F487190
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 973 | 508 | 759 | 484 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1138701|Ga0436365_1138701_1323_2963 |
| Length | 546 |
| Sequence | MAGHTMPSNTAAVGFASMLVSGSATTAAEVNVETAPPIRSIATDLSFIPRSRARFKRHPMFKKISRRDLAGLLGLSALGLAAPAGAQRSAAKPGTYVPASFPKDFLWGTATSSYQVEGAVDEDGRGPSIWDTFAHAEGNIEDRSNGDIACDHYHRYKDDVGLIRDLGAKAYRFSIAWPRVFPDGIGTPNPKGLDFYDRLIDELLKTGIEPYATLYHWDLPQALQERVGGWLSSETSRAFADYAGHVVARLGDRVRSFFTVNECGRFVPFGYGLGIDAPGLKLPQAEVNQARHHVALAHGLAVQAIRAHGRAGTRVGVAENITSCVPAIDTEANIEATRVATRELNAGFLNVILTGAYTEGFLRYAGATAPKFTAEELKIIATPTDFLGLNIYAPGHYITASDRPPGFDVLPFPSAFPHMSSDWLRIAPETMYWAPRLAAEIWNVDAIYISENGTSSIDRRAGDGQVYDLDRVMFLRNYLGQLQRAIADGVPVKGYFLWSLMDNFEWIYGYGKRFGVYWVDFETQARTPKLSAFFYRDVIARNAIGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 7 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 18 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 19 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 20 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 21 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 22 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 23 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 24 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 25 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 26 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 27 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 32 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 33 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 34 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 35 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 36 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 37 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 38 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 39 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 40 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 41 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 42 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 43 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 44 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 45 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 46 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 47 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 48 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 49 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 50 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 51 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 52 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 53 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 54 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 55 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 56 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 57 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 58 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 59 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 60 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 61 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 62 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 63 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 64 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 65 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 66 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 67 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 68 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 69 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 70 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 71 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 72 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 73 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 74 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 75 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 76 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 77 | 2906610324 | |||
| 78 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 79 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 80 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 81 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 82 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 83 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 84 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 85 | 2922368715 | |||
| 86 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 87 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 88 | 2922425934 | |||
| 89 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 90 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 91 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 92 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 93 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 94 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 95 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 96 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 97 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 98 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 99 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 100 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 101 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 102 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 103 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 104 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 105 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 106 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 107 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 108 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 109 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 110 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 111 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 112 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 113 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 114 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 115 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 116 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 117 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 118 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 119 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 120 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 121 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 122 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 123 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 124 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 125 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 126 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 127 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 128 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 129 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 130 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 131 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 132 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 133 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 134 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 135 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 136 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 137 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 138 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 139 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 140 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 141 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 142 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 143 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 144 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 145 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 146 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 147 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 148 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 149 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 150 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 151 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 152 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 154 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 155 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 156 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 167 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 170 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 171 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 172 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 175 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 177 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 179 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 181 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 182 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 183 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 184 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 185 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 186 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 187 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 188 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 189 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 190 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 191 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 193 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 194 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 195 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 197 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 199 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 200 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 201 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 202 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 203 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 204 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 205 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 206 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 207 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 208 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 221 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 234 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 235 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 236 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 237 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 243 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 245 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 294 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 296 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 299 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 300 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 301 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 302 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 303 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 304 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 305 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 306 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 307 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 308 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 309 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 310 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 311 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 312 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 313 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 314 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 315 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 316 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 317 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 318 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 319 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 320 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 321 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 322 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 323 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 324 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 325 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 326 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 327 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 328 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 329 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 330 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 331 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 333 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 334 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 335 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 336 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 337 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 338 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 339 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 340 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 341 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 342 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 343 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 344 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 347 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 348 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 416 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 417 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 418 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 419 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 420 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 421 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 424 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 425 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 426 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 427 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 428 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 429 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 430 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 433 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 434 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 435 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 436 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 446 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 447 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 453 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 458 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 459 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 460 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 461 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 462 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 463 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 464 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 465 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 466 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 467 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 468 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 470 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 471 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 472 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 473 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 474 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 475 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 476 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 477 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 478 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 479 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 480 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 482 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 484 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 485 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 486 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 487 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 488 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 489 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 490 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 491 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 492 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 493 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 494 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 495 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 496 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 497 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 498 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 499 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 500 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 501 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 502 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 503 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 504 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 505 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 506 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 507 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 508 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.41 |
