| 785 | 3300025923 | Ga0207681_10000420 | Ga0207681_1000042027 | 279 |
| 786 | 3300025923 | Ga0207681_10078532 | Ga0207681_100785322 | 279 |
| 787 | 3300025924 | Ga0207694_10082472 | Ga0207694_100824722 | 279 |
| 788 | 3300025925 | Ga0207650_10048613 | Ga0207650_100486132 | 279 |
| 789 | 3300025927 | Ga0207687_10042809 | Ga0207687_100428092 | 279 |
| 790 | 3300025928 | Ga0207700_10008355 | Ga0207700_100083556 | 279 |
| 791 | 3300025928 | Ga0207700_10138066 | Ga0207700_101380662 | 279 |
| 792 | 3300025929 | Ga0207664_10028334 | Ga0207664_100283344 | 279 |
| 793 | 3300025929 | Ga0207664_10604645 | Ga0207664_106046451 | 279 |
| 794 | 3300025933 | Ga0207706_10010909 | Ga0207706_100109092 | 279 |
| 795 | 3300025933 | Ga0207706_10012641 | Ga0207706_100126418 | 279 |
| 796 | 3300025934 | Ga0207686_10015040 | Ga0207686_100150405 | 279 |
| 797 | 3300025934 | Ga0207686_10097532 | Ga0207686_100975322 | 279 |
| 798 | 3300025935 | Ga0207709_10002614 | Ga0207709_100026148 | 279 |
| 799 | 3300025936 | Ga0207670_10053580 | Ga0207670_100535802 | 279 |
| 800 | 3300025936 | Ga0207670_10232701 | Ga0207670_102327012 | 279 |
| 801 | 3300025937 | Ga0207669_10002041 | Ga0207669_100020413 | 279 |
| 802 | 3300025937 | Ga0207669_10053543 | Ga0207669_100535433 | 279 |
| 803 | 3300025938 | Ga0207704_10028850 | Ga0207704_100288504 | 279 |
| 804 | 3300025941 | Ga0207711_10018835 | Ga0207711_100188352 | 279 |
| 805 | 3300025942 | Ga0207689_10005334 | Ga0207689_100053343 | 279 |
| 806 | 3300025944 | Ga0207661_10143539 | Ga0207661_101435391 | 279 |
| 807 | 3300025949 | Ga0207667_10072152 | Ga0207667_100721522 | 279 |
| 808 | 3300025960 | Ga0207651_10116405 | Ga0207651_101164052 | 279 |
| 809 | 3300025961 | Ga0207712_10002298 | Ga0207712_100022989 | 279 |
| 810 | 3300025972 | Ga0207668_10012133 | Ga0207668_100121334 | 279 |
| 811 | 3300025981 | Ga0207640_10145498 | Ga0207640_101454982 | 279 |
| 812 | 3300025986 | Ga0207658_10000212 | Ga0207658_1000021225 | 279 |
| 813 | 3300025986 | Ga0207658_10084714 | Ga0207658_100847142 | 279 |
| 814 | 3300026023 | Ga0207677_10010957 | Ga0207677_100109572 | 279 |
| 815 | 3300026035 | Ga0207703_10008468 | Ga0207703_100084689 | 279 |
| 816 | 3300026041 | Ga0207639_10019008 | Ga0207639_100190082 | 279 |
| 817 | 3300026041 | Ga0207639_10287161 | Ga0207639_102871612 | 279 |
| 818 | 3300026067 | Ga0207678_10011624 | Ga0207678_100116247 | 279 |
| 819 | 3300026067 | Ga0207678_10443642 | Ga0207678_104436422 | 279 |
| 820 | 3300026075 | Ga0207708_10093574 | Ga0207708_100935742 | 279 |
| 821 | 3300026088 | Ga0207641_10001060 | Ga0207641_1000106023 | 279 |
| 822 | 3300026088 | Ga0207641_10059943 | Ga0207641_100599434 | 279 |
| 823 | 3300026089 | Ga0207648_10012760 | Ga0207648_100127609 | 279 |
| 824 | 3300026089 | Ga0207648_10045089 | Ga0207648_100450893 | 279 |
| 825 | 3300026095 | Ga0207676_10032372 | Ga0207676_100323724 | 279 |
| 826 | 3300026095 | Ga0207676_10117611 | Ga0207676_101176112 | 279 |
| 827 | 3300026095 | Ga0207676_10182050 | Ga0207676_101820502 | 279 |
| 828 | 3300026116 | Ga0207674_10003900 | Ga0207674_1000390016 | 279 |
| 829 | 3300026118 | Ga0207675_100002876 | Ga0207675_10000287610 | 279 |
| 830 | 3300026118 | Ga0207675_100246021 | Ga0207675_1002460212 | 279 |
| 831 | 3300026121 | Ga0207683_10164940 | Ga0207683_101649402 | 279 |
| 832 | 3300026142 | Ga0207698_10097677 | Ga0207698_100976771 | 279 |
| 833 | 3300026142 | Ga0207698_10495866 | Ga0207698_104958661 | 279 |
| 834 | 3300027512 | Ga0209179_1011904 | Ga0209179_10119042 | 279 |
| 835 | 3300027866 | Ga0209813_10005178 | Ga0209813_100051781 | 279 |
| 836 | 3300027907 | Ga0207428_10000920 | Ga0207428_1000092024 | 279 |
| 837 | 3300027907 | Ga0207428_10067274 | Ga0207428_100672743 | 279 |
| 838 | 3300027907 | Ga0207428_10259916 | Ga0207428_102599162 | 279 |
| 839 | 3300028379 | Ga0268266_10001037 | Ga0268266_1000103733 | 279 |
| 840 | 3300028379 | Ga0268266_10118260 | Ga0268266_101182602 | 279 |
| 841 | 3300028380 | Ga0268265_10007719 | Ga0268265_100077198 | 279 |
| 842 | 3300028381 | Ga0268264_10001043 | Ga0268264_100010437 | 279 |
| 843 | 3300028381 | Ga0268264_10201501 | Ga0268264_102015012 | 279 |
| 844 | 3300028800 | Ga0265338_10255062 | Ga0265338_102550622 | 279 |
| 845 | 3300031548 | Ga0307408_100072743 | Ga0307408_1000727432 | 279 |
| 846 | 3300031711 | Ga0265314_10054838 | Ga0265314_100548381 | 279 |
| 847 | 3300031901 | Ga0307406_10036509 | Ga0307406_100365092 | 279 |
| 848 | 3300035083 | Ga0373926_0048917 | Ga0373926_0048917_47_928 | 279 |
| 849 | 3300035089 | Ga0373944_0076517 | Ga0373944_0076517_142_1023 | 279 |
| 850 | 3300035117 | Ga0373953_0030732 | Ga0373953_0030732_1046_1927 | 279 |
| 851 | 3300035118 | Ga0373954_0051215 | Ga0373954_0051215_271_1152 | 279 |
| 852 | 3300035171 | Ga0373946_0066571 | Ga0373946_0066571_96_977 | 279 |
| 853 | 3300035172 | Ga0373955_0031668 | Ga0373955_0031668_647_1528 | 279 |
| 854 | 3300035724 | Ga0373933_0021159 | Ga0373933_0021159_1391_2272 | 279 |
| 855 | 3300035724 | Ga0373933_0245769 | Ga0373933_0245769_88_969 | 279 |
| 856 | 3300035725 | Ga0373947_0001456 | Ga0373947_0001456_6051_6932 | 279 |
| 857 | 3300035725 | Ga0373947_0068416 | Ga0373947_0068416_49_930 | 279 |
| 858 | 3300036401 | Ga0373937_0447383 | Ga0373937_0447383_139_1020 | 279 |
| 859 | 3300037068 | Ga0373925_0017252 | Ga0373925_0017252_3176_4057 | 279 |
| 860 | 3300037068 | Ga0373925_0333701 | Ga0373925_0333701_147_1028 | 279 |
| 861 | 3300037418 | Ga0395900_0657009 | Ga0395900_0657009_66_947 | 279 |
| 862 | 3300041507 | Ga0451851_0622210 | Ga0451851_0622210_228_1109 | 279 |
| 863 | 3300044693 | Ga0466961_0092505 | Ga0466961_0092505_827_1708 | 279 |
| 864 | 3300044842 | Ga0466957_0002234 | Ga0466957_0002234_3269_4150 | 279 |
| 865 | 3300046454 | Ga0495592_0012664 | Ga0495592_0012664_3423_4304 | 279 |
| 866 | 3300046459 | Ga0495629_0051236 | Ga0495629_0051236_363_1244 | 279 |
| 867 | 3300046459 | Ga0495629_0290239 | Ga0495629_0290239_29_910 | 279 |
| 868 | 3300046462 | Ga0495651_0012806 | Ga0495651_0012806_1806_2687 | 279 |
| 869 | 3300046475 | Ga0495639_0073620 | Ga0495639_0073620_61_942 | 279 |
| 870 | 3300046476 | Ga0495662_0052717 | Ga0495662_0052717_413_1294 | 279 |
| 871 | 3300046477 | Ga0495664_0022730 | Ga0495664_0022730_2293_3174 | 279 |
| 872 | 3300046477 | Ga0495664_0023262 | Ga0495664_0023262_499_1380 | 279 |
| 873 | 3300046499 | Ga0495594_0038110 | Ga0495594_0038110_887_1768 | 279 |
| 874 | 3300046507 | Ga0495606_0000753 | Ga0495606_0000753_46024_46905 | 279 |
| 875 | 3300046511 | Ga0495608_0050053 | Ga0495608_0050053_1244_2125 | 279 |
| 876 | 3300046512 | Ga0495610_0052743 | Ga0495610_0052743_947_1828 | 279 |
| 877 | 3300046514 | Ga0495618_0005416 | Ga0495618_0005416_3674_4555 | 279 |
| 878 | 3300046529 | Ga0495652_0013306 | Ga0495652_0013306_6257_7138 | 279 |
| 879 | 3300046533 | Ga0495640_0016234 | Ga0495640_0016234_4081_4962 | 279 |
| 880 | 3300046533 | Ga0495640_0032820 | Ga0495640_0032820_1834_2715 | 279 |
| 881 | 3300046533 | Ga0495640_0048856 | Ga0495640_0048856_1444_2325 | 279 |
| 882 | 3300046535 | Ga0495586_0245654 | Ga0495586_0245654_90_971 | 279 |
| 883 | 3300046543 | Ga0495645_0053978 | Ga0495645_0053978_1203_2084 | 279 |
| 884 | 3300046558 | Ga0495633_0088933 | Ga0495633_0088933_508_1389 | 279 |
| 885 | 3300046559 | Ga0495667_0058318 | Ga0495667_0058318_1191_2072 | 279 |
| 886 | 3300046559 | Ga0495667_0116614 | Ga0495667_0116614_699_1580 | 279 |
| 887 | 3300046616 | Ga0495668_0176715 | Ga0495668_0176715_172_1053 | 279 |
| 888 | 3300046642 | Ga0495634_0007278 | Ga0495634_0007278_2967_3848 | 279 |
| 889 | 3300046663 | Ga0495635_0089010 | Ga0495635_0089010_700_1581 | 279 |
| 890 | 3300046678 | Ga0495599_0020720 | Ga0495599_0020720_638_1519 | 279 |
| 891 | 3300046679 | Ga0495623_0081074 | Ga0495623_0081074_1096_1977 | 279 |
| 892 | 3300046680 | Ga0495646_0010909 | Ga0495646_0010909_1128_2009 | 279 |
| 893 | 3300046681 | Ga0495647_0035432 | Ga0495647_0035432_707_1588 | 279 |
| 894 | 3300046689 | Ga0495613_0248653 | Ga0495613_0248653_334_1215 | 279 |
| 895 | 3300046692 | Ga0495671_0074954 | Ga0495671_0074954_399_1280 | 279 |
| 896 | 3300046794 | Ga0495589_0106405 | Ga0495589_0106405_28_909 | 279 |
| 897 | 3300046809 | Ga0495600_0069402 | Ga0495600_0069402_958_1839 | 279 |
| 898 | 3300047319 | Ga0495674_0025024 | Ga0495674_0025024_1780_2661 | 279 |
| 899 | 3300047319 | Ga0495674_0037448 | Ga0495674_0037448_549_1430 | 279 |
| 900 | 3300047320 | Ga0495672_0018735 | Ga0495672_0018735_362_1243 | 279 |
| 901 | 3300047320 | Ga0495672_0056188 | Ga0495672_0056188_358_1239 | 279 |
| 902 | 3300047321 | Ga0495676_0156369 | Ga0495676_0156369_76_957 | 279 |
| 903 | 3300047444 | Ga0495675_0031629 | Ga0495675_0031629_1034_1915 | 279 |
| 904 | 3300047471 | Ga0495684_0044442 | Ga0495684_0044442_725_1606 | 279 |
| 905 | 3300047471 | Ga0495684_0095324 | Ga0495684_0095324_266_1147 | 279 |
| 906 | 3300047472 | Ga0495686_0201318 | Ga0495686_0201318_225_1106 | 279 |
| 907 | 3300047673 | Ga0495593_0163728 | Ga0495593_0163728_54_935 | 279 |
| 908 | 3300048903 | Ga0496100_0265393 | Ga0496100_0265393_234_1115 | 279 |
| 909 | 3300048904 | Ga0496101_0013918 | Ga0496101_0013918_3882_4763 | 279 |
| 910 | 3300048905 | Ga0496102_0006168 | Ga0496102_0006168_1226_2107 | 279 |
| 911 | 3300048905 | Ga0496102_0167897 | Ga0496102_0167897_534_1415 | 279 |
| 912 | 3300048905 | Ga0496102_0183714 | Ga0496102_0183714_864_1745 | 279 |
| 913 | 3300048905 | Ga0496102_0325901 | Ga0496102_0325901_274_1155 | 279 |
| 914 | 3300048905 | Ga0496102_0579705 | Ga0496102_0579705_41_922 | 279 |
| 915 | 3300048906 | Ga0496103_0244019 | Ga0496103_0244019_98_979 | 279 |
| 916 | 3300048907 | Ga0496104_0004028 | Ga0496104_0004028_6820_7701 | 279 |
| 917 | 3300048907 | Ga0496104_0133112 | Ga0496104_0133112_853_1734 | 279 |
| 918 | 3300048907 | Ga0496104_0289065 | Ga0496104_0289065_639_1520 | 279 |
| 919 | 3300048908 | Ga0496105_0017587 | Ga0496105_0017587_2849_3730 | 279 |
| 920 | 3300048908 | Ga0496105_0054150 | Ga0496105_0054150_421_1302 | 279 |
| 921 | 3300048908 | Ga0496105_0173044 | Ga0496105_0173044_250_1131 | 279 |
| 922 | 3300048909 | Ga0496106_0101339 | Ga0496106_0101339_662_1543 | 279 |
| 923 | 3300048909 | Ga0496106_0102701 | Ga0496106_0102701_593_1474 | 279 |
| 924 | 3300048910 | Ga0496107_0061329 | Ga0496107_0061329_418_1299 | 279 |
| 925 | 3300048911 | Ga0496108_0053569 | Ga0496108_0053569_802_1683 | 279 |
| 926 | 3300048911 | Ga0496108_0184333 | Ga0496108_0184333_491_1372 | 279 |
| 927 | 3300048912 | Ga0496109_0003355 | Ga0496109_0003355_11980_12861 | 279 |
| 928 | 3300048912 | Ga0496109_0006466 | Ga0496109_0006466_8399_9280 | 279 |
| 929 | 3300048912 | Ga0496109_0133766 | Ga0496109_0133766_942_1823 | 279 |
| 930 | 3300048913 | Ga0496110_0029303 | Ga0496110_0029303_1750_2631 | 279 |
| 931 | 3300048913 | Ga0496110_0046287 | Ga0496110_0046287_2182_3063 | 279 |
| 932 | 3300048913 | Ga0496110_0050288 | Ga0496110_0050288_2240_3121 | 279 |
| 933 | 3300048913 | Ga0496110_0186778 | Ga0496110_0186778_96_977 | 279 |
| 934 | 3300048913 | Ga0496110_0395143 | Ga0496110_0395143_32_913 | 279 |
| 935 | 3300048913 | Ga0496110_0633882 | Ga0496110_0633882_19_900 | 279 |
| 936 | 3300048914 | Ga0496111_0027590 | Ga0496111_0027590_3123_4004 | 279 |
| 937 | 3300048914 | Ga0496111_0048931 | Ga0496111_0048931_435_1316 | 279 |
| 938 | 3300048915 | Ga0496112_0000039 | Ga0496112_0000039_17853_18734 | 279 |
| 939 | 3300048915 | Ga0496112_0005830 | Ga0496112_0005830_244_1125 | 279 |
| 940 | 3300048915 | Ga0496112_0011666 | Ga0496112_0011666_2035_2916 | 279 |
| 941 | 3300048915 | Ga0496112_0102285 | Ga0496112_0102285_1317_2198 | 279 |
| 942 | 3300048916 | Ga0496113_0008638 | Ga0496113_0008638_638_1519 | 279 |
| 943 | 3300048916 | Ga0496113_0075442 | Ga0496113_0075442_712_1593 | 279 |
| 944 | 3300048916 | Ga0496113_0143458 | Ga0496113_0143458_965_1846 | 279 |
| 945 | 3300048916 | Ga0496113_0259607 | Ga0496113_0259607_372_1253 | 279 |
| 946 | 3300048917 | Ga0496114_0152975 | Ga0496114_0152975_669_1550 | 279 |
| 947 | 3300048918 | Ga0496115_0053257 | Ga0496115_0053257_69_950 | 279 |
| 948 | 3300048918 | Ga0496115_0150511 | Ga0496115_0150511_1009_1890 | 279 |
| 949 | 3300048924 | Ga0496121_0001073 | Ga0496121_0001073_28894_29775 | 279 |
| 950 | 3300048928 | Ga0496125_0000487 | Ga0496125_0000487_46359_47240 | 279 |
| 951 | 3300050492 | nmdc:mga0yw44_125239_c1 | nmdc:mga0yw44_125239_c1_505_1386 | 279 |
| 952 | 3300050492 | nmdc:mga0yw44_1925_c1 | nmdc:mga0yw44_1925_c1_761_1642 | 279 |
| 953 | 3300050492 | nmdc:mga0yw44_64664_c1 | nmdc:mga0yw44_64664_c1_98_979 | 279 |
| 954 | 3300050494 | nmdc:mga06z11_59921_c1 | nmdc:mga06z11_59921_c1_743_1624 | 279 |
| 955 | 3300050507 | nmdc:mga05p37_28900_c1 | nmdc:mga05p37_28900_c1_5176_6057 | 279 |
| 956 | 3300050507 | nmdc:mga05p37_31225_c1 | nmdc:mga05p37_31225_c1_1073_1954 | 279 |
| 957 | 3300050507 | nmdc:mga05p37_8481_c1 | nmdc:mga05p37_8481_c1_5403_6284 | 279 |
| 958 | 3300050508 | nmdc:mga09592_2676_c1 | nmdc:mga09592_2676_c1_7277_8158 | 279 |
| 959 | 3300050509 | nmdc:mga0qj67_2917_c1 | nmdc:mga0qj67_2917_c1_2740_3621 | 279 |
| 960 | 3300050510 | nmdc:mga06r32_3325_c1 | nmdc:mga06r32_3325_c1_6252_7133 | 279 |
| 961 | 3300050511 | nmdc:mga08y16_13516_c1 | nmdc:mga08y16_13516_c1_3870_4751 | 279 |
| 962 | 3300050511 | nmdc:mga08y16_185410_c1 | nmdc:mga08y16_185410_c1_40_933 | 279 |
| 963 | 3300050512 | nmdc:mga0n895_2399_c1 | nmdc:mga0n895_2399_c1_9354_10235 | 279 |
| 964 | 3300050513 | nmdc:mga0rr50_6545_c1 | nmdc:mga0rr50_6545_c1_2461_3342 | 279 |
| 965 | 3300050514 | nmdc:mga08x19_280107_c1 | nmdc:mga08x19_280107_c1_125_1006 | 279 |
| 966 | 3300050515 | nmdc:mga0a205_3143_c1 | nmdc:mga0a205_3143_c1_4379_5260 | 279 |
| 967 | 3300053077 | Ga0495601_0000889 | Ga0495601_0000889_9186_10067 | 279 |
| 968 | 3300053077 | Ga0495601_0036436 | Ga0495601_0036436_1035_1916 | 279 |
| 969 | 3300053078 | Ga0495612_0019714 | Ga0495612_0019714_647_1528 | 279 |
| 970 | 3300053085 | Ga0495619_0047385 | Ga0495619_0047385_143_1024 | 279 |
| 971 | 3300053085 | Ga0495619_0149708 | Ga0495619_0149708_441_1322 | 279 |
| 972 | 3300053119 | Ga0500595_017033 | Ga0500595_017033_782_1663 | 279 |
| 973 | 3300053139 | Ga0500568_0034603 | Ga0500568_0034603_566_1447 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5325 | 16 | 212 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4975 | 12 | 215 |
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.4821 | 16 | 214 |
| 5b57-assembly1.cif.gz_A | inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia | 0.448 | 6 | 211 |
| 5b58-assembly1.cif.gz_B | inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia | 0.421 | 6 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8551 | 11 | 217 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.749 | 9 | 214 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.728 | 12 | 216 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.726 | 8 | 215 | 1.10.3470.10 |
| af_P77315_52_317_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7037 | 12 | 216 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3QNQ8-F1-model_v4 | deleted | 0.8824 | 1 | 214 |
|
| AF-A0A535E139-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8823 | 2 | 215 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A522QHU0-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8799 | 1 | 216 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A7W0PAZ5-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8751 | 1 | 214 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-X0Q9P1-F1-model_v4 | Putative ABC transporter ATP-binding protein | 0.8745 | 1 | 216 |
GO:0005524
GO:0005886 GO:0015658 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar