F487199

General Info

Members Datasets Scaffolds Average Seq Length
973 779 1946 147

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2600255279|2601607992
Length 169
Sequence VDSIVSAASKPSAFHPGVAMSIPFPSAPADKEVLENAGLFSPKFDAHGLVTAVVTDARDGELLMVAHMNAEALSLTLETGIAHYYSRSRDKIWKKGETSGNLQTVKEFRTDCDQDAVWLKVSVAGHDATCHTGRRSCFYRTVELSNGDAVTKITDDTRHFDPATTYSNT

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
63 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
64 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
65 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
66 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
119 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
120 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
121 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
125 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
126 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
127 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
128 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
129 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
130 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
131 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
132 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
133 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
134 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
135 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
227 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
228 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
247 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
248 2509276019 Ensifer aridi TW10 Isolate Nodule
249 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
250 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
251 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
252 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
253 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
254 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
255 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
256 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
257 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
258 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
259 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
260 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
261 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
262 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
263 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
264 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
265 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
266 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
267 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
268 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
269 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
270 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
271 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
272 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
273 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
274 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
275 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
276 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
277 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
278 2516143018 Ensifer sp. BR816 Isolate Nodule
279 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
280 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
281 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
282 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
283 2519899620 Rhizobium sp. Pop5 Isolate Nodule
284 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
285 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
286 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
287 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
288 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
289 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
290 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
291 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
292 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
293 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
294 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
295 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
296 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
297 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
298 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
299 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
300 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
301 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
302 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
303 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
304 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
305 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
306 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
307 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
308 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
309 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
310 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
311 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
312 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
313 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
314 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
315 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
316 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
317 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
318 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
319 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
320 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
321 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
322 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
323 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
324 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
325 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
326 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
327 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
328 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
329 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
330 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
331 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
332 2643221557 Ensifer sp. Root558 Isolate Unclassified
333 2643221558 Rhizobium sp. Root149 Isolate Unclassified
334 2643221568 Rhizobium sp. Root564 Isolate Unclassified
335 2643221582 Rhizobium sp. Root651 Isolate Unclassified
336 2643221610 Ensifer sp. Root74 Isolate Unclassified
337 2643221618 Ensifer sp. Root231 Isolate Unclassified
338 2643221626 Ensifer sp. Root31 Isolate Unclassified
339 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
340 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
341 2643221655 Ensifer sp. Root1252 Isolate Unclassified
342 2643221659 Ensifer sp. Root127 Isolate Unclassified
343 2643221668 Ensifer sp. Root423 Isolate Unclassified
344 2643221675 Ensifer sp. Root1298 Isolate Unclassified
345 2643221680 Ensifer sp. Root1312 Isolate Unclassified
346 2643221688 Rhizobium sp. Root482 Isolate Unclassified
347 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
348 2643221693 Rhizobium sp. Root491 Isolate Unclassified
349 2643221698 Ensifer sp. Root142 Isolate Unclassified
350 2643221712 Ensifer sp. Root258 Isolate Unclassified
351 2643221718 Rhizobium sp. Root268 Isolate Unclassified
352 2643221719 Rhizobium sp. Root274 Isolate Unclassified
353 2643221723 Ensifer sp. Root278 Isolate Unclassified
354 2643221726 Ensifer sp. Root954 Isolate Unclassified
355 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
356 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
357 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
358 2718217882 Rhizobium sp. N741 Isolate Nodule
359 2718217927 Rhizobium sp. N324 Isolate Nodule
360 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
361 2718218009 Rhizobium sp. N561 Isolate Nodule
362 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
363 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
364 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
365 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
366 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
367 2718218363 Rhizobium sp. N113 Isolate Nodule
368 2718218365 Rhizobium sp. N731 Isolate Nodule
369 2718218366 Rhizobium sp. N621 Isolate Nodule
370 2718218423 Rhizobium sp. N941 Isolate Nodule
371 2721755514 Rhizobium sp. N6212 Isolate Nodule
372 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
373 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
374 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
375 2721755809 Rhizobium sp. N541 Isolate Nodule
376 2721755810 Rhizobium sp. N871 Isolate Nodule
377 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
378 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
379 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
380 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
381 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
382 2728369365 Rhizobium sp. N1341 Isolate Nodule
383 2728369397 Rhizobium sp. N1314 Isolate Nodule
384 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
385 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
386 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
387 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
388 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
389 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
390 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
391 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
392 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
393 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
394 2791355256 Rhizobium sp. M10 Isolate Nodule
395 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
396 2791355260 Rhizobium sp. L9 Isolate Nodule
397 2791355261 Rhizobium sp. J15 Isolate Nodule
398 2791355262 Rhizobium sp. M1 Isolate Nodule
399 2791355263 Rhizobium chutanense C5 Isolate Nodule
400 2791355264 Rhizobium sp. S9 Isolate Nodule
401 2791355265 Rhizobium sp. H4 Isolate Nodule
402 2791355266 Rhizobium sp. L43 Isolate Nodule
403 2791355267 Rhizobium sp. L18 Isolate Nodule
404 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
405 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
406 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
407 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
408 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
409 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
410 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
411 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
412 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
413 2802429633 Rhizobium anhuiense J3 Isolate Nodule
414 2802429634 Rhizobium anhuiense S10 Isolate Nodule
415 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
416 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
417 2802429637 Rhizobium anhuiense C15 Isolate Nodule
418 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
419 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
420 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
421 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
422 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
423 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
424 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
425 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
426 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
427 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
428 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
429 2838048938 Rhizobium pisi 27/80 Isolate Nodule
430 2838061910 Rhizobium phaseoli L15 Isolate Nodule
431 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
432 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
433 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
434 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
435 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
436 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
437 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
438 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
439 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
440 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
441 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
442 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
443 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
444 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
445 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
446 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
447 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
448 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
449 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
450 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
451 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
452 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
453 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
454 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
455 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
456 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
457 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
458 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
459 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
460 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
461 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
462 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
463 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
464 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
465 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
466 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
467 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
468 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
469 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
470 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
471 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
472 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
473 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
474 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
475 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
476 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
477 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
478 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
479 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
480 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
481 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
482 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
483 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
484 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
485 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
486 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
487 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
488 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
489 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
490 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
491 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
492 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
493 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
494 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
495 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
496 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
497 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
498 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
499 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
500 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
501 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
502 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
503 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
504 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
505 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
506 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
507 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
508 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
509 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
510 2844163670 Ensifer sp. 1H6 Isolate Unclassified
511 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
512 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
513 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
514 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
515 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
516 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
517 2854911287 Brucella lupini LUP21 Isolate Unclassified
518 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
519 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
520 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
521 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
522 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
523 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
524 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
525 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
526 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
527 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
528 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
529 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
530 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
531 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
532 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
533 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
534 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
535 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
536 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
537 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
538 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
539 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
540 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
541 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
542 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
543 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
544 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
545 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
546 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
547 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
548 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
549 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
550 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
551 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
552 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
553 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
554 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
555 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
556 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
557 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
558 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
559 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
560 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
561 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
562 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
563 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
564 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
565 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
566 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
567 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
568 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
569 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
570 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
571 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
572 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
573 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
574 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
575 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
576 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
577 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
578 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
579 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
580 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
581 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
582 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
583 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
584 2933599457 Rhizobium phaseoli M3 Isolate Nodule
585 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
586 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
587 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
588 2936381700 Rhizobium chutanense C16 Isolate Unclassified
589 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
590 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
591 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
592 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
593 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
594 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
595 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
596 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
597 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
598 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
599 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
600 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
601 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
602 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
603 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
604 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
605 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
606 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
607 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
608 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
609 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
610 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
611 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
612 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
613 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
614 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
615 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
616 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
617 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
618 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
619 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
620 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
621 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
622 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
623 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
624 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
625 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
626 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
627 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
628 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
629 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
630 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
631 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
632 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
633 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
634 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
635 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
636 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
637 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
638 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
639 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
640 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
641 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
642 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
643 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
644 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
645 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
646 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
647 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
648 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
649 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
650 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
651 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
652 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
653 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
654 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
655 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
656 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
657 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
658 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
659 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
660 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
661 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
662 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
663 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
664 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
665 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
666 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
667 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
668 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
669 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
670 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
671 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
672 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
673 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
674 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
675 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
676 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
677 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
678 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
679 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
680 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
681 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
682 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
683 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
684 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
685 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
686 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
687 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
688 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
689 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
690 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
691 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
692 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
693 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
694 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
695 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
696 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
697 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
698 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
699 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
700 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
701 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
702 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
703 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
704 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
705 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
706 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
707 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
708 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
709 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
710 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
711 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
712 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
713 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
714 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
715 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
716 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
717 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
718 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
719 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
720 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
721 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
722 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
723 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
724 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
725 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
726 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
727 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
728 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
729 2996893221 Rhizobium sp. R635 Isolate Nodule
730 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
731 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
732 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
733 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
734 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
735 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
736 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
737 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
738 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
739 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
740 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
741 8005275841 Rhizobium sp. N4311 Isolate Nodule
742 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
743 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
744 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
745 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
746 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
747 8005382845 Rhizobium sp. R634 Isolate Nodule
748 8005395548 Rhizobium sp. R339 Isolate Nodule
749 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
750 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
751 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
752 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
753 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
754 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
755 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
756 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
757 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
758 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
759 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
760 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
761 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
762 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
763 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
764 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
765 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
766 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
767 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
768 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
769 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
770 8024501048 Rhizobium sp. H4 Isolate Nodule
771 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
772 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
773 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
774 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
775 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
776 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
777 8056382006 Rhizobium croatiense 13T Isolate Nodule
778 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
779 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.88
Metatranscriptomes 1.23
Isolates 54.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 15.62
Nodule 41.42
Rhizoplane 2.06
Rhizosphere 21.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C9452 2010549000 Bacteria 1300
2 JGI24740J21852_10000240 3300001979 Bacteria 23152
3 JGI25155J39150_1000058 3300002704 Bacteria 72188
4 JGI25156J39149_1000080 3300002705 Bacteria 72430
5 JGI25162J39368_1000798 3300002737 Bacteria 21041
6 JGI25162J39368_1000942 3300002737 Bacteria 18688
7 JGI25162J39368_1002903 3300002737 Bacteria 5848
8 JGI25162J39368_1003447 3300002737 Bacteria 4568
9 JGI25154J39366_1000224 3300002738 Bacteria 38440
10 JGI25157J39369_1000101 3300002741 Bacteria 72430
11 JGI25152J39213_1006003 3300002773 Bacteria 3405
12 JGI25152J39213_1027029 3300002773 Bacteria 928
13 JGI25152J39213_1027068 3300002773 Bacteria 927
14 JGI25150J39212_1011557 3300002774 Bacteria 1594
15 JGI25159J45721_1000006 3300002987 Bacteria 188201
16 JGI25151J46595_10010040 3300003187 Bacteria 4435
17 JGI25151J46595_10037454 3300003187 Bacteria 1819
18 JGI25151J46595_10045366 3300003187 Bacteria 1552
19 JGI25165J46597_1000747 3300003214 Bacteria 25073
20 JGI25165J46597_1001007 3300003214 Bacteria 18684
21 JGI25165J46597_1008197 3300003214 Bacteria 1659
22 JGI25153J46596_10004125 3300003215 Bacteria 7905
23 JGI25153J46596_10068665 3300003215 Bacteria 928
24 JGI25153J46596_10068750 3300003215 Bacteria 927
25 rootH1_10058669 3300003316 Bacteria 2282
26 rootH2_10006547 3300003320 Bacteria 2155
27 rootL2_10001427 3300003322 Bacteria 10865
28 rootL2_10141239 3300003322 Bacteria 2047
29 rootH1_10087504 3300003323 Bacteria 1107
30 rootH1_10140377 3300003323 Bacteria 2152
31 JGI25160J50197_1000019 3300003354 Bacteria 233980
32 JGI25160J50197_1002563 3300003354 Bacteria 8406
33 JGI25161J50226_1000157 3300003374 Bacteria 47443
34 JGI25161J50226_1000346 3300003374 Bacteria 24757
35 Ga0055539_1006528 3300003752 Bacteria 1490
36 Ga0055526_1006233 3300003771 Bacteria 6540
37 Ga0055526_1008270 3300003771 Bacteria 5221
38 Ga0055526_1020769 3300003771 Bacteria 2316
39 Ga0055524_1001008 3300003775 Bacteria 17483
40 Ga0055524_1001365 3300003775 Bacteria 14165
41 Ga0055524_1024519 3300003775 Bacteria 1911
42 Ga0055524_1032341 3300003775 Bacteria 1485
43 Ga0055536_1000645 3300003781 Bacteria 23637
44 Ga0055528_1000851 3300003790 Bacteria 20725
45 Ga0055530_10004713 3300003791 Bacteria 6900
46 Ga0055530_10065194 3300003791 Bacteria 800
47 Ga0055540_1001322 3300003792 Bacteria 14966
48 Ga0055540_1001521 3300003792 Bacteria 13669
49 Ga0055540_1012369 3300003792 Bacteria 2683
50 Ga0055531_10001888 3300003794 Bacteria 14671
51 Ga0055531_10002873 3300003794 Bacteria 11229
52 Ga0055531_10067209 3300003794 Bacteria 843
53 Ga0055543_1000032 3300004625 Bacteria 130218
54 Ga0055543_1000145 3300004625 Bacteria 58910
55 Ga0058859_11670122 3300004798 Bacteria 1326
56 Ga0065165_1000180 3300005262 Bacteria 111768
57 Ga0065165_1003840 3300005262 Bacteria 10003
58 Ga0070670_100000603 3300005331 Bacteria 28216
59 Ga0070682_100207910 3300005337 Bacteria 1385
60 Ga0070669_100597990 3300005353 Bacteria 924
61 Ga0070671_100130749 3300005355 Bacteria 2114
62 Ga0070665_100284105 3300005548 Bacteria 1657
63 Ga0068854_100043013 3300005578 Bacteria 3200
64 Ga0068856_100033811 3300005614 Bacteria 5007
65 Ga0068856_100946695 3300005614 Bacteria 880
66 Ga0068852_100041122 3300005616 Bacteria 3905
67 Ga0081455_10210237 3300005937 Bacteria 1450
68 Ga0075365_10027350 3300006038 Bacteria 3629
69 Ga0075365_10505039 3300006038 Bacteria 855
70 Ga0075364_10000170 3300006051 Bacteria 29008
71 Ga0075364_10054934 3300006051 Bacteria 2605
72 Ga0075364_11005233 3300006051 Bacteria 567
73 Ga0075369_10018019 3300006186 Bacteria 2871
74 Ga0075366_10224069 3300006195 Bacteria 1146
75 Ga0075370_10011896 3300006353 Bacteria 4584
76 Ga0075370_10319958 3300006353 Bacteria 924
77 Ga0075370_10815880 3300006353 Bacteria 569
78 Ga0075434_100106989 3300006871 Bacteria 2807
79 Ga0079104_1011892 3300006946 Bacteria 2768
80 Ga0105240_10000005 3300009093 Bacteria 702630
81 Ga0105237_10001344 3300009545 Bacteria 32586
82 Ga0105239_10003591 3300010375 Bacteria 18945
83 Ga0105239_10329586 3300010375 Bacteria 1722
84 Ga0157319_1002443 3300012497 Bacteria 1069
85 Ga0157371_10012507 3300013102 Bacteria 6486
86 Ga0157370_10000948 3300013104 Bacteria 36781
87 Ga0157369_10096384 3300013105 Bacteria 3156
88 Ga0157369_10158503 3300013105 Bacteria 2390
89 Ga0171463_1011 3300013249 Bacteria 230603
90 Ga0157378_11306727 3300013297 Bacteria 767
91 Ga0163162_10316912 3300013306 Bacteria 1692
92 Ga0182008_10078580 3300014497 Bacteria 1623
93 Ga0182007_10002187 3300015262 Bacteria 9922
94 Ga0182005_1003334 3300015265 Bacteria 5475
95 Ga0183363_1430 3300015690 Bacteria 3144
96 Ga0163161_11422499 3300017792 Bacteria 606
97 Ga0214544_1000265 3300021320 Bacteria 87060
98 Ga0214542_1000015 3300021321 Bacteria 227912
99 Ga0214542_1020378 3300021321 Bacteria 4884
100 Ga0214543_1000011 3300021327 Bacteria 344093
101 Ga0214543_1000032 3300021327 Bacteria 200766
102 Ga0209435_100045 3300025206 Bacteria 96483
103 Ga0209760_107039 3300025207 Bacteria 871
104 Ga0209436_100001 3300025208 Bacteria 304543
105 Ga0209436_100333 3300025208 Bacteria 21394
106 Ga0209672_102875 3300025228 Bacteria 3868
107 Ga0209672_117561 3300025228 Bacteria 753
108 Ga0209563_103879 3300025230 Bacteria 2978
109 Ga0207427_106592 3300025231 Bacteria 1452
110 Ga0209437_100047 3300025233 Bacteria 405163
111 Ga0209437_100122 3300025233 Bacteria 201364
112 Ga0207425_1002752 3300025245 Bacteria 5980
113 Ga0207425_1045841 3300025245 Bacteria 816
114 Ga0207425_1059235 3300025245 Bacteria 679
115 Ga0209646_1000154 3300025246 Bacteria 96483
116 Ga0209646_1003813 3300025246 Bacteria 2877
117 Ga0209026_1000177 3300025250 Bacteria 96629
118 Ga0209677_100440 3300025253 Bacteria 24115
119 Ga0209759_1000274 3300025256 Bacteria 72593
120 Ga0209759_1041180 3300025256 Bacteria 794
121 Ga0209129_1002592 3300025258 Bacteria 8661
122 Ga0209129_1003488 3300025258 Bacteria 6797
123 Ga0209129_1003511 3300025258 Bacteria 6776
124 Ga0209129_1005991 3300025258 Bacteria 4082
125 Ga0209233_1000048 3300025261 Bacteria 453669
126 Ga0209233_1000170 3300025261 Bacteria 147527
127 Ga0209233_1001493 3300025261 Bacteria 9197
128 Ga0209565_1070826 3300025263 Bacteria 588
129 Ga0209673_1000013 3300025273 Bacteria 571633
130 Ga0209673_1001787 3300025273 Bacteria 17792
131 Ga0209673_1022246 3300025273 Bacteria 2192
132 Ga0209130_1000004 3300025284 Bacteria 633436
133 Ga0209130_1000007 3300025284 Bacteria 591584
134 Ga0209130_1034287 3300025284 Bacteria 1023
135 Ga0209676_1000399 3300025292 Bacteria 79312
136 Ga0209676_1013109 3300025292 Bacteria 3206
137 Ga0209025_1000787 3300025294 Bacteria 52060
138 Ga0209025_1000870 3300025294 Bacteria 47707
139 Ga0209025_1007264 3300025294 Bacteria 8325
140 Ga0209025_1027407 3300025294 Bacteria 2826
141 Ga0209025_1029520 3300025294 Bacteria 2650
142 Ga0209564_1000140 3300025295 Bacteria 179856
143 Ga0209564_1000566 3300025295 Bacteria 58647
144 Ga0209564_1000906 3300025295 Bacteria 38845
145 Ga0209758_1000977 3300025297 Bacteria 38489
146 Ga0209758_1001265 3300025297 Bacteria 31307
147 Ga0209758_1001420 3300025297 Bacteria 28346
148 Ga0209758_1002711 3300025297 Bacteria 17455
149 Ga0209758_1008178 3300025297 Bacteria 6861
150 Ga0209758_1055124 3300025297 Bacteria 1353
151 Ga0209050_1000906 3300025298 Bacteria 39206
152 Ga0209050_1001733 3300025298 Bacteria 21711
153 Ga0209256_1000606 3300025299 Bacteria 49790
154 Ga0209256_1000947 3300025299 Bacteria 35197
155 Ga0209256_1001532 3300025299 Bacteria 23262
156 Ga0209256_1002736 3300025299 Bacteria 13634
157 Ga0209256_1010200 3300025299 Bacteria 3976
158 Ga0207426_1000003 3300025302 Bacteria 1063212
159 Ga0207426_1000111 3300025302 Bacteria 234032
160 Ga0209051_1001061 3300025303 Bacteria 25637
161 Ga0209051_1002566 3300025303 Bacteria 12821
162 Ga0209051_1003671 3300025303 Bacteria 9931
163 Ga0209051_1045274 3300025303 Bacteria 1524
164 Ga0209257_1001014 3300025304 Bacteria 37770
165 Ga0209257_1001423 3300025304 Bacteria 28423
166 Ga0209257_1057234 3300025304 Bacteria 1073
167 Ga0207695_10000011 3300025913 Bacteria 910221
168 Ga0207671_10000314 3300025914 Bacteria 71414
169 Ga0207649_10300260 3300025920 Bacteria 1174
170 Ga0207681_10513840 3300025923 Bacteria 982
171 Ga0207650_10001911 3300025925 Bacteria 14671
172 Ga0207644_10420203 3300025931 Bacteria 1095
173 Ga0207712_10139481 3300025961 Bacteria 1859
174 Ga0207640_10036793 3300025981 Bacteria 3076
175 Ga0207702_10016488 3300026078 Bacteria 6114
176 Ga0207702_10355219 3300026078 Bacteria 1403
177 Ga0207698_10795544 3300026142 Bacteria 947
178 Ga0209281_1000334 3300027111 Bacteria 81109
179 Ga0209281_1000361 3300027111 Bacteria 74287
180 Ga0209371_1011930 3300027312 Bacteria 2548
181 Ga0209282_1000073 3300027666 Bacteria 81125
182 Ga0209282_1000095 3300027666 Bacteria 60099
183 Ga0268266_10202752 3300028379 Bacteria 1816
184 Ga0307515_10001215 3300028794 Bacteria 58879
185 Ga0307515_10001393 3300028794 Bacteria 54715
186 Ga0307515_10038442 3300028794 Bacteria 7655
187 Ga0307515_10258924 3300028794 Bacteria 1479
188 Ga0268256_1012987 3300030500 Bacteria 2548
189 Ga0307513_10046052 3300031456 Bacteria 4761
190 Ga0307405_11246188 3300031731 Bacteria 645
191 Ga0307412_10563049 3300031911 Bacteria 959
192 Ga0307416_102118423 3300032002 Bacteria 664
193 Ga0307414_12071045 3300032004 Bacteria 531
194 Ga0315913_1000129 3300033430 Bacteria 48181
195 Ga0373932_0422585 3300035112 Bacteria 519
196 Ga0316574_0981343 3300035398 Bacteria 509
197 Ga0316582_0250613 3300036647 Bacteria 1213
198 Ga0395905_0000827 3300037471 Bacteria 40424
199 Ga0395905_0006518 3300037471 Bacteria 11738
200 Ga0395905_0609660 3300037471 Bacteria 993
201 Ga0395905_1124358 3300037471 Bacteria 689
202 Ga0395901_0447926 3300038443 Bacteria 1321
203 Ga0439436_0112232 3300041404 Bacteria 761
204 Ga0439438_070849 3300041405 Bacteria 863
205 Ga0439461_0049033 3300041410 Bacteria 932
206 Ga0439466_0114642 3300041411 Bacteria 834
207 Ga0439465_0044118 3300041413 Bacteria 1448
208 Ga0439465_0094279 3300041413 Bacteria 1027
209 Ga0451793_1771588 3300041452 Bacteria 2505
210 Ga0451833_1006218 3300041491 Bacteria 517
211 Ga0451835_0689076 3300041492 Bacteria 2775
212 Ga0451840_12231 3300041497 Bacteria 1258
213 Ga0451841_0183806 3300041498 Bacteria 1424
214 Ga0451846_02444 3300041502 Bacteria 1556
215 Ga0451847_0483869 3300041503 Bacteria 603
216 Ga0451847_0486657 3300041503 Bacteria 2072
217 Ga0451848_08423 3300041504 Bacteria 784
218 Ga0451849_0137763 3300041505 Bacteria 1088
219 Ga0451850_51725 3300041506 Bacteria 1527
220 Ga0451851_0203844 3300041507 Bacteria 774
221 Ga0451854_17026 3300041510 Bacteria 1526
222 Ga0451855_0606958 3300041511 Bacteria 985
223 Ga0451853_3234756 3300041512 Bacteria 2743
224 Ga0439449_0005864 3300042007 Bacteria 4695
225 Ga0439457_017484 3300042014 Bacteria 1593
226 Ga0466965_0188862 3300044683 Bacteria 1089
227 Ga0466971_0319425 3300044719 Bacteria 748
228 Ga0466968_0013912 3300044735 Bacteria 3172
229 Ga0466970_0001159 3300044765 Bacteria 12775
230 Ga0466957_0323890 3300044842 Bacteria 1040
231 Ga0466959_0155850 3300045049 Bacteria 1607
232 Ga0466958_0306419 3300045836 Bacteria 1020
233 Ga0466967_0389383 3300045976 Bacteria 1355
234 Ga0495638_0000597 3300046460 Bacteria 40647
235 Ga0495638_0065247 3300046460 Bacteria 2241
236 Ga0495650_0082159 3300046471 Bacteria 1240
237 Ga0495585_0114385 3300046492 Bacteria 1432
238 Ga0495596_0340851 3300046500 Bacteria 583
239 Ga0495607_0014939 3300046501 Bacteria 5048
240 Ga0495583_0047246 3300046506 Bacteria 1981
241 Ga0495606_0005935 3300046507 Bacteria 11467
242 Ga0495606_0031156 3300046507 Bacteria 3712
243 Ga0495606_0065151 3300046507 Bacteria 2316
244 Ga0495606_0377080 3300046507 Bacteria 745
245 Ga0495610_0031394 3300046512 Bacteria 2772
246 Ga0495610_0048705 3300046512 Bacteria 2079
247 Ga0495616_0023559 3300046513 Bacteria 3310
248 Ga0495616_0058559 3300046513 Bacteria 1897
249 Ga0495620_0012510 3300046515 Bacteria 4378
250 Ga0495631_0035705 3300046518 Bacteria 2222
251 Ga0495632_0040920 3300046519 Bacteria 2331
252 Ga0495632_0211342 3300046519 Bacteria 880
253 Ga0495643_0036606 3300046522 Bacteria 2695
254 Ga0495643_0083423 3300046522 Bacteria 1659
255 Ga0495643_0142369 3300046522 Bacteria 1194
256 Ga0495643_0316035 3300046522 Bacteria 707
257 Ga0495654_0000641 3300046530 Bacteria 27579
258 Ga0495654_0130829 3300046530 Bacteria 1127
259 Ga0495597_0010628 3300046542 Bacteria 4490
260 Ga0495597_0046866 3300046542 Bacteria 1915
261 Ga0495668_0184666 3300046616 Bacteria 1142
262 Ga0495625_0038160 3300046660 Bacteria 3518
263 Ga0495625_0132496 3300046660 Bacteria 1687
264 Ga0495625_0284198 3300046660 Bacteria 1063
265 Ga0495625_0285028 3300046660 Bacteria 1062
266 Ga0495625_0368167 3300046660 Bacteria 904
267 Ga0495670_0118813 3300046691 Bacteria 1372
268 Ga0495671_0060942 3300046692 Bacteria 1862
269 Ga0495649_0060150 3300046694 Bacteria 2044
270 Ga0495636_0141114 3300047318 Bacteria 1076
271 Ga0495636_0330062 3300047318 Bacteria 717
272 Ga0495672_0020846 3300047320 Bacteria 4287
273 Ga0495687_203038 3300047443 Bacteria 628
274 Ga0495679_072035 3300047446 Bacteria 994
275 Ga0495681_0079294 3300047470 Bacteria 1469
276 Ga0495686_0003870 3300047472 Bacteria 12635
277 Ga0495686_0015546 3300047472 Bacteria 5190
278 Ga0495686_0018766 3300047472 Bacteria 4633
279 Ga0495686_0056345 3300047472 Bacteria 2456
280 Ga0495686_0099843 3300047472 Bacteria 1752
281 Ga0495686_0115104 3300047472 Bacteria 1609
282 Ga0495615_0014893 3300048090 Bacteria 1652
283 Ga0495615_0113248 3300048090 Bacteria 778
284 Ga0496100_0607993 3300048903 Bacteria 849
285 Ga0496102_0053430 3300048905 Bacteria 3682
286 Ga0496103_0011652 3300048906 Bacteria 5215
287 Ga0496106_0000801 3300048909 Bacteria 22763
288 Ga0496106_0381654 3300048909 Bacteria 1132
289 Ga0496106_0756981 3300048909 Bacteria 772
290 Ga0496110_0061950 3300048913 Bacteria 3303
291 Ga0496111_0018396 3300048914 Bacteria 4840
292 Ga0496113_0136267 3300048916 Bacteria 1929
293 Ga0496116_0050273 3300048919 Bacteria 2778
294 Ga0496116_0110497 3300048919 Bacteria 1617
295 Ga0496116_0260180 3300048919 Bacteria 856
296 Ga0496117_0000641 3300048920 Bacteria 56335
297 Ga0496117_0002492 3300048920 Bacteria 23104
298 Ga0496117_0032556 3300048920 Bacteria 3959
299 Ga0496117_0044740 3300048920 Bacteria 3204
300 Ga0496117_0119160 3300048920 Bacteria 1626
301 Ga0496118_0002255 3300048921 Bacteria 26416
302 Ga0496118_0002788 3300048921 Bacteria 22874
303 Ga0496118_0021378 3300048921 Bacteria 5697
304 Ga0496118_0056313 3300048921 Bacteria 2957
305 Ga0496118_0165800 3300048921 Bacteria 1358
306 Ga0496118_0283407 3300048921 Bacteria 921
307 Ga0496119_0032601 3300048922 Bacteria 3469
308 Ga0496119_0033903 3300048922 Bacteria 3374
309 Ga0496119_0058911 3300048922 Bacteria 2311
310 Ga0496120_0011601 3300048923 Bacteria 6050
311 Ga0496120_0030634 3300048923 Bacteria 3266
312 Ga0496120_0045117 3300048923 Bacteria 2556
313 Ga0496121_0000003 3300048924 Bacteria 1191431
314 Ga0496121_0000751 3300048924 Bacteria 59594
315 Ga0496121_0003358 3300048924 Bacteria 22960
316 Ga0496121_0015611 3300048924 Bacteria 7931
317 Ga0496121_0031398 3300048924 Bacteria 4853
318 Ga0496121_0091314 3300048924 Bacteria 2378
319 Ga0496121_0189522 3300048924 Bacteria 1476
320 Ga0496122_0000025 3300048925 Bacteria 362915
321 Ga0496122_0000399 3300048925 Bacteria 92476
322 Ga0496122_0003165 3300048925 Bacteria 21967
323 Ga0496122_0007138 3300048925 Bacteria 12531
324 Ga0496122_0008228 3300048925 Bacteria 11322
325 Ga0496122_0016386 3300048925 Bacteria 7015
326 Ga0496122_0074908 3300048925 Bacteria 2391
327 Ga0496122_0122567 3300048925 Bacteria 1672
328 Ga0496123_0000054 3300048926 Bacteria 234046
329 Ga0496123_0002112 3300048926 Bacteria 25505
330 Ga0496123_0010688 3300048926 Bacteria 8073
331 Ga0496123_0018189 3300048926 Bacteria 5605
332 Ga0496123_0049479 3300048926 Bacteria 2817
333 Ga0496123_0065931 3300048926 Bacteria 2297
334 Ga0496123_0129005 3300048926 Bacteria 1405
335 Ga0496123_0359006 3300048926 Bacteria 675
336 Ga0496124_0002648 3300048927 Bacteria 23011
337 Ga0496124_0008646 3300048927 Bacteria 10606
338 Ga0496124_0012897 3300048927 Bacteria 8204
339 Ga0496124_0036616 3300048927 Bacteria 4278
340 Ga0496124_0084961 3300048927 Bacteria 2594
341 Ga0496124_0088991 3300048927 Bacteria 2522
342 Ga0496124_0214638 3300048927 Bacteria 1453
343 Ga0496124_0428850 3300048927 Bacteria 908
344 Ga0496124_0608190 3300048927 Bacteria 709
345 Ga0496124_0637151 3300048927 Bacteria 687
346 Ga0496124_0759022 3300048927 Bacteria 606
347 Ga0496125_0000141 3300048928 Bacteria 158991
348 Ga0496125_0001650 3300048928 Bacteria 31436
349 Ga0496125_0021828 3300048928 Bacteria 5957
350 Ga0496125_0051706 3300048928 Bacteria 3386
351 Ga0496125_0338138 3300048928 Bacteria 905
352 Ga0496125_0342169 3300048928 Bacteria 897
353 Ga0496125_0438316 3300048928 Bacteria 752
354 Ga0496126_0001055 3300048929 Bacteria 46595
355 Ga0496126_0020807 3300048929 Bacteria 6421
356 Ga0496126_0068999 3300048929 Bacteria 3155
357 Ga0495678_029785 3300049459 Bacteria 2290
358 Ga0501031_0043880 3300049568 Bacteria 2917
359 Ga0501032_0040703 3300049569 Bacteria 3158
360 Ga0501032_0085344 3300049569 Bacteria 2099
361 Ga0501032_0252683 3300049569 Bacteria 1144
362 Ga0501033_0000118 3300049570 Bacteria 75690
363 Ga0501033_0028448 3300049570 Bacteria 4198
364 Ga0501033_0376166 3300049570 Bacteria 993
365 Ga0501034_0102139 3300049571 Bacteria 2860
366 Ga0501034_0167499 3300049571 Bacteria 2165
367 Ga0501036_0062044 3300049572 Bacteria 3166
368 Ga0501037_0215004 3300049573 Bacteria 1354
369 Ga0501038_0025657 3300049574 Bacteria 5250
370 Ga0501038_0375140 3300049574 Bacteria 1104
371 Ga0501039_0495514 3300049575 Bacteria 959
372 Ga0501043_0745639 3300049579 Bacteria 712
373 Ga0501043_0789076 3300049579 Bacteria 688
374 Ga0501047_0102950 3300049581 Bacteria 2735
375 Ga0501048_0508220 3300049582 Bacteria 864
376 Ga0501067_0197042 3300049583 Bacteria 1122
377 Ga0501068_0260229 3300049584 Bacteria 1107
378 Ga0501073_0036549 3300049589 Bacteria 3490
379 Ga0501080_0132818 3300049742 Bacteria 2304
380 Ga0501083_0052901 3300049744 Bacteria 2726
381 Ga0501083_0330634 3300049744 Bacteria 991
382 Ga0501280_002116 3300049776 Bacteria 3421
383 Ga0501280_038125 3300049776 Bacteria 771
384 Ga0501035_0002363 3300049822 Bacteria 18561
385 Ga0501035_0525970 3300049822 Bacteria 971
386 Ga0501035_0552929 3300049822 Bacteria 942
387 Ga0501035_0848203 3300049822 Bacteria 727
388 Ga0501035_1302068 3300049822 Bacteria 560
389 Ga0501044_0106883 3300049823 Bacteria 2810
390 Ga0501044_0142973 3300049823 Bacteria 2380
391 Ga0501045_0113532 3300049824 Bacteria 2009
392 nmdc:mga00v17_291_c1 3300050491 Bacteria 29216
393 nmdc:mga00v17_42712_c1 3300050491 Bacteria 2728
394 nmdc:mga0yw44_516265_c1 3300050492 Bacteria 811
395 nmdc:mga0k408_215936_c1 3300050493 Bacteria 1145
396 nmdc:mga0k408_451596_c1 3300050493 Bacteria 763
397 nmdc:mga06z11_293392_c1 3300050494 Bacteria 965
398 nmdc:mga0n895_430661_c1 3300050512 Bacteria 1333
399 nmdc:mga0rr50_583495_c1 3300050513 Bacteria 952
400 nmdc:mga0a205_596688_c1 3300050515 Bacteria 958
401 nmdc:mga0sz30_3070_c1 3300050516 Bacteria 4255
402 Ga0500578_0044842 3300053086 Bacteria 2837
403 Ga0500644_0005315 3300053088 Bacteria 3248
404 Ga0500646_0233981 3300053090 Bacteria 641
405 Ga0500654_103001 3300053099 Bacteria 1208
406 Ga0500556_0237166 3300053104 Bacteria 719
407 Ga0500572_116256 3300053111 Bacteria 864
408 Ga0500618_000125 3300053125 Bacteria 63168
409 Ga0500618_000289 3300053125 Bacteria 38453
410 Ga0500618_009145 3300053125 Bacteria 2720
411 Ga0500618_015691 3300053125 Bacteria 1909
412 Ga0500628_046983 3300053129 Bacteria 1010
413 Ga0500655_007893 3300053133 Bacteria 1917
414 Ga0500658_0000162 3300053134 Bacteria 32065
415 Ga0500658_0213842 3300053134 Bacteria 883
416 Ga0500559_0007060 3300053136 Bacteria 5009
417 Ga0500568_0000411 3300053139 Bacteria 32773
418 Ga0500568_0001577 3300053139 Bacteria 14417
419 Ga0500568_0057248 3300053139 Bacteria 1517
420 Ga0500573_0008408 3300053140 Bacteria 5684
421 Ga0500573_0013003 3300053140 Bacteria 4682
422 Ga0500577_0108487 3300053142 Bacteria 1143
423 Ga0500604_0003667 3300053151 Bacteria 4125
424 Ga0500604_0129644 3300053151 Bacteria 847
425 Ga0500616_0000661 3300053153 Bacteria 41050
426 Ga0500616_0001852 3300053153 Bacteria 19135
427 Ga0500616_0012405 3300053153 Bacteria 4987
428 Ga0500622_0000428 3300053156 Bacteria 39928
429 Ga0500622_0000956 3300053156 Bacteria 24552
430 Ga0500622_0068032 3300053156 Bacteria 1805
431 Ga0500627_0292184 3300053158 Bacteria 713
432 Ga0500645_066116 3300053730 Bacteria 1041
433 Ga0587073_0003572 3300059492 Bacteria 2146
434 Ga0587088_000751 3300059508 Bacteria 2957
435 Ga0587088_019463 3300059508 Bacteria 1116
436 Ga0587075_000934 3300059644 Bacteria 2634
437 Ga0587078_061485 3300059646 Bacteria 570
438 Ga0587079_037095 3300059647 Bacteria 967
439 Ga0501082_0044180 3300060353 Bacteria 3844
440 2601607992 2600255279 Bacteria 5605316
441 2509107915 2508501122 Bacteria 6292184
442 2509375703 2509276019 Bacteria 6802256
443 2509386809 2509276021 Bacteria 7634384
444 2509442356 2509276033 Bacteria 7180565
445 2510307010 2510065057 Bacteria 6649661
446 2510842691 2510461069 Bacteria 5505000
447 2510894545 2510461076 Bacteria 8618824
448 2511134994 2510917022 Bacteria 6504556
449 2511171591 2510917026 Bacteria 7046020
450 2511501327 2511231052 Bacteria 6974333
451 2512532748 2512047086 Bacteria 6850303
452 2512971924 2512875026 Bacteria 6861065
453 2513572225 2513237084 Bacteria 7231967
454 2513579594 2513237085 Bacteria 7695351
455 2513587081 2513237086 Bacteria 7265287
456 2513606325 2513237089 Bacteria 6553624
457 2513617841 2513237091 Bacteria 6900273
458 2513634366 2513237093 Bacteria 7545552
459 2513708858 2513237103 Bacteria 7647401
460 2513880726 2513237140 Bacteria 7076289
461 2513906727 2513237143 Bacteria 6664116
462 2513986532 2513237156 Bacteria 6402557
463 2514005474 2513237160 Bacteria 6650282
464 2514022802 2513237162 Bacteria 7468464
465 2514418537 2513237305 Bacteria 7293571
466 2515112141 2515075009 Bacteria 7288508
467 2515611533 2515154107 Bacteria 6795637
468 2515635608 2515154113 Bacteria 7807172
469 2515646192 2515154114 Bacteria 7848616
470 2515657284 2515154116 Bacteria 7552979
471 2515738711 2515154134 Bacteria 7220242
472 2516209201 2516143018 Bacteria 6951533
473 2516892606 2516653046 Bacteria 6989037
474 2517076263 2516653085 Bacteria 7346596
475 2517406653 2517287029 Bacteria 6905599
476 2517569416 2517487022 Bacteria 7227575
477 2520379371 2519899620 Bacteria 6499161
478 2524452834 2524023207 Bacteria 6813453
479 2524460534 2524023209 Bacteria 6679728
480 2530645398 2529292951 Bacteria 6916614
481 2537876560 2537561587 Bacteria 5425293
482 2551682239 2551306084 Bacteria 8942552
483 2551683770 2551306085 Bacteria 7347181
484 2551695804 2551306086 Bacteria 6843938
485 2551704803 2551306087 Bacteria 7351905
486 2551709647 2551306089 Bacteria 7162724
487 2551719589 2551306090 Bacteria 7953713
488 2551728675 2551306091 Bacteria 7086830
489 2551732135 2551306092 Bacteria 6992595
490 2551744647 2551306093 Bacteria 7064773
491 2554247824 2554235003 Bacteria 5877155
492 2558863172 2558860100 Bacteria 8458965
493 2559294954 2558860242 Bacteria 5568029
494 2561466317 2558860983 Bacteria 4133860
495 2585168231 2582581283 Bacteria 6030556
496 2585200043 2582581294 Bacteria 6626667
497 2585224223 2582581298 Bacteria 7315509
498 2585268866 2582581306 Bacteria 6450535
499 2585270733 2582581307 Bacteria 6597605
500 2585277081 2582581308 Bacteria 7413247
501 2585323911 2582581315 Bacteria 7318924
502 2585333739 2582581316 Bacteria 7774528
503 2585391413 2582581865 Bacteria 6644329
504 2585529824 2585427526 Bacteria 7258840
505 2585534181 2585427527 Bacteria 7273426
506 2585542326 2585427528 Bacteria 6842387
507 2585546344 2585427529 Bacteria 7395659
508 2585551966 2585427530 Bacteria 7383882
509 2585558456 2585427531 Bacteria 6992870
510 2585838817 2585427593 Bacteria 7141551
511 2585897826 2585427608 Bacteria 6544331
512 2585904574 2585427609 Bacteria 6667127
513 2585995923 2585427633 Bacteria 6413184
514 2586000491 2585427634 Bacteria 6455027
515 2587980310 2585428125 Bacteria 6662905
516 2599333464 2599185156 Bacteria 5403036
517 2599601349 2599185210 Bacteria 5624189
518 2599720905 2599185236 Bacteria 6875203
519 2600192265 2599185352 Bacteria 7228948
520 2600375764 2600254933 Bacteria 4750527
521 2601744767 2600255308 Bacteria 5611129
522 2616292592 2615840624 Bacteria 6557588
523 2616308457 2615840626 Bacteria 7921970
524 2616556455 2615840698 Bacteria 7319877
525 2617385101 2617270742 Bacteria 6808054
526 2643808346 2643221557 Bacteria 7184309
527 2643811963 2643221558 Bacteria 5460675
528 2643855540 2643221568 Bacteria 5187270
529 2643919448 2643221582 Bacteria 5804683
530 2644066560 2643221610 Bacteria 7480339
531 2644109589 2643221618 Bacteria 7717186
532 2644145273 2643221626 Bacteria 8069654
533 2644207656 2643221637 Bacteria 5345260
534 2644300365 2643221653 Bacteria 4569637
535 2644310978 2643221655 Bacteria 7722067
536 2644332631 2643221659 Bacteria 7890716
537 2644378149 2643221668 Bacteria 7306521
538 2644415227 2643221675 Bacteria 7473456
539 2644450372 2643221680 Bacteria 7473610
540 2644494765 2643221688 Bacteria 5260751
541 2644499154 2643221689 Bacteria 6042950
542 2644522350 2643221693 Bacteria 5513853
543 2644544376 2643221698 Bacteria 7756764
544 2644613944 2643221712 Bacteria 7729434
545 2644654537 2643221718 Bacteria 5345506
546 2644658589 2643221719 Bacteria 4568197
547 2644677843 2643221723 Bacteria 7095460
548 2644687924 2643221726 Bacteria 7455827
549 2657683750 2657244999 Bacteria 5946535
550 2671116437 2667528174 Bacteria 6435400
551 2692316480 2690316117 Bacteria 6800650
552 2719181047 2718217882 Bacteria 6556348
553 2719385660 2718217927 Bacteria 6972593
554 2719665481 2718217997 Bacteria 6740740
555 2719731796 2718218009 Bacteria 6478651
556 2720491901 2718218199 Bacteria 6740745
557 2720613168 2718218232 Bacteria 6720332
558 2720620023 2718218233 Bacteria 6662049
559 2720631448 2718218235 Bacteria 6630699
560 2720775176 2718218269 Bacteria 6906114
561 2721147141 2718218363 Bacteria 6524337
562 2721158675 2718218365 Bacteria 6274507
563 2721164059 2718218366 Bacteria 6425255
564 2721399442 2718218423 Bacteria 6438183
565 2722840229 2721755514 Bacteria 6424414
566 2723026813 2721755556 Bacteria 6745503
567 2723560430 2721755684 Bacteria 6859907
568 2723566995 2721755685 Bacteria 6704835
569 2724038255 2721755809 Bacteria 6438790
570 2724044552 2721755810 Bacteria 6479005
571 2724089783 2721755819 Bacteria 6906405
572 2724104260 2721755822 Bacteria 6726041
573 2724110074 2721755823 Bacteria 6752556
574 2725951244 2724679232 Bacteria 7646494
575 2730107749 2728369352 Bacteria 6745171
576 2730164284 2728369365 Bacteria 6555560
577 2730298307 2728369397 Bacteria 6274511
578 2738945448 2738541317 Bacteria 5340176
579 2739038104 2738541333 Bacteria 7106503
580 2758641674 2758568016 Bacteria 5645291
581 2765466060 2765235802 Bacteria 5618596
582 2776271677 2775506902 Bacteria 6208009
583 2776279811 2775506904 Bacteria 5954060
584 2776913288 2775507049 Bacteria 6284736
585 2778177798 2775507266 Bacteria 7392367
586 2792581242 2791355082 Bacteria 5973319
587 2792642451 2791355094 Bacteria 7011481
588 2793298161 2791355256 Bacteria 6798008
589 2793313650 2791355259 Bacteria 7254731
590 2793322162 2791355260 Bacteria 6598818
591 2793326543 2791355261 Bacteria 6661293
592 2793337214 2791355262 Bacteria 6774204
593 2793341395 2791355263 Bacteria 6872478
594 2793350481 2791355264 Bacteria 6429314
595 2793352490 2791355265 Bacteria 6539969
596 2793361298 2791355266 Bacteria 7116587
597 2793369565 2791355267 Bacteria 7222458
598 2802718919 2802428858 Bacteria 6636079
599 2802726529 2802428859 Bacteria 6667919
600 2802733822 2802428860 Bacteria 6525526
601 2802738428 2802428861 Bacteria 6534206
602 2802744761 2802428862 Bacteria 6633353
603 2802751033 2802428863 Bacteria 6410669
604 2804751813 2802429268 Bacteria 6094027
605 2805931071 2802429605 Bacteria 6875453
606 2805938086 2802429606 Bacteria 6346811
607 2806047916 2802429633 Bacteria 7341974
608 2806056333 2802429634 Bacteria 7083200
609 2806061598 2802429635 Bacteria 7650140
610 2806070127 2802429636 Bacteria 7597525
611 2806072504 2802429637 Bacteria 7067217
612 2808985275 2808606387 Bacteria 5697198
613 2819242016 2818991272 Bacteria 4622173
614 2819559707 2818991439 Bacteria 6907412
615 2819612868 2818991448 Bacteria 6772224
616 2819638029 2818991453 Bacteria 7181617
617 2819688612 2818991461 Bacteria 7026071
618 2821127779 2821123053 Bacteria 7836056
619 2838021042 2838016132 Bacteria 6577831
620 2838027986 2838022645 Bacteria 6494267
621 2838030216 2838029111 Bacteria 6603031
622 2838043297 2838042994 Bacteria 6046894
623 2838052554 2838048938 Bacteria 6044578
624 2838066080 2838061910 Bacteria 6794874
625 2838071582 2838068647 Bacteria 6208656
626 2838079276 2838074704 Bacteria 6785777
627 2838673981 2838668709 Bacteria 6671819
628 2838676114 2838675328 Bacteria 4909118
629 2838682358 2838680041 Bacteria 6545511
630 2838689354 2838686498 Bacteria 7807632
631 2838696929 2838694306 Bacteria 6853137
632 2838706381 2838701080 Bacteria 6669771
633 2838709830 2838707686 Bacteria 6619912
634 2838714996 2838714209 Bacteria 5525906
635 2838721203 2838719591 Bacteria 5523910
636 2838725756 2838724970 Bacteria 4908691
637 2838730687 2838729681 Bacteria 7400765
638 2838738203 2838736955 Bacteria 5760694
639 2838743628 2838742623 Bacteria 7396178
640 2840770001 2840764183 Bacteria 6358399
641 2841841427 2841840854 Bacteria 5761912
642 2841848161 2841846520 Bacteria 5345850
643 2841854696 2841851746 Bacteria 7532261
644 2841859289 2841859092 Bacteria 5436171
645 2841864691 2841864319 Bacteria 6742987
646 2842078004 2842077413 Bacteria 6508645
647 2842119488 2842118031 Bacteria 7033875
648 2842125809 2842124991 Bacteria 5346824
649 2842131009 2842130223 Bacteria 4909145
650 2842141205 2842140634 Bacteria 5759631
651 2842148715 2842146304 Bacteria 5957337
652 2842153821 2842152218 Bacteria 4908957
653 2842157559 2842156927 Bacteria 6894975
654 2842164751 2842163707 Bacteria 6916235
655 2842171240 2842170452 Bacteria 5525737
656 2842177441 2842175837 Bacteria 4908771
657 2842180856 2842180545 Bacteria 6888678
658 2842188105 2842187318 Bacteria 5524014
659 2842196761 2842192696 Bacteria 6147454
660 2842203880 2842198810 Bacteria 6608673
661 2842206183 2842205361 Bacteria 6340321
662 2842212416 2842211629 Bacteria 5523832
663 2842217095 2842217011 Bacteria 7497767
664 2842225965 2842224351 Bacteria 5524473
665 2842231086 2842229732 Bacteria 7475766
666 2842239243 2842237096 Bacteria 6620661
667 2842244807 2842243621 Bacteria 7421798
668 2842256099 2842250916 Bacteria 6579627
669 2842258620 2842257432 Bacteria 7401195
670 2842268145 2842264693 Bacteria 6472963
671 2842273374 2842271015 Bacteria 7807131
672 2842279640 2842278818 Bacteria 6340002
673 2842286282 2842285085 Bacteria 6011953
674 2842291667 2842291075 Bacteria 7076806
675 2842301714 2842298080 Bacteria 6123127
676 2842304151 2842304105 Bacteria 7023636
677 2842313782 2842311132 Bacteria 6616990
678 2842318055 2842317721 Bacteria 6793725
679 2842345969 2842341865 Bacteria 7003929
680 2842357367 2842357229 Bacteria 6485165
681 2842364403 2842363717 Bacteria 6844742
682 2842372924 2842370503 Bacteria 7038661
683 2842378063 2842377471 Bacteria 7140707
684 2842385996 2842384541 Bacteria 7057858
685 2842397530 2842395702 Bacteria 6780583
686 2842408023 2842402390 Bacteria 6681310
687 2842414784 2842409023 Bacteria 6687331
688 2842421333 2842415677 Bacteria 6596907
689 2842424760 2842422224 Bacteria 6239196
690 2842431620 2842428310 Bacteria 6767288
691 2842438420 2842434925 Bacteria 6502746
692 2842445050 2842441272 Bacteria 6769273
693 2842452365 2842447887 Bacteria 6754142
694 2842465992 2842462802 Bacteria 6588055
695 2842473035 2842469257 Bacteria 6752936
696 2842476499 2842475841 Bacteria 6603183
697 2842488394 2842482326 Bacteria 7212537
698 2842492980 2842489311 Bacteria 6620893
699 2842496325 2842495871 Bacteria 6820686
700 2842503744 2842502639 Bacteria 6604161
701 2842510332 2842509118 Bacteria 6850950
702 2842516073 2842515876 Bacteria 5436280
703 2842925128 2842922631 Bacteria 5824079
704 2844170467 2844163670 Bacteria 7266046
705 2844459306 2844454524 Bacteria 7952546
706 2847418454 2847417321 Bacteria 6913799
707 2848993432 2848992105 Bacteria 6810864
708 2850080755 2850079185 Bacteria 6848280
709 2852389771 2852387548 Bacteria 8025568
710 2854899294 2854896431 Bacteria 5869725
711 2854911960 2854911287 Bacteria 5582813
712 2854919251 2854916844 Bacteria 5725939
713 2855831676 2855825444 Bacteria 6785811
714 2855840795 2855839649 Bacteria 7135830
715 2855873383 2855872281 Bacteria 6964271
716 2857534480 2857531043 Bacteria 6754041
717 2858801319 2858800743 Bacteria 6603254
718 2891374376 2891373044 Bacteria 5202277
719 2896386944 2896384573 Bacteria 7700774
720 2899793932 2899792073 Bacteria 4926588
721 2899808993 2899803654 Bacteria 5577784
722 2899846465 2899845264 Bacteria 5672268
723 2904583334 2904578770 Bacteria 5302906
724 2913300362 2913295892 Bacteria 6333755
725 2913310154 2913308742 Bacteria 5350706
726 2915985159 2915980308 Bacteria 6624279
727 2915989044 2915986958 Bacteria 6739310
728 2915997439 2915993759 Bacteria 7016183
729 2916006407 2916000859 Bacteria 6865702
730 2916012179 2916007675 Bacteria 6898660
731 2916021005 2916014648 Bacteria 6946486
732 2916025931 2916021584 Bacteria 6854472
733 2916034721 2916028427 Bacteria 6748433
734 2916041814 2916035215 Bacteria 6755766
735 2916046258 2916041962 Bacteria 6820487
736 2916051114 2916048683 Bacteria 6543552
737 2916061078 2916055098 Bacteria 6758838
738 2916066176 2916061851 Bacteria 6737736
739 2916072803 2916068649 Bacteria 6943657
740 2916078288 2916076590 Bacteria 6596108
741 2919115088 2919114240 Bacteria 5700270
742 2919121046 2919119836 Bacteria 5208557
743 2919167696 2919166419 Bacteria 4952238
744 2919175039 2919171160 Bacteria 6499771
745 2919411811 2919408235 Bacteria 6149349
746 2920765531 2920760137 Bacteria 7427611
747 2920824154 2920822456 Bacteria 6897201
748 2921206713 2921201388 Bacteria 6926299
749 2921209661 2921208531 Bacteria 6745326
750 2921243481 2921237296 Bacteria 6876710
751 2921249502 2921244191 Bacteria 6568419
752 2921253084 2921250672 Bacteria 6677771
753 2921262666 2921257292 Bacteria 6808382
754 2921270311 2921263974 Bacteria 6864552
755 2921288442 2921282425 Bacteria 6826397
756 2921293539 2921289301 Bacteria 7316391
757 2921304509 2921296804 Bacteria 7176999
758 2924147548 2924144063 Bacteria 6883928
759 2924157082 2924150972 Bacteria 7169444
760 2924165101 2924158325 Bacteria 7188855
761 2924171939 2924165586 Bacteria 7260590
762 2924179260 2924172951 Bacteria 6749356
763 2924183863 2924179722 Bacteria 6843264
764 2924192587 2924186466 Bacteria 6876637
765 2924197888 2924193448 Bacteria 6955718
766 2924205890 2924200457 Bacteria 6757188
767 2924211584 2924207177 Bacteria 6917007
768 2924217531 2924214083 Bacteria 7080103
769 2924228278 2924221636 Bacteria 7113495
770 2924234239 2924228884 Bacteria 6633132
771 2926756052 2926754445 Bacteria 5964435
772 2926760366 2926760298 Bacteria 5505990
773 2929140545 2929138655 Bacteria 5810547
774 2933008467 2933006813 Bacteria 4912075
775 2933013282 2933011516 Bacteria 5439334
776 2933571430 2933570622 Bacteria 7023390
777 2933597971 2933594066 Bacteria 5594265
778 2933602381 2933599457 Bacteria 5858799
779 2935897216 2935894831 Bacteria 6620579
780 2935904602 2935901341 Bacteria 7341747
781 2936376740 2936375103 Bacteria 6652732
782 2936385110 2936381700 Bacteria 7006523
783 2936997687 2936996657 Bacteria 6298727
784 2937007302 2937002841 Bacteria 6934057
785 2937012392 2937009748 Bacteria 6746052
786 2937022003 2937016420 Bacteria 6782579
787 2937028236 2937023124 Bacteria 6815156
788 2937031134 2937029754 Bacteria 6424026
789 2937040476 2937036028 Bacteria 6846469
790 2937049401 2937042894 Bacteria 6741576
791 2937056186 2937049772 Bacteria 6757901
792 2937058521 2937056579 Bacteria 7107896
793 2937064499 2937063883 Bacteria 7199456
794 2937077496 2937071275 Bacteria 6984483
795 2937079929 2937078374 Bacteria 6610289
796 2937091039 2937084907 Bacteria 6618516
797 2937097939 2937091812 Bacteria 6979387
798 2937105118 2937098957 Bacteria 7249374
799 2937107710 2937106411 Bacteria 6947143
800 2937117234 2937113482 Bacteria 6505872
801 2937124856 2937119839 Bacteria 6597547
802 2937130427 2937126314 Bacteria 6771275
803 2941499894 2941499720 Bacteria 7599444
804 2957379741 2957375807 Bacteria 6425588
805 2957387629 2957382221 Bacteria 6737050
806 2957393448 2957388812 Bacteria 6778072
807 2957400954 2957395598 Bacteria 6822399
808 2957408780 2957402308 Bacteria 6741770
809 2957412609 2957408893 Bacteria 6558585
810 2957416337 2957415311 Bacteria 6991633
811 2957428828 2957422303 Bacteria 7172205
812 2957436267 2957430029 Bacteria 7022557
813 2957438152 2957437181 Bacteria 6568994
814 2957449290 2957443900 Bacteria 6869977
815 2957456651 2957450854 Bacteria 6765715
816 2957463793 2957457609 Bacteria 6967680
817 2957469182 2957464669 Bacteria 6568877
818 2957477010 2957471148 Bacteria 6797643
819 2957484014 2957478035 Bacteria 6756658
820 2957490604 2957484790 Bacteria 6703082
821 2957495002 2957491536 Bacteria 6695180
822 2957504291 2957498199 Bacteria 7126688
823 2957512078 2957505466 Bacteria 7253085
824 2960590564 2960584000 Bacteria 6864594
825 2960596094 2960591022 Bacteria 6622873
826 2960601864 2960597568 Bacteria 6550735
827 2960610071 2960603979 Bacteria 6898737
828 2960615019 2960610863 Bacteria 6691244
829 2960621925 2960617483 Bacteria 6727748
830 2960628830 2960624210 Bacteria 6875384
831 2960634676 2960631154 Bacteria 6732508
832 2960644355 2960637947 Bacteria 7296468
833 2960647195 2960645483 Bacteria 7211087
834 2960658956 2960652885 Bacteria 7083688
835 2960665182 2960660292 Bacteria 7041660
836 2960672652 2960667422 Bacteria 6763020
837 2960679372 2960674078 Bacteria 6609048
838 2960685124 2960680706 Bacteria 6624464
839 2960693225 2960687367 Bacteria 6535474
840 2960698528 2960693952 Bacteria 6749742
841 2964609810 2964607997 Bacteria 7101408
842 2964619495 2964615318 Bacteria 6809089
843 2964622800 2964621998 Bacteria 6834995
844 2964634440 2964628898 Bacteria 7083044
845 2964637145 2964636051 Bacteria 7091832
846 2964648608 2964643177 Bacteria 6820887
847 2964654388 2964649959 Bacteria 6675118
848 2964660253 2964656573 Bacteria 7100150
849 2964666225 2964663802 Bacteria 7019362
850 2964673670 2964670856 Bacteria 6851364
851 2964684174 2964678106 Bacteria 6792020
852 2964691077 2964685014 Bacteria 6839111
853 2964696376 2964691889 Bacteria 6802758
854 2964699531 2964698721 Bacteria 6765331
855 2964711712 2964705432 Bacteria 7114648
856 2964717891 2964712639 Bacteria 6695970
857 2964725920 2964719344 Bacteria 7286602
858 2967668595 2967664464 Bacteria 6948836
859 2967677822 2967671571 Bacteria 7021409
860 2967683698 2967678726 Bacteria 7264382
861 2967688800 2967686174 Bacteria 6678622
862 2967698608 2967693043 Bacteria 6804451
863 2967705500 2967699805 Bacteria 6854538
864 2967713478 2967706974 Bacteria 7186053
865 2967719061 2967714385 Bacteria 7000047
866 2967726322 2967721400 Bacteria 7073753
867 2967733041 2967728569 Bacteria 6641507
868 2967740318 2967735183 Bacteria 6827012
869 2967743200 2967742019 Bacteria 6794534
870 2967753420 2967748971 Bacteria 6733771
871 2967761105 2967755722 Bacteria 6814706
872 2967767412 2967762386 Bacteria 6923502
873 2967772938 2967769361 Bacteria 6587838
874 2967776504 2967775926 Bacteria 6738189
875 2970024911 2970019648 Bacteria 7072033
876 2970031562 2970026789 Bacteria 6785236
877 2970040377 2970033650 Bacteria 7118744
878 2970045356 2970040964 Bacteria 6731123
879 2970054151 2970047711 Bacteria 7088379
880 2970059459 2970054988 Bacteria 6611507
881 2970065584 2970061556 Bacteria 7099761
882 2970075021 2970068827 Bacteria 7123112
883 2970081447 2970076120 Bacteria 6697332
884 2970087928 2970082768 Bacteria 6183754
885 2970094592 2970088815 Bacteria 6933825
886 2970096554 2970095765 Bacteria 6936963
887 2970107235 2970102677 Bacteria 6812532
888 2970112222 2970109326 Bacteria 6863976
889 2970120399 2970116247 Bacteria 6501857
890 2970128574 2970122695 Bacteria 6625855
891 2970133365 2970129317 Bacteria 6806560
892 2970136707 2970136068 Bacteria 7207982
893 2970147773 2970143518 Bacteria 6446480
894 2970155385 2970149975 Bacteria 6779706
895 2970163194 2970156795 Bacteria 7168044
896 2970168163 2970164137 Bacteria 6861252
897 2970174787 2970170962 Bacteria 6876229
898 2970181770 2970177841 Bacteria 6768001
899 2970187985 2970184632 Bacteria 7054431
900 2970197815 2970191845 Bacteria 7032787
901 2977520682 2977516862 Bacteria 6940108
902 2977529517 2977523885 Bacteria 6960446
903 2977533792 2977530762 Bacteria 6951399
904 2977542174 2977537788 Bacteria 6929320
905 2977547276 2977544691 Bacteria 6875412
906 2977557448 2977551784 Bacteria 7125765
907 2977565003 2977558990 Bacteria 6863948
908 2977570393 2977565890 Bacteria 6901543
909 2977575490 2977572785 Bacteria 6763888
910 2977584143 2977579622 Bacteria 6772100
911 2978974154 2978969890 Bacteria 5400756
912 2979094356 2979089926 Bacteria 5670289
913 2979098261 2979095461 Bacteria 5669583
914 2979103597 2979100975 Bacteria 5423623
915 2984511840 2984509177 Bacteria 5274802
916 2984521800 2984518228 Bacteria 5277463
917 2984541098 2984537506 Bacteria 5277481
918 2984589481 2984587000 Bacteria 5263363
919 2984603378 2984601300 Bacteria 5455244
920 2989353169 2989349275 Bacteria 6349068
921 2989773663 2989771324 Bacteria 5605128
922 2989778708 2989776772 Bacteria 4843317
923 2996898277 2996893221 Bacteria 5823108
924 3003933354 3003930520 Bacteria 5667563
925 3005420224 3005416602 Bacteria 7064308
926 3005447385 3005445848 Bacteria 6906074
927 639648408 639633055 Bacteria 7751309
928 643825461 643692032 Bacteria 6891900
929 648740093 648276728 Bacteria 6968865
930 650740212 650716007 Bacteria 5573770
931 8003571274 8003570095 Bacteria 5747666
932 8003993294 8003992118 Bacteria 7266902
933 8004000547 8003999396 Bacteria 7063185
934 8005250718 8005246636 Bacteria 4933972
935 8005280435 8005275841 Bacteria 6929066
936 8005285656 8005282627 Bacteria 6675747
937 8005290735 8005289223 Bacteria 6634003
938 8005302287 8005301065 Bacteria 6614431
939 8005314390 8005307578 Bacteria 7395396
940 8005317175 8005314921 Bacteria 7072929
941 8005388199 8005382845 Bacteria 6732062
942 8005397275 8005395548 Bacteria 6806915
943 8005433630 8005430974 Bacteria 6689030
944 8005462801 8005460587 Bacteria 7157962
945 8005485025 8005484373 Bacteria 6297373
946 8005500202 8005497431 Bacteria 6477605
947 8005557855 8005556819 Bacteria 6908598
948 8005569028 8005563573 Bacteria 7153261
949 8005572166 8005570704 Bacteria 6957481
950 8005621494 8005619151 Bacteria 7030230
951 8005631161 8005626139 Bacteria 6534237
952 8005648762 8005645114 Bacteria 6950293
953 8005659269 8005658619 Bacteria 4500593
954 8005671618 8005668836 Bacteria 6953162
955 8005683314 8005682033 Bacteria 6726518
956 8005689860 8005688590 Bacteria 6610080
957 8005700162 8005695170 Bacteria 6912330
958 8018129778 8018127388 Bacteria 7351159
959 8018155506 8018150411 Bacteria 5549903
960 8018166940 8018163183 Bacteria 7277977
961 8023685533 8023680758 Bacteria 7729763
962 8024482158 8024479707 Bacteria 6954785
963 8024488735 8024486573 Bacteria 6540512
964 8024506743 8024501048 Bacteria 6427847
965 8046769427 8046767195 Bacteria 7547379
966 8049294347 8049293176 Bacteria 6128433
967 8054462792 8054460903 Bacteria 4872905
968 8054559696 8054558443 Bacteria 5204801
969 8055435063 8055431914 Bacteria 4551896
970 8056377291 8056375014 Bacteria 7006639
971 8056388228 8056382006 Bacteria 6408074
972 8056877700 8056875544 Bacteria 4355797
973 8057578888 8057575449 Bacteria 7367519
974 RicEn_C9452
975 JGI24740J21852_10000240
976 JGI25155J39150_1000058
977 JGI25156J39149_1000080
978 JGI25162J39368_1000798
979 JGI25162J39368_1000942
980 JGI25162J39368_1002903
981 JGI25162J39368_1003447
982 JGI25154J39366_1000224
983 JGI25157J39369_1000101
984 JGI25152J39213_1006003
985 JGI25152J39213_1027029
986 JGI25152J39213_1027068
987 JGI25150J39212_1011557
988 JGI25159J45721_1000006
989 JGI25151J46595_10010040
990 JGI25151J46595_10037454
991 JGI25151J46595_10045366
992 JGI25165J46597_1000747
993 JGI25165J46597_1001007
994 JGI25165J46597_1008197
995 JGI25153J46596_10004125
996 JGI25153J46596_10068665
997 JGI25153J46596_10068750
998 rootH1_10058669
999 rootH2_10006547
1000 rootL2_10001427
1001 rootL2_10141239
1002 rootH1_10087504
1003 rootH1_10140377
1004 JGI25160J50197_1000019
1005 JGI25160J50197_1002563
1006 JGI25161J50226_1000157
1007 JGI25161J50226_1000346
1008 Ga0055539_1006528
1009 Ga0055526_1006233
1010 Ga0055526_1008270
1011 Ga0055526_1020769
1012 Ga0055524_1001008
1013 Ga0055524_1001365
1014 Ga0055524_1024519
1015 Ga0055524_1032341
1016 Ga0055536_1000645
1017 Ga0055528_1000851
1018 Ga0055530_10004713
1019 Ga0055530_10065194
1020 Ga0055540_1001322
1021 Ga0055540_1001521
1022 Ga0055540_1012369
1023 Ga0055531_10001888
1024 Ga0055531_10002873
1025 Ga0055531_10067209
1026 Ga0055543_1000032
1027 Ga0055543_1000145
1028 Ga0058859_11670122
1029 Ga0065165_1000180
1030 Ga0065165_1003840
1031 Ga0070670_100000603
1032 Ga0070682_100207910
1033 Ga0070669_100597990
1034 Ga0070671_100130749
1035 Ga0070665_100284105
1036 Ga0068854_100043013
1037 Ga0068856_100033811
1038 Ga0068856_100946695
1039 Ga0068852_100041122
1040 Ga0081455_10210237
1041 Ga0075365_10027350
1042 Ga0075365_10505039
1043 Ga0075364_10000170
1044 Ga0075364_10054934
1045 Ga0075364_11005233
1046 Ga0075369_10018019
1047 Ga0075366_10224069
1048 Ga0075370_10011896
1049 Ga0075370_10319958
1050 Ga0075370_10815880
1051 Ga0075434_100106989
1052 Ga0079104_1011892
1053 Ga0105240_10000005
1054 Ga0105237_10001344
1055 Ga0105239_10003591
1056 Ga0105239_10329586
1057 Ga0157319_1002443
1058 Ga0157371_10012507
1059 Ga0157370_10000948
1060 Ga0157369_10096384
1061 Ga0157369_10158503
1062 Ga0171463_1011
1063 Ga0157378_11306727
1064 Ga0163162_10316912
1065 Ga0182008_10078580
1066 Ga0182007_10002187
1067 Ga0182005_1003334
1068 Ga0183363_1430
1069 Ga0163161_11422499
1070 Ga0214544_1000265
1071 Ga0214542_1000015
1072 Ga0214542_1020378
1073 Ga0214543_1000011
1074 Ga0214543_1000032
1075 Ga0209435_100045
1076 Ga0209760_107039
1077 Ga0209436_100001
1078 Ga0209436_100333
1079 Ga0209672_102875
1080 Ga0209672_117561
1081 Ga0209563_103879
1082 Ga0207427_106592
1083 Ga0209437_100047
1084 Ga0209437_100122
1085 Ga0207425_1002752
1086 Ga0207425_1045841
1087 Ga0207425_1059235
1088 Ga0209646_1000154
1089 Ga0209646_1003813
1090 Ga0209026_1000177
1091 Ga0209677_100440
1092 Ga0209759_1000274
1093 Ga0209759_1041180
1094 Ga0209129_1002592
1095 Ga0209129_1003488
1096 Ga0209129_1003511
1097 Ga0209129_1005991
1098 Ga0209233_1000048
1099 Ga0209233_1000170
1100 Ga0209233_1001493
1101 Ga0209565_1070826
1102 Ga0209673_1000013
1103 Ga0209673_1001787
1104 Ga0209673_1022246
1105 Ga0209130_1000004
1106 Ga0209130_1000007
1107 Ga0209130_1034287
1108 Ga0209676_1000399
1109 Ga0209676_1013109
1110 Ga0209025_1000787
1111 Ga0209025_1000870
1112 Ga0209025_1007264
1113 Ga0209025_1027407
1114 Ga0209025_1029520
1115 Ga0209564_1000140
1116 Ga0209564_1000566
1117 Ga0209564_1000906
1118 Ga0209758_1000977
1119 Ga0209758_1001265
1120 Ga0209758_1001420
1121 Ga0209758_1002711
1122 Ga0209758_1008178
1123 Ga0209758_1055124
1124 Ga0209050_1000906
1125 Ga0209050_1001733
1126 Ga0209256_1000606
1127 Ga0209256_1000947
1128 Ga0209256_1001532
1129 Ga0209256_1002736
1130 Ga0209256_1010200
1131 Ga0207426_1000003
1132 Ga0207426_1000111
1133 Ga0209051_1001061
1134 Ga0209051_1002566
1135 Ga0209051_1003671
1136 Ga0209051_1045274
1137 Ga0209257_1001014
1138 Ga0209257_1001423
1139 Ga0209257_1057234
1140 Ga0207695_10000011
1141 Ga0207671_10000314
1142 Ga0207649_10300260
1143 Ga0207681_10513840
1144 Ga0207650_10001911
1145 Ga0207644_10420203
1146 Ga0207712_10139481
1147 Ga0207640_10036793
1148 Ga0207702_10016488
1149 Ga0207702_10355219
1150 Ga0207698_10795544
1151 Ga0209281_1000334
1152 Ga0209281_1000361
1153 Ga0209371_1011930
1154 Ga0209282_1000073
1155 Ga0209282_1000095
1156 Ga0268266_10202752
1157 Ga0307515_10001215
1158 Ga0307515_10001393
1159 Ga0307515_10038442
1160 Ga0307515_10258924
1161 Ga0268256_1012987
1162 Ga0307513_10046052
1163 Ga0307405_11246188
1164 Ga0307412_10563049
1165 Ga0307416_102118423
1166 Ga0307414_12071045
1167 Ga0315913_1000129
1168 Ga0373932_0422585
1169 Ga0316574_0981343
1170 Ga0316582_0250613
1171 Ga0395905_0000827
1172 Ga0395905_0006518
1173 Ga0395905_0609660
1174 Ga0395905_1124358
1175 Ga0395901_0447926
1176 Ga0439436_0112232
1177 Ga0439438_070849
1178 Ga0439461_0049033
1179 Ga0439466_0114642
1180 Ga0439465_0044118
1181 Ga0439465_0094279
1182 Ga0451793_1771588
1183 Ga0451833_1006218
1184 Ga0451835_0689076
1185 Ga0451840_12231
1186 Ga0451841_0183806
1187 Ga0451846_02444
1188 Ga0451847_0483869
1189 Ga0451847_0486657
1190 Ga0451848_08423
1191 Ga0451849_0137763
1192 Ga0451850_51725
1193 Ga0451851_0203844
1194 Ga0451854_17026
1195 Ga0451855_0606958
1196 Ga0451853_3234756
1197 Ga0439449_0005864
1198 Ga0439457_017484
1199 Ga0466965_0188862
1200 Ga0466971_0319425
1201 Ga0466968_0013912
1202 Ga0466970_0001159
1203 Ga0466957_0323890
1204 Ga0466959_0155850
1205 Ga0466958_0306419
1206 Ga0466967_0389383
1207 Ga0495638_0000597
1208 Ga0495638_0065247
1209 Ga0495650_0082159
1210 Ga0495585_0114385
1211 Ga0495596_0340851
1212 Ga0495607_0014939
1213 Ga0495583_0047246
1214 Ga0495606_0005935
1215 Ga0495606_0031156
1216 Ga0495606_0065151
1217 Ga0495606_0377080
1218 Ga0495610_0031394
1219 Ga0495610_0048705
1220 Ga0495616_0023559
1221 Ga0495616_0058559
1222 Ga0495620_0012510
1223 Ga0495631_0035705
1224 Ga0495632_0040920
1225 Ga0495632_0211342
1226 Ga0495643_0036606
1227 Ga0495643_0083423
1228 Ga0495643_0142369
1229 Ga0495643_0316035
1230 Ga0495654_0000641
1231 Ga0495654_0130829
1232 Ga0495597_0010628
1233 Ga0495597_0046866
1234 Ga0495668_0184666
1235 Ga0495625_0038160
1236 Ga0495625_0132496
1237 Ga0495625_0284198
1238 Ga0495625_0285028
1239 Ga0495625_0368167
1240 Ga0495670_0118813
1241 Ga0495671_0060942
1242 Ga0495649_0060150
1243 Ga0495636_0141114
1244 Ga0495636_0330062
1245 Ga0495672_0020846
1246 Ga0495687_203038
1247 Ga0495679_072035
1248 Ga0495681_0079294
1249 Ga0495686_0003870
1250 Ga0495686_0015546
1251 Ga0495686_0018766
1252 Ga0495686_0056345
1253 Ga0495686_0099843
1254 Ga0495686_0115104
1255 Ga0495615_0014893
1256 Ga0495615_0113248
1257 Ga0496100_0607993
1258 Ga0496102_0053430
1259 Ga0496103_0011652
1260 Ga0496106_0000801
1261 Ga0496106_0381654
1262 Ga0496106_0756981
1263 Ga0496110_0061950
1264 Ga0496111_0018396
1265 Ga0496113_0136267
1266 Ga0496116_0050273
1267 Ga0496116_0110497
1268 Ga0496116_0260180
1269 Ga0496117_0000641
1270 Ga0496117_0002492
1271 Ga0496117_0032556
1272 Ga0496117_0044740
1273 Ga0496117_0119160
1274 Ga0496118_0002255
1275 Ga0496118_0002788
1276 Ga0496118_0021378
1277 Ga0496118_0056313
1278 Ga0496118_0165800
1279 Ga0496118_0283407
1280 Ga0496119_0032601
1281 Ga0496119_0033903
1282 Ga0496119_0058911
1283 Ga0496120_0011601
1284 Ga0496120_0030634
1285 Ga0496120_0045117
1286 Ga0496121_0000003
1287 Ga0496121_0000751
1288 Ga0496121_0003358
1289 Ga0496121_0015611
1290 Ga0496121_0031398
1291 Ga0496121_0091314
1292 Ga0496121_0189522
1293 Ga0496122_0000025
1294 Ga0496122_0000399
1295 Ga0496122_0003165
1296 Ga0496122_0007138
1297 Ga0496122_0008228
1298 Ga0496122_0016386
1299 Ga0496122_0074908
1300 Ga0496122_0122567
1301 Ga0496123_0000054
1302 Ga0496123_0002112
1303 Ga0496123_0010688
1304 Ga0496123_0018189
1305 Ga0496123_0049479
1306 Ga0496123_0065931
1307 Ga0496123_0129005
1308 Ga0496123_0359006
1309 Ga0496124_0002648
1310 Ga0496124_0008646
1311 Ga0496124_0012897
1312 Ga0496124_0036616
1313 Ga0496124_0084961
1314 Ga0496124_0088991
1315 Ga0496124_0214638
1316 Ga0496124_0428850
1317 Ga0496124_0608190
1318 Ga0496124_0637151
1319 Ga0496124_0759022
1320 Ga0496125_0000141
1321 Ga0496125_0001650
1322 Ga0496125_0021828
1323 Ga0496125_0051706
1324 Ga0496125_0338138
1325 Ga0496125_0342169
1326 Ga0496125_0438316
1327 Ga0496126_0001055
1328 Ga0496126_0020807
1329 Ga0496126_0068999
1330 Ga0495678_029785
1331 Ga0501031_0043880
1332 Ga0501032_0040703
1333 Ga0501032_0085344
1334 Ga0501032_0252683
1335 Ga0501033_0000118
1336 Ga0501033_0028448
1337 Ga0501033_0376166
1338 Ga0501034_0102139
1339 Ga0501034_0167499
1340 Ga0501036_0062044
1341 Ga0501037_0215004
1342 Ga0501038_0025657
1343 Ga0501038_0375140
1344 Ga0501039_0495514
1345 Ga0501043_0745639
1346 Ga0501043_0789076
1347 Ga0501047_0102950
1348 Ga0501048_0508220
1349 Ga0501067_0197042
1350 Ga0501068_0260229
1351 Ga0501073_0036549
1352 Ga0501080_0132818
1353 Ga0501083_0052901
1354 Ga0501083_0330634
1355 Ga0501280_002116
1356 Ga0501280_038125
1357 Ga0501035_0002363
1358 Ga0501035_0525970
1359 Ga0501035_0552929
1360 Ga0501035_0848203
1361 Ga0501035_1302068
1362 Ga0501044_0106883
1363 Ga0501044_0142973
1364 Ga0501045_0113532
1365 nmdc:mga00v17_291_c1
1366 nmdc:mga00v17_42712_c1
1367 nmdc:mga0yw44_516265_c1
1368 nmdc:mga0k408_215936_c1
1369 nmdc:mga0k408_451596_c1
1370 nmdc:mga06z11_293392_c1
1371 nmdc:mga0n895_430661_c1
1372 nmdc:mga0rr50_583495_c1
1373 nmdc:mga0a205_596688_c1
1374 nmdc:mga0sz30_3070_c1
1375 Ga0500578_0044842
1376 Ga0500644_0005315
1377 Ga0500646_0233981
1378 Ga0500654_103001
1379 Ga0500556_0237166
1380 Ga0500572_116256
1381 Ga0500618_000125
1382 Ga0500618_000289
1383 Ga0500618_009145
1384 Ga0500618_015691
1385 Ga0500628_046983
1386 Ga0500655_007893
1387 Ga0500658_0000162
1388 Ga0500658_0213842
1389 Ga0500559_0007060
1390 Ga0500568_0000411
1391 Ga0500568_0001577
1392 Ga0500568_0057248
1393 Ga0500573_0008408
1394 Ga0500573_0013003
1395 Ga0500577_0108487
1396 Ga0500604_0003667
1397 Ga0500604_0129644
1398 Ga0500616_0000661
1399 Ga0500616_0001852
1400 Ga0500616_0012405
1401 Ga0500622_0000428
1402 Ga0500622_0000956
1403 Ga0500622_0068032
1404 Ga0500627_0292184
1405 Ga0500645_066116
1406 Ga0587073_0003572
1407 Ga0587088_000751
1408 Ga0587088_019463
1409 Ga0587075_000934
1410 Ga0587078_061485
1411 Ga0587079_037095
1412 Ga0501082_0044180
1413 2601607992
1414 2509107915
1415 2509375703
1416 2509386809
1417 2509442356
1418 2510307010
1419 2510842691
1420 2510894545
1421 2511134994
1422 2511171591
1423 2511501327
1424 2512532748
1425 2512971924
1426 2513572225
1427 2513579594
1428 2513587081
1429 2513606325
1430 2513617841
1431 2513634366
1432 2513708858
1433 2513880726
1434 2513906727
1435 2513986532
1436 2514005474
1437 2514022802
1438 2514418537
1439 2515112141
1440 2515611533
1441 2515635608
1442 2515646192
1443 2515657284
1444 2515738711
1445 2516209201
1446 2516892606
1447 2517076263
1448 2517406653
1449 2517569416
1450 2520379371
1451 2524452834
1452 2524460534
1453 2530645398
1454 2537876560
1455 2551682239
1456 2551683770
1457 2551695804
1458 2551704803
1459 2551709647
1460 2551719589
1461 2551728675
1462 2551732135
1463 2551744647
1464 2554247824
1465 2558863172
1466 2559294954
1467 2561466317
1468 2585168231
1469 2585200043
1470 2585224223
1471 2585268866
1472 2585270733
1473 2585277081
1474 2585323911
1475 2585333739
1476 2585391413
1477 2585529824
1478 2585534181
1479 2585542326
1480 2585546344
1481 2585551966
1482 2585558456
1483 2585838817
1484 2585897826
1485 2585904574
1486 2585995923
1487 2586000491
1488 2587980310
1489 2599333464
1490 2599601349
1491 2599720905
1492 2600192265
1493 2600375764
1494 2601744767
1495 2616292592
1496 2616308457
1497 2616556455
1498 2617385101
1499 2643808346
1500 2643811963
1501 2643855540
1502 2643919448
1503 2644066560
1504 2644109589
1505 2644145273
1506 2644207656
1507 2644300365
1508 2644310978
1509 2644332631
1510 2644378149
1511 2644415227
1512 2644450372
1513 2644494765
1514 2644499154
1515 2644522350
1516 2644544376
1517 2644613944
1518 2644654537
1519 2644658589
1520 2644677843
1521 2644687924
1522 2657683750
1523 2671116437
1524 2692316480
1525 2719181047
1526 2719385660
1527 2719665481
1528 2719731796
1529 2720491901
1530 2720613168
1531 2720620023
1532 2720631448
1533 2720775176
1534 2721147141
1535 2721158675
1536 2721164059
1537 2721399442
1538 2722840229
1539 2723026813
1540 2723560430
1541 2723566995
1542 2724038255
1543 2724044552
1544 2724089783
1545 2724104260
1546 2724110074
1547 2725951244
1548 2730107749
1549 2730164284
1550 2730298307
1551 2738945448
1552 2739038104
1553 2758641674
1554 2765466060
1555 2776271677
1556 2776279811
1557 2776913288
1558 2778177798
1559 2792581242
1560 2792642451
1561 2793298161
1562 2793313650
1563 2793322162
1564 2793326543
1565 2793337214
1566 2793341395
1567 2793350481
1568 2793352490
1569 2793361298
1570 2793369565
1571 2802718919
1572 2802726529
1573 2802733822
1574 2802738428
1575 2802744761
1576 2802751033
1577 2804751813
1578 2805931071
1579 2805938086
1580 2806047916
1581 2806056333
1582 2806061598
1583 2806070127
1584 2806072504
1585 2808985275
1586 2819242016
1587 2819559707
1588 2819612868
1589 2819638029
1590 2819688612
1591 2821127779
1592 2838021042
1593 2838027986
1594 2838030216
1595 2838043297
1596 2838052554
1597 2838066080
1598 2838071582
1599 2838079276
1600 2838673981
1601 2838676114
1602 2838682358
1603 2838689354
1604 2838696929
1605 2838706381
1606 2838709830
1607 2838714996
1608 2838721203
1609 2838725756
1610 2838730687
1611 2838738203
1612 2838743628
1613 2840770001
1614 2841841427
1615 2841848161
1616 2841854696
1617 2841859289
1618 2841864691
1619 2842078004
1620 2842119488
1621 2842125809
1622 2842131009
1623 2842141205
1624 2842148715
1625 2842153821
1626 2842157559
1627 2842164751
1628 2842171240
1629 2842177441
1630 2842180856
1631 2842188105
1632 2842196761
1633 2842203880
1634 2842206183
1635 2842212416
1636 2842217095
1637 2842225965
1638 2842231086
1639 2842239243
1640 2842244807
1641 2842256099
1642 2842258620
1643 2842268145
1644 2842273374
1645 2842279640
1646 2842286282
1647 2842291667
1648 2842301714
1649 2842304151
1650 2842313782
1651 2842318055
1652 2842345969
1653 2842357367
1654 2842364403
1655 2842372924
1656 2842378063
1657 2842385996
1658 2842397530
1659 2842408023
1660 2842414784
1661 2842421333
1662 2842424760
1663 2842431620
1664 2842438420
1665 2842445050
1666 2842452365
1667 2842465992
1668 2842473035
1669 2842476499
1670 2842488394
1671 2842492980
1672 2842496325
1673 2842503744
1674 2842510332
1675 2842516073
1676 2842925128
1677 2844170467
1678 2844459306
1679 2847418454
1680 2848993432
1681 2850080755
1682 2852389771
1683 2854899294
1684 2854911960
1685 2854919251
1686 2855831676
1687 2855840795
1688 2855873383
1689 2857534480
1690 2858801319
1691 2891374376
1692 2896386944
1693 2899793932
1694 2899808993
1695 2899846465
1696 2904583334
1697 2913300362
1698 2913310154
1699 2915985159
1700 2915989044
1701 2915997439
1702 2916006407
1703 2916012179
1704 2916021005
1705 2916025931
1706 2916034721
1707 2916041814
1708 2916046258
1709 2916051114
1710 2916061078
1711 2916066176
1712 2916072803
1713 2916078288
1714 2919115088
1715 2919121046
1716 2919167696
1717 2919175039
1718 2919411811
1719 2920765531
1720 2920824154
1721 2921206713
1722 2921209661
1723 2921243481
1724 2921249502
1725 2921253084
1726 2921262666
1727 2921270311
1728 2921288442
1729 2921293539
1730 2921304509
1731 2924147548
1732 2924157082
1733 2924165101
1734 2924171939
1735 2924179260
1736 2924183863
1737 2924192587
1738 2924197888
1739 2924205890
1740 2924211584
1741 2924217531
1742 2924228278
1743 2924234239
1744 2926756052
1745 2926760366
1746 2929140545
1747 2933008467
1748 2933013282
1749 2933571430
1750 2933597971
1751 2933602381
1752 2935897216
1753 2935904602
1754 2936376740
1755 2936385110
1756 2936997687
1757 2937007302
1758 2937012392
1759 2937022003
1760 2937028236
1761 2937031134
1762 2937040476
1763 2937049401
1764 2937056186
1765 2937058521
1766 2937064499
1767 2937077496
1768 2937079929
1769 2937091039
1770 2937097939
1771 2937105118
1772 2937107710
1773 2937117234
1774 2937124856
1775 2937130427
1776 2941499894
1777 2957379741
1778 2957387629
1779 2957393448
1780 2957400954
1781 2957408780
1782 2957412609
1783 2957416337
1784 2957428828
1785 2957436267
1786 2957438152
1787 2957449290
1788 2957456651
1789 2957463793
1790 2957469182
1791 2957477010
1792 2957484014
1793 2957490604
1794 2957495002
1795 2957504291
1796 2957512078
1797 2960590564
1798 2960596094
1799 2960601864
1800 2960610071
1801 2960615019
1802 2960621925
1803 2960628830
1804 2960634676
1805 2960644355
1806 2960647195
1807 2960658956
1808 2960665182
1809 2960672652
1810 2960679372
1811 2960685124
1812 2960693225
1813 2960698528
1814 2964609810
1815 2964619495
1816 2964622800
1817 2964634440
1818 2964637145
1819 2964648608
1820 2964654388
1821 2964660253
1822 2964666225
1823 2964673670
1824 2964684174
1825 2964691077
1826 2964696376
1827 2964699531
1828 2964711712
1829 2964717891
1830 2964725920
1831 2967668595
1832 2967677822
1833 2967683698
1834 2967688800
1835 2967698608
1836 2967705500
1837 2967713478
1838 2967719061
1839 2967726322
1840 2967733041
1841 2967740318
1842 2967743200
1843 2967753420
1844 2967761105
1845 2967767412
1846 2967772938
1847 2967776504
1848 2970024911
1849 2970031562
1850 2970040377
1851 2970045356
1852 2970054151
1853 2970059459
1854 2970065584
1855 2970075021
1856 2970081447
1857 2970087928
1858 2970094592
1859 2970096554
1860 2970107235
1861 2970112222
1862 2970120399
1863 2970128574
1864 2970133365
1865 2970136707
1866 2970147773
1867 2970155385
1868 2970163194
1869 2970168163
1870 2970174787
1871 2970181770
1872 2970187985
1873 2970197815
1874 2977520682
1875 2977529517
1876 2977533792
1877 2977542174
1878 2977547276
1879 2977557448
1880 2977565003
1881 2977570393
1882 2977575490
1883 2977584143
1884 2978974154
1885 2979094356
1886 2979098261
1887 2979103597
1888 2984511840
1889 2984521800
1890 2984541098
1891 2984589481
1892 2984603378
1893 2989353169
1894 2989773663
1895 2989778708
1896 2996898277
1897 3003933354
1898 3005420224
1899 3005447385
1900 639648408
1901 643825461
1902 648740093
1903 650740212
1904 8003571274
1905 8003993294
1906 8004000547
1907 8005250718
1908 8005280435
1909 8005285656
1910 8005290735
1911 8005302287
1912 8005314390
1913 8005317175
1914 8005388199
1915 8005397275
1916 8005433630
1917 8005462801
1918 8005485025
1919 8005500202
1920 8005557855
1921 8005569028
1922 8005572166
1923 8005621494
1924 8005631161
1925 8005648762
1926 8005659269
1927 8005671618
1928 8005683314
1929 8005689860
1930 8005700162
1931 8018129778
1932 8018155506
1933 8018166940
1934 8023685533
1935 8024482158
1936 8024488735
1937 8024506743
1938 8046769427
1939 8049294347
1940 8054462792
1941 8054559696
1942 8055435063
1943 8056377291
1944 8056388228
1945 8056877700
1946 8057578888

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

64

139

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9369 28 105
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.8876 30 111
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8732 28 110
7bgn-assembly2.cif.gz_D crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.8644 23 114
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.8639 25 110
ID Description Score Start End Superfamily
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9523 23 105 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9522 30 105 3.10.20.810
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9067 24 105 3.10.20.810
af_O59667_194_289_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8853 23 105 3.10.20.810
af_A0A1D8PKY7_169_272_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8843 23 108 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A1S6IYE0-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] 0.965 23 104 GO:0000105
GO:0004635
GO:0004636
GO:0005524
GO:0005737
AF-A0A2H6G3I7-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9647 23 105 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A7J5BUA8-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9646 23 104 GO:0000105
GO:0004635
AF-A0A425W566-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] 0.9645 23 105 GO:0000105
GO:0004635
GO:0004636
GO:0005524
GO:0005737
AF-A0A7C6XYQ9-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9642 25 105 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270

Map