| Metatranscriptomes | 0 |
| Isolates | 21.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.28 |
| Nodule | 16.96 |
| Rhizoplane | 4.93 |
| Rhizosphere | 56.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10020016 | 3300001989 | Bacteria | 2392 |
| 2 | JGI25406J46586_10000211 | 3300003203 | Bacteria | 25873 |
| 3 | JGI25406J46586_10008578 | 3300003203 | Bacteria | 4618 |
| 4 | JGI25406J46586_10011188 | 3300003203 | Bacteria | 3944 |
| 5 | JGI25406J46586_10012161 | 3300003203 | Bacteria | 3744 |
| 6 | JGI25406J46586_10012193 | 3300003203 | Bacteria | 3738 |
| 7 | JGI25406J46586_10018461 | 3300003203 | Bacteria | 2865 |
| 8 | JGI25153J46596_10000366 | 3300003215 | Bacteria | 31011 |
| 9 | JGI25153J46596_10002691 | 3300003215 | Bacteria | 10135 |
| 10 | JGI25153J46596_10003214 | 3300003215 | Bacteria | 9180 |
| 11 | JGI25160J50197_1000634 | 3300003354 | Bacteria | 19622 |
| 12 | JGI25160J50197_1005366 | 3300003354 | Bacteria | 5348 |
| 13 | JGI25160J50197_1016938 | 3300003354 | Bacteria | 2329 |
| 14 | JGI25404J52841_10001286 | 3300003659 | Bacteria | 4354 |
| 15 | JGI25404J52841_10002990 | 3300003659 | Bacteria | 3286 |
| 16 | Ga0055531_10008533 | 3300003794 | Bacteria | 5380 |
| 17 | Ga0055543_1007582 | 3300004625 | Bacteria | 2491 |
| 18 | Ga0065165_1000370 | 3300005262 | Bacteria | 73604 |
| 19 | Ga0065165_1002106 | 3300005262 | Bacteria | 18195 |
| 20 | Ga0065165_1002233 | 3300005262 | Bacteria | 17217 |
| 21 | Ga0065165_1004477 | 3300005262 | Bacteria | 8611 |
| 22 | Ga0070658_10018746 | 3300005327 | Bacteria | 5544 |
| 23 | Ga0070658_10061097 | 3300005327 | Bacteria | 3069 |
| 24 | Ga0070683_100032625 | 3300005329 | Bacteria | 4743 |
| 25 | Ga0070683_100128037 | 3300005329 | Bacteria | 2401 |
| 26 | Ga0070680_100004282 | 3300005336 | Bacteria | 10720 |
| 27 | Ga0070680_100011230 | 3300005336 | Bacteria | 6928 |
| 28 | Ga0070680_100011893 | 3300005336 | Bacteria | 6752 |
| 29 | Ga0070680_100178670 | 3300005336 | Bacteria | 1787 |
| 30 | Ga0070682_100016968 | 3300005337 | Bacteria | 4239 |
| 31 | Ga0070682_100150449 | 3300005337 | Bacteria | 1596 |
| 32 | Ga0070661_100048046 | 3300005344 | Bacteria | 3123 |
| 33 | Ga0070661_100165052 | 3300005344 | Bacteria | 1679 |
| 34 | Ga0070668_100138081 | 3300005347 | Bacteria | 1962 |
| 35 | Ga0070674_100011692 | 3300005356 | Bacteria | 5351 |
| 36 | Ga0070659_100122594 | 3300005366 | Bacteria | 2107 |
| 37 | Ga0070667_100043969 | 3300005367 | Bacteria | 3750 |
| 38 | Ga0070709_10001276 | 3300005434 | Bacteria | 13760 |
| 39 | Ga0070709_10002887 | 3300005434 | Bacteria | 9266 |
| 40 | Ga0070709_10030459 | 3300005434 | Bacteria | 3239 |
| 41 | Ga0070709_10084723 | 3300005434 | Bacteria | 2077 |
| 42 | Ga0070714_100019221 | 3300005435 | Bacteria | 5561 |
| 43 | Ga0070714_100026244 | 3300005435 | Bacteria | 4813 |
| 44 | Ga0070713_100002401 | 3300005436 | Bacteria | 12213 |
| 45 | Ga0070713_100071085 | 3300005436 | Bacteria | 2940 |
| 46 | Ga0070713_100121129 | 3300005436 | Bacteria | 2295 |
| 47 | Ga0070710_10000994 | 3300005437 | Bacteria | 13487 |
| 48 | Ga0070710_10004037 | 3300005437 | Bacteria | 6965 |
| 49 | Ga0070710_10019839 | 3300005437 | Bacteria | 3480 |
| 50 | Ga0070711_100001853 | 3300005439 | Bacteria | 11800 |
| 51 | Ga0070711_100015612 | 3300005439 | Bacteria | 4808 |
| 52 | Ga0070711_100016367 | 3300005439 | Bacteria | 4708 |
| 53 | Ga0070711_100019871 | 3300005439 | Bacteria | 4319 |
| 54 | Ga0070711_100041414 | 3300005439 | Bacteria | 3110 |
| 55 | Ga0070700_100028624 | 3300005441 | Bacteria | 3316 |
| 56 | Ga0070663_100007555 | 3300005455 | Bacteria | 6625 |
| 57 | Ga0070663_100015733 | 3300005455 | Bacteria | 4894 |
| 58 | Ga0070663_100015897 | 3300005455 | Bacteria | 4871 |
| 59 | Ga0070663_100033776 | 3300005455 | Bacteria | 3537 |
| 60 | Ga0070663_100062456 | 3300005455 | Bacteria | 2685 |
| 61 | Ga0070663_100071463 | 3300005455 | Bacteria | 2525 |
| 62 | Ga0070678_100013527 | 3300005456 | Bacteria | 5121 |
| 63 | Ga0070678_100020942 | 3300005456 | Bacteria | 4300 |
| 64 | Ga0070678_100068185 | 3300005456 | Bacteria | 2651 |
| 65 | Ga0070681_10001279 | 3300005458 | Bacteria | 21955 |
| 66 | Ga0070681_10002031 | 3300005458 | Bacteria | 18326 |
| 67 | Ga0070681_10004718 | 3300005458 | Bacteria | 13048 |
| 68 | Ga0070706_100000914 | 3300005467 | Bacteria | 32341 |
| 69 | Ga0070706_100084440 | 3300005467 | Bacteria | 2942 |
| 70 | Ga0070707_100244890 | 3300005468 | Bacteria | 1745 |
| 71 | Ga0070698_100005514 | 3300005471 | Bacteria | 13818 |
| 72 | Ga0070699_100176273 | 3300005518 | Bacteria | 1896 |
| 73 | Ga0070679_100002107 | 3300005530 | Bacteria | 17921 |
| 74 | Ga0070679_100016733 | 3300005530 | Bacteria | 7086 |
| 75 | Ga0070679_100019713 | 3300005530 | Bacteria | 6563 |
| 76 | Ga0070679_100020463 | 3300005530 | Bacteria | 6451 |
| 77 | Ga0070684_100036414 | 3300005535 | Bacteria | 4216 |
| 78 | Ga0068853_100035496 | 3300005539 | Bacteria | 4236 |
| 79 | Ga0068853_100044041 | 3300005539 | Bacteria | 3820 |
| 80 | Ga0070665_100011321 | 3300005548 | Bacteria | 9023 |
| 81 | Ga0070665_100028000 | 3300005548 | Bacteria | 5676 |
| 82 | Ga0070665_100049712 | 3300005548 | Bacteria | 4207 |
| 83 | Ga0068855_100074479 | 3300005563 | Bacteria | 3943 |
| 84 | Ga0070664_100074950 | 3300005564 | Bacteria | 2905 |
| 85 | Ga0070664_100108691 | 3300005564 | Bacteria | 2418 |
| 86 | Ga0068857_100138640 | 3300005577 | Bacteria | 2198 |
| 87 | Ga0068854_100054605 | 3300005578 | Bacteria | 2874 |
| 88 | Ga0068856_100000656 | 3300005614 | Bacteria | 37454 |
| 89 | Ga0068856_100048565 | 3300005614 | Unclassified | 4183 |
| 90 | Ga0068856_100152659 | 3300005614 | Bacteria | 2319 |
| 91 | Ga0068852_100002424 | 3300005616 | Bacteria | 12841 |
| 92 | Ga0068864_100033493 | 3300005618 | Bacteria | 4368 |
| 93 | Ga0068864_100157775 | 3300005618 | Bacteria | 2061 |
| 94 | Ga0068861_100045874 | 3300005719 | Bacteria | 3293 |
| 95 | Ga0068860_100072316 | 3300005843 | Bacteria | 3277 |
| 96 | Ga0068862_100014626 | 3300005844 | Bacteria | 6518 |
| 97 | Ga0081455_10000875 | 3300005937 | Bacteria | 38950 |
| 98 | Ga0081455_10006148 | 3300005937 | Bacteria | 12957 |
| 99 | Ga0081455_10009845 | 3300005937 | Bacteria | 9790 |
| 100 | Ga0081455_10010305 | 3300005937 | Bacteria | 9502 |
| 101 | Ga0081455_10036908 | 3300005937 | Bacteria | 4345 |
| 102 | Ga0081455_10070453 | 3300005937 | Bacteria | 2903 |
| 103 | Ga0081455_10070810 | 3300005937 | Bacteria | 2894 |
| 104 | Ga0081540_1000902 | 3300005983 | Bacteria | 26820 |
| 105 | Ga0081540_1001083 | 3300005983 | Bacteria | 24193 |
| 106 | Ga0081540_1001280 | 3300005983 | Bacteria | 21939 |
| 107 | Ga0081540_1002773 | 3300005983 | Bacteria | 14213 |
| 108 | Ga0081540_1003372 | 3300005983 | Bacteria | 12666 |
| 109 | Ga0081540_1005023 | 3300005983 | Bacteria | 9936 |
| 110 | Ga0081540_1008519 | 3300005983 | Bacteria | 7158 |
| 111 | Ga0081540_1010347 | 3300005983 | Bacteria | 6327 |
| 112 | Ga0081540_1013005 | 3300005983 | Bacteria | 5436 |
| 113 | Ga0081540_1032272 | 3300005983 | Bacteria | 2863 |
| 114 | Ga0081539_10000747 | 3300005985 | Bacteria | 64612 |
| 115 | Ga0081539_10001953 | 3300005985 | Bacteria | 31481 |
| 116 | Ga0081539_10002377 | 3300005985 | Bacteria | 26916 |
| 117 | Ga0081539_10021392 | 3300005985 | Bacteria | 4324 |
| 118 | Ga0081539_10027548 | 3300005985 | Bacteria | 3595 |
| 119 | Ga0070717_10056632 | 3300006028 | Bacteria | 3240 |
| 120 | Ga0070717_10059530 | 3300006028 | Bacteria | 3161 |
| 121 | Ga0075365_10016054 | 3300006038 | Bacteria | 4543 |
| 122 | Ga0075365_10057996 | 3300006038 | Bacteria | 2577 |
| 123 | Ga0075365_10067199 | 3300006038 | Bacteria | 2406 |
| 124 | Ga0075368_10008381 | 3300006042 | Bacteria | 3679 |
| 125 | Ga0075363_100000627 | 3300006048 | Bacteria | 11678 |
| 126 | Ga0075363_100023739 | 3300006048 | Bacteria | 3112 |
| 127 | Ga0070715_10000080 | 3300006163 | Bacteria | 26555 |
| 128 | Ga0070715_10017240 | 3300006163 | Bacteria | 2731 |
| 129 | Ga0070716_100008521 | 3300006173 | Bacteria | 5090 |
| 130 | Ga0070712_100007062 | 3300006175 | Bacteria | 7002 |
| 131 | Ga0070712_100064719 | 3300006175 | Bacteria | 2593 |
| 132 | Ga0075367_10004749 | 3300006178 | Bacteria | 6683 |
| 133 | Ga0075369_10012724 | 3300006186 | Bacteria | 3324 |
| 134 | Ga0075366_10062170 | 3300006195 | Bacteria | 2220 |
| 135 | Ga0075366_10072006 | 3300006195 | Bacteria | 2059 |
| 136 | Ga0075428_100231582 | 3300006844 | Bacteria | 1993 |
| 137 | Ga0075433_10043130 | 3300006852 | Bacteria | 3915 |
| 138 | Ga0075434_100018537 | 3300006871 | Bacteria | 6725 |
| 139 | Ga0075434_100154705 | 3300006871 | Bacteria | 2313 |
| 140 | Ga0099824_1010060 | 3300006942 | Bacteria | 11362 |
| 141 | Ga0099822_1001406 | 3300006943 | Bacteria | 27885 |
| 142 | Ga0099794_10031724 | 3300007265 | Bacteria | 2475 |
| 143 | Ga0099795_10018698 | 3300007788 | Bacteria | 2231 |
| 144 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 145 | Ga0105240_10006715 | 3300009093 | Bacteria | 16854 |
| 146 | Ga0105240_10011282 | 3300009093 | Bacteria | 12454 |
| 147 | Ga0105240_10019980 | 3300009093 | Bacteria | 8944 |
| 148 | Ga0105240_10132992 | 3300009093 | Bacteria | 2981 |
| 149 | Ga0111539_10022105 | 3300009094 | Bacteria | 7818 |
| 150 | Ga0105245_10026215 | 3300009098 | Bacteria | 5130 |
| 151 | Ga0105245_10063237 | 3300009098 | Bacteria | 3341 |
| 152 | Ga0105247_10027235 | 3300009101 | Bacteria | 3457 |
| 153 | Ga0114129_10058379 | 3300009147 | Bacteria | 5397 |
| 154 | Ga0105243_10135334 | 3300009148 | Bacteria | 2096 |
| 155 | Ga0105241_10007164 | 3300009174 | Bacteria | 8209 |
| 156 | Ga0105242_10039794 | 3300009176 | Bacteria | 3785 |
| 157 | Ga0105248_10013709 | 3300009177 | Bacteria | 8923 |
| 158 | Ga0105248_10022582 | 3300009177 | Bacteria | 6982 |
| 159 | Ga0105248_10027439 | 3300009177 | Bacteria | 6340 |
| 160 | Ga0105248_10028360 | 3300009177 | Bacteria | 6237 |
| 161 | Ga0105237_10017337 | 3300009545 | Bacteria | 7467 |
| 162 | Ga0105237_10138092 | 3300009545 | Bacteria | 2432 |
| 163 | Ga0105238_10033071 | 3300009551 | Bacteria | 5262 |
| 164 | Ga0105238_10119372 | 3300009551 | Bacteria | 2617 |
| 165 | Ga0105249_10021024 | 3300009553 | Bacteria | 5841 |
| 166 | Ga0099796_10002924 | 3300010159 | Bacteria | 3859 |
| 167 | Ga0105239_10003423 | 3300010375 | Bacteria | 19451 |
| 168 | Ga0105239_10022536 | 3300010375 | Bacteria | 6944 |
| 169 | Ga0105239_10260365 | 3300010375 | Bacteria | 1949 |
| 170 | Ga0105239_10349587 | 3300010375 | Bacteria | 1669 |
| 171 | Ga0105246_10024145 | 3300011119 | Bacteria | 3945 |
| 172 | Ga0157370_10029227 | 3300013104 | Bacteria | 5414 |
| 173 | Ga0157369_10004999 | 3300013105 | Bacteria | 15528 |
| 174 | Ga0157369_10008262 | 3300013105 | Bacteria | 11933 |
| 175 | Ga0157369_10148938 | 3300013105 | Bacteria | 2474 |
| 176 | Ga0157374_10046855 | 3300013296 | Bacteria | 4005 |
| 177 | Ga0157374_10143983 | 3300013296 | Bacteria | 2315 |
| 178 | Ga0157378_10006823 | 3300013297 | Bacteria | 9960 |
| 179 | Ga0163162_10007620 | 3300013306 | Bacteria | 10540 |
| 180 | Ga0157372_10055379 | 3300013307 | Bacteria | 4429 |
| 181 | Ga0157372_10089782 | 3300013307 | Bacteria | 3492 |
| 182 | Ga0157375_10017569 | 3300013308 | Bacteria | 6458 |
| 183 | Ga0157375_10064324 | 3300013308 | Bacteria | 3652 |
| 184 | Ga0157375_10302704 | 3300013308 | Bacteria | 1762 |
| 185 | Ga0163163_10003981 | 3300014325 | Bacteria | 12608 |
| 186 | Ga0163163_10058200 | 3300014325 | Bacteria | 3821 |
| 187 | Ga0157380_10102466 | 3300014326 | Bacteria | 2387 |
| 188 | Ga0157376_10008559 | 3300014969 | Bacteria | 7392 |
| 189 | Ga0157376_10028666 | 3300014969 | Bacteria | 4427 |
| 190 | Ga0157376_10074942 | 3300014969 | Bacteria | 2886 |
| 191 | Ga0214544_1000013 | 3300021320 | Bacteria | 228947 |
| 192 | Ga0214542_1000013 | 3300021321 | Bacteria | 234019 |
| 193 | Ga0214545_1000012 | 3300021324 | Bacteria | 187898 |
| 194 | Ga0214543_1000065 | 3300021327 | Bacteria | 126516 |
| 195 | Ga0209563_102315 | 3300025230 | Bacteria | 4375 |
| 196 | Ga0209677_100482 | 3300025253 | Bacteria | 22696 |
| 197 | Ga0209677_103565 | 3300025253 | Bacteria | 4955 |
| 198 | Ga0209148_1000319 | 3300025254 | Bacteria | 67129 |
| 199 | Ga0209148_1000577 | 3300025254 | Bacteria | 33949 |
| 200 | Ga0209233_1001276 | 3300025261 | Bacteria | 10091 |
| 201 | Ga0209233_1001653 | 3300025261 | Bacteria | 8678 |
| 202 | Ga0209455_1002601 | 3300025272 | Bacteria | 6866 |
| 203 | Ga0209455_1003722 | 3300025272 | Bacteria | 5274 |
| 204 | Ga0209564_1004727 | 3300025295 | Bacteria | 8157 |
| 205 | Ga0209564_1006891 | 3300025295 | Bacteria | 5990 |
| 206 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 207 | Ga0209758_1000893 | 3300025297 | Bacteria | 40627 |
| 208 | Ga0209758_1002062 | 3300025297 | Bacteria | 21474 |
| 209 | Ga0209758_1003963 | 3300025297 | Bacteria | 12841 |
| 210 | Ga0209758_1004684 | 3300025297 | Bacteria | 11176 |
| 211 | Ga0209256_1003250 | 3300025299 | Bacteria | 11687 |
| 212 | Ga0207426_1000271 | 3300025302 | Bacteria | 108392 |
| 213 | Ga0207426_1002767 | 3300025302 | Bacteria | 10573 |
| 214 | Ga0207426_1002886 | 3300025302 | Bacteria | 10168 |
| 215 | Ga0207426_1015753 | 3300025302 | Bacteria | 2736 |
| 216 | Ga0207426_1021621 | 3300025302 | Bacteria | 2222 |
| 217 | Ga0209257_1002080 | 3300025304 | Bacteria | 21092 |
| 218 | Ga0209257_1032230 | 3300025304 | Bacteria | 1664 |
| 219 | Ga0207692_10000950 | 3300025898 | Bacteria | 10525 |
| 220 | Ga0207692_10001820 | 3300025898 | Bacteria | 8096 |
| 221 | Ga0207710_10013662 | 3300025900 | Bacteria | 3416 |
| 222 | Ga0207647_10013298 | 3300025904 | Bacteria | 5711 |
| 223 | Ga0207647_10028961 | 3300025904 | Bacteria | 3590 |
| 224 | Ga0207699_10004122 | 3300025906 | Bacteria | 6965 |
| 225 | Ga0207699_10043081 | 3300025906 | Bacteria | 2620 |
| 226 | Ga0207645_10041897 | 3300025907 | Bacteria | 2930 |
| 227 | Ga0207645_10047793 | 3300025907 | Bacteria | 2732 |
| 228 | Ga0207684_10001650 | 3300025910 | Bacteria | 23689 |
| 229 | Ga0207654_10004552 | 3300025911 | Bacteria | 7000 |
| 230 | Ga0207707_10000080 | 3300025912 | Bacteria | 96693 |
| 231 | Ga0207707_10000204 | 3300025912 | Bacteria | 63042 |
| 232 | Ga0207707_10149187 | 3300025912 | Bacteria | 2044 |
| 233 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 234 | Ga0207695_10000240 | 3300025913 | Bacteria | 143196 |
| 235 | Ga0207695_10210351 | 3300025913 | Bacteria | 1856 |
| 236 | Ga0207671_10006330 | 3300025914 | Bacteria | 10568 |
| 237 | Ga0207671_10029364 | 3300025914 | Bacteria | 4105 |
| 238 | Ga0207671_10029689 | 3300025914 | Bacteria | 4081 |
| 239 | Ga0207693_10000845 | 3300025915 | Bacteria | 27292 |
| 240 | Ga0207693_10001000 | 3300025915 | Bacteria | 25410 |
| 241 | Ga0207693_10037258 | 3300025915 | Bacteria | 3833 |
| 242 | Ga0207663_10000382 | 3300025916 | Bacteria | 19375 |
| 243 | Ga0207663_10008433 | 3300025916 | Bacteria | 5386 |
| 244 | Ga0207663_10021175 | 3300025916 | Bacteria | 3697 |
| 245 | Ga0207663_10077924 | 3300025916 | Bacteria | 2159 |
| 246 | Ga0207660_10002408 | 3300025917 | Bacteria | 12287 |
| 247 | Ga0207657_10070474 | 3300025919 | Bacteria | 2963 |
| 248 | Ga0207657_10128365 | 3300025919 | Bacteria | 2080 |
| 249 | Ga0207652_10001974 | 3300025921 | Bacteria | 17736 |
| 250 | Ga0207652_10006752 | 3300025921 | Bacteria | 9252 |
| 251 | Ga0207652_10024276 | 3300025921 | Bacteria | 5029 |
| 252 | Ga0207652_10058055 | 3300025921 | Bacteria | 3334 |
| 253 | Ga0207694_10069309 | 3300025924 | Bacteria | 2755 |
| 254 | Ga0207650_10036869 | 3300025925 | Bacteria | 3559 |
| 255 | Ga0207659_10019924 | 3300025926 | Bacteria | 4425 |
| 256 | Ga0207687_10008466 | 3300025927 | Bacteria | 6727 |
| 257 | Ga0207687_10018033 | 3300025927 | Bacteria | 4656 |
| 258 | Ga0207687_10042542 | 3300025927 | Bacteria | 3126 |
| 259 | Ga0207687_10086874 | 3300025927 | Bacteria | 2272 |
| 260 | Ga0207700_10024587 | 3300025928 | Bacteria | 4171 |
| 261 | Ga0207664_10016632 | 3300025929 | Bacteria | 5372 |
| 262 | Ga0207664_10041705 | 3300025929 | Bacteria | 3577 |
| 263 | Ga0207644_10020857 | 3300025931 | Bacteria | 4458 |
| 264 | Ga0207644_10116402 | 3300025931 | Bacteria | 2028 |
| 265 | Ga0207644_10155376 | 3300025931 | Bacteria | 1773 |
| 266 | Ga0207706_10027145 | 3300025933 | Bacteria | 5121 |
| 267 | Ga0207686_10056292 | 3300025934 | Bacteria | 2471 |
| 268 | Ga0207709_10026836 | 3300025935 | Bacteria | 3312 |
| 269 | Ga0207669_10038665 | 3300025937 | Bacteria | 2750 |
| 270 | Ga0207665_10002330 | 3300025939 | Bacteria | 12823 |
| 271 | Ga0207665_10048485 | 3300025939 | Bacteria | 2851 |
| 272 | Ga0207665_10067791 | 3300025939 | Bacteria | 2430 |
| 273 | Ga0207691_10028242 | 3300025940 | Bacteria | 5254 |
| 274 | Ga0207711_10007926 | 3300025941 | Bacteria | 8884 |
| 275 | Ga0207711_10023662 | 3300025941 | Bacteria | 5143 |
| 276 | Ga0207711_10069420 | 3300025941 | Bacteria | 3054 |
| 277 | Ga0207711_10261554 | 3300025941 | Bacteria | 1590 |
| 278 | Ga0207689_10198498 | 3300025942 | Bacteria | 1656 |
| 279 | Ga0207661_10005001 | 3300025944 | Bacteria | 9294 |
| 280 | Ga0207661_10054608 | 3300025944 | Bacteria | 3201 |
| 281 | Ga0207679_10056504 | 3300025945 | Bacteria | 2898 |
| 282 | Ga0207667_10035220 | 3300025949 | Bacteria | 5370 |
| 283 | Ga0207712_10029202 | 3300025961 | Bacteria | 3696 |
| 284 | Ga0207668_10055058 | 3300025972 | Bacteria | 2763 |
| 285 | Ga0207640_10043082 | 3300025981 | Bacteria | 2882 |
| 286 | Ga0207640_10074258 | 3300025981 | Bacteria | 2301 |
| 287 | Ga0207658_10090008 | 3300025986 | Bacteria | 2377 |
| 288 | Ga0207658_10177749 | 3300025986 | Bacteria | 1759 |
| 289 | Ga0207703_10065269 | 3300026035 | Bacteria | 2991 |
| 290 | Ga0207703_10155817 | 3300026035 | Bacteria | 1996 |
| 291 | Ga0207639_10035296 | 3300026041 | Bacteria | 3699 |
| 292 | Ga0207639_10049581 | 3300026041 | Bacteria | 3184 |
| 293 | Ga0207678_10016142 | 3300026067 | Bacteria | 6558 |
| 294 | Ga0207678_10026522 | 3300026067 | Bacteria | 5054 |
| 295 | Ga0207678_10027418 | 3300026067 | Bacteria | 4968 |
| 296 | Ga0207678_10067098 | 3300026067 | Bacteria | 3079 |
| 297 | Ga0207678_10087422 | 3300026067 | Bacteria | 2664 |
| 298 | Ga0207678_10127642 | 3300026067 | Bacteria | 2169 |
| 299 | Ga0207702_10000127 | 3300026078 | Bacteria | 89755 |
| 300 | Ga0207702_10078321 | 3300026078 | Bacteria | 2861 |
| 301 | Ga0207702_10143700 | 3300026078 | Bacteria | 2162 |
| 302 | Ga0207648_10124079 | 3300026089 | Bacteria | 2271 |
| 303 | Ga0207648_10203680 | 3300026089 | Bacteria | 1756 |
| 304 | Ga0207676_10161109 | 3300026095 | Bacteria | 1944 |
| 305 | Ga0207676_10235652 | 3300026095 | Bacteria | 1639 |
| 306 | Ga0207674_10117331 | 3300026116 | Bacteria | 2632 |
| 307 | Ga0207674_10173521 | 3300026116 | Bacteria | 2109 |
| 308 | Ga0207683_10049597 | 3300026121 | Bacteria | 3676 |
| 309 | Ga0207683_10061599 | 3300026121 | Bacteria | 3303 |
| 310 | Ga0207683_10072698 | 3300026121 | Bacteria | 3041 |
| 311 | Ga0207683_10099101 | 3300026121 | Bacteria | 2600 |
| 312 | Ga0207683_10129824 | 3300026121 | Bacteria | 2266 |
| 313 | Ga0207698_10021751 | 3300026142 | Bacteria | 4442 |
| 314 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 315 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 316 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 317 | Ga0268266_10001437 | 3300028379 | Bacteria | 28363 |
| 318 | Ga0268266_10004114 | 3300028379 | Bacteria | 14049 |
| 319 | Ga0268266_10016394 | 3300028379 | Bacteria | 6334 |
| 320 | Ga0268266_10018620 | 3300028379 | Bacteria | 5917 |
| 321 | Ga0268266_10041405 | 3300028379 | Bacteria | 3930 |
| 322 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 323 | Ga0265334_10023851 | 3300028573 | Bacteria | 2486 |
| 324 | Ga0265318_10009805 | 3300028577 | Bacteria | 4198 |
| 325 | Ga0265323_10002846 | 3300028653 | Bacteria | 7782 |
| 326 | Ga0265336_10000277 | 3300028666 | Bacteria | 36011 |
| 327 | Ga0307517_10000650 | 3300028786 | Bacteria | 59699 |
| 328 | Ga0307517_10002374 | 3300028786 | Bacteria | 30296 |
| 329 | Ga0265338_10002073 | 3300028800 | Bacteria | 30961 |
| 330 | Ga0265325_10051657 | 3300031241 | Bacteria | 2113 |
| 331 | Ga0265340_10012248 | 3300031247 | Bacteria | 4531 |
| 332 | Ga0265339_10019126 | 3300031249 | Bacteria | 4024 |
| 333 | Ga0307513_10128355 | 3300031456 | Bacteria | 2486 |
| 334 | Ga0307513_10139705 | 3300031456 | Bacteria | 2351 |
| 335 | Ga0307508_10060189 | 3300031616 | Bacteria | 3359 |
| 336 | Ga0265314_10003222 | 3300031711 | Bacteria | 15968 |
| 337 | Ga0265314_10050797 | 3300031711 | Bacteria | 2892 |
| 338 | Ga0265342_10007451 | 3300031712 | Bacteria | 8006 |
| 339 | Ga0265342_10057748 | 3300031712 | Bacteria | 2296 |
| 340 | Ga0307516_10005375 | 3300031730 | Bacteria | 15391 |
| 341 | Ga0307516_10010888 | 3300031730 | Bacteria | 9950 |
| 342 | Ga0307516_10040408 | 3300031730 | Bacteria | 4644 |
| 343 | Ga0307516_10090410 | 3300031730 | Bacteria | 2890 |
| 344 | Ga0307415_100094286 | 3300032126 | Bacteria | 2176 |
| 345 | Ga0307510_10002885 | 3300033180 | Bacteria | 19782 |
| 346 | Ga0307510_10012541 | 3300033180 | Bacteria | 10051 |
| 347 | Ga0307510_10067703 | 3300033180 | Bacteria | 3592 |
| 348 | Ga0307510_10146539 | 3300033180 | Bacteria | 1991 |
| 349 | Ga0315911_1000007 | 3300033442 | Bacteria | 413725 |
| 350 | Ga0373929_0003358 | 3300035085 | Bacteria | 2888 |
| 351 | Ga0373934_0001552 | 3300035086 | Bacteria | 8431 |
| 352 | Ga0373923_0008219 | 3300035111 | Bacteria | 3709 |
| 353 | Ga0373923_0016842 | 3300035111 | Bacteria | 2785 |
| 354 | Ga0373936_0034284 | 3300035113 | Bacteria | 2016 |
| 355 | Ga0373945_0007106 | 3300035116 | Bacteria | 3625 |
| 356 | Ga0373953_0000126 | 3300035117 | Bacteria | 18697 |
| 357 | Ga0373954_0001939 | 3300035118 | Bacteria | 8573 |
| 358 | Ga0373954_0035248 | 3300035118 | Bacteria | 2320 |
| 359 | Ga0373956_0000764 | 3300035119 | Bacteria | 13305 |
| 360 | Ga0373957_0004766 | 3300035120 | Bacteria | 4154 |
| 361 | Ga0373943_0040496 | 3300035170 | Bacteria | 2250 |
| 362 | Ga0373946_0005087 | 3300035171 | Bacteria | 4738 |
| 363 | Ga0373946_0038774 | 3300035171 | Bacteria | 1942 |
| 364 | Ga0373946_0069861 | 3300035171 | Bacteria | 1514 |
| 365 | Ga0373955_0004252 | 3300035172 | Bacteria | 6323 |
| 366 | Ga0373924_0000464 | 3300035410 | Bacteria | 12448 |
| 367 | Ga0373924_0049542 | 3300035410 | Bacteria | 1738 |
| 368 | Ga0373931_0000734 | 3300035691 | Bacteria | 13646 |
| 369 | Ga0373927_0011774 | 3300035695 | Bacteria | 5824 |
| 370 | Ga0373927_0013533 | 3300035695 | Bacteria | 5419 |
| 371 | Ga0373927_0069980 | 3300035695 | Bacteria | 2271 |
| 372 | Ga0373933_0000074 | 3300035724 | Bacteria | 61625 |
| 373 | Ga0373933_0000600 | 3300035724 | Bacteria | 22552 |
| 374 | Ga0373933_0008928 | 3300035724 | Bacteria | 5466 |
| 375 | Ga0373937_0039793 | 3300036401 | Bacteria | 4284 |
| 376 | Ga0373937_0040701 | 3300036401 | Bacteria | 4236 |
| 377 | Ga0373937_0069295 | 3300036401 | Bacteria | 3252 |
| 378 | Ga0373937_0142763 | 3300036401 | Bacteria | 2240 |
| 379 | Ga0373925_0012992 | 3300037068 | Bacteria | 6029 |
| 380 | Ga0373925_0060982 | 3300037068 | Bacteria | 2833 |
| 381 | Ga0373925_0153674 | 3300037068 | Bacteria | 1809 |
| 382 | Ga0395899_0074592 | 3300037312 | Bacteria | 2478 |
| 383 | Ga0395900_0089725 | 3300037418 | Bacteria | 3159 |
| 384 | Ga0395900_0134326 | 3300037418 | Bacteria | 2534 |
| 385 | Ga0395898_0002852 | 3300037466 | Bacteria | 19765 |
| 386 | Ga0395898_0036523 | 3300037466 | Bacteria | 4878 |
| 387 | Ga0395898_0185564 | 3300037466 | Bacteria | 1987 |
| 388 | Ga0395905_0151032 | 3300037471 | Bacteria | 2185 |
| 389 | Ga0395905_0160578 | 3300037471 | Bacteria | 2112 |
| 390 | Ga0395901_0001945 | 3300038443 | Bacteria | 21264 |
| 391 | Ga0395901_0056960 | 3300038443 | Bacteria | 4066 |
| 392 | Ga0436365_1138701 | 3300039437 | Bacteria | 28644 |
| 393 | Ga0436365_1552989 | 3300039437 | Bacteria | 8029 |
| 394 | Ga0436365_1642928 | 3300039437 | Bacteria | 2383 |
| 395 | Ga0436365_1665810 | 3300039437 | Bacteria | 4494 |
| 396 | Ga0436361_0211974 | 3300039447 | Bacteria | 2132 |
| 397 | Ga0436361_1209908 | 3300039447 | Bacteria | 5821 |
| 398 | Ga0436362_0284263 | 3300039453 | Bacteria | 1842 |
| 399 | Ga0436362_0505551 | 3300039453 | Bacteria | 8829 |
| 400 | Ga0439465_0026860 | 3300041413 | Bacteria | 1822 |
| 401 | Ga0466972_0001570 | 3300044658 | Bacteria | 11144 |
| 402 | Ga0466966_0013093 | 3300044684 | Bacteria | 5491 |
| 403 | Ga0466961_0000016 | 3300044693 | Bacteria | 111421 |
| 404 | Ga0466959_0002071 | 3300045049 | Bacteria | 12683 |
| 405 | Ga0466958_0106234 | 3300045836 | Bacteria | 1750 |
| 406 | Ga0466967_0068372 | 3300045976 | Bacteria | 3171 |
| 407 | Ga0495592_0000570 | 3300046454 | Bacteria | 26078 |
| 408 | Ga0495592_0008334 | 3300046454 | Bacteria | 7775 |
| 409 | Ga0495592_0041333 | 3300046454 | Bacteria | 3455 |
| 410 | Ga0495592_0118504 | 3300046454 | Bacteria | 1865 |
| 411 | Ga0495592_0147583 | 3300046454 | Bacteria | 1629 |
| 412 | Ga0495603_0000326 | 3300046455 | Bacteria | 25731 |
| 413 | Ga0495603_0008509 | 3300046455 | Bacteria | 6199 |
| 414 | Ga0495603_0012700 | 3300046455 | Bacteria | 5095 |
| 415 | Ga0495603_0043606 | 3300046455 | Bacteria | 2678 |
| 416 | Ga0495603_0096535 | 3300046455 | Bacteria | 1727 |
| 417 | Ga0495629_0003532 | 3300046459 | Bacteria | 11816 |
| 418 | Ga0495629_0028760 | 3300046459 | Bacteria | 3945 |
| 419 | Ga0495638_0003490 | 3300046460 | Bacteria | 12354 |
| 420 | Ga0495638_0003584 | 3300046460 | Bacteria | 12153 |
| 421 | Ga0495641_0048488 | 3300046461 | Bacteria | 1947 |
| 422 | Ga0495651_0001932 | 3300046462 | Bacteria | 16028 |
| 423 | Ga0495651_0006357 | 3300046462 | Bacteria | 9039 |
| 424 | Ga0495651_0017002 | 3300046462 | Bacteria | 5634 |
| 425 | Ga0495651_0047024 | 3300046462 | Bacteria | 3338 |
| 426 | Ga0495651_0095391 | 3300046462 | Bacteria | 2225 |
| 427 | Ga0495651_0187183 | 3300046462 | Bacteria | 1460 |
| 428 | Ga0495653_0004089 | 3300046463 | Bacteria | 11800 |
| 429 | Ga0495653_0044635 | 3300046463 | Bacteria | 3440 |
| 430 | Ga0495653_0136449 | 3300046463 | Bacteria | 1730 |
| 431 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 432 | Ga0495650_0002096 | 3300046471 | Bacteria | 17160 |
| 433 | Ga0495580_0010882 | 3300046472 | Bacteria | 7060 |
| 434 | Ga0495580_0025602 | 3300046472 | Bacteria | 4311 |
| 435 | Ga0495582_0001540 | 3300046473 | Bacteria | 13016 |
| 436 | Ga0495582_0005857 | 3300046473 | Bacteria | 6849 |
| 437 | Ga0495582_0035806 | 3300046473 | Bacteria | 2730 |
| 438 | Ga0495582_0103035 | 3300046473 | Bacteria | 1599 |
| 439 | Ga0495639_0009301 | 3300046475 | Bacteria | 4213 |
| 440 | Ga0495639_0016428 | 3300046475 | Bacteria | 3213 |
| 441 | Ga0495662_0016351 | 3300046476 | Bacteria | 3593 |
| 442 | Ga0495664_0005846 | 3300046477 | Bacteria | 6771 |
| 443 | Ga0495664_0012300 | 3300046477 | Bacteria | 4846 |
| 444 | Ga0495664_0029107 | 3300046477 | Bacteria | 3228 |
| 445 | Ga0495664_0038845 | 3300046477 | Bacteria | 2811 |
| 446 | Ga0495664_0093331 | 3300046477 | Bacteria | 1811 |
| 447 | Ga0495584_0021729 | 3300046491 | Bacteria | 3259 |
| 448 | Ga0495585_0046723 | 3300046492 | Bacteria | 2413 |
| 449 | Ga0495594_0000561 | 3300046499 | Bacteria | 19039 |
| 450 | Ga0495594_0003180 | 3300046499 | Bacteria | 8494 |
| 451 | Ga0495594_0009698 | 3300046499 | Bacteria | 4981 |
| 452 | Ga0495606_0002474 | 3300046507 | Bacteria | 21381 |
| 453 | Ga0495606_0034723 | 3300046507 | Bacteria | 3458 |
| 454 | Ga0495606_0090115 | 3300046507 | Bacteria | 1888 |
| 455 | Ga0495608_0012407 | 3300046511 | Bacteria | 5915 |
| 456 | Ga0495618_0052596 | 3300046514 | Bacteria | 2575 |
| 457 | Ga0495628_0019403 | 3300046516 | Bacteria | 5622 |
| 458 | Ga0495628_0037037 | 3300046516 | Bacteria | 3911 |
| 459 | Ga0495628_0104958 | 3300046516 | Bacteria | 2177 |
| 460 | Ga0495630_0028997 | 3300046517 | Bacteria | 4114 |
| 461 | Ga0495630_0034977 | 3300046517 | Bacteria | 3753 |
| 462 | Ga0495630_0037585 | 3300046517 | Bacteria | 3620 |
| 463 | Ga0495631_0014579 | 3300046518 | Bacteria | 3787 |
| 464 | Ga0495631_0029447 | 3300046518 | Bacteria | 2497 |
| 465 | Ga0495644_0000300 | 3300046523 | Bacteria | 22812 |
| 466 | Ga0495648_0000857 | 3300046524 | Bacteria | 32107 |
| 467 | Ga0495648_0007181 | 3300046524 | Bacteria | 8948 |
| 468 | Ga0495648_0086930 | 3300046524 | Bacteria | 1762 |
| 469 | Ga0495666_0007697 | 3300046526 | Bacteria | 5388 |
| 470 | Ga0495666_0023829 | 3300046526 | Bacteria | 3027 |
| 471 | Ga0495642_0024644 | 3300046528 | Bacteria | 2381 |
| 472 | Ga0495652_0002875 | 3300046529 | Bacteria | 17358 |
| 473 | Ga0495652_0003587 | 3300046529 | Bacteria | 15224 |
| 474 | Ga0495652_0021303 | 3300046529 | Bacteria | 5763 |
| 475 | Ga0495652_0084915 | 3300046529 | Bacteria | 2602 |
| 476 | Ga0495652_0092876 | 3300046529 | Bacteria | 2465 |
| 477 | Ga0495652_0103676 | 3300046529 | Bacteria | 2302 |
| 478 | Ga0495665_0036869 | 3300046531 | Bacteria | 2609 |
| 479 | Ga0495665_0071267 | 3300046531 | Bacteria | 1830 |
| 480 | Ga0495640_0008019 | 3300046533 | Bacteria | 8297 |
| 481 | Ga0495640_0011883 | 3300046533 | Bacteria | 6677 |
| 482 | Ga0495640_0026959 | 3300046533 | Bacteria | 4147 |
| 483 | Ga0495640_0053587 | 3300046533 | Bacteria | 2765 |
| 484 | Ga0495640_0142031 | 3300046533 | Bacteria | 1547 |
| 485 | Ga0495587_0018457 | 3300046536 | Bacteria | 4326 |
| 486 | Ga0495587_0028751 | 3300046536 | Bacteria | 3378 |
| 487 | Ga0495587_0029230 | 3300046536 | Bacteria | 3347 |
| 488 | Ga0495587_0032841 | 3300046536 | Bacteria | 3135 |
| 489 | Ga0495609_0019296 | 3300046538 | Bacteria | 3157 |
| 490 | Ga0495645_0003943 | 3300046543 | Bacteria | 10127 |
| 491 | Ga0495645_0007372 | 3300046543 | Bacteria | 7651 |
| 492 | Ga0495645_0016899 | 3300046543 | Bacteria | 5222 |
| 493 | Ga0495645_0023368 | 3300046543 | Bacteria | 4476 |
| 494 | Ga0495622_0003972 | 3300046557 | Bacteria | 6904 |
| 495 | Ga0495622_0014341 | 3300046557 | Bacteria | 3681 |
| 496 | Ga0495622_0051722 | 3300046557 | Bacteria | 1905 |
| 497 | Ga0495667_0000747 | 3300046559 | Bacteria | 20874 |
| 498 | Ga0495667_0005130 | 3300046559 | Bacteria | 8847 |
| 499 | Ga0495667_0015701 | 3300046559 | Bacteria | 5119 |
| 500 | Ga0495667_0017229 | 3300046559 | Bacteria | 4880 |
| 501 | Ga0495667_0056493 | 3300046559 | Bacteria | 2581 |
| 502 | Ga0495656_0008694 | 3300046615 | Bacteria | 3633 |
| 503 | Ga0495668_0029830 | 3300046616 | Bacteria | 3082 |
| 504 | Ga0495668_0056386 | 3300046616 | Bacteria | 2169 |
| 505 | Ga0495634_0012178 | 3300046642 | Bacteria | 6236 |
| 506 | Ga0495634_0030552 | 3300046642 | Bacteria | 3720 |
| 507 | Ga0495634_0033315 | 3300046642 | Bacteria | 3540 |
| 508 | Ga0495634_0040760 | 3300046642 | Bacteria | 3156 |
| 509 | Ga0495625_0000814 | 3300046660 | Bacteria | 43131 |
| 510 | Ga0495625_0078570 | 3300046660 | Bacteria | 2303 |
| 511 | Ga0495625_0083891 | 3300046660 | Bacteria | 2214 |
| 512 | Ga0495625_0084930 | 3300046660 | Bacteria | 2198 |
| 513 | Ga0495635_0000532 | 3300046663 | Bacteria | 24183 |
| 514 | Ga0495635_0000796 | 3300046663 | Bacteria | 20579 |
| 515 | Ga0495635_0001601 | 3300046663 | Bacteria | 15230 |
| 516 | Ga0495635_0008660 | 3300046663 | Bacteria | 7104 |
| 517 | Ga0495635_0022404 | 3300046663 | Bacteria | 4399 |
| 518 | Ga0495635_0028422 | 3300046663 | Bacteria | 3887 |
| 519 | Ga0495635_0044435 | 3300046663 | Bacteria | 3065 |
| 520 | Ga0495659_0004386 | 3300046664 | Bacteria | 4441 |
| 521 | Ga0495588_0007159 | 3300046674 | Bacteria | 5061 |
| 522 | Ga0495588_0023354 | 3300046674 | Bacteria | 3062 |
| 523 | Ga0495657_0000725 | 3300046675 | Bacteria | 29627 |
| 524 | Ga0495657_0002564 | 3300046675 | Bacteria | 15242 |
| 525 | Ga0495657_0016182 | 3300046675 | Bacteria | 5440 |
| 526 | Ga0495657_0044699 | 3300046675 | Bacteria | 3011 |
| 527 | Ga0495599_0000394 | 3300046678 | Bacteria | 24995 |
| 528 | Ga0495599_0016403 | 3300046678 | Bacteria | 4598 |
| 529 | Ga0495599_0065770 | 3300046678 | Bacteria | 2265 |
| 530 | Ga0495623_0002532 | 3300046679 | Bacteria | 12094 |
| 531 | Ga0495623_0003534 | 3300046679 | Bacteria | 10342 |
| 532 | Ga0495623_0017418 | 3300046679 | Bacteria | 4642 |
| 533 | Ga0495646_0000916 | 3300046680 | Bacteria | 16760 |
| 534 | Ga0495646_0033545 | 3300046680 | Bacteria | 3191 |
| 535 | Ga0495647_0002968 | 3300046681 | Bacteria | 5389 |
| 536 | Ga0495647_0009216 | 3300046681 | Bacteria | 3337 |
| 537 | Ga0495658_0004513 | 3300046683 | Bacteria | 6845 |
| 538 | Ga0495669_0003897 | 3300046684 | Bacteria | 6140 |
| 539 | Ga0495669_0022128 | 3300046684 | Bacteria | 2762 |
| 540 | Ga0495613_0003043 | 3300046689 | Bacteria | 12547 |
| 541 | Ga0495613_0059287 | 3300046689 | Bacteria | 2806 |
| 542 | Ga0495613_0095595 | 3300046689 | Bacteria | 2149 |
| 543 | Ga0495624_0008393 | 3300046690 | Bacteria | 7206 |
| 544 | Ga0495624_0061259 | 3300046690 | Bacteria | 2358 |
| 545 | Ga0495671_0025187 | 3300046692 | Bacteria | 3094 |
| 546 | Ga0495600_0012306 | 3300046809 | Bacteria | 5347 |
| 547 | Ga0495600_0015246 | 3300046809 | Bacteria | 4856 |
| 548 | Ga0495600_0016939 | 3300046809 | Bacteria | 4632 |
| 549 | Ga0495581_0005146 | 3300047315 | Bacteria | 7568 |
| 550 | Ga0495581_0005373 | 3300047315 | Bacteria | 7414 |
| 551 | Ga0495581_0023465 | 3300047315 | Bacteria | 3575 |
| 552 | Ga0495604_0000420 | 3300047317 | Bacteria | 38211 |
| 553 | Ga0495604_0001069 | 3300047317 | Bacteria | 22717 |
| 554 | Ga0495604_0001405 | 3300047317 | Bacteria | 19734 |
| 555 | Ga0495604_0001856 | 3300047317 | Bacteria | 17220 |
| 556 | Ga0495604_0021505 | 3300047317 | Bacteria | 5149 |
| 557 | Ga0495604_0025801 | 3300047317 | Bacteria | 4680 |
| 558 | Ga0495674_0002922 | 3300047319 | Bacteria | 16628 |
| 559 | Ga0495674_0007305 | 3300047319 | Bacteria | 10565 |
| 560 | Ga0495674_0007646 | 3300047319 | Bacteria | 10321 |
| 561 | Ga0495674_0015599 | 3300047319 | Bacteria | 7095 |
| 562 | Ga0495674_0040793 | 3300047319 | Bacteria | 4149 |
| 563 | Ga0495672_0001637 | 3300047320 | Bacteria | 21778 |
| 564 | Ga0495672_0015482 | 3300047320 | Bacteria | 5176 |
| 565 | Ga0495676_0020272 | 3300047321 | Bacteria | 5838 |
| 566 | Ga0495676_0036432 | 3300047321 | Bacteria | 4108 |
| 567 | Ga0495676_0072345 | 3300047321 | Bacteria | 2648 |
| 568 | Ga0495680_0001853 | 3300047322 | Bacteria | 22287 |
| 569 | Ga0495680_0002126 | 3300047322 | Bacteria | 20566 |
| 570 | Ga0495680_0017768 | 3300047322 | Bacteria | 6055 |
| 571 | Ga0495680_0019256 | 3300047322 | Bacteria | 5771 |
| 572 | Ga0495680_0148278 | 3300047322 | Bacteria | 1712 |
| 573 | Ga0495687_017006 | 3300047443 | Bacteria | 3642 |
| 574 | Ga0495675_0004302 | 3300047444 | Bacteria | 8615 |
| 575 | Ga0495675_0005826 | 3300047444 | Bacteria | 7528 |
| 576 | Ga0495675_0018356 | 3300047444 | Bacteria | 4441 |
| 577 | Ga0495675_0063545 | 3300047444 | Bacteria | 2335 |
| 578 | Ga0495675_0142380 | 3300047444 | Bacteria | 1485 |
| 579 | Ga0495677_0050459 | 3300047445 | Bacteria | 1531 |
| 580 | Ga0495684_0001102 | 3300047471 | Bacteria | 21742 |
| 581 | Ga0495684_0027189 | 3300047471 | Bacteria | 4392 |
| 582 | Ga0495684_0030968 | 3300047471 | Bacteria | 4107 |
| 583 | Ga0495684_0035115 | 3300047471 | Bacteria | 3846 |
| 584 | Ga0495684_0145083 | 3300047471 | Bacteria | 1778 |
| 585 | Ga0495686_0032501 | 3300047472 | Bacteria | 3377 |
| 586 | Ga0495686_0105959 | 3300047472 | Bacteria | 1691 |
| 587 | Ga0495593_0000928 | 3300047673 | Bacteria | 17048 |
| 588 | Ga0495593_0007129 | 3300047673 | Bacteria | 6554 |
| 589 | Ga0495602_0003533 | 3300048088 | Bacteria | 16153 |
| 590 | Ga0495602_0003593 | 3300048088 | Bacteria | 16061 |
| 591 | Ga0495602_0016266 | 3300048088 | Bacteria | 7484 |
| 592 | Ga0495602_0023066 | 3300048088 | Bacteria | 6074 |
| 593 | Ga0496100_0092626 | 3300048903 | Bacteria | 2066 |
| 594 | Ga0496100_0104040 | 3300048903 | Bacteria | 1961 |
| 595 | Ga0496100_0121858 | 3300048903 | Bacteria | 1825 |
| 596 | Ga0496101_0072888 | 3300048904 | Bacteria | 2522 |
| 597 | Ga0496102_0008428 | 3300048905 | Bacteria | 8836 |
| 598 | Ga0496102_0039932 | 3300048905 | Bacteria | 4243 |
| 599 | Ga0496102_0056323 | 3300048905 | Bacteria | 3586 |
| 600 | Ga0496102_0061309 | 3300048905 | Bacteria | 3442 |
| 601 | Ga0496102_0200979 | 3300048905 | Bacteria | 1879 |
| 602 | Ga0496102_0260205 | 3300048905 | Bacteria | 1636 |
| 603 | Ga0496103_0002871 | 3300048906 | Bacteria | 10700 |
| 604 | Ga0496103_0009352 | 3300048906 | Bacteria | 5804 |
| 605 | Ga0496103_0011177 | 3300048906 | Bacteria | 5316 |
| 606 | Ga0496104_0001629 | 3300048907 | Bacteria | 19389 |
| 607 | Ga0496104_0013027 | 3300048907 | Bacteria | 7489 |
| 608 | Ga0496104_0043425 | 3300048907 | Bacteria | 4223 |
| 609 | Ga0496104_0061464 | 3300048907 | Bacteria | 3562 |
| 610 | Ga0496104_0083017 | 3300048907 | Bacteria | 3056 |
| 611 | Ga0496105_0042737 | 3300048908 | Bacteria | 3737 |
| 612 | Ga0496105_0044094 | 3300048908 | Bacteria | 3677 |
| 613 | Ga0496105_0056234 | 3300048908 | Bacteria | 3247 |
| 614 | Ga0496106_0005138 | 3300048909 | Bacteria | 9699 |
| 615 | Ga0496106_0029885 | 3300048909 | Bacteria | 4062 |
| 616 | Ga0496106_0033373 | 3300048909 | Bacteria | 3841 |
| 617 | Ga0496106_0034275 | 3300048909 | Bacteria | 3791 |
| 618 | Ga0496106_0067899 | 3300048909 | Bacteria | 2719 |
| 619 | Ga0496107_0020008 | 3300048910 | Bacteria | 4727 |
| 620 | Ga0496107_0029169 | 3300048910 | Bacteria | 3924 |
| 621 | Ga0496107_0041791 | 3300048910 | Bacteria | 3293 |
| 622 | Ga0496107_0055576 | 3300048910 | Bacteria | 2859 |
| 623 | Ga0496108_0029866 | 3300048911 | Bacteria | 4517 |
| 624 | Ga0496108_0061889 | 3300048911 | Bacteria | 3151 |
| 625 | Ga0496109_0040986 | 3300048912 | Bacteria | 4195 |
| 626 | Ga0496109_0137322 | 3300048912 | Bacteria | 2285 |
| 627 | Ga0496110_0008411 | 3300048913 | Bacteria | 8302 |
| 628 | Ga0496111_0012192 | 3300048914 | Bacteria | 5813 |
| 629 | Ga0496111_0061930 | 3300048914 | Bacteria | 2713 |
| 630 | Ga0496111_0093582 | 3300048914 | Bacteria | 2203 |
| 631 | Ga0496112_0000023 | 3300048915 | Bacteria | 156144 |
| 632 | Ga0496112_0003139 | 3300048915 | Bacteria | 13559 |
| 633 | Ga0496112_0068438 | 3300048915 | Bacteria | 3506 |
| 634 | Ga0496112_0204827 | 3300048915 | Bacteria | 1931 |
| 635 | Ga0496113_0001253 | 3300048916 | Bacteria | 13987 |
| 636 | Ga0496113_0009073 | 3300048916 | Bacteria | 6517 |
| 637 | Ga0496114_0104436 | 3300048917 | Bacteria | 2423 |
| 638 | Ga0496115_0006975 | 3300048918 | Bacteria | 8296 |
| 639 | Ga0496115_0015877 | 3300048918 | Bacteria | 5721 |
| 640 | Ga0496117_0019064 | 3300048920 | Bacteria | 5652 |
| 641 | Ga0496117_0052254 | 3300048920 | Bacteria | 2880 |
| 642 | Ga0496117_0067973 | 3300048920 | Bacteria | 2408 |
| 643 | Ga0496118_0002027 | 3300048921 | Bacteria | 28645 |
| 644 | Ga0496118_0023033 | 3300048921 | Bacteria | 5424 |
| 645 | Ga0496121_0000110 | 3300048924 | Bacteria | 186482 |
| 646 | Ga0496121_0003633 | 3300048924 | Bacteria | 21728 |
| 647 | Ga0496121_0005213 | 3300048924 | Bacteria | 16838 |
| 648 | Ga0496121_0018264 | 3300048924 | Bacteria | 7085 |
| 649 | Ga0496121_0021784 | 3300048924 | Bacteria | 6259 |
| 650 | Ga0496121_0037055 | 3300048924 | Bacteria | 4336 |
| 651 | Ga0496121_0040389 | 3300048924 | Bacteria | 4094 |
| 652 | Ga0496121_0048986 | 3300048924 | Bacteria | 3588 |
| 653 | Ga0496121_0054247 | 3300048924 | Bacteria | 3351 |
| 654 | Ga0496121_0104399 | 3300048924 | Bacteria | 2178 |
| 655 | Ga0496122_0074641 | 3300048925 | Bacteria | 2398 |
| 656 | Ga0496124_0000378 | 3300048927 | Bacteria | 81220 |
| 657 | Ga0496124_0020155 | 3300048927 | Bacteria | 6173 |
| 658 | Ga0496124_0072785 | 3300048927 | Bacteria | 2845 |
| 659 | Ga0496124_0090738 | 3300048927 | Bacteria | 2491 |
| 660 | Ga0496125_0003060 | 3300048928 | Bacteria | 20890 |
| 661 | Ga0496125_0026354 | 3300048928 | Bacteria | 5300 |
| 662 | Ga0496125_0068293 | 3300048928 | Bacteria | 2797 |
| 663 | Ga0496125_0071915 | 3300048928 | Bacteria | 2699 |
| 664 | Ga0496125_0110732 | 3300048928 | Bacteria | 1989 |
| 665 | Ga0496125_0124803 | 3300048928 | Bacteria | 1827 |
| 666 | Ga0496125_0146895 | 3300048928 | Bacteria | 1628 |
| 667 | Ga0496126_0001567 | 3300048929 | Bacteria | 35073 |
| 668 | Ga0496126_0001604 | 3300048929 | Bacteria | 34358 |
| 669 | Ga0496126_0014354 | 3300048929 | Bacteria | 8011 |
| 670 | Ga0496126_0017399 | 3300048929 | Bacteria | 7161 |
| 671 | Ga0496126_0018189 | 3300048929 | Bacteria | 6972 |
| 672 | Ga0496126_0031803 | 3300048929 | Bacteria | 4979 |
| 673 | Ga0496126_0057234 | 3300048929 | Bacteria | 3521 |
| 674 | Ga0496126_0072299 | 3300048929 | Bacteria | 3068 |
| 675 | Ga0496126_0080937 | 3300048929 | Bacteria | 2873 |
| 676 | Ga0496126_0085755 | 3300048929 | Bacteria | 2776 |
| 677 | Ga0496126_0109866 | 3300048929 | Bacteria | 2403 |
| 678 | Ga0496126_0199781 | 3300048929 | Bacteria | 1689 |
| 679 | Ga0501031_0029390 | 3300049568 | Bacteria | 3585 |
| 680 | Ga0501034_0016739 | 3300049571 | Bacteria | 7518 |
| 681 | Ga0501038_0122089 | 3300049574 | Bacteria | 2147 |
| 682 | Ga0501038_0135494 | 3300049574 | Bacteria | 2018 |
| 683 | Ga0501042_0042674 | 3300049578 | Bacteria | 3229 |
| 684 | Ga0501042_0060011 | 3300049578 | Bacteria | 2717 |
| 685 | Ga0501047_0021802 | 3300049581 | Bacteria | 6151 |
| 686 | Ga0501070_0009576 | 3300049586 | Bacteria | 8183 |
| 687 | Ga0501072_0118406 | 3300049588 | Bacteria | 2110 |
| 688 | Ga0501073_0048267 | 3300049589 | Bacteria | 2989 |
| 689 | Ga0501073_0169886 | 3300049589 | Bacteria | 1510 |
| 690 | Ga0501076_0021451 | 3300049592 | Bacteria | 4955 |
| 691 | nmdc:mga03683_22163_c1 | 3300050489 | Bacteria | 2460 |
| 692 | nmdc:mga03n38_5011_c1 | 3300050490 | Bacteria | 4462 |
| 693 | nmdc:mga06z11_5428_c1 | 3300050494 | Bacteria | 5112 |
| 694 | nmdc:mga07m45_5405_c1 | 3300050496 | Bacteria | 5864 |
| 695 | nmdc:mga07m45_9385_c1 | 3300050496 | Bacteria | 5073 |
| 696 | nmdc:mga08y16_39496_c1 | 3300050511 | Bacteria | 4951 |
| 697 | nmdc:mga0n895_31203_c1 | 3300050512 | Bacteria | 5099 |
| 698 | nmdc:mga0a205_100493_c1 | 3300050515 | Bacteria | 2791 |
| 699 | nmdc:mga0sz30_18716_c1 | 3300050516 | Bacteria | 2775 |
| 700 | Ga0495601_0003650 | 3300053077 | Bacteria | 8851 |
| 701 | Ga0495601_0034073 | 3300053077 | Bacteria | 3174 |
| 702 | Ga0495601_0068688 | 3300053077 | Bacteria | 2259 |
| 703 | Ga0495612_0005421 | 3300053078 | Bacteria | 5274 |
| 704 | Ga0495612_0007966 | 3300053078 | Bacteria | 4319 |
| 705 | Ga0495612_0025502 | 3300053078 | Bacteria | 2374 |
| 706 | Ga0495595_0003571 | 3300053084 | Bacteria | 6177 |
| 707 | Ga0495595_0006075 | 3300053084 | Bacteria | 4907 |
| 708 | Ga0495619_0040929 | 3300053085 | Bacteria | 3029 |
| 709 | Ga0495619_0110619 | 3300053085 | Bacteria | 1877 |
| 710 | Ga0495619_0166231 | 3300053085 | Bacteria | 1525 |
| 711 | Ga0500643_000028 | 3300053087 | Bacteria | 245672 |
| 712 | Ga0500643_000686 | 3300053087 | Bacteria | 22575 |
| 713 | Ga0500651_0000108 | 3300053093 | Bacteria | 50821 |
| 714 | Ga0500651_0015213 | 3300053093 | Bacteria | 4718 |
| 715 | Ga0500566_0000011 | 3300053094 | Bacteria | 118644 |
| 716 | Ga0500566_0000245 | 3300053094 | Bacteria | 28976 |
| 717 | Ga0500566_0001264 | 3300053094 | Bacteria | 14744 |
| 718 | Ga0500640_008947 | 3300053095 | Bacteria | 3982 |
| 719 | Ga0500641_0003634 | 3300053096 | Bacteria | 5450 |
| 720 | Ga0500554_005062 | 3300053102 | Bacteria | 2844 |
| 721 | Ga0500555_011195 | 3300053103 | Bacteria | 2575 |
| 722 | Ga0500556_0003275 | 3300053104 | Bacteria | 4802 |
| 723 | Ga0500569_001642 | 3300053109 | Bacteria | 4261 |
| 724 | Ga0500572_000281 | 3300053111 | Bacteria | 18537 |
| 725 | Ga0500572_000395 | 3300053111 | Bacteria | 15407 |
| 726 | Ga0500595_000372 | 3300053119 | Bacteria | 28914 |
| 727 | Ga0500595_000489 | 3300053119 | Bacteria | 24099 |
| 728 | Ga0500595_002940 | 3300053119 | Bacteria | 8141 |
| 729 | Ga0500595_004814 | 3300053119 | Bacteria | 5976 |
| 730 | Ga0500595_008036 | 3300053119 | Bacteria | 4329 |
| 731 | Ga0500595_012671 | 3300053119 | Bacteria | 3253 |
| 732 | Ga0500597_007385 | 3300053120 | Bacteria | 3719 |
| 733 | Ga0500608_016467 | 3300053122 | Bacteria | 3340 |
| 734 | Ga0500617_036455 | 3300053124 | Bacteria | 2202 |
| 735 | Ga0500642_0000070 | 3300053130 | Bacteria | 55760 |
| 736 | Ga0500642_0000368 | 3300053130 | Bacteria | 15154 |
| 737 | Ga0500642_0005215 | 3300053130 | Bacteria | 4172 |
| 738 | Ga0500642_0029051 | 3300053130 | Bacteria | 2288 |
| 739 | Ga0500559_0000609 | 3300053136 | Bacteria | 24325 |
| 740 | Ga0500559_0022136 | 3300053136 | Bacteria | 2696 |
| 741 | Ga0500577_0000269 | 3300053142 | Bacteria | 13586 |
| 742 | Ga0500590_016846 | 3300053148 | Bacteria | 3778 |
| 743 | Ga0500603_000115 | 3300053150 | Bacteria | 18809 |
| 744 | Ga0500603_002253 | 3300053150 | Bacteria | 4237 |
| 745 | Ga0500616_0021920 | 3300053153 | Bacteria | 3573 |
| 746 | Ga0500622_0004868 | 3300053156 | Bacteria | 8217 |
| 747 | Ga0500630_003676 | 3300053159 | Bacteria | 7437 |
| 748 | Ga0500634_0081344 | 3300053161 | Bacteria | 1668 |
| 749 | Ga0500638_002737 | 3300053162 | Bacteria | 6273 |
| 750 | Ga0500639_000009 | 3300053163 | Bacteria | 139043 |
| 751 | Ga0500636_0000335 | 3300053177 | Bacteria | 26103 |
| 752 | Ga0500636_0018629 | 3300053177 | Bacteria | 4104 |
| 753 | Ga0500637_0000390 | 3300053178 | Bacteria | 16718 |
| 754 | Ga0500645_009918 | 3300053730 | Bacteria | 3177 |
| 755 | Ga0500609_001065 | 3300053731 | Bacteria | 4099 |
| 756 | Ga0500596_005060 | 3300053735 | Bacteria | 2358 |
| 757 | Ga0500601_000077 | 3300053737 | Bacteria | 20039 |
| 758 | Ga0500601_000106 | 3300053737 | Bacteria | 17299 |
| 759 | Ga0501084_0055624 | 3300054114 | Bacteria | 3310 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8019648815 | 8019655884 | 380 |
| 2 | 3300009545 | Ga0105237_10138092 | Ga0105237_101380922 | 397 |
| 3 | 3300005985 | Ga0081539_10027548 | Ga0081539_100275482 | 400 |
| 4 | 3300005329 | Ga0070683_100032625 | Ga0070683_1000326251 | 410 |
| 5 | 3300048909 | Ga0496106_0005138 | Ga0496106_0005138_6229_7701 | 415 |
| 6 | 3300048921 | Ga0496118_0002027 | Ga0496118_0002027_21724_23196 | 415 |
| 7 | 3300048924 | Ga0496121_0000110 | Ga0496121_0000110_35216_36688 | 415 |
| 8 | 3300048927 | Ga0496124_0000378 | Ga0496124_0000378_5205_6677 | 415 |
| 9 | 3300048929 | Ga0496126_0017399 | Ga0496126_0017399_2082_3554 | 415 |
| 10 | 3300031730 | Ga0307516_10005375 | Ga0307516_100053756 | 416 |
| 11 | 3300039447 | Ga0436361_0211974 | Ga0436361_0211974_111_1472 | 416 |
| 12 | 3300025900 | Ga0207710_10013662 | Ga0207710_100136622 | 420 |
| 13 | 3300028381 | Ga0268264_10000043 | Ga0268264_10000043318 | 420 |
| 14 | 3300035170 | Ga0373943_0040496 | Ga0373943_0040496_731_2203 | 420 |
| 15 | 3300037068 | Ga0373925_0060982 | Ga0373925_0060982_306_1778 | 420 |
| 16 | 3300053177 | Ga0500636_0018629 | Ga0500636_0018629_385_1857 | 420 |
| 17 | 3300003203 | JGI25406J46586_10011188 | JGI25406J46586_100111883 | 423 |
| 18 | 3300003203 | JGI25406J46586_10012161 | JGI25406J46586_100121612 | 423 |
| 19 | 3300003203 | JGI25406J46586_10012193 | JGI25406J46586_100121932 | 423 |
| 20 | 3300003215 | JGI25153J46596_10000366 | JGI25153J46596_1000036613 | 423 |
| 21 | 3300005985 | Ga0081539_10000747 | Ga0081539_1000074743 | 423 |
| 22 | 3300025297 | Ga0209758_1002062 | Ga0209758_100206214 | 423 |
| 23 | 3300035171 | Ga0373946_0069861 | Ga0373946_0069861_74_1399 | 426 |
| 24 | 3300048903 | Ga0496100_0104040 | Ga0496100_0104040_568_1893 | 426 |
| 25 | 3300003659 | JGI25404J52841_10001286 | JGI25404J52841_100012862 | 427 |
| 26 | 3300005983 | Ga0081540_1002773 | Ga0081540_100277314 | 427 |
| 27 | 3300005616 | Ga0068852_100002424 | Ga0068852_1000024246 | 429 |
| 28 | 3300006038 | Ga0075365_10067199 | Ga0075365_100671992 | 429 |
| 29 | 3300009093 | Ga0105240_10006715 | Ga0105240_1000671513 | 429 |
| 30 | 3300009174 | Ga0105241_10007164 | Ga0105241_100071643 | 429 |
| 31 | 3300009545 | Ga0105237_10017337 | Ga0105237_100173375 | 429 |
| 32 | 3300025911 | Ga0207654_10004552 | Ga0207654_100045521 | 429 |
| 33 | 3300025913 | Ga0207695_10000240 | Ga0207695_1000024046 | 429 |
| 34 | 3300025914 | Ga0207671_10006330 | Ga0207671_100063306 | 429 |
| 35 | 3300025927 | Ga0207687_10008466 | Ga0207687_100084662 | 429 |
| 36 | 3300026067 | Ga0207678_10067098 | Ga0207678_100670982 | 429 |
| 37 | 3300026142 | Ga0207698_10021751 | Ga0207698_100217512 | 429 |
| 38 | 3300028786 | Ga0307517_10002374 | Ga0307517_1000237416 | 429 |
| 39 | 3300003354 | JGI25160J50197_1016938 | JGI25160J50197_10169382 | 430 |
| 40 | 3300005262 | Ga0065165_1002106 | Ga0065165_10021062 | 430 |
| 41 | 3300005983 | Ga0081540_1013005 | Ga0081540_10130054 | 430 |
| 42 | 3300025230 | Ga0209563_102315 | Ga0209563_1023155 | 430 |
| 43 | 3300025253 | Ga0209677_103565 | Ga0209677_1035655 | 430 |
| 44 | 3300025302 | Ga0207426_1002767 | Ga0207426_10027675 | 430 |
| 45 | 3300025302 | Ga0207426_1021621 | Ga0207426_10216212 | 430 |
| 46 | 3300025913 | Ga0207695_10000001 | Ga0207695_10000001541 | 430 |
| 47 | 3300031456 | Ga0307513_10139705 | Ga0307513_101397051 | 430 |
| 48 | 3300033180 | Ga0307510_10012541 | Ga0307510_100125416 | 430 |
| 49 | 3300046460 | Ga0495638_0003584 | Ga0495638_0003584_850_2313 | 430 |
| 50 | 3300050489 | nmdc:mga03683_22163_c1 | nmdc:mga03683_22163_c1_1008_2450 | 430 |
| 51 | 3300053087 | Ga0500643_000686 | Ga0500643_000686_4870_6372 | 430 |
| 52 | 3300053103 | Ga0500555_011195 | Ga0500555_011195_1095_2558 | 430 |
| 53 | 3300053156 | Ga0500622_0004868 | Ga0500622_0004868_5959_7422 | 430 |
| 54 | 3300025916 | Ga0207663_10077924 | Ga0207663_100779242 | 431 |
| 55 | 3300047319 | Ga0495674_0040793 | Ga0495674_0040793_2553_3914 | 431 |
| 56 | 3300047322 | Ga0495680_0148278 | Ga0495680_0148278_322_1683 | 431 |
| 57 | 3300050515 | nmdc:mga0a205_100493_c1 | nmdc:mga0a205_100493_c1_455_1834 | 431 |
| 58 | 3300005439 | Ga0070711_100016367 | Ga0070711_1000163675 | 432 |
| 59 | 3300005937 | Ga0081455_10036908 | Ga0081455_100369082 | 432 |
| 60 | 3300035120 | Ga0373957_0004766 | Ga0373957_0004766_2094_3536 | 432 |
| 61 | 3300035410 | Ga0373924_0049542 | Ga0373924_0049542_317_1699 | 432 |
| 62 | 3300035724 | Ga0373933_0008928 | Ga0373933_0008928_3762_5204 | 432 |
| 63 | 3300036401 | Ga0373937_0142763 | Ga0373937_0142763_389_1831 | 432 |
| 64 | 3300046454 | Ga0495592_0008334 | Ga0495592_0008334_4414_5856 | 432 |
| 65 | 3300046455 | Ga0495603_0096535 | Ga0495603_0096535_29_1378 | 432 |
| 66 | 3300046516 | Ga0495628_0019403 | Ga0495628_0019403_2520_3962 | 432 |
| 67 | 3300046536 | Ga0495587_0018457 | Ga0495587_0018457_1581_3023 | 432 |
| 68 | 3300046679 | Ga0495623_0003534 | Ga0495623_0003534_2445_3887 | 432 |
| 69 | 3300047315 | Ga0495581_0023465 | Ga0495581_0023465_34_1392 | 432 |
| 70 | 3300047322 | Ga0495680_0017768 | Ga0495680_0017768_3881_5323 | 432 |
| 71 | 3300047472 | Ga0495686_0105959 | Ga0495686_0105959_82_1440 | 432 |
| 72 | 3300053077 | Ga0495601_0034073 | Ga0495601_0034073_217_1659 | 432 |
| 73 | 3300053078 | Ga0495612_0007966 | Ga0495612_0007966_860_2302 | 432 |
| 74 | 3300053084 | Ga0495595_0003571 | Ga0495595_0003571_2655_4058 | 432 |
| 75 | 3300053085 | Ga0495619_0166231 | Ga0495619_0166231_134_1492 | 432 |
| 76 | 3300053119 | Ga0500595_004814 | Ga0500595_004814_1024_2463 | 432 |
| 77 | 3300009551 | Ga0105238_10033071 | Ga0105238_100330715 | 433 |
| 78 | 3300013296 | Ga0157374_10046855 | Ga0157374_100468553 | 433 |
| 79 | 3300025907 | Ga0207645_10047793 | Ga0207645_100477932 | 433 |
| 80 | 3300039437 | Ga0436365_1552989 | Ga0436365_1552989_69_1517 | 433 |
| 81 | 3300046462 | Ga0495651_0187183 | Ga0495651_0187183_18_1382 | 433 |
| 82 | 3300046533 | Ga0495640_0053587 | Ga0495640_0053587_378_1802 | 433 |
| 83 | 3300046663 | Ga0495635_0008660 | Ga0495635_0008660_5117_6541 | 433 |
| 84 | 3300046675 | Ga0495657_0044699 | Ga0495657_0044699_514_1938 | 433 |
| 85 | 3300046681 | Ga0495647_0002968 | Ga0495647_0002968_3953_5353 | 433 |
| 86 | 3300046689 | Ga0495613_0059287 | Ga0495613_0059287_216_1640 | 433 |
| 87 | 3300046809 | Ga0495600_0012306 | Ga0495600_0012306_3795_5219 | 433 |
| 88 | 3300047317 | Ga0495604_0001856 | Ga0495604_0001856_13733_15157 | 433 |
| 89 | 3300047319 | Ga0495674_0007305 | Ga0495674_0007305_7453_8853 | 433 |
| 90 | 3300047321 | Ga0495676_0020272 | Ga0495676_0020272_608_2032 | 433 |
| 91 | 3300047444 | Ga0495675_0142380 | Ga0495675_0142380_40_1464 | 433 |
| 92 | 3300048907 | Ga0496104_0001629 | Ga0496104_0001629_16644_18068 | 433 |
| 93 | 3300048908 | Ga0496105_0056234 | Ga0496105_0056234_307_1731 | 433 |
| 94 | 3300048928 | Ga0496125_0124803 | Ga0496125_0124803_320_1744 | 433 |
| 95 | 3300053136 | Ga0500559_0022136 | Ga0500559_0022136_1235_2659 | 433 |
| 96 | 3300025981 | Ga0207640_10074258 | Ga0207640_100742581 | 434 |
| 97 | 3300026078 | Ga0207702_10143700 | Ga0207702_101437002 | 434 |
| 98 | 3300037471 | Ga0395905_0160578 | Ga0395905_0160578_639_2102 | 434 |
| 99 | 3300048924 | Ga0496121_0054247 | Ga0496121_0054247_1457_2920 | 434 |
| 100 | 3300005564 | Ga0070664_100108691 | Ga0070664_1001086912 | 435 |
| 101 | 3300009098 | Ga0105245_10026215 | Ga0105245_100262153 | 435 |
| 102 | 3300021320 | Ga0214544_1000013 | Ga0214544_1000013178 | 435 |
| 103 | 3300021321 | Ga0214542_1000013 | Ga0214542_100001356 | 435 |
| 104 | 3300021324 | Ga0214545_1000012 | Ga0214545_1000012179 | 435 |
| 105 | 3300021327 | Ga0214543_1000065 | Ga0214543_100006514 | 435 |
| 106 | 3300025254 | Ga0209148_1000319 | Ga0209148_100031952 | 435 |
| 107 | 3300037418 | Ga0395900_0089725 | Ga0395900_0089725_1361_2755 | 435 |
| 108 | 3300037418 | Ga0395900_0134326 | Ga0395900_0134326_1097_2488 | 435 |
| 109 | 3300037466 | Ga0395898_0036523 | Ga0395898_0036523_404_1798 | 435 |
| 110 | 3300038443 | Ga0395901_0001945 | Ga0395901_0001945_2954_4345 | 435 |
| 111 | 3300046471 | Ga0495650_0000038 | Ga0495650_0000038_105729_107192 | 435 |
| 112 | 3300049571 | Ga0501034_0016739 | Ga0501034_0016739_559_1953 | 435 |
| 113 | 3300009093 | Ga0105240_10000001 | Ga0105240_10000001540 | 436 |
| 114 | 3300025297 | Ga0209758_1003963 | Ga0209758_10039633 | 436 |
| 115 | 3300044684 | Ga0466966_0013093 | Ga0466966_0013093_3715_5178 | 436 |
| 116 | 3300044693 | Ga0466961_0000016 | Ga0466961_0000016_65610_67073 | 436 |
| 117 | 3300045049 | Ga0466959_0002071 | Ga0466959_0002071_3178_4641 | 436 |
| 118 | 3300045836 | Ga0466958_0106234 | Ga0466958_0106234_37_1500 | 436 |
| 119 | 3300005455 | Ga0070663_100062456 | Ga0070663_1000624562 | 437 |
| 120 | 3300005518 | Ga0070699_100176273 | Ga0070699_1001762731 | 437 |
| 121 | 3300005843 | Ga0068860_100072316 | Ga0068860_1000723163 | 437 |
| 122 | 3300014325 | Ga0163163_10003981 | Ga0163163_100039814 | 437 |
| 123 | 3300025921 | Ga0207652_10024276 | Ga0207652_100242764 | 437 |
| 124 | 3300025935 | Ga0207709_10026836 | Ga0207709_100268364 | 437 |
| 125 | 3300035172 | Ga0373955_0004252 | Ga0373955_0004252_1020_2480 | 437 |
| 126 | 3300046477 | Ga0495664_0038845 | Ga0495664_0038845_1331_2788 | 437 |
| 127 | 3300048905 | Ga0496102_0200979 | Ga0496102_0200979_132_1613 | 437 |
| 128 | 3300048910 | Ga0496107_0041791 | Ga0496107_0041791_315_1796 | 437 |
| 129 | 3300049589 | Ga0501073_0169886 | Ga0501073_0169886_28_1359 | 437 |
| 130 | 3300005336 | Ga0070680_100004282 | Ga0070680_1000042827 | 438 |
| 131 | 3300005458 | Ga0070681_10001279 | Ga0070681_1000127918 | 438 |
| 132 | 3300005530 | Ga0070679_100002107 | Ga0070679_1000021072 | 438 |
| 133 | 3300009093 | Ga0105240_10132992 | Ga0105240_101329922 | 438 |
| 134 | 3300025261 | Ga0209233_1001276 | Ga0209233_10012763 | 438 |
| 135 | 3300025912 | Ga0207707_10000080 | Ga0207707_1000008088 | 438 |
| 136 | 3300025917 | Ga0207660_10002408 | Ga0207660_100024082 | 438 |
| 137 | 3300025921 | Ga0207652_10001974 | Ga0207652_1000197412 | 438 |
| 138 | 3300031241 | Ga0265325_10051657 | Ga0265325_100516572 | 438 |
| 139 | 3300046462 | Ga0495651_0017002 | Ga0495651_0017002_4140_5591 | 438 |
| 140 | 3300046516 | Ga0495628_0104958 | Ga0495628_0104958_393_1844 | 438 |
| 141 | 3300046529 | Ga0495652_0021303 | Ga0495652_0021303_3066_4517 | 438 |
| 142 | 3300046559 | Ga0495667_0015701 | Ga0495667_0015701_3008_4459 | 438 |
| 143 | 3300046678 | Ga0495599_0065770 | Ga0495599_0065770_470_1921 | 438 |
| 144 | 3300046692 | Ga0495671_0025187 | Ga0495671_0025187_203_1654 | 438 |
| 145 | 3300047317 | Ga0495604_0001405 | Ga0495604_0001405_14530_15981 | 438 |
| 146 | 3300047322 | Ga0495680_0001853 | Ga0495680_0001853_13945_15396 | 438 |
| 147 | 3300047471 | Ga0495684_0145083 | Ga0495684_0145083_286_1737 | 438 |
| 148 | 3300048088 | Ga0495602_0003593 | Ga0495602_0003593_10578_12029 | 438 |
| 149 | iso_pu_bacteria | 2513237095 | 2513649227 | 438 |
| 150 | iso_pu_bacteria | 2528768022 | 2528849466 | 438 |
| 151 | iso_pu_bacteria | 2791355196 | 2793059274 | 438 |
| 152 | iso_pu_bacteria | 2816332527 | 2818240615 | 438 |
| 153 | iso_pu_bacteria | 2824661429 | 2824665866 | 438 |
| 154 | iso_pu_bacteria | 2874628541 | 2874629606 | 438 |
| 155 | iso_pu_bacteria | 2879099564 | 2879104460 | 438 |
| 156 | iso_pu_bacteria | 2888378607 | 2888387295 | 438 |
| 157 | iso_pu_bacteria | 2929615660 | 2929622666 | 438 |
| 158 | iso_pu_bacteria | 2929624759 | 2929632231 | 438 |
| 159 | iso_pu_bacteria | 2932784394 | 2932789992 | 438 |
| 160 | iso_pu_bacteria | 2932809354 | 2932815534 | 438 |
| 161 | iso_pu_bacteria | 2932818245 | 2932824890 | 438 |
| 162 | iso_pu_bacteria | 2933577622 | 2933584703 | 438 |
| 163 | iso_pu_bacteria | 2935616580 | 2935617627 | 438 |
| 164 | iso_pu_bacteria | 2935638405 | 2935643672 | 438 |
| 165 | iso_pu_bacteria | 2935665750 | 2935671018 | 438 |
| 166 | iso_pu_bacteria | 2935675223 | 2935681661 | 438 |
| 167 | iso_pu_bacteria | 2935684952 | 2935692638 | 438 |
| 168 | iso_pu_bacteria | 2935694250 | 2935702625 | 438 |
| 169 | iso_pu_bacteria | 2935703347 | 2935711912 | 438 |
| 170 | iso_pu_bacteria | 2935713505 | 2935721256 | 438 |
| 171 | iso_pu_bacteria | 2935722832 | 2935730750 | 438 |
| 172 | iso_pu_bacteria | 2935732158 | 2935739946 | 438 |
| 173 | iso_pu_bacteria | 2935741537 | 2935748984 | 438 |
| 174 | iso_pu_bacteria | 2935750917 | 2935758854 | 438 |
| 175 | iso_pu_bacteria | 2935760218 | 2935767118 | 438 |
| 176 | iso_pu_bacteria | 2935801545 | 2935806883 | 438 |
| 177 | iso_pu_bacteria | 2935827899 | 2935834357 | 438 |
| 178 | iso_pu_bacteria | 2935837841 | 2935843918 | 438 |
| 179 | iso_pu_bacteria | 2935855204 | 2935856874 | 438 |
| 180 | iso_pu_bacteria | 2935864058 | 2935868401 | 438 |
| 181 | iso_pu_bacteria | 2935873716 | 2935879711 | 438 |
| 182 | iso_pu_bacteria | 2935959822 | 2935965336 | 438 |
| 183 | iso_pu_bacteria | 2935992306 | 2935997217 | 438 |
| 184 | iso_pu_bacteria | 2936002035 | 2936009964 | 438 |
| 185 | iso_pu_bacteria | 2940556831 | 2940564556 | 438 |
| 186 | iso_pu_bacteria | 2941538514 | 2941545166 | 438 |
| 187 | iso_pu_bacteria | 8019576017 | 8019578183 | 438 |
| 188 | iso_pu_bacteria | 8019597564 | 8019605479 | 438 |
| 189 | iso_pu_bacteria | 8055742211 | 8055750549 | 438 |
| 190 | iso_pu_bacteria | 8056967851 | 8056975332 | 438 |
| 191 | 3300003203 | JGI25406J46586_10000211 | JGI25406J46586_1000021112 | 439 |
| 192 | 3300005434 | Ga0070709_10001276 | Ga0070709_1000127612 | 439 |
| 193 | 3300005435 | Ga0070714_100026244 | Ga0070714_1000262443 | 439 |
| 194 | 3300005436 | Ga0070713_100121129 | Ga0070713_1001211293 | 439 |
| 195 | 3300005437 | Ga0070710_10000994 | Ga0070710_100009945 | 439 |
| 196 | 3300005439 | Ga0070711_100015612 | Ga0070711_1000156124 | 439 |
| 197 | 3300005468 | Ga0070707_100244890 | Ga0070707_1002448901 | 439 |
| 198 | 3300005548 | Ga0070665_100049712 | Ga0070665_1000497125 | 439 |
| 199 | 3300005563 | Ga0068855_100074479 | Ga0068855_1000744791 | 439 |
| 200 | 3300005614 | Ga0068856_100048565 | Ga0068856_1000485652 | 439 |
| 201 | 3300005618 | Ga0068864_100157775 | Ga0068864_1001577752 | 439 |
| 202 | 3300005937 | Ga0081455_10070810 | Ga0081455_100708103 | 439 |
| 203 | 3300005985 | Ga0081539_10002377 | Ga0081539_1000237712 | 439 |
| 204 | 3300006163 | Ga0070715_10017240 | Ga0070715_100172402 | 439 |
| 205 | 3300006175 | Ga0070712_100064719 | Ga0070712_1000647193 | 439 |
| 206 | 3300006852 | Ga0075433_10043130 | Ga0075433_100431303 | 439 |
| 207 | 3300006871 | Ga0075434_100018537 | Ga0075434_1000185374 | 439 |
| 208 | 3300009177 | Ga0105248_10028360 | Ga0105248_100283606 | 439 |
| 209 | 3300009553 | Ga0105249_10021024 | Ga0105249_100210242 | 439 |
| 210 | 3300013306 | Ga0163162_10007620 | Ga0163162_100076204 | 439 |
| 211 | 3300025297 | Ga0209758_1004684 | Ga0209758_10046843 | 439 |
| 212 | 3300025898 | Ga0207692_10000950 | Ga0207692_100009506 | 439 |
| 213 | 3300025906 | Ga0207699_10004122 | Ga0207699_100041221 | 439 |
| 214 | 3300025915 | Ga0207693_10037258 | Ga0207693_100372583 | 439 |
| 215 | 3300025916 | Ga0207663_10008433 | Ga0207663_100084335 | 439 |
| 216 | 3300025929 | Ga0207664_10041705 | Ga0207664_100417051 | 439 |
| 217 | 3300025939 | Ga0207665_10048485 | Ga0207665_100484852 | 439 |
| 218 | 3300025941 | Ga0207711_10023662 | Ga0207711_100236624 | 439 |
| 219 | 3300025961 | Ga0207712_10029202 | Ga0207712_100292021 | 439 |
| 220 | 3300028379 | Ga0268266_10001437 | Ga0268266_100014373 | 439 |
| 221 | 3300028379 | Ga0268266_10016394 | Ga0268266_100163943 | 439 |
| 222 | 3300033180 | Ga0307510_10067703 | Ga0307510_100677032 | 439 |
| 223 | 3300046455 | Ga0495603_0012700 | Ga0495603_0012700_2665_4134 | 439 |
| 224 | 3300046462 | Ga0495651_0095391 | Ga0495651_0095391_37_1569 | 439 |
| 225 | 3300046471 | Ga0495650_0002096 | Ga0495650_0002096_5489_6952 | 439 |
| 226 | 3300046473 | Ga0495582_0001540 | Ga0495582_0001540_16_1485 | 439 |
| 227 | 3300046477 | Ga0495664_0005846 | Ga0495664_0005846_3433_4902 | 439 |
| 228 | 3300046499 | Ga0495594_0003180 | Ga0495594_0003180_4223_5692 | 439 |
| 229 | 3300046499 | Ga0495594_0009698 | Ga0495594_0009698_1897_3393 | 439 |
| 230 | 3300046523 | Ga0495644_0000300 | Ga0495644_0000300_4239_5708 | 439 |
| 231 | 3300046526 | Ga0495666_0007697 | Ga0495666_0007697_865_2334 | 439 |
| 232 | 3300046528 | Ga0495642_0024644 | Ga0495642_0024644_852_2321 | 439 |
| 233 | 3300046538 | Ga0495609_0019296 | Ga0495609_0019296_899_2368 | 439 |
| 234 | 3300046543 | Ga0495645_0016899 | Ga0495645_0016899_2218_3687 | 439 |
| 235 | 3300046559 | Ga0495667_0056493 | Ga0495667_0056493_394_1863 | 439 |
| 236 | 3300046616 | Ga0495668_0056386 | Ga0495668_0056386_351_1808 | 439 |
| 237 | 3300046642 | Ga0495634_0033315 | Ga0495634_0033315_106_1575 | 439 |
| 238 | 3300046660 | Ga0495625_0000814 | Ga0495625_0000814_38206_39666 | 439 |
| 239 | 3300046660 | Ga0495625_0078570 | Ga0495625_0078570_641_2098 | 439 |
| 240 | 3300046684 | Ga0495669_0022128 | Ga0495669_0022128_118_1587 | 439 |
| 241 | 3300046689 | Ga0495613_0003043 | Ga0495613_0003043_843_2339 | 439 |
| 242 | 3300047315 | Ga0495581_0005373 | Ga0495581_0005373_3421_4890 | 439 |
| 243 | 3300047320 | Ga0495672_0001637 | Ga0495672_0001637_873_2336 | 439 |
| 244 | 3300047321 | Ga0495676_0036432 | Ga0495676_0036432_2540_4009 | 439 |
| 245 | 3300047444 | Ga0495675_0004302 | Ga0495675_0004302_529_1998 | 439 |
| 246 | 3300047471 | Ga0495684_0030968 | Ga0495684_0030968_2208_3677 | 439 |
| 247 | 3300047472 | Ga0495686_0032501 | Ga0495686_0032501_344_1816 | 439 |
| 248 | 3300048909 | Ga0496106_0067899 | Ga0496106_0067899_705_2171 | 439 |
| 249 | 3300048929 | Ga0496126_0001604 | Ga0496126_0001604_22307_23761 | 439 |
| 250 | 3300048929 | Ga0496126_0109866 | Ga0496126_0109866_720_2183 | 439 |
| 251 | 3300050512 | nmdc:mga0n895_31203_c1 | nmdc:mga0n895_31203_c1_278_1744 | 439 |
| 252 | 3300053093 | Ga0500651_0000108 | Ga0500651_0000108_30050_31510 | 439 |
| 253 | 3300053104 | Ga0500556_0003275 | Ga0500556_0003275_3128_4591 | 439 |
| 254 | 3300053119 | Ga0500595_000489 | Ga0500595_000489_14547_16001 | 439 |
| 255 | 3300053142 | Ga0500577_0000269 | Ga0500577_0000269_1996_3483 | 439 |
| 256 | iso_pu_bacteria | 2508501128 | 2509151751 | 439 |
| 257 | iso_pu_bacteria | 2508501128 | 2509151999 | 439 |
| 258 | iso_pu_bacteria | 2511231028 | 2511398664 | 439 |
| 259 | iso_pu_bacteria | 2511231028 | 2511400278 | 439 |
| 260 | iso_pu_bacteria | 2513237092 | 2513625996 | 439 |
| 261 | iso_pu_bacteria | 2513237098 | 2513671044 | 439 |
| 262 | iso_pu_bacteria | 2513237101 | 2513694471 | 439 |
| 263 | iso_pu_bacteria | 2513237102 | 2513704574 | 439 |
| 264 | iso_pu_bacteria | 2513237104 | 2513715771 | 439 |
| 265 | iso_pu_bacteria | 2513237137 | 2513861542 | 439 |
| 266 | iso_pu_bacteria | 2513237139 | 2513874150 | 439 |
| 267 | iso_pu_bacteria | 2513237141 | 2513888234 | 439 |
| 268 | iso_pu_bacteria | 2513237145 | 2513919775 | 439 |
| 269 | iso_pu_bacteria | 2513237161 | 2514010089 | 439 |
| 270 | iso_pu_bacteria | 2517093001 | 2517103049 | 439 |
| 271 | iso_pu_bacteria | 2517572143 | 2517895214 | 439 |
| 272 | iso_pu_bacteria | 2524023205 | 2524438890 | 439 |
| 273 | iso_pu_bacteria | 2524023210 | 2524465942 | 439 |
| 274 | iso_pu_bacteria | 2524023228 | 2524536341 | 439 |
| 275 | iso_pu_bacteria | 2528768022 | 2528854328 | 439 |
| 276 | iso_pu_bacteria | 2617270741 | 2617378798 | 439 |
| 277 | iso_pu_bacteria | 2667528175 | 2671121762 | 439 |
| 278 | iso_pu_bacteria | 2721755755 | 2723849046 | 439 |
| 279 | iso_pu_bacteria | 2728368998 | 2728752168 | 439 |
| 280 | iso_pu_bacteria | 2744054633 | 2745081944 | 439 |
| 281 | iso_pu_bacteria | 2791355197 | 2793069164 | 439 |
| 282 | iso_pu_bacteria | 2791355199 | 2793079818 | 439 |
| 283 | iso_pu_bacteria | 2802429603 | 2805920868 | 439 |
| 284 | iso_pu_bacteria | 2816332527 | 2818242580 | 439 |
| 285 | iso_pu_bacteria | 2824617872 | 2824620867 | 439 |
| 286 | iso_pu_bacteria | 2824626560 | 2824628271 | 439 |
| 287 | iso_pu_bacteria | 2824635225 | 2824636180 | 439 |
| 288 | iso_pu_bacteria | 2824644064 | 2824647031 | 439 |
| 289 | iso_pu_bacteria | 2824661429 | 2824662530 | 439 |
| 290 | iso_pu_bacteria | 2824671348 | 2824675837 | 439 |
| 291 | iso_pu_bacteria | 2824679649 | 2824681205 | 439 |
| 292 | iso_pu_bacteria | 2824687955 | 2824692798 | 439 |
| 293 | iso_pu_bacteria | 2824696289 | 2824699373 | 439 |
| 294 | iso_pu_bacteria | 2824704595 | 2824709646 | 439 |
| 295 | iso_pu_bacteria | 2824714736 | 2824719080 | 439 |
| 296 | iso_pu_bacteria | 2824723954 | 2824727478 | 439 |
| 297 | iso_pu_bacteria | 2824732956 | 2824734710 | 439 |
| 298 | iso_pu_bacteria | 2824746037 | 2824747772 | 439 |
| 299 | iso_pu_bacteria | 2824753945 | 2824756281 | 439 |
| 300 | iso_pu_bacteria | 2824753945 | 2824761504 | 439 |
| 301 | iso_pu_bacteria | 2824763712 | 2824763965 | 439 |
| 302 | iso_pu_bacteria | 2824763712 | 2824765047 | 439 |
| 303 | iso_pu_bacteria | 2824773399 | 2824778031 | 439 |
| 304 | iso_pu_bacteria | 2838122688 | 2838126002 | 439 |
| 305 | iso_pu_bacteria | 2841941048 | 2841942605 | 439 |
| 306 | iso_pu_bacteria | 2841949485 | 2841953046 | 439 |
| 307 | iso_pu_bacteria | 2841957949 | 2841963897 | 439 |
| 308 | iso_pu_bacteria | 2841966195 | 2841970929 | 439 |
| 309 | iso_pu_bacteria | 2841974524 | 2841977811 | 439 |
| 310 | iso_pu_bacteria | 2841983080 | 2841984625 | 439 |
| 311 | iso_pu_bacteria | 2847939898 | 2847943186 | 439 |
| 312 | iso_pu_bacteria | 2849076700 | 2849081176 | 439 |
| 313 | iso_pu_bacteria | 2857509624 | 2857516041 | 439 |
| 314 | iso_pu_bacteria | 2874604998 | 2874607055 | 439 |
| 315 | iso_pu_bacteria | 2874628541 | 2874634628 | 439 |
| 316 | iso_pu_bacteria | 2876808645 | 2876812277 | 439 |
| 317 | iso_pu_bacteria | 2879099564 | 2879109660 | 439 |
| 318 | iso_pu_bacteria | 2879110137 | 2879117108 | 439 |
| 319 | iso_pu_bacteria | 2881364244 | 2881365096 | 439 |
| 320 | iso_pu_bacteria | 2885374607 | 2885375641 | 439 |
| 321 | iso_pu_bacteria | 2885383462 | 2885385249 | 439 |
| 322 | iso_pu_bacteria | 2888378607 | 2888381902 | 439 |
| 323 | iso_pu_bacteria | 2888388044 | 2888388739 | 439 |
| 324 | iso_pu_bacteria | 2889033259 | 2889034845 | 439 |
| 325 | iso_pu_bacteria | 2903748898 | 2903754286 | 439 |
| 326 | iso_pu_bacteria | 2903768456 | 2903768807 | 439 |
| 327 | iso_pu_bacteria | 2904690495 | 2904698267 | 439 |
| 328 | iso_pu_bacteria | 2904711408 | 2904716514 | 439 |
| 329 | iso_pu_bacteria | 2904711408 | 2904720451 | 439 |
| 330 | iso_pu_bacteria | 2906610324 | 2906611881 | 439 |
| 331 | iso_pu_bacteria | 2906635258 | 2906635854 | 439 |
| 332 | iso_pu_bacteria | 2906660503 | 2906665437 | 439 |
| 333 | iso_pu_bacteria | 2908756301 | 2908762867 | 439 |
| 334 | iso_pu_bacteria | 2908775508 | 2908778156 | 439 |
| 335 | iso_pu_bacteria | 2922361189 | 2922364722 | 439 |
| 336 | iso_pu_bacteria | 2922368715 | 2922370277 | 439 |
| 337 | iso_pu_bacteria | 2922368715 | 2922371851 | 439 |
| 338 | iso_pu_bacteria | 2922386360 | 2922391816 | 439 |
| 339 | iso_pu_bacteria | 2922393267 | 2922399428 | 439 |
| 340 | iso_pu_bacteria | 2922425934 | 2922427417 | 439 |
| 341 | iso_pu_bacteria | 2929615660 | 2929616799 | 439 |
| 342 | iso_pu_bacteria | 2929624759 | 2929625542 | 439 |
| 343 | iso_pu_bacteria | 2932784394 | 2932791178 | 439 |
| 344 | iso_pu_bacteria | 2932809354 | 2932811639 | 439 |
| 345 | iso_pu_bacteria | 2932818245 | 2932826444 | 439 |
| 346 | iso_pu_bacteria | 2932828146 | 2932834209 | 439 |
| 347 | iso_pu_bacteria | 2933577622 | 2933577919 | 439 |
| 348 | iso_pu_bacteria | 2935608549 | 2935613125 | 439 |
| 349 | iso_pu_bacteria | 2935608549 | 2935616120 | 439 |
| 350 | iso_pu_bacteria | 2935616580 | 2935623968 | 439 |
| 351 | iso_pu_bacteria | 2935630451 | 2935637174 | 439 |
| 352 | iso_pu_bacteria | 2935638405 | 2935647014 | 439 |
| 353 | iso_pu_bacteria | 2935665750 | 2935674295 | 439 |
| 354 | iso_pu_bacteria | 2935675223 | 2935682396 | 439 |
| 355 | iso_pu_bacteria | 2935684952 | 2935691610 | 439 |
| 356 | iso_pu_bacteria | 2935694250 | 2935699484 | 439 |
| 357 | iso_pu_bacteria | 2935703347 | 2935707712 | 439 |
| 358 | iso_pu_bacteria | 2935713505 | 2935719444 | 439 |
| 359 | iso_pu_bacteria | 2935722832 | 2935728956 | 439 |
| 360 | iso_pu_bacteria | 2935732158 | 2935737803 | 439 |
| 361 | iso_pu_bacteria | 2935741537 | 2935747179 | 439 |
| 362 | iso_pu_bacteria | 2935750917 | 2935758021 | 439 |
| 363 | iso_pu_bacteria | 2935760218 | 2935766659 | 439 |
| 364 | iso_pu_bacteria | 2935801545 | 2935809461 | 439 |
| 365 | iso_pu_bacteria | 2935810662 | 2935817780 | 439 |
| 366 | iso_pu_bacteria | 2935810662 | 2935818852 | 439 |
| 367 | iso_pu_bacteria | 2935819856 | 2935820016 | 439 |
| 368 | iso_pu_bacteria | 2935819856 | 2935825023 | 439 |
| 369 | iso_pu_bacteria | 2935827899 | 2935836281 | 439 |
| 370 | iso_pu_bacteria | 2935837841 | 2935845193 | 439 |
| 371 | iso_pu_bacteria | 2935847175 | 2935849974 | 439 |
| 372 | iso_pu_bacteria | 2935847175 | 2935852242 | 439 |
| 373 | iso_pu_bacteria | 2935855204 | 2935862182 | 439 |
| 374 | iso_pu_bacteria | 2935864058 | 2935870891 | 439 |
| 375 | iso_pu_bacteria | 2935873716 | 2935881284 | 439 |
| 376 | iso_pu_bacteria | 2935883170 | 2935884344 | 439 |
| 377 | iso_pu_bacteria | 2935908558 | 2935910676 | 439 |
| 378 | iso_pu_bacteria | 2935916978 | 2935921856 | 439 |
| 379 | iso_pu_bacteria | 2935926038 | 2935930005 | 439 |
| 380 | iso_pu_bacteria | 2935934488 | 2935937673 | 439 |
| 381 | iso_pu_bacteria | 2935942939 | 2935949777 | 439 |
| 382 | iso_pu_bacteria | 2935951376 | 2935956873 | 439 |
| 383 | iso_pu_bacteria | 2935959822 | 2935963739 | 439 |
| 384 | iso_pu_bacteria | 2935967501 | 2935970870 | 439 |
| 385 | iso_pu_bacteria | 2935992306 | 2935999124 | 439 |
| 386 | iso_pu_bacteria | 2936002035 | 2936005544 | 439 |
| 387 | iso_pu_bacteria | 2936037263 | 2936042073 | 439 |
| 388 | iso_pu_bacteria | 2936037263 | 2936045462 | 439 |
| 389 | iso_pu_bacteria | 2940556831 | 2940564068 | 439 |
| 390 | iso_pu_bacteria | 2941507105 | 2941513739 | 439 |
| 391 | iso_pu_bacteria | 2941515067 | 2941521701 | 439 |
| 392 | iso_pu_bacteria | 2941523033 | 2941529631 | 439 |
| 393 | iso_pu_bacteria | 2941531003 | 2941535056 | 439 |
| 394 | iso_pu_bacteria | 2941538514 | 2941545519 | 439 |
| 395 | iso_pu_bacteria | 3005474847 | 3005477129 | 439 |
| 396 | iso_pu_bacteria | 3005483717 | 3005488639 | 439 |
| 397 | iso_pu_bacteria | 3005506211 | 3005512578 | 439 |
| 398 | iso_pu_bacteria | 3005594810 | 3005596912 | 439 |
| 399 | iso_pu_bacteria | 3005710791 | 3005712944 | 439 |
| 400 | iso_pu_bacteria | 3005710791 | 3005717558 | 439 |
| 401 | iso_pu_bacteria | 3005718088 | 3005720323 | 439 |
| 402 | iso_pu_bacteria | 8006926726 | 8006928759 | 439 |
| 403 | iso_pu_bacteria | 8006933436 | 8006938340 | 439 |
| 404 | iso_pu_bacteria | 8006964411 | 8006965058 | 439 |
| 405 | iso_pu_bacteria | 8006973647 | 8006978417 | 439 |
| 406 | iso_pu_bacteria | 8006984368 | 8006988492 | 439 |
| 407 | iso_pu_bacteria | 8006994254 | 8006995306 | 439 |
| 408 | iso_pu_bacteria | 8016511872 | 8016515833 | 439 |
| 409 | iso_pu_bacteria | 8017057580 | 8017060675 | 439 |
| 410 | iso_pu_bacteria | 8019555841 | 8019560689 | 439 |
| 411 | iso_pu_bacteria | 8019565922 | 8019570773 | 439 |
| 412 | iso_pu_bacteria | 8019576017 | 8019580187 | 439 |
| 413 | iso_pu_bacteria | 8019597564 | 8019603422 | 439 |
| 414 | iso_pu_bacteria | 8019687851 | 8019695438 | 439 |
| 415 | iso_pu_bacteria | 8055742211 | 8055748444 | 439 |
| 416 | iso_pu_bacteria | 8056673599 | 8056679201 | 439 |
| 417 | iso_pu_bacteria | 8056681323 | 8056682821 | 439 |
| 418 | iso_pu_bacteria | 8056689827 | 8056691520 | 439 |
| 419 | 3300003215 | JGI25153J46596_10002691 | JGI25153J46596_100026917 | 440 |
| 420 | 3300003354 | JGI25160J50197_1000634 | JGI25160J50197_100063413 | 440 |
| 421 | 3300004625 | Ga0055543_1007582 | Ga0055543_10075823 | 440 |
| 422 | 3300005262 | Ga0065165_1000370 | Ga0065165_100037023 | 440 |
| 423 | 3300005347 | Ga0070668_100138081 | Ga0070668_1001380812 | 440 |
| 424 | 3300005367 | Ga0070667_100043969 | Ga0070667_1000439692 | 440 |
| 425 | 3300005435 | Ga0070714_100019221 | Ga0070714_1000192212 | 440 |
| 426 | 3300005436 | Ga0070713_100002401 | Ga0070713_1000024016 | 440 |
| 427 | 3300005437 | Ga0070710_10019839 | Ga0070710_100198392 | 440 |
| 428 | 3300005439 | Ga0070711_100019871 | Ga0070711_1000198712 | 440 |
| 429 | 3300005455 | Ga0070663_100033776 | Ga0070663_1000337762 | 440 |
| 430 | 3300006028 | Ga0070717_10056632 | Ga0070717_100566323 | 440 |
| 431 | 3300006038 | Ga0075365_10016054 | Ga0075365_100160541 | 440 |
| 432 | 3300006042 | Ga0075368_10008381 | Ga0075368_100083812 | 440 |
| 433 | 3300006048 | Ga0075363_100023739 | Ga0075363_1000237391 | 440 |
| 434 | 3300006163 | Ga0070715_10000080 | Ga0070715_1000008015 | 440 |
| 435 | 3300009101 | Ga0105247_10027235 | Ga0105247_100272352 | 440 |
| 436 | 3300009148 | Ga0105243_10135334 | Ga0105243_101353342 | 440 |
| 437 | 3300013308 | Ga0157375_10064324 | Ga0157375_100643242 | 440 |
| 438 | 3300014969 | Ga0157376_10028666 | Ga0157376_100286663 | 440 |
| 439 | 3300025254 | Ga0209148_1000577 | Ga0209148_100057733 | 440 |
| 440 | 3300025261 | Ga0209233_1001653 | Ga0209233_10016536 | 440 |
| 441 | 3300025272 | Ga0209455_1002601 | Ga0209455_10026015 | 440 |
| 442 | 3300025302 | Ga0207426_1000271 | Ga0207426_100027155 | 440 |
| 443 | 3300025898 | Ga0207692_10001820 | Ga0207692_100018203 | 440 |
| 444 | 3300025904 | Ga0207647_10028961 | Ga0207647_100289614 | 440 |
| 445 | 3300025906 | Ga0207699_10043081 | Ga0207699_100430812 | 440 |
| 446 | 3300025915 | Ga0207693_10001000 | Ga0207693_100010007 | 440 |
| 447 | 3300025916 | Ga0207663_10000382 | Ga0207663_1000038213 | 440 |
| 448 | 3300025931 | Ga0207644_10155376 | Ga0207644_101553762 | 440 |
| 449 | 3300025939 | Ga0207665_10002330 | Ga0207665_100023306 | 440 |
| 450 | 3300025986 | Ga0207658_10090008 | Ga0207658_100900082 | 440 |
| 451 | 3300025986 | Ga0207658_10177749 | Ga0207658_101777492 | 440 |
| 452 | 3300026067 | Ga0207678_10016142 | Ga0207678_100161422 | 440 |
| 453 | 3300026067 | Ga0207678_10127642 | Ga0207678_101276422 | 440 |
| 454 | 3300026095 | Ga0207676_10161109 | Ga0207676_101611092 | 440 |
| 455 | 3300026121 | Ga0207683_10072698 | Ga0207683_100726983 | 440 |
| 456 | 3300028379 | Ga0268266_10041405 | Ga0268266_100414052 | 440 |
| 457 | 3300031247 | Ga0265340_10012248 | Ga0265340_100122484 | 440 |
| 458 | 3300031249 | Ga0265339_10019126 | Ga0265339_100191264 | 440 |
| 459 | 3300031711 | Ga0265314_10003222 | Ga0265314_1000322216 | 440 |
| 460 | 3300031712 | Ga0265342_10007451 | Ga0265342_100074515 | 440 |
| 461 | 3300031712 | Ga0265342_10057748 | Ga0265342_100577483 | 440 |
| 462 | 3300031730 | Ga0307516_10040408 | Ga0307516_100404082 | 440 |
| 463 | 3300033180 | Ga0307510_10002885 | Ga0307510_100028852 | 440 |
| 464 | 3300033180 | Ga0307510_10146539 | Ga0307510_101465392 | 440 |
| 465 | 3300039437 | Ga0436365_1138701 | Ga0436365_1138701_1323_2963 | 440 |
| 466 | 3300039437 | Ga0436365_1665810 | Ga0436365_1665810_2748_4220 | 440 |
| 467 | 3300039453 | Ga0436362_0505551 | Ga0436362_0505551_1434_3074 | 440 |
| 468 | 3300046454 | Ga0495592_0118504 | Ga0495592_0118504_400_1851 | 440 |
| 469 | 3300046460 | Ga0495638_0003490 | Ga0495638_0003490_351_1814 | 440 |
| 470 | 3300046507 | Ga0495606_0090115 | Ga0495606_0090115_233_1696 | 440 |
| 471 | 3300046524 | Ga0495648_0007181 | Ga0495648_0007181_4606_6099 | 440 |
| 472 | 3300046524 | Ga0495648_0086930 | Ga0495648_0086930_127_1578 | 440 |
| 473 | 3300046529 | Ga0495652_0103676 | Ga0495652_0103676_705_2156 | 440 |
| 474 | 3300046557 | Ga0495622_0003972 | Ga0495622_0003972_5189_6682 | 440 |
| 475 | 3300046642 | Ga0495634_0030552 | Ga0495634_0030552_1507_2958 | 440 |
| 476 | 3300046674 | Ga0495588_0007159 | Ga0495588_0007159_2150_3643 | 440 |
| 477 | 3300046690 | Ga0495624_0061259 | Ga0495624_0061259_210_1667 | 440 |
| 478 | 3300047443 | Ga0495687_017006 | Ga0495687_017006_1102_2565 | 440 |
| 479 | 3300048906 | Ga0496103_0009352 | Ga0496103_0009352_201_1664 | 440 |
| 480 | 3300048907 | Ga0496104_0061464 | Ga0496104_0061464_599_2062 | 440 |
| 481 | 3300048908 | Ga0496105_0042737 | Ga0496105_0042737_1123_2586 | 440 |
| 482 | 3300048909 | Ga0496106_0033373 | Ga0496106_0033373_1940_3403 | 440 |
| 483 | 3300048910 | Ga0496107_0020008 | Ga0496107_0020008_257_1750 | 440 |
| 484 | 3300048911 | Ga0496108_0061889 | Ga0496108_0061889_298_1761 | 440 |
| 485 | 3300048912 | Ga0496109_0137322 | Ga0496109_0137322_87_1550 | 440 |
| 486 | 3300048920 | Ga0496117_0019064 | Ga0496117_0019064_3731_5224 | 440 |
| 487 | 3300048920 | Ga0496117_0052254 | Ga0496117_0052254_744_2207 | 440 |
| 488 | 3300048920 | Ga0496117_0067973 | Ga0496117_0067973_445_1926 | 440 |
| 489 | 3300048921 | Ga0496118_0023033 | Ga0496118_0023033_3432_4925 | 440 |
| 490 | 3300048924 | Ga0496121_0003633 | Ga0496121_0003633_735_2216 | 440 |
| 491 | 3300048924 | Ga0496121_0005213 | Ga0496121_0005213_4521_6014 | 440 |
| 492 | 3300048924 | Ga0496121_0018264 | Ga0496121_0018264_4296_5756 | 440 |
| 493 | 3300048924 | Ga0496121_0048986 | Ga0496121_0048986_576_2030 | 440 |
| 494 | 3300048924 | Ga0496121_0104399 | Ga0496121_0104399_472_1941 | 440 |
| 495 | 3300048925 | Ga0496122_0074641 | Ga0496122_0074641_557_2026 | 440 |
| 496 | 3300048927 | Ga0496124_0072785 | Ga0496124_0072785_43_1512 | 440 |
| 497 | 3300048928 | Ga0496125_0003060 | Ga0496125_0003060_9347_10819 | 440 |
| 498 | 3300048928 | Ga0496125_0026354 | Ga0496125_0026354_2278_3738 | 440 |
| 499 | 3300048928 | Ga0496125_0068293 | Ga0496125_0068293_1260_2723 | 440 |
| 500 | 3300048929 | Ga0496126_0018189 | Ga0496126_0018189_1932_3404 | 440 |
| 501 | 3300048929 | Ga0496126_0080937 | Ga0496126_0080937_269_1762 | 440 |
| 502 | 3300050496 | nmdc:mga07m45_9385_c1 | nmdc:mga07m45_9385_c1_3159_4622 | 440 |
| 503 | 3300050516 | nmdc:mga0sz30_18716_c1 | nmdc:mga0sz30_18716_c1_842_2305 | 440 |
| 504 | 3300053087 | Ga0500643_000028 | Ga0500643_000028_184270_185733 | 440 |
| 505 | 3300053093 | Ga0500651_0015213 | Ga0500651_0015213_149_1612 | 440 |
| 506 | 3300053096 | Ga0500641_0003634 | Ga0500641_0003634_253_1734 | 440 |
| 507 | 3300053119 | Ga0500595_008036 | Ga0500595_008036_915_2393 | 440 |
| 508 | 3300053119 | Ga0500595_012671 | Ga0500595_012671_319_1779 | 440 |
| 509 | 3300053130 | Ga0500642_0005215 | Ga0500642_0005215_1917_3380 | 440 |
| 510 | 3300053153 | Ga0500616_0021920 | Ga0500616_0021920_613_2076 | 440 |
| 511 | 3300053177 | Ga0500636_0000335 | Ga0500636_0000335_4877_6340 | 440 |
| 512 | 3300053737 | Ga0500601_000106 | Ga0500601_000106_13040_14503 | 440 |
| 513 | iso_pu_bacteria | 2617270735 | 2617350271 | 440 |
| 514 | iso_pu_bacteria | 2908739725 | 2908740596 | 440 |
| 515 | 3300003203 | JGI25406J46586_10008578 | JGI25406J46586_100085783 | 441 |
| 516 | 3300003203 | JGI25406J46586_10018461 | JGI25406J46586_100184612 | 441 |
| 517 | 3300003215 | JGI25153J46596_10003214 | JGI25153J46596_100032142 | 441 |
| 518 | 3300003354 | JGI25160J50197_1005366 | JGI25160J50197_10053662 | 441 |
| 519 | 3300003659 | JGI25404J52841_10002990 | JGI25404J52841_100029902 | 441 |
| 520 | 3300003794 | Ga0055531_10008533 | Ga0055531_100085335 | 441 |
| 521 | 3300005262 | Ga0065165_1002233 | Ga0065165_10022332 | 441 |
| 522 | 3300005262 | Ga0065165_1004477 | Ga0065165_10044775 | 441 |
| 523 | 3300005327 | Ga0070658_10061097 | Ga0070658_100610972 | 441 |
| 524 | 3300005336 | Ga0070680_100011230 | Ga0070680_1000112305 | 441 |
| 525 | 3300005336 | Ga0070680_100011893 | Ga0070680_1000118935 | 441 |
| 526 | 3300005337 | Ga0070682_100016968 | Ga0070682_1000169682 | 441 |
| 527 | 3300005344 | Ga0070661_100165052 | Ga0070661_1001650521 | 441 |
| 528 | 3300005356 | Ga0070674_100011692 | Ga0070674_1000116923 | 441 |
| 529 | 3300005366 | Ga0070659_100122594 | Ga0070659_1001225942 | 441 |
| 530 | 3300005434 | Ga0070709_10002887 | Ga0070709_100028879 | 441 |
| 531 | 3300005434 | Ga0070709_10030459 | Ga0070709_100304592 | 441 |
| 532 | 3300005434 | Ga0070709_10084723 | Ga0070709_100847232 | 441 |
| 533 | 3300005436 | Ga0070713_100071085 | Ga0070713_1000710852 | 441 |
| 534 | 3300005437 | Ga0070710_10004037 | Ga0070710_100040374 | 441 |
| 535 | 3300005439 | Ga0070711_100001853 | Ga0070711_1000018535 | 441 |
| 536 | 3300005439 | Ga0070711_100041414 | Ga0070711_1000414142 | 441 |
| 537 | 3300005441 | Ga0070700_100028624 | Ga0070700_1000286243 | 441 |
| 538 | 3300005455 | Ga0070663_100007555 | Ga0070663_1000075552 | 441 |
| 539 | 3300005455 | Ga0070663_100015733 | Ga0070663_1000157334 | 441 |
| 540 | 3300005455 | Ga0070663_100015897 | Ga0070663_1000158973 | 441 |
| 541 | 3300005455 | Ga0070663_100071463 | Ga0070663_1000714632 | 441 |
| 542 | 3300005456 | Ga0070678_100013527 | Ga0070678_1000135274 | 441 |
| 543 | 3300005456 | Ga0070678_100020942 | Ga0070678_1000209423 | 441 |
| 544 | 3300005456 | Ga0070678_100068185 | Ga0070678_1000681852 | 441 |
| 545 | 3300005458 | Ga0070681_10002031 | Ga0070681_1000203112 | 441 |
| 546 | 3300005458 | Ga0070681_10004718 | Ga0070681_100047185 | 441 |
| 547 | 3300005471 | Ga0070698_100005514 | Ga0070698_10000551411 | 441 |
| 548 | 3300005530 | Ga0070679_100016733 | Ga0070679_1000167333 | 441 |
| 549 | 3300005530 | Ga0070679_100019713 | Ga0070679_1000197134 | 441 |
| 550 | 3300005530 | Ga0070679_100020463 | Ga0070679_1000204634 | 441 |
| 551 | 3300005535 | Ga0070684_100036414 | Ga0070684_1000364145 | 441 |
| 552 | 3300005539 | Ga0068853_100035496 | Ga0068853_1000354962 | 441 |
| 553 | 3300005539 | Ga0068853_100044041 | Ga0068853_1000440413 | 441 |
| 554 | 3300005548 | Ga0070665_100011321 | Ga0070665_1000113214 | 441 |
| 555 | 3300005548 | Ga0070665_100028000 | Ga0070665_1000280003 | 441 |
| 556 | 3300005564 | Ga0070664_100074950 | Ga0070664_1000749502 | 441 |
| 557 | 3300005577 | Ga0068857_100138640 | Ga0068857_1001386403 | 441 |
| 558 | 3300005578 | Ga0068854_100054605 | Ga0068854_1000546053 | 441 |
| 559 | 3300005614 | Ga0068856_100000656 | Ga0068856_10000065618 | 441 |
| 560 | 3300005614 | Ga0068856_100152659 | Ga0068856_1001526592 | 441 |
| 561 | 3300005618 | Ga0068864_100033493 | Ga0068864_1000334932 | 441 |
| 562 | 3300005719 | Ga0068861_100045874 | Ga0068861_1000458743 | 441 |
| 563 | 3300005844 | Ga0068862_100014626 | Ga0068862_1000146266 | 441 |
| 564 | 3300005937 | Ga0081455_10000875 | Ga0081455_100008759 | 441 |
| 565 | 3300005937 | Ga0081455_10006148 | Ga0081455_100061486 | 441 |
| 566 | 3300005937 | Ga0081455_10009845 | Ga0081455_100098456 | 441 |
| 567 | 3300005937 | Ga0081455_10010305 | Ga0081455_100103055 | 441 |
| 568 | 3300005937 | Ga0081455_10070453 | Ga0081455_100704533 | 441 |
| 569 | 3300005983 | Ga0081540_1000902 | Ga0081540_100090211 | 441 |
| 570 | 3300005983 | Ga0081540_1001083 | Ga0081540_100108322 | 441 |
| 571 | 3300005983 | Ga0081540_1001280 | Ga0081540_10012808 | 441 |
| 572 | 3300005983 | Ga0081540_1003372 | Ga0081540_100337211 | 441 |
| 573 | 3300005983 | Ga0081540_1005023 | Ga0081540_10050234 | 441 |
| 574 | 3300005983 | Ga0081540_1008519 | Ga0081540_10085195 | 441 |
| 575 | 3300005983 | Ga0081540_1010347 | Ga0081540_10103476 | 441 |
| 576 | 3300005983 | Ga0081540_1032272 | Ga0081540_10322722 | 441 |
| 577 | 3300005985 | Ga0081539_10001953 | Ga0081539_1000195311 | 441 |
| 578 | 3300005985 | Ga0081539_10021392 | Ga0081539_100213922 | 441 |
| 579 | 3300006028 | Ga0070717_10059530 | Ga0070717_100595303 | 441 |
| 580 | 3300006038 | Ga0075365_10057996 | Ga0075365_100579962 | 441 |
| 581 | 3300006048 | Ga0075363_100000627 | Ga0075363_1000006278 | 441 |
| 582 | 3300006173 | Ga0070716_100008521 | Ga0070716_1000085213 | 441 |
| 583 | 3300006175 | Ga0070712_100007062 | Ga0070712_1000070622 | 441 |
| 584 | 3300006178 | Ga0075367_10004749 | Ga0075367_100047494 | 441 |
| 585 | 3300006186 | Ga0075369_10012724 | Ga0075369_100127243 | 441 |
| 586 | 3300006195 | Ga0075366_10062170 | Ga0075366_100621702 | 441 |
| 587 | 3300006195 | Ga0075366_10072006 | Ga0075366_100720062 | 441 |
| 588 | 3300006844 | Ga0075428_100231582 | Ga0075428_1002315822 | 441 |
| 589 | 3300006871 | Ga0075434_100154705 | Ga0075434_1001547052 | 441 |
| 590 | 3300006942 | Ga0099824_1010060 | Ga0099824_10100602 | 441 |
| 591 | 3300006943 | Ga0099822_1001406 | Ga0099822_10014062 | 441 |
| 592 | 3300007265 | Ga0099794_10031724 | Ga0099794_100317242 | 441 |
| 593 | 3300007788 | Ga0099795_10018698 | Ga0099795_100186982 | 441 |
| 594 | 3300009093 | Ga0105240_10011282 | Ga0105240_100112826 | 441 |
| 595 | 3300009093 | Ga0105240_10019980 | Ga0105240_100199805 | 441 |
| 596 | 3300009094 | Ga0111539_10022105 | Ga0111539_100221054 | 441 |
| 597 | 3300009098 | Ga0105245_10063237 | Ga0105245_100632372 | 441 |
| 598 | 3300009147 | Ga0114129_10058379 | Ga0114129_100583794 | 441 |
| 599 | 3300009176 | Ga0105242_10039794 | Ga0105242_100397944 | 441 |
| 600 | 3300009177 | Ga0105248_10013709 | Ga0105248_100137096 | 441 |
| 601 | 3300009177 | Ga0105248_10022582 | Ga0105248_100225826 | 441 |
| 602 | 3300009177 | Ga0105248_10027439 | Ga0105248_100274392 | 441 |
| 603 | 3300010159 | Ga0099796_10002924 | Ga0099796_100029242 | 441 |
| 604 | 3300010375 | Ga0105239_10003423 | Ga0105239_100034236 | 441 |
| 605 | 3300010375 | Ga0105239_10022536 | Ga0105239_100225366 | 441 |
| 606 | 3300010375 | Ga0105239_10260365 | Ga0105239_102603651 | 441 |
| 607 | 3300010375 | Ga0105239_10349587 | Ga0105239_103495872 | 441 |
| 608 | 3300011119 | Ga0105246_10024145 | Ga0105246_100241453 | 441 |
| 609 | 3300013104 | Ga0157370_10029227 | Ga0157370_100292274 | 441 |
| 610 | 3300013105 | Ga0157369_10004999 | Ga0157369_1000499912 | 441 |
| 611 | 3300013105 | Ga0157369_10008262 | Ga0157369_100082625 | 441 |
| 612 | 3300013296 | Ga0157374_10143983 | Ga0157374_101439832 | 441 |
| 613 | 3300013297 | Ga0157378_10006823 | Ga0157378_100068239 | 441 |
| 614 | 3300013307 | Ga0157372_10055379 | Ga0157372_100553793 | 441 |
| 615 | 3300013307 | Ga0157372_10089782 | Ga0157372_100897822 | 441 |
| 616 | 3300013308 | Ga0157375_10017569 | Ga0157375_100175695 | 441 |
| 617 | 3300013308 | Ga0157375_10302704 | Ga0157375_103027042 | 441 |
| 618 | 3300014325 | Ga0163163_10058200 | Ga0163163_100582003 | 441 |
| 619 | 3300014326 | Ga0157380_10102466 | Ga0157380_101024662 | 441 |
| 620 | 3300014969 | Ga0157376_10008559 | Ga0157376_100085592 | 441 |
| 621 | 3300014969 | Ga0157376_10074942 | Ga0157376_100749424 | 441 |
| 622 | 3300025295 | Ga0209564_1004727 | Ga0209564_10047272 | 441 |
| 623 | 3300025295 | Ga0209564_1006891 | Ga0209564_10068916 | 441 |
| 624 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026305 | 441 |
| 625 | 3300025297 | Ga0209758_1000893 | Ga0209758_100089345 | 441 |
| 626 | 3300025299 | Ga0209256_1003250 | Ga0209256_10032508 | 441 |
| 627 | 3300025302 | Ga0207426_1002886 | Ga0207426_10028862 | 441 |
| 628 | 3300025302 | Ga0207426_1015753 | Ga0207426_10157532 | 441 |
| 629 | 3300025304 | Ga0209257_1002080 | Ga0209257_100208015 | 441 |
| 630 | 3300025304 | Ga0209257_1032230 | Ga0209257_10322302 | 441 |
| 631 | 3300025904 | Ga0207647_10013298 | Ga0207647_100132981 | 441 |
| 632 | 3300025907 | Ga0207645_10041897 | Ga0207645_100418972 | 441 |
| 633 | 3300025912 | Ga0207707_10000204 | Ga0207707_1000020417 | 441 |
| 634 | 3300025912 | Ga0207707_10149187 | Ga0207707_101491872 | 441 |
| 635 | 3300025913 | Ga0207695_10210351 | Ga0207695_102103512 | 441 |
| 636 | 3300025914 | Ga0207671_10029364 | Ga0207671_100293642 | 441 |
| 637 | 3300025914 | Ga0207671_10029689 | Ga0207671_100296893 | 441 |
| 638 | 3300025915 | Ga0207693_10000845 | Ga0207693_1000084513 | 441 |
| 639 | 3300025916 | Ga0207663_10021175 | Ga0207663_100211752 | 441 |
| 640 | 3300025919 | Ga0207657_10070474 | Ga0207657_100704742 | 441 |
| 641 | 3300025919 | Ga0207657_10128365 | Ga0207657_101283652 | 441 |
| 642 | 3300025921 | Ga0207652_10006752 | Ga0207652_100067526 | 441 |
| 643 | 3300025921 | Ga0207652_10058055 | Ga0207652_100580553 | 441 |
| 644 | 3300025924 | Ga0207694_10069309 | Ga0207694_100693092 | 441 |
| 645 | 3300025925 | Ga0207650_10036869 | Ga0207650_100368692 | 441 |
| 646 | 3300025926 | Ga0207659_10019924 | Ga0207659_100199242 | 441 |
| 647 | 3300025927 | Ga0207687_10018033 | Ga0207687_100180332 | 441 |
| 648 | 3300025927 | Ga0207687_10042542 | Ga0207687_100425422 | 441 |
| 649 | 3300025927 | Ga0207687_10086874 | Ga0207687_100868743 | 441 |
| 650 | 3300025928 | Ga0207700_10024587 | Ga0207700_100245874 | 441 |
| 651 | 3300025929 | Ga0207664_10016632 | Ga0207664_100166323 | 441 |
| 652 | 3300025931 | Ga0207644_10020857 | Ga0207644_100208574 | 441 |
| 653 | 3300025931 | Ga0207644_10116402 | Ga0207644_101164021 | 441 |
| 654 | 3300025933 | Ga0207706_10027145 | Ga0207706_100271453 | 441 |
| 655 | 3300025934 | Ga0207686_10056292 | Ga0207686_100562923 | 441 |
| 656 | 3300025937 | Ga0207669_10038665 | Ga0207669_100386653 | 441 |
| 657 | 3300025939 | Ga0207665_10067791 | Ga0207665_100677912 | 441 |
| 658 | 3300025940 | Ga0207691_10028242 | Ga0207691_100282423 | 441 |
| 659 | 3300025941 | Ga0207711_10007926 | Ga0207711_100079265 | 441 |
| 660 | 3300025941 | Ga0207711_10069420 | Ga0207711_100694204 | 441 |
| 661 | 3300025941 | Ga0207711_10261554 | Ga0207711_102615541 | 441 |
| 662 | 3300025942 | Ga0207689_10198498 | Ga0207689_101984982 | 441 |
| 663 | 3300025944 | Ga0207661_10005001 | Ga0207661_100050014 | 441 |
| 664 | 3300025945 | Ga0207679_10056504 | Ga0207679_100565043 | 441 |
| 665 | 3300025949 | Ga0207667_10035220 | Ga0207667_100352202 | 441 |
| 666 | 3300025972 | Ga0207668_10055058 | Ga0207668_100550582 | 441 |
| 667 | 3300025981 | Ga0207640_10043082 | Ga0207640_100430822 | 441 |
| 668 | 3300026035 | Ga0207703_10065269 | Ga0207703_100652692 | 441 |
| 669 | 3300026041 | Ga0207639_10035296 | Ga0207639_100352965 | 441 |
| 670 | 3300026041 | Ga0207639_10049581 | Ga0207639_100495812 | 441 |
| 671 | 3300026067 | Ga0207678_10026522 | Ga0207678_100265222 | 441 |
| 672 | 3300026067 | Ga0207678_10027418 | Ga0207678_100274182 | 441 |
| 673 | 3300026067 | Ga0207678_10087422 | Ga0207678_100874222 | 441 |
| 674 | 3300026078 | Ga0207702_10000127 | Ga0207702_1000012737 | 441 |
| 675 | 3300026078 | Ga0207702_10078321 | Ga0207702_100783212 | 441 |
| 676 | 3300026089 | Ga0207648_10124079 | Ga0207648_101240792 | 441 |
| 677 | 3300026089 | Ga0207648_10203680 | Ga0207648_102036802 | 441 |
| 678 | 3300026095 | Ga0207676_10235652 | Ga0207676_102356521 | 441 |
| 679 | 3300026116 | Ga0207674_10173521 | Ga0207674_101735212 | 441 |
| 680 | 3300026121 | Ga0207683_10049597 | Ga0207683_100495972 | 441 |
| 681 | 3300026121 | Ga0207683_10061599 | Ga0207683_100615993 | 441 |
| 682 | 3300026121 | Ga0207683_10099101 | Ga0207683_100991011 | 441 |
| 683 | 3300026121 | Ga0207683_10129824 | Ga0207683_101298241 | 441 |
| 684 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007244 | 441 |
| 685 | 3300027361 | Ga0209489_100008 | Ga0209489_100008244 | 441 |
| 686 | 3300027363 | Ga0209700_100009 | Ga0209700_100009244 | 441 |
| 687 | 3300028379 | Ga0268266_10004114 | Ga0268266_100041148 | 441 |
| 688 | 3300028379 | Ga0268266_10018620 | Ga0268266_100186206 | 441 |
| 689 | 3300028786 | Ga0307517_10000650 | Ga0307517_100006508 | 441 |
| 690 | 3300031456 | Ga0307513_10128355 | Ga0307513_101283553 | 441 |
| 691 | 3300031616 | Ga0307508_10060189 | Ga0307508_100601892 | 441 |
| 692 | 3300031711 | Ga0265314_10050797 | Ga0265314_100507974 | 441 |
| 693 | 3300031730 | Ga0307516_10010888 | Ga0307516_100108887 | 441 |
| 694 | 3300031730 | Ga0307516_10090410 | Ga0307516_100904103 | 441 |
| 695 | 3300032126 | Ga0307415_100094286 | Ga0307415_1000942862 | 441 |
| 696 | 3300033442 | Ga0315911_1000007 | Ga0315911_100000797 | 441 |
| 697 | 3300035085 | Ga0373929_0003358 | Ga0373929_0003358_493_1965 | 441 |
| 698 | 3300035086 | Ga0373934_0001552 | Ga0373934_0001552_3898_5370 | 441 |
| 699 | 3300035111 | Ga0373923_0008219 | Ga0373923_0008219_625_2097 | 441 |
| 700 | 3300035111 | Ga0373923_0016842 | Ga0373923_0016842_319_1791 | 441 |
| 701 | 3300035113 | Ga0373936_0034284 | Ga0373936_0034284_320_1792 | 441 |
| 702 | 3300035116 | Ga0373945_0007106 | Ga0373945_0007106_29_1489 | 441 |
| 703 | 3300035117 | Ga0373953_0000126 | Ga0373953_0000126_6024_7496 | 441 |
| 704 | 3300035118 | Ga0373954_0001939 | Ga0373954_0001939_4398_5870 | 441 |
| 705 | 3300035118 | Ga0373954_0035248 | Ga0373954_0035248_11_1471 | 441 |
| 706 | 3300035119 | Ga0373956_0000764 | Ga0373956_0000764_1670_3142 | 441 |
| 707 | 3300035171 | Ga0373946_0005087 | Ga0373946_0005087_977_2437 | 441 |
| 708 | 3300035171 | Ga0373946_0038774 | Ga0373946_0038774_335_1807 | 441 |
| 709 | 3300035410 | Ga0373924_0000464 | Ga0373924_0000464_9574_11046 | 441 |
| 710 | 3300035691 | Ga0373931_0000734 | Ga0373931_0000734_3685_5157 | 441 |
| 711 | 3300035695 | Ga0373927_0011774 | Ga0373927_0011774_2096_3568 | 441 |
| 712 | 3300035695 | Ga0373927_0013533 | Ga0373927_0013533_1756_3228 | 441 |
| 713 | 3300035695 | Ga0373927_0069980 | Ga0373927_0069980_514_1986 | 441 |
| 714 | 3300035724 | Ga0373933_0000074 | Ga0373933_0000074_26665_28137 | 441 |
| 715 | 3300035724 | Ga0373933_0000600 | Ga0373933_0000600_12707_14179 | 441 |
| 716 | 3300036401 | Ga0373937_0039793 | Ga0373937_0039793_2618_4090 | 441 |
| 717 | 3300036401 | Ga0373937_0040701 | Ga0373937_0040701_428_1900 | 441 |
| 718 | 3300036401 | Ga0373937_0069295 | Ga0373937_0069295_131_1603 | 441 |
| 719 | 3300037068 | Ga0373925_0012992 | Ga0373925_0012992_1808_3280 | 441 |
| 720 | 3300037068 | Ga0373925_0153674 | Ga0373925_0153674_155_1627 | 441 |
| 721 | 3300037312 | Ga0395899_0074592 | Ga0395899_0074592_431_1891 | 441 |
| 722 | 3300037466 | Ga0395898_0002852 | Ga0395898_0002852_7075_8535 | 441 |
| 723 | 3300037466 | Ga0395898_0185564 | Ga0395898_0185564_140_1597 | 441 |
| 724 | 3300037471 | Ga0395905_0151032 | Ga0395905_0151032_470_1927 | 441 |
| 725 | 3300038443 | Ga0395901_0056960 | Ga0395901_0056960_1748_3205 | 441 |
| 726 | 3300039437 | Ga0436365_1642928 | Ga0436365_1642928_806_2266 | 441 |
| 727 | 3300039447 | Ga0436361_1209908 | Ga0436361_1209908_247_1719 | 441 |
| 728 | 3300039453 | Ga0436362_0284263 | Ga0436362_0284263_314_1780 | 441 |
| 729 | 3300041413 | Ga0439465_0026860 | Ga0439465_0026860_337_1809 | 441 |
| 730 | 3300044658 | Ga0466972_0001570 | Ga0466972_0001570_9010_10470 | 441 |
| 731 | 3300045976 | Ga0466967_0068372 | Ga0466967_0068372_929_2386 | 441 |
| 732 | 3300046454 | Ga0495592_0000570 | Ga0495592_0000570_6510_7982 | 441 |
| 733 | 3300046454 | Ga0495592_0041333 | Ga0495592_0041333_526_1998 | 441 |
| 734 | 3300046454 | Ga0495592_0147583 | Ga0495592_0147583_68_1528 | 441 |
| 735 | 3300046455 | Ga0495603_0000326 | Ga0495603_0000326_1170_2642 | 441 |
| 736 | 3300046455 | Ga0495603_0008509 | Ga0495603_0008509_3717_5186 | 441 |
| 737 | 3300046455 | Ga0495603_0043606 | Ga0495603_0043606_1004_2476 | 441 |
| 738 | 3300046459 | Ga0495629_0003532 | Ga0495629_0003532_6809_8281 | 441 |
| 739 | 3300046459 | Ga0495629_0028760 | Ga0495629_0028760_148_1620 | 441 |
| 740 | 3300046461 | Ga0495641_0048488 | Ga0495641_0048488_280_1752 | 441 |
| 741 | 3300046462 | Ga0495651_0001932 | Ga0495651_0001932_1823_3286 | 441 |
| 742 | 3300046462 | Ga0495651_0006357 | Ga0495651_0006357_4476_5948 | 441 |
| 743 | 3300046462 | Ga0495651_0047024 | Ga0495651_0047024_993_2465 | 441 |
| 744 | 3300046463 | Ga0495653_0004089 | Ga0495653_0004089_8510_9982 | 441 |
| 745 | 3300046463 | Ga0495653_0044635 | Ga0495653_0044635_1963_3426 | 441 |
| 746 | 3300046463 | Ga0495653_0136449 | Ga0495653_0136449_91_1563 | 441 |
| 747 | 3300046472 | Ga0495580_0010882 | Ga0495580_0010882_1795_3255 | 441 |
| 748 | 3300046472 | Ga0495580_0025602 | Ga0495580_0025602_1019_2491 | 441 |
| 749 | 3300046473 | Ga0495582_0005857 | Ga0495582_0005857_3673_5145 | 441 |
| 750 | 3300046473 | Ga0495582_0035806 | Ga0495582_0035806_981_2441 | 441 |
| 751 | 3300046473 | Ga0495582_0103035 | Ga0495582_0103035_92_1564 | 441 |
| 752 | 3300046475 | Ga0495639_0009301 | Ga0495639_0009301_282_1751 | 441 |
| 753 | 3300046475 | Ga0495639_0016428 | Ga0495639_0016428_179_1651 | 441 |
| 754 | 3300046476 | Ga0495662_0016351 | Ga0495662_0016351_1237_2709 | 441 |
| 755 | 3300046477 | Ga0495664_0012300 | Ga0495664_0012300_1839_3299 | 441 |
| 756 | 3300046477 | Ga0495664_0029107 | Ga0495664_0029107_995_2458 | 441 |
| 757 | 3300046477 | Ga0495664_0093331 | Ga0495664_0093331_178_1650 | 441 |
| 758 | 3300046491 | Ga0495584_0021729 | Ga0495584_0021729_675_2138 | 441 |
| 759 | 3300046492 | Ga0495585_0046723 | Ga0495585_0046723_675_2144 | 441 |
| 760 | 3300046499 | Ga0495594_0000561 | Ga0495594_0000561_1158_2630 | 441 |
| 761 | 3300046507 | Ga0495606_0002474 | Ga0495606_0002474_8307_9770 | 441 |
| 762 | 3300046507 | Ga0495606_0034723 | Ga0495606_0034723_1349_2824 | 441 |
| 763 | 3300046511 | Ga0495608_0012407 | Ga0495608_0012407_138_1610 | 441 |
| 764 | 3300046514 | Ga0495618_0052596 | Ga0495618_0052596_1067_2530 | 441 |
| 765 | 3300046516 | Ga0495628_0037037 | Ga0495628_0037037_624_2096 | 441 |
| 766 | 3300046517 | Ga0495630_0028997 | Ga0495630_0028997_1594_3057 | 441 |
| 767 | 3300046517 | Ga0495630_0034977 | Ga0495630_0034977_1450_2922 | 441 |
| 768 | 3300046517 | Ga0495630_0037585 | Ga0495630_0037585_73_1533 | 441 |
| 769 | 3300046518 | Ga0495631_0014579 | Ga0495631_0014579_1942_3411 | 441 |
| 770 | 3300046518 | Ga0495631_0029447 | Ga0495631_0029447_567_2030 | 441 |
| 771 | 3300046524 | Ga0495648_0000857 | Ga0495648_0000857_23117_24589 | 441 |
| 772 | 3300046526 | Ga0495666_0023829 | Ga0495666_0023829_656_2128 | 441 |
| 773 | 3300046529 | Ga0495652_0002875 | Ga0495652_0002875_1794_3257 | 441 |
| 774 | 3300046529 | Ga0495652_0003587 | Ga0495652_0003587_2477_3949 | 441 |
| 775 | 3300046529 | Ga0495652_0084915 | Ga0495652_0084915_1072_2544 | 441 |
| 776 | 3300046529 | Ga0495652_0092876 | Ga0495652_0092876_802_2304 | 441 |
| 777 | 3300046531 | Ga0495665_0036869 | Ga0495665_0036869_134_1606 | 441 |
| 778 | 3300046531 | Ga0495665_0071267 | Ga0495665_0071267_202_1662 | 441 |
| 779 | 3300046533 | Ga0495640_0008019 | Ga0495640_0008019_2250_3722 | 441 |
| 780 | 3300046533 | Ga0495640_0011883 | Ga0495640_0011883_1146_2618 | 441 |
| 781 | 3300046533 | Ga0495640_0026959 | Ga0495640_0026959_755_2218 | 441 |
| 782 | 3300046533 | Ga0495640_0142031 | Ga0495640_0142031_29_1489 | 441 |
| 783 | 3300046536 | Ga0495587_0028751 | Ga0495587_0028751_428_1900 | 441 |
| 784 | 3300046536 | Ga0495587_0029230 | Ga0495587_0029230_1080_2543 | 441 |
| 785 | 3300046536 | Ga0495587_0032841 | Ga0495587_0032841_543_2015 | 441 |
| 786 | 3300046543 | Ga0495645_0003943 | Ga0495645_0003943_5029_6489 | 441 |
| 787 | 3300046543 | Ga0495645_0007372 | Ga0495645_0007372_4440_5912 | 441 |
| 788 | 3300046543 | Ga0495645_0023368 | Ga0495645_0023368_2481_3944 | 441 |
| 789 | 3300046557 | Ga0495622_0014341 | Ga0495622_0014341_1280_2743 | 441 |
| 790 | 3300046557 | Ga0495622_0051722 | Ga0495622_0051722_285_1757 | 441 |
| 791 | 3300046559 | Ga0495667_0000747 | Ga0495667_0000747_4699_6171 | 441 |
| 792 | 3300046559 | Ga0495667_0005130 | Ga0495667_0005130_2832_4304 | 441 |
| 793 | 3300046559 | Ga0495667_0017229 | Ga0495667_0017229_3347_4810 | 441 |
| 794 | 3300046615 | Ga0495656_0008694 | Ga0495656_0008694_1461_2924 | 441 |
| 795 | 3300046616 | Ga0495668_0029830 | Ga0495668_0029830_275_1747 | 441 |
| 796 | 3300046642 | Ga0495634_0012178 | Ga0495634_0012178_1185_2657 | 441 |
| 797 | 3300046642 | Ga0495634_0040760 | Ga0495634_0040760_572_2044 | 441 |
| 798 | 3300046660 | Ga0495625_0083891 | Ga0495625_0083891_318_1790 | 441 |
| 799 | 3300046660 | Ga0495625_0084930 | Ga0495625_0084930_107_1576 | 441 |
| 800 | 3300046663 | Ga0495635_0000532 | Ga0495635_0000532_2422_3894 | 441 |
| 801 | 3300046663 | Ga0495635_0000796 | Ga0495635_0000796_1539_3011 | 441 |
| 802 | 3300046663 | Ga0495635_0001601 | Ga0495635_0001601_11327_12790 | 441 |
| 803 | 3300046663 | Ga0495635_0022404 | Ga0495635_0022404_2721_4181 | 441 |
| 804 | 3300046663 | Ga0495635_0028422 | Ga0495635_0028422_1637_3100 | 441 |
| 805 | 3300046663 | Ga0495635_0044435 | Ga0495635_0044435_618_2090 | 441 |
| 806 | 3300046664 | Ga0495659_0004386 | Ga0495659_0004386_205_1674 | 441 |
| 807 | 3300046674 | Ga0495588_0023354 | Ga0495588_0023354_525_1997 | 441 |
| 808 | 3300046675 | Ga0495657_0000725 | Ga0495657_0000725_22282_23745 | 441 |
| 809 | 3300046675 | Ga0495657_0002564 | Ga0495657_0002564_2621_4093 | 441 |
| 810 | 3300046675 | Ga0495657_0016182 | Ga0495657_0016182_3816_5288 | 441 |
| 811 | 3300046678 | Ga0495599_0000394 | Ga0495599_0000394_4305_5777 | 441 |
| 812 | 3300046678 | Ga0495599_0016403 | Ga0495599_0016403_331_1794 | 441 |
| 813 | 3300046679 | Ga0495623_0002532 | Ga0495623_0002532_4383_5846 | 441 |
| 814 | 3300046679 | Ga0495623_0017418 | Ga0495623_0017418_2709_4181 | 441 |
| 815 | 3300046680 | Ga0495646_0000916 | Ga0495646_0000916_6838_8310 | 441 |
| 816 | 3300046680 | Ga0495646_0033545 | Ga0495646_0033545_222_1694 | 441 |
| 817 | 3300046681 | Ga0495647_0009216 | Ga0495647_0009216_746_2218 | 441 |
| 818 | 3300046683 | Ga0495658_0004513 | Ga0495658_0004513_1326_2798 | 441 |
| 819 | 3300046684 | Ga0495669_0003897 | Ga0495669_0003897_1930_3393 | 441 |
| 820 | 3300046689 | Ga0495613_0095595 | Ga0495613_0095595_505_1965 | 441 |
| 821 | 3300046690 | Ga0495624_0008393 | Ga0495624_0008393_1601_3073 | 441 |
| 822 | 3300046809 | Ga0495600_0015246 | Ga0495600_0015246_66_1529 | 441 |
| 823 | 3300046809 | Ga0495600_0016939 | Ga0495600_0016939_425_1897 | 441 |
| 824 | 3300047315 | Ga0495581_0005146 | Ga0495581_0005146_1342_2814 | 441 |
| 825 | 3300047317 | Ga0495604_0000420 | Ga0495604_0000420_27594_29057 | 441 |
| 826 | 3300047317 | Ga0495604_0001069 | Ga0495604_0001069_9843_11306 | 441 |
| 827 | 3300047317 | Ga0495604_0021505 | Ga0495604_0021505_495_1967 | 441 |
| 828 | 3300047317 | Ga0495604_0025801 | Ga0495604_0025801_892_2364 | 441 |
| 829 | 3300047319 | Ga0495674_0002922 | Ga0495674_0002922_2277_3740 | 441 |
| 830 | 3300047319 | Ga0495674_0007646 | Ga0495674_0007646_8633_10105 | 441 |
| 831 | 3300047319 | Ga0495674_0015599 | Ga0495674_0015599_4057_5529 | 441 |
| 832 | 3300047320 | Ga0495672_0015482 | Ga0495672_0015482_12_1472 | 441 |
| 833 | 3300047321 | Ga0495676_0072345 | Ga0495676_0072345_1120_2592 | 441 |
| 834 | 3300047322 | Ga0495680_0002126 | Ga0495680_0002126_5900_7363 | 441 |
| 835 | 3300047322 | Ga0495680_0019256 | Ga0495680_0019256_1383_2855 | 441 |
| 836 | 3300047444 | Ga0495675_0005826 | Ga0495675_0005826_3056_4528 | 441 |
| 837 | 3300047444 | Ga0495675_0018356 | Ga0495675_0018356_138_1610 | 441 |
| 838 | 3300047444 | Ga0495675_0063545 | Ga0495675_0063545_853_2316 | 441 |
| 839 | 3300047445 | Ga0495677_0050459 | Ga0495677_0050459_24_1487 | 441 |
| 840 | 3300047471 | Ga0495684_0001102 | Ga0495684_0001102_15573_17045 | 441 |
| 841 | 3300047471 | Ga0495684_0027189 | Ga0495684_0027189_2739_4211 | 441 |
| 842 | 3300047471 | Ga0495684_0035115 | Ga0495684_0035115_2196_3656 | 441 |
| 843 | 3300047673 | Ga0495593_0000928 | Ga0495593_0000928_3507_4979 | 441 |
| 844 | 3300047673 | Ga0495593_0007129 | Ga0495593_0007129_4575_6047 | 441 |
| 845 | 3300048088 | Ga0495602_0003533 | Ga0495602_0003533_11275_12747 | 441 |
| 846 | 3300048088 | Ga0495602_0016266 | Ga0495602_0016266_1050_2513 | 441 |
| 847 | 3300048088 | Ga0495602_0023066 | Ga0495602_0023066_3812_5284 | 441 |
| 848 | 3300048903 | Ga0496100_0092626 | Ga0496100_0092626_323_1780 | 441 |
| 849 | 3300048903 | Ga0496100_0121858 | Ga0496100_0121858_226_1707 | 441 |
| 850 | 3300048904 | Ga0496101_0072888 | Ga0496101_0072888_474_1931 | 441 |
| 851 | 3300048905 | Ga0496102_0008428 | Ga0496102_0008428_5469_6950 | 441 |
| 852 | 3300048905 | Ga0496102_0039932 | Ga0496102_0039932_1741_3204 | 441 |
| 853 | 3300048905 | Ga0496102_0056323 | Ga0496102_0056323_421_1935 | 441 |
| 854 | 3300048905 | Ga0496102_0061309 | Ga0496102_0061309_636_2108 | 441 |
| 855 | 3300048905 | Ga0496102_0260205 | Ga0496102_0260205_161_1624 | 441 |
| 856 | 3300048906 | Ga0496103_0002871 | Ga0496103_0002871_7083_8543 | 441 |
| 857 | 3300048906 | Ga0496103_0011177 | Ga0496103_0011177_1506_2978 | 441 |
| 858 | 3300048907 | Ga0496104_0013027 | Ga0496104_0013027_1910_3370 | 441 |
| 859 | 3300048907 | Ga0496104_0043425 | Ga0496104_0043425_912_2369 | 441 |
| 860 | 3300048907 | Ga0496104_0083017 | Ga0496104_0083017_975_2456 | 441 |
| 861 | 3300048908 | Ga0496105_0044094 | Ga0496105_0044094_1330_2811 | 441 |
| 862 | 3300048909 | Ga0496106_0029885 | Ga0496106_0029885_1510_2991 | 441 |
| 863 | 3300048909 | Ga0496106_0034275 | Ga0496106_0034275_371_1843 | 441 |
| 864 | 3300048910 | Ga0496107_0029169 | Ga0496107_0029169_1066_2547 | 441 |
| 865 | 3300048910 | Ga0496107_0055576 | Ga0496107_0055576_1218_2672 | 441 |
| 866 | 3300048911 | Ga0496108_0029866 | Ga0496108_0029866_259_1719 | 441 |
| 867 | 3300048912 | Ga0496109_0040986 | Ga0496109_0040986_895_2376 | 441 |
| 868 | 3300048913 | Ga0496110_0008411 | Ga0496110_0008411_2061_3542 | 441 |
| 869 | 3300048914 | Ga0496111_0012192 | Ga0496111_0012192_575_2047 | 441 |
| 870 | 3300048914 | Ga0496111_0061930 | Ga0496111_0061930_674_2152 | 441 |
| 871 | 3300048914 | Ga0496111_0093582 | Ga0496111_0093582_22_1503 | 441 |
| 872 | 3300048915 | Ga0496112_0000023 | Ga0496112_0000023_5546_7006 | 441 |
| 873 | 3300048915 | Ga0496112_0003139 | Ga0496112_0003139_3793_5265 | 441 |
| 874 | 3300048915 | Ga0496112_0068438 | Ga0496112_0068438_1526_2998 | 441 |
| 875 | 3300048915 | Ga0496112_0204827 | Ga0496112_0204827_226_1740 | 441 |
| 876 | 3300048916 | Ga0496113_0001253 | Ga0496113_0001253_11656_13128 | 441 |
| 877 | 3300048916 | Ga0496113_0009073 | Ga0496113_0009073_256_1716 | 441 |
| 878 | 3300048917 | Ga0496114_0104436 | Ga0496114_0104436_91_1554 | 441 |
| 879 | 3300048918 | Ga0496115_0006975 | Ga0496115_0006975_1398_2879 | 441 |
| 880 | 3300048918 | Ga0496115_0015877 | Ga0496115_0015877_970_2442 | 441 |
| 881 | 3300048924 | Ga0496121_0021784 | Ga0496121_0021784_2327_3796 | 441 |
| 882 | 3300048924 | Ga0496121_0037055 | Ga0496121_0037055_1070_2539 | 441 |
| 883 | 3300048924 | Ga0496121_0040389 | Ga0496121_0040389_927_2396 | 441 |
| 884 | 3300048927 | Ga0496124_0020155 | Ga0496124_0020155_4620_6080 | 441 |
| 885 | 3300048928 | Ga0496125_0071915 | Ga0496125_0071915_217_1677 | 441 |
| 886 | 3300048928 | Ga0496125_0146895 | Ga0496125_0146895_141_1610 | 441 |
| 887 | 3300048929 | Ga0496126_0001567 | Ga0496126_0001567_27944_29422 | 441 |
| 888 | 3300048929 | Ga0496126_0014354 | Ga0496126_0014354_5460_6932 | 441 |
| 889 | 3300048929 | Ga0496126_0031803 | Ga0496126_0031803_3434_4909 | 441 |
| 890 | 3300048929 | Ga0496126_0057234 | Ga0496126_0057234_249_1715 | 441 |
| 891 | 3300048929 | Ga0496126_0072299 | Ga0496126_0072299_1248_2723 | 441 |
| 892 | 3300048929 | Ga0496126_0085755 | Ga0496126_0085755_1159_2619 | 441 |
| 893 | 3300048929 | Ga0496126_0199781 | Ga0496126_0199781_148_1608 | 441 |
| 894 | 3300049578 | Ga0501042_0060011 | Ga0501042_0060011_802_2268 | 441 |
| 895 | 3300049581 | Ga0501047_0021802 | Ga0501047_0021802_3252_4730 | 441 |
| 896 | 3300049586 | Ga0501070_0009576 | Ga0501070_0009576_6630_8108 | 441 |
| 897 | 3300049589 | Ga0501073_0048267 | Ga0501073_0048267_208_1686 | 441 |
| 898 | 3300050490 | nmdc:mga03n38_5011_c1 | nmdc:mga03n38_5011_c1_2411_3862 | 441 |
| 899 | 3300050494 | nmdc:mga06z11_5428_c1 | nmdc:mga06z11_5428_c1_1428_2879 | 441 |
| 900 | 3300050496 | nmdc:mga07m45_5405_c1 | nmdc:mga07m45_5405_c1_811_2262 | 441 |
| 901 | 3300050511 | nmdc:mga08y16_39496_c1 | nmdc:mga08y16_39496_c1_363_1826 | 441 |
| 902 | 3300053077 | Ga0495601_0003650 | Ga0495601_0003650_5881_7353 | 441 |
| 903 | 3300053077 | Ga0495601_0068688 | Ga0495601_0068688_473_1933 | 441 |
| 904 | 3300053078 | Ga0495612_0005421 | Ga0495612_0005421_3416_4876 | 441 |
| 905 | 3300053078 | Ga0495612_0025502 | Ga0495612_0025502_616_2076 | 441 |
| 906 | 3300053084 | Ga0495595_0006075 | Ga0495595_0006075_1019_2491 | 441 |
| 907 | 3300053085 | Ga0495619_0040929 | Ga0495619_0040929_1322_2794 | 441 |
| 908 | 3300053085 | Ga0495619_0110619 | Ga0495619_0110619_84_1547 | 441 |
| 909 | 3300053094 | Ga0500566_0000011 | Ga0500566_0000011_913_2382 | 441 |
| 910 | 3300053094 | Ga0500566_0000245 | Ga0500566_0000245_18733_20193 | 441 |
| 911 | 3300053094 | Ga0500566_0001264 | Ga0500566_0001264_10024_11496 | 441 |
| 912 | 3300053095 | Ga0500640_008947 | Ga0500640_008947_732_2201 | 441 |
| 913 | 3300053102 | Ga0500554_005062 | Ga0500554_005062_68_1537 | 441 |
| 914 | 3300053109 | Ga0500569_001642 | Ga0500569_001642_1616_3079 | 441 |
| 915 | 3300053111 | Ga0500572_000395 | Ga0500572_000395_9053_10522 | 441 |
| 916 | 3300053119 | Ga0500595_000372 | Ga0500595_000372_3803_5275 | 441 |
| 917 | 3300053119 | Ga0500595_002940 | Ga0500595_002940_6319_7788 | 441 |
| 918 | 3300053120 | Ga0500597_007385 | Ga0500597_007385_614_2116 | 441 |
| 919 | 3300053122 | Ga0500608_016467 | Ga0500608_016467_109_1578 | 441 |
| 920 | 3300053124 | Ga0500617_036455 | Ga0500617_036455_94_1563 | 441 |
| 921 | 3300053130 | Ga0500642_0000070 | Ga0500642_0000070_20541_22004 | 441 |
| 922 | 3300053130 | Ga0500642_0000368 | Ga0500642_0000368_8345_9820 | 441 |
| 923 | 3300053130 | Ga0500642_0029051 | Ga0500642_0029051_459_1922 | 441 |
| 924 | 3300053148 | Ga0500590_016846 | Ga0500590_016846_2055_3524 | 441 |
| 925 | 3300053150 | Ga0500603_000115 | Ga0500603_000115_5002_6489 | 441 |
| 926 | 3300053150 | Ga0500603_002253 | Ga0500603_002253_1905_3374 | 441 |
| 927 | 3300053159 | Ga0500630_003676 | Ga0500630_003676_5254_6723 | 441 |
| 928 | 3300053161 | Ga0500634_0081344 | Ga0500634_0081344_63_1532 | 441 |
| 929 | 3300053162 | Ga0500638_002737 | Ga0500638_002737_1217_2689 | 441 |
| 930 | 3300053163 | Ga0500639_000009 | Ga0500639_000009_36968_38437 | 441 |
| 931 | 3300053178 | Ga0500637_0000390 | Ga0500637_0000390_9390_10862 | 441 |
| 932 | 3300053730 | Ga0500645_009918 | Ga0500645_009918_1561_3030 | 441 |
| 933 | 3300053731 | Ga0500609_001065 | Ga0500609_001065_1064_2527 | 441 |
| 934 | 3300053737 | Ga0500601_000077 | Ga0500601_000077_1969_3432 | 441 |
| 935 | iso_pu_bacteria | 2876761206 | 2876770057 | 441 |
| 936 | 3300009551 | Ga0105238_10119372 | Ga0105238_101193721 | 442 |
| 937 | 3300026035 | Ga0207703_10155817 | Ga0207703_101558172 | 442 |
| 938 | 3300028573 | Ga0265334_10023851 | Ga0265334_100238512 | 442 |
| 939 | 3300028577 | Ga0265318_10009805 | Ga0265318_100098053 | 442 |
| 940 | 3300028653 | Ga0265323_10002846 | Ga0265323_100028468 | 442 |
| 941 | 3300028666 | Ga0265336_10000277 | Ga0265336_1000027716 | 442 |
| 942 | 3300028800 | Ga0265338_10002073 | Ga0265338_100020737 | 442 |
| 943 | 3300048927 | Ga0496124_0090738 | Ga0496124_0090738_706_2166 | 442 |
| 944 | 3300048928 | Ga0496125_0110732 | Ga0496125_0110732_243_1703 | 442 |
| 945 | 3300049568 | Ga0501031_0029390 | Ga0501031_0029390_1768_3120 | 442 |
| 946 | 3300049574 | Ga0501038_0122089 | Ga0501038_0122089_262_1614 | 442 |
| 947 | 3300049574 | Ga0501038_0135494 | Ga0501038_0135494_134_1486 | 442 |
| 948 | 3300049578 | Ga0501042_0042674 | Ga0501042_0042674_139_1491 | 442 |
| 949 | 3300049588 | Ga0501072_0118406 | Ga0501072_0118406_62_1414 | 442 |
| 950 | 3300049592 | Ga0501076_0021451 | Ga0501076_0021451_569_1921 | 442 |
| 951 | 3300054114 | Ga0501084_0055624 | Ga0501084_0055624_1837_3189 | 442 |
| 952 | 3300025272 | Ga0209455_1003722 | Ga0209455_10037222 | 445 |
| 953 | 3300053111 | Ga0500572_000281 | Ga0500572_000281_3429_4940 | 445 |
| 954 | 3300053136 | Ga0500559_0000609 | Ga0500559_0000609_3555_5066 | 445 |
| 955 | 3300053735 | Ga0500596_005060 | Ga0500596_005060_832_2343 | 445 |
| 956 | iso_pu_bacteria | 2912723979 | 2912728715 | 449 |
| 957 | 3300005327 | Ga0070658_10018746 | Ga0070658_100187466 | 454 |
| 958 | 3300005329 | Ga0070683_100128037 | Ga0070683_1001280372 | 454 |
| 959 | 3300005336 | Ga0070680_100178670 | Ga0070680_1001786702 | 454 |
| 960 | 3300005337 | Ga0070682_100150449 | Ga0070682_1001504491 | 454 |
| 961 | 3300005344 | Ga0070661_100048046 | Ga0070661_1000480463 | 454 |
| 962 | 3300013105 | Ga0157369_10148938 | Ga0157369_101489384 | 454 |
| 963 | 3300026116 | Ga0207674_10117331 | Ga0207674_101173313 | 454 |
| 964 | 3300025253 | Ga0209677_100482 | Ga0209677_10048213 | 455 |
| 965 | iso_pu_bacteria | 2501939600 | 2501941235 | 455 |
| 966 | iso_pu_bacteria | 2856858025 | 2856863874 | 455 |
| 967 | iso_pu_bacteria | 649633069 | 649814417 | 455 |
| 968 | 3300025944 | Ga0207661_10054608 | Ga0207661_100546083 | 456 |
| 969 | iso_pu_bacteria | 2808606448 | 2809235401 | 464 |
| 970 | 3300001989 | JGI24739J22299_10020016 | JGI24739J22299_100200162 | 469 |
| 971 | 3300005467 | Ga0070706_100000914 | Ga0070706_10000091419 | 469 |
| 972 | 3300005467 | Ga0070706_100084440 | Ga0070706_1000844401 | 469 |
| 973 | 3300025910 | Ga0207684_10001650 | Ga0207684_100016505 | 469 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ns6-assembly1.cif.gz_C | crystal structure of beta-glucosidase bglm-g1 from marine metagenome | 0.9914 | 29 | 459 |
| 5ns7-assembly1.cif.gz_A | crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome | 0.9913 | 29 | 459 |
| 5ns7-assembly1.cif.gz_B | crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome | 0.9911 | 29 | 459 |
| 6m6m-assembly2.cif.gz_B | the crystal structure of glycosidase mutant | 0.9884 | 20 | 462 |
| 6m6l-assembly2.cif.gz_B | the crystal structure of glycosidase hydrolyzing notoginsenoside | 0.9883 | 20 | 462 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ns7A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9913 | 29 | 459 | 3.20.20.80 |
| 5aybA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9826 | 25 | 460 | 3.20.20.80 |
| 3ta9B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9718 | 25 | 461 | 3.20.20.80 |
| 5aybA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9716 | 25 | 460 | 3.20.20.80 |
| 5gnzI00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9702 | 25 | 465 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3IHB8-F1-model_v4 | Family 1 glycosylhydrolase | 0.998 | 116 | 308 |
GO:0005829
GO:0008422 GO:0016052 |
| AF-A0A060BTT6-F1-model_v4 | Glyco_hydro_1 | 0.9963 | 85 | 195 |
GO:0005829
GO:0008422 GO:0016052 |
| AF-A0A1H0K4E1-F1-model_v4 | Beta-glucosidase (EC 3.2.1.21) | 0.9961 | 21 | 469 |
GO:0005829
GO:0008422 GO:0030245 |
| AF-A0A2N5AAG0-F1-model_v4 | Aryl-phospho-beta-D-glucosidase | 0.996 | 25 | 158 |
GO:0005829
GO:0008422 GO:0016052 |
| AF-A0A3D5DVX1-F1-model_v4 | Beta-glucosidase | 0.9953 | 25 | 145 |
GO:0005829
GO:0008422 GO:0030245 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar