F487200

General Info

Members Datasets Scaffolds Average Seq Length
974 325 1948 66

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10003300|rootL2_1000330018
Length 62
Sequence VTGLWDNVVFALALVLIAEGLLPFMSPRSWRRFVAQLSELKDGQLRFVGLALLLIGLLLLAL

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
94 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
95 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
96 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
231 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
232 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
233 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
234 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
235 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
236 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
237 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
238 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
239 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
240 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
245 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
246 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
247 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
320 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
323 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
324 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
325 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0
Rhizoplane 4.72
Rhizosphere 88.6
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10003300 3300003322 Bacteria 21471
2 rootH1_10031410 3300003316 Bacteria 3396
3 JGI26145J50221_1001962 3300003371 Bacteria 1616
4 Ga0065165_1003031 3300005262 Bacteria 12647
5 Ga0065712_10056070 3300005290 Bacteria 659
6 Ga0065715_10120848 3300005293 Bacteria 2246
7 Ga0070658_10182587 3300005327 Bacteria 1766
8 Ga0070658_10289100 3300005327 Bacteria 1396
9 Ga0070658_10613061 3300005327 Bacteria 943
10 Ga0070676_10007895 3300005328 Bacteria 5719
11 Ga0070676_10011958 3300005328 Bacteria 4731
12 Ga0070676_10030674 3300005328 Bacteria 3067
13 Ga0070676_10152281 3300005328 Bacteria 1481
14 Ga0070676_10165762 3300005328 Bacteria 1425
15 Ga0070676_10202608 3300005328 Bacteria 1301
16 Ga0070676_10235372 3300005328 Bacteria 1216
17 Ga0070676_10278163 3300005328 Bacteria 1127
18 Ga0070683_100039749 3300005329 Bacteria 4321
19 Ga0070683_100557719 3300005329 Bacteria 1095
20 Ga0070683_101344516 3300005329 Bacteria 687
21 Ga0070690_100116392 3300005330 Bacteria 1789
22 Ga0070690_100367271 3300005330 Bacteria 1049
23 Ga0070690_100558543 3300005330 Bacteria 864
24 Ga0070670_100000334 3300005331 Bacteria 39594
25 Ga0070670_100044516 3300005331 Bacteria 3816
26 Ga0070670_100060634 3300005331 Bacteria 3248
27 Ga0070670_100075077 3300005331 Bacteria 2904
28 Ga0070670_100087706 3300005331 Bacteria 2674
29 Ga0070670_100220336 3300005331 Bacteria 1651
30 Ga0070670_100645234 3300005331 Bacteria 949
31 Ga0070670_100864623 3300005331 Bacteria 818
32 Ga0070670_101289499 3300005331 Bacteria 668
33 Ga0070677_10006421 3300005333 Bacteria 3906
34 Ga0070677_10006836 3300005333 Bacteria 3791
35 Ga0070677_10008378 3300005333 Bacteria 3477
36 Ga0070677_10081611 3300005333 Bacteria 1385
37 Ga0070677_10096075 3300005333 Bacteria 1298
38 Ga0070677_10117753 3300005333 Bacteria 1195
39 Ga0070677_10137535 3300005333 Bacteria 1123
40 Ga0070677_10213302 3300005333 Bacteria 939
41 Ga0070677_10245694 3300005333 Bacteria 886
42 Ga0070677_10450072 3300005333 Bacteria 689
43 Ga0068869_100013349 3300005334 Bacteria 5461
44 Ga0068869_100284837 3300005334 Bacteria 1330
45 Ga0068869_100378101 3300005334 Bacteria 1160
46 Ga0068869_100611001 3300005334 Bacteria 922
47 Ga0068869_100802983 3300005334 Bacteria 809
48 Ga0070666_10003466 3300005335 Bacteria 9561
49 Ga0070666_10596720 3300005335 Bacteria 806
50 Ga0070666_10635016 3300005335 Bacteria 780
51 Ga0070666_10677108 3300005335 Bacteria 755
52 Ga0070666_11039612 3300005335 Bacteria 608
53 Ga0070680_100012537 3300005336 Bacteria 6588
54 Ga0068868_100010821 3300005338 Bacteria 6618
55 Ga0068868_100055602 3300005338 Bacteria 3123
56 Ga0068868_100079519 3300005338 Bacteria 2626
57 Ga0068868_100336794 3300005338 Bacteria 1289
58 Ga0068868_100400257 3300005338 Bacteria 1185
59 Ga0068868_100656203 3300005338 Bacteria 935
60 Ga0068868_100856291 3300005338 Bacteria 824
61 Ga0068868_100893892 3300005338 Bacteria 807
62 Ga0070660_100120719 3300005339 Bacteria 2091
63 Ga0070660_100293410 3300005339 Bacteria 1332
64 Ga0070660_100618286 3300005339 Bacteria 906
65 Ga0070689_100252613 3300005340 Bacteria 1455
66 Ga0070689_100564921 3300005340 Bacteria 982
67 Ga0070687_100105520 3300005343 Bacteria 1586
68 Ga0070687_100367005 3300005343 Bacteria 934
69 Ga0070687_100694693 3300005343 Bacteria 710
70 Ga0070687_101539852 3300005343 Bacteria 501
71 Ga0070661_100022092 3300005344 Bacteria 4551
72 Ga0070661_100123527 3300005344 Bacteria 1940
73 Ga0070661_100150066 3300005344 Bacteria 1762
74 Ga0070661_100323746 3300005344 Bacteria 1204
75 Ga0070661_100595266 3300005344 Unclassified 893
76 Ga0070661_101402844 3300005344 Bacteria 588
77 Ga0070692_10358886 3300005345 Bacteria 908
78 Ga0070692_11380430 3300005345 Bacteria 508
79 Ga0070668_100030279 3300005347 Bacteria 4115
80 Ga0070668_100064311 3300005347 Bacteria 2844
81 Ga0070668_100526822 3300005347 Bacteria 1026
82 Ga0070668_100860308 3300005347 Bacteria 808
83 Ga0070668_101247167 3300005347 Bacteria 675
84 Ga0070669_100046349 3300005353 Bacteria 3170
85 Ga0070669_100118475 3300005353 Bacteria 2017
86 Ga0070669_100148531 3300005353 Bacteria 1813
87 Ga0070669_100398760 3300005353 Bacteria 1125
88 Ga0070669_101096316 3300005353 Bacteria 685
89 Ga0070675_100009823 3300005354 Bacteria 7457
90 Ga0070675_100037083 3300005354 Bacteria 3969
91 Ga0070675_100048867 3300005354 Bacteria 3470
92 Ga0070675_100072089 3300005354 Bacteria 2867
93 Ga0070675_100095821 3300005354 Bacteria 2492
94 Ga0070675_100145848 3300005354 Bacteria 2026
95 Ga0070675_100161112 3300005354 Bacteria 1929
96 Ga0070675_100671595 3300005354 Bacteria 942
97 Ga0070675_101026303 3300005354 Bacteria 757
98 Ga0070675_101329059 3300005354 Bacteria 662
99 Ga0070675_101827236 3300005354 Bacteria 560
100 Ga0070671_100004257 3300005355 Bacteria 11325
101 Ga0070671_100010829 3300005355 Bacteria 7317
102 Ga0070671_100010852 3300005355 Bacteria 7310
103 Ga0070671_100035500 3300005355 Bacteria 4130
104 Ga0070671_100054208 3300005355 Bacteria 3333
105 Ga0070671_100151034 3300005355 Bacteria 1961
106 Ga0070671_100352284 3300005355 Bacteria 1256
107 Ga0070671_100431186 3300005355 Bacteria 1130
108 Ga0070671_100541482 3300005355 Bacteria 1003
109 Ga0070671_100549835 3300005355 Bacteria 995
110 Ga0070671_100601713 3300005355 Bacteria 950
111 Ga0070671_100621150 3300005355 Bacteria 934
112 Ga0070671_100746480 3300005355 Bacteria 850
113 Ga0070671_100853014 3300005355 Bacteria 794
114 Ga0070674_100000872 3300005356 Bacteria 15687
115 Ga0070674_100017499 3300005356 Bacteria 4511
116 Ga0070674_100020439 3300005356 Bacteria 4231
117 Ga0070674_100042928 3300005356 Bacteria 3074
118 Ga0070674_100061607 3300005356 Bacteria 2619
119 Ga0070674_100422050 3300005356 Bacteria 1094
120 Ga0070674_100780396 3300005356 Bacteria 823
121 Ga0070674_100790631 3300005356 Bacteria 818
122 Ga0070673_100002229 3300005364 Bacteria 11725
123 Ga0070673_100029463 3300005364 Bacteria 4093
124 Ga0070673_100209803 3300005364 Bacteria 1681
125 Ga0070673_100283599 3300005364 Bacteria 1453
126 Ga0070673_100482213 3300005364 Bacteria 1119
127 Ga0070673_100917931 3300005364 Bacteria 812
128 Ga0070673_101102563 3300005364 Bacteria 741
129 Ga0070673_101157201 3300005364 Bacteria 724
130 Ga0070688_100227549 3300005365 Bacteria 1318
131 Ga0070659_100052563 3300005366 Bacteria 3205
132 Ga0070659_100238971 3300005366 Bacteria 1502
133 Ga0070659_100896862 3300005366 Bacteria 775
134 Ga0070659_101373298 3300005366 Bacteria 627
135 Ga0070659_102036705 3300005366 Bacteria 516
136 Ga0070667_100001505 3300005367 Bacteria 20850
137 Ga0070667_100032551 3300005367 Bacteria 4349
138 Ga0070667_100063471 3300005367 Bacteria 3130
139 Ga0070667_100177233 3300005367 Bacteria 1884
140 Ga0070667_100282605 3300005367 Bacteria 1490
141 Ga0070667_101867480 3300005367 Bacteria 565
142 Ga0070701_10412031 3300005438 Bacteria 859
143 Ga0070705_100773616 3300005440 Bacteria 761
144 Ga0070700_100486279 3300005441 Bacteria 947
145 Ga0070700_100511520 3300005441 Bacteria 926
146 Ga0070700_100735827 3300005441 Bacteria 788
147 Ga0070663_100022288 3300005455 Bacteria 4232
148 Ga0070663_100122435 3300005455 Bacteria 1966
149 Ga0070663_100416214 3300005455 Bacteria 1102
150 Ga0070663_100780688 3300005455 Bacteria 818
151 Ga0070663_100848311 3300005455 Bacteria 786
152 Ga0070678_100017379 3300005456 Bacteria 4630
153 Ga0070678_100093244 3300005456 Bacteria 2315
154 Ga0070678_100185327 3300005456 Bacteria 1707
155 Ga0070678_100322701 3300005456 Bacteria 1319
156 Ga0070678_100721715 3300005456 Bacteria 899
157 Ga0070678_100743803 3300005456 Bacteria 886
158 Ga0070678_100757931 3300005456 Bacteria 878
159 Ga0070678_100966038 3300005456 Bacteria 782
160 Ga0070678_101937979 3300005456 Bacteria 557
161 Ga0070662_100029907 3300005457 Bacteria 3806
162 Ga0070662_100213825 3300005457 Bacteria 1535
163 Ga0070662_100310989 3300005457 Bacteria 1282
164 Ga0070662_100759759 3300005457 Bacteria 822
165 Ga0070662_101136506 3300005457 Bacteria 671
166 Ga0070662_101239250 3300005457 Bacteria 641
167 Ga0070662_101297301 3300005457 Bacteria 626
168 Ga0070681_10177627 3300005458 Bacteria 2051
169 Ga0070681_10410491 3300005458 Bacteria 1266
170 Ga0068867_100010980 3300005459 Bacteria 6384
171 Ga0068867_100011650 3300005459 Bacteria 6209
172 Ga0068867_100027355 3300005459 Bacteria 4097
173 Ga0068867_100029135 3300005459 Bacteria 3977
174 Ga0068867_100138386 3300005459 Bacteria 1900
175 Ga0068867_100314874 3300005459 Bacteria 1294
176 Ga0068867_100987307 3300005459 Bacteria 763
177 Ga0068867_101212099 3300005459 Bacteria 694
178 Ga0068867_101993781 3300005459 Bacteria 548
179 Ga0070685_10082173 3300005466 Bacteria 1933
180 Ga0070699_100317735 3300005518 Bacteria 1399
181 Ga0070679_100000691 3300005530 Bacteria 28927
182 Ga0070679_100159319 3300005530 Bacteria 2231
183 Ga0070679_100940739 3300005530 Bacteria 808
184 Ga0070684_100054576 3300005535 Bacteria 3481
185 Ga0068853_100076200 3300005539 Bacteria 2928
186 Ga0068853_100102309 3300005539 Bacteria 2535
187 Ga0068853_100170182 3300005539 Bacteria 1971
188 Ga0068853_100345747 3300005539 Bacteria 1383
189 Ga0068853_100652212 3300005539 Bacteria 1002
190 Ga0068853_100816421 3300005539 Bacteria 893
191 Ga0068853_101437684 3300005539 Bacteria 667
192 Ga0068853_101617743 3300005539 Bacteria 628
193 Ga0068853_101716184 3300005539 Bacteria 609
194 Ga0068853_101757731 3300005539 Bacteria 601
195 Ga0070672_100012438 3300005543 Bacteria 5972
196 Ga0070672_100019128 3300005543 Bacteria 4965
197 Ga0070672_100021770 3300005543 Bacteria 4695
198 Ga0070672_100080708 3300005543 Bacteria 2606
199 Ga0070672_100096056 3300005543 Bacteria 2397
200 Ga0070672_100132447 3300005543 Bacteria 2050
201 Ga0070672_100189735 3300005543 Bacteria 1715
202 Ga0070672_100198784 3300005543 Bacteria 1676
203 Ga0070672_100364095 3300005543 Bacteria 1234
204 Ga0070672_100540986 3300005543 Bacteria 1010
205 Ga0070672_100636990 3300005543 Bacteria 930
206 Ga0070672_100796211 3300005543 Bacteria 831
207 Ga0070672_101648803 3300005543 Bacteria 576
208 Ga0070686_100446543 3300005544 Bacteria 993
209 Ga0070686_100856101 3300005544 Bacteria 737
210 Ga0070686_101555188 3300005544 Bacteria 559
211 Ga0070686_101577993 3300005544 Bacteria 555
212 Ga0070695_100279361 3300005545 Bacteria 1226
213 Ga0070693_100030221 3300005547 Bacteria 2961
214 Ga0070693_100111203 3300005547 Bacteria 1685
215 Ga0070693_100671530 3300005547 Bacteria 756
216 Ga0070665_100073467 3300005548 Bacteria 3425
217 Ga0070665_100526607 3300005548 Bacteria 1194
218 Ga0070665_100806133 3300005548 Bacteria 952
219 Ga0070665_100819728 3300005548 Bacteria 944
220 Ga0070665_101247166 3300005548 Bacteria 754
221 Ga0070665_101909177 3300005548 Bacteria 600
222 Ga0070665_102106153 3300005548 Bacteria 569
223 Ga0068855_100224232 3300005563 Bacteria 2107
224 Ga0070664_100175279 3300005564 Bacteria 1903
225 Ga0070664_100224547 3300005564 Bacteria 1681
226 Ga0070664_100533145 3300005564 Bacteria 1084
227 Ga0070664_100540979 3300005564 Bacteria 1076
228 Ga0070664_101200706 3300005564 Bacteria 715
229 Ga0070664_101369863 3300005564 Bacteria 668
230 Ga0070664_102074130 3300005564 Bacteria 540
231 Ga0068857_100302591 3300005577 Bacteria 1474
232 Ga0068857_100771888 3300005577 Bacteria 916
233 Ga0068857_101253612 3300005577 Bacteria 719
234 Ga0068857_102213244 3300005577 Bacteria 540
235 Ga0068854_100066733 3300005578 Bacteria 2619
236 Ga0068854_100111211 3300005578 Bacteria 2066
237 Ga0068854_100114061 3300005578 Bacteria 2042
238 Ga0068854_100129258 3300005578 Bacteria 1927
239 Ga0068854_100273394 3300005578 Bacteria 1357
240 Ga0068854_101407492 3300005578 Bacteria 631
241 Ga0068856_100259013 3300005614 Bacteria 1755
242 Ga0068856_100793270 3300005614 Bacteria 967
243 Ga0070702_100119007 3300005615 Bacteria 1650
244 Ga0070702_101699598 3300005615 Bacteria 525
245 Ga0070702_101862658 3300005615 Bacteria 504
246 Ga0068852_100030611 3300005616 Bacteria 4433
247 Ga0068852_100117867 3300005616 Bacteria 2425
248 Ga0068852_100141286 3300005616 Bacteria 2229
249 Ga0068852_100326162 3300005616 Bacteria 1492
250 Ga0068852_100328621 3300005616 Bacteria 1487
251 Ga0068852_100661751 3300005616 Bacteria 1052
252 Ga0068852_101191661 3300005616 Bacteria 782
253 Ga0068852_101241726 3300005616 Bacteria 766
254 Ga0068852_101462184 3300005616 Bacteria 706
255 Ga0068852_101511748 3300005616 Bacteria 694
256 Ga0068852_101694245 3300005616 Bacteria 655
257 Ga0068859_100121582 3300005617 Bacteria 2678
258 Ga0068859_100238610 3300005617 Bacteria 1907
259 Ga0068859_100685257 3300005617 Bacteria 1116
260 Ga0068859_101688161 3300005617 Bacteria 700
261 Ga0068864_100007117 3300005618 Bacteria 9189
262 Ga0068864_100032020 3300005618 Bacteria 4464
263 Ga0068864_100377487 3300005618 Bacteria 1343
264 Ga0068864_100380656 3300005618 Bacteria 1337
265 Ga0068864_100604369 3300005618 Bacteria 1064
266 Ga0068864_100673773 3300005618 Bacteria 1008
267 Ga0068864_101029247 3300005618 Bacteria 818
268 Ga0068864_101794862 3300005618 Bacteria 619
269 Ga0068866_10007228 3300005718 Bacteria 4645
270 Ga0068866_10195782 3300005718 Bacteria 1204
271 Ga0068866_10564443 3300005718 Bacteria 763
272 Ga0068861_100000343 3300005719 Bacteria 26498
273 Ga0068861_100011955 3300005719 Bacteria 6045
274 Ga0068861_100321369 3300005719 Bacteria 1348
275 Ga0068861_101121144 3300005719 Bacteria 757
276 Ga0068861_102572670 3300005719 Bacteria 513
277 Ga0068851_10002903 3300005834 Bacteria 7573
278 Ga0068851_10010554 3300005834 Bacteria 4313
279 Ga0068851_10056524 3300005834 Bacteria 2002
280 Ga0068851_10133644 3300005834 Bacteria 1344
281 Ga0068851_10164200 3300005834 Bacteria 1222
282 Ga0068851_10193935 3300005834 Bacteria 1130
283 Ga0068851_10507855 3300005834 Bacteria 724
284 Ga0068851_10812046 3300005834 Bacteria 581
285 Ga0068870_10063592 3300005840 Bacteria 1991
286 Ga0068870_10118521 3300005840 Bacteria 1521
287 Ga0068870_10897942 3300005840 Bacteria 626
288 Ga0068863_100065326 3300005841 Bacteria 3442
289 Ga0068863_100115186 3300005841 Bacteria 2561
290 Ga0068863_100130049 3300005841 Bacteria 2403
291 Ga0068863_100177120 3300005841 Bacteria 2047
292 Ga0068863_100413570 3300005841 Bacteria 1320
293 Ga0068863_101323130 3300005841 Bacteria 728
294 Ga0068863_102318511 3300005841 Bacteria 546
295 Ga0068858_100001875 3300005842 Bacteria 21440
296 Ga0068858_100005928 3300005842 Bacteria 11931
297 Ga0068858_100261499 3300005842 Bacteria 1645
298 Ga0068858_100652105 3300005842 Bacteria 1023
299 Ga0068860_100000707 3300005843 Bacteria 38265
300 Ga0068860_100000715 3300005843 Bacteria 37986
301 Ga0068860_100104922 3300005843 Bacteria 2698
302 Ga0068860_100189597 3300005843 Bacteria 1989
303 Ga0068862_100011541 3300005844 Bacteria 7290
304 Ga0068862_100014347 3300005844 Bacteria 6572
305 Ga0068862_100068622 3300005844 Bacteria 3059
306 Ga0068862_100415803 3300005844 Bacteria 1261
307 Ga0070717_11540018 3300006028 Bacteria 603
308 Ga0075368_10088381 3300006042 Bacteria 1266
309 Ga0075363_100328174 3300006048 Bacteria 891
310 Ga0070715_10096131 3300006163 Bacteria 1373
311 Ga0070715_10253411 3300006163 Bacteria 921
312 Ga0070715_10931147 3300006163 Bacteria 537
313 Ga0075362_10086726 3300006177 Bacteria 1449
314 Ga0075362_10277468 3300006177 Bacteria 828
315 Ga0075362_10458263 3300006177 Bacteria 648
316 Ga0075362_10545978 3300006177 Bacteria 596
317 Ga0075367_10496110 3300006178 Bacteria 774
318 Ga0075366_10170362 3300006195 Bacteria 1321
319 Ga0075366_10541221 3300006195 Bacteria 721
320 Ga0075366_10607848 3300006195 Bacteria 678
321 Ga0075366_10640360 3300006195 Bacteria 659
322 Ga0075366_10779250 3300006195 Bacteria 594
323 Ga0097621_100011190 3300006237 Bacteria 6605
324 Ga0097621_100044489 3300006237 Bacteria 3582
325 Ga0097621_100044639 3300006237 Bacteria 3576
326 Ga0097621_100093928 3300006237 Bacteria 2514
327 Ga0097621_102331765 3300006237 Bacteria 512
328 Ga0068871_100020020 3300006358 Bacteria 5119
329 Ga0068871_100277044 3300006358 Bacteria 1466
330 Ga0068871_100373397 3300006358 Bacteria 1265
331 Ga0068871_100484828 3300006358 Bacteria 1112
332 Ga0068871_101751292 3300006358 Bacteria 590
333 Ga0068865_100007045 3300006881 Bacteria 6901
334 Ga0068865_100024062 3300006881 Bacteria 3992
335 Ga0068865_100046341 3300006881 Bacteria 2983
336 Ga0068865_100092367 3300006881 Bacteria 2198
337 Ga0068865_100267267 3300006881 Bacteria 1356
338 Ga0097620_100121581 3300006931 Bacteria 2678
339 Ga0097620_100238594 3300006931 Bacteria 1907
340 Ga0097620_100685274 3300006931 Bacteria 1116
341 Ga0097620_101688261 3300006931 Bacteria 700
342 Ga0075435_100172515 3300007076 Bacteria 1825
343 Ga0105250_10473094 3300009092 Bacteria 565
344 Ga0105240_10055798 3300009093 Bacteria 4946
345 Ga0105240_10277408 3300009093 Bacteria 1927
346 Ga0105240_12534235 3300009093 Bacteria 530
347 Ga0111539_11849977 3300009094 Bacteria 700
348 Ga0105245_10064976 3300009098 Bacteria 3299
349 Ga0105245_10329579 3300009098 Bacteria 1506
350 Ga0105245_12341658 3300009098 Bacteria 588
351 Ga0105247_10067959 3300009101 Bacteria 2221
352 Ga0105247_11447209 3300009101 Bacteria 558
353 Ga0105247_11489538 3300009101 Bacteria 551
354 Ga0114129_11646705 3300009147 Bacteria 784
355 Ga0105243_10113425 3300009148 Bacteria 2273
356 Ga0105243_10132427 3300009148 Bacteria 2117
357 Ga0105243_10341295 3300009148 Bacteria 1372
358 Ga0105243_10870838 3300009148 Bacteria 894
359 Ga0105243_11316347 3300009148 Bacteria 740
360 Ga0105241_10371778 3300009174 Bacteria 1247
361 Ga0105241_11742821 3300009174 Bacteria 606
362 Ga0105242_10305956 3300009176 Bacteria 1453
363 Ga0105242_10709211 3300009176 Bacteria 985
364 Ga0105242_11118956 3300009176 Bacteria 802
365 Ga0105242_11582279 3300009176 Bacteria 689
366 Ga0105242_12948473 3300009176 Bacteria 526
367 Ga0105248_10002863 3300009177 Bacteria 19149
368 Ga0105248_10059166 3300009177 Bacteria 4303
369 Ga0105248_10617720 3300009177 Bacteria 1223
370 Ga0105248_10714340 3300009177 Bacteria 1131
371 Ga0105248_10715923 3300009177 Bacteria 1129
372 Ga0105237_10000367 3300009545 Bacteria 63983
373 Ga0105238_10040068 3300009551 Bacteria 4749
374 Ga0105238_10401529 3300009551 Bacteria 1364
375 Ga0105238_10487169 3300009551 Bacteria 1233
376 Ga0105238_10940719 3300009551 Bacteria 884
377 Ga0105238_12134239 3300009551 Bacteria 595
378 Ga0105249_10089453 3300009553 Bacteria 2877
379 Ga0105249_10133828 3300009553 Bacteria 2370
380 Ga0105249_10631708 3300009553 Bacteria 1127
381 Ga0105249_10669065 3300009553 Bacteria 1097
382 Ga0105249_11228564 3300009553 Bacteria 821
383 Ga0105249_12146313 3300009553 Bacteria 631
384 Ga0105239_10000150 3300010375 Bacteria 100349
385 Ga0105239_10276434 3300010375 Bacteria 1890
386 Ga0105246_10352684 3300011119 Bacteria 1206
387 Ga0105246_10761488 3300011119 Bacteria 855
388 Ga0105246_11093499 3300011119 Bacteria 727
389 Ga0105246_11817416 3300011119 Bacteria 583
390 Ga0157337_1038356 3300012483 Unclassified 519
391 Ga0157324_1038928 3300012506 Bacteria 574
392 Ga0157342_1031486 3300012507 Bacteria 670
393 Ga0157327_1075180 3300012512 Bacteria 533
394 Ga0157373_10025385 3300013100 Bacteria 4286
395 Ga0157373_10186599 3300013100 Bacteria 1461
396 Ga0157371_10072827 3300013102 Bacteria 2433
397 Ga0157371_10128765 3300013102 Bacteria 1800
398 Ga0157370_10185786 3300013104 Bacteria 1930
399 Ga0157370_10216969 3300013104 Bacteria 1773
400 Ga0157370_10808849 3300013104 Bacteria 853
401 Ga0157369_10304210 3300013105 Bacteria 1658
402 Ga0157369_10473092 3300013105 Bacteria 1297
403 Ga0157369_11770209 3300013105 Bacteria 628
404 Ga0157369_11993140 3300013105 Bacteria 589
405 Ga0157374_10011711 3300013296 Bacteria 7608
406 Ga0157374_10167425 3300013296 Bacteria 2142
407 Ga0157374_10497068 3300013296 Bacteria 1224
408 Ga0157374_10866612 3300013296 Bacteria 920
409 Ga0157378_10009725 3300013297 Bacteria 8376
410 Ga0157378_10128783 3300013297 Bacteria 2340
411 Ga0157378_10770619 3300013297 Bacteria 986
412 Ga0157378_11235427 3300013297 Bacteria 787
413 Ga0163162_10005242 3300013306 Bacteria 12495
414 Ga0163162_10033576 3300013306 Bacteria 5100
415 Ga0163162_10060697 3300013306 Bacteria 3817
416 Ga0163162_10087073 3300013306 Bacteria 3202
417 Ga0163162_10445140 3300013306 Bacteria 1427
418 Ga0163162_10771061 3300013306 Bacteria 1080
419 Ga0163162_10934425 3300013306 Bacteria 979
420 Ga0163162_11106003 3300013306 Bacteria 898
421 Ga0157372_10155294 3300013307 Bacteria 2643
422 Ga0157372_10324538 3300013307 Bacteria 1792
423 Ga0157372_10683649 3300013307 Bacteria 1194
424 Ga0157372_10688085 3300013307 Bacteria 1190
425 Ga0157375_10050873 3300013308 Bacteria 4066
426 Ga0157375_10075875 3300013308 Bacteria 3387
427 Ga0157375_10159639 3300013308 Bacteria 2396
428 Ga0157375_10234397 3300013308 Bacteria 1995
429 Ga0157375_10387830 3300013308 Bacteria 1564
430 Ga0157375_10496673 3300013308 Bacteria 1384
431 Ga0157375_10916976 3300013308 Bacteria 1019
432 Ga0157375_11111808 3300013308 Bacteria 925
433 Ga0157375_11532370 3300013308 Bacteria 787
434 Ga0157375_11561389 3300013308 Bacteria 780
435 Ga0163163_10014367 3300014325 Bacteria 7279
436 Ga0163163_10529428 3300014325 Bacteria 1241
437 Ga0163163_11098699 3300014325 Bacteria 858
438 Ga0163163_11138890 3300014325 Bacteria 843
439 Ga0163163_11420162 3300014325 Bacteria 756
440 Ga0163163_12367296 3300014325 Bacteria 590
441 Ga0163163_12479108 3300014325 Bacteria 577
442 Ga0157380_10011753 3300014326 Bacteria 6331
443 Ga0157380_10021172 3300014326 Bacteria 4874
444 Ga0157380_10061204 3300014326 Bacteria 3011
445 Ga0157380_10166331 3300014326 Bacteria 1922
446 Ga0157380_10281277 3300014326 Bacteria 1522
447 Ga0157380_10625553 3300014326 Bacteria 1069
448 Ga0157380_11209550 3300014326 Bacteria 799
449 Ga0157380_12583851 3300014326 Unclassified 574
450 Ga0157377_10017799 3300014745 Bacteria 3683
451 Ga0157377_10296155 3300014745 Bacteria 1066
452 Ga0157377_11613543 3300014745 Bacteria 520
453 Ga0157379_10000528 3300014968 Bacteria 30947
454 Ga0157379_10034268 3300014968 Bacteria 4526
455 Ga0157379_10034425 3300014968 Bacteria 4517
456 Ga0157379_10376614 3300014968 Bacteria 1302
457 Ga0157379_10411811 3300014968 Bacteria 1244
458 Ga0157379_10809452 3300014968 Bacteria 885
459 Ga0157379_11107729 3300014968 Bacteria 759
460 Ga0157376_10014036 3300014969 Bacteria 5997
461 Ga0157376_10130516 3300014969 Bacteria 2241
462 Ga0157376_10199089 3300014969 Bacteria 1841
463 Ga0157376_10762639 3300014969 Bacteria 977
464 Ga0157376_11214602 3300014969 Bacteria 782
465 Ga0157376_11397944 3300014969 Bacteria 731
466 Ga0182005_1053602 3300015265 Bacteria 1098
467 Ga0163161_10005129 3300017792 Bacteria 9108
468 Ga0163161_10085881 3300017792 Bacteria 2322
469 Ga0163161_10484359 3300017792 Bacteria 1005
470 Ga0163161_10830353 3300017792 Bacteria 778
471 Ga0163161_11527848 3300017792 Bacteria 587
472 Ga0163161_12049609 3300017792 Bacteria 509
473 Ga0213872_10000016 3300021361 Bacteria 180524
474 Ga0213876_10055319 3300021384 Bacteria 2095
475 Ga0209565_1070607 3300025263 Bacteria 590
476 Ga0209673_1027766 3300025273 Bacteria 1835
477 Ga0209758_1006025 3300025297 Bacteria 8954
478 Ga0209050_1001091 3300025298 Bacteria 32964
479 Ga0209257_1102802 3300025304 Bacteria 694
480 Ga0207697_10096614 3300025315 Bacteria 1256
481 Ga0207697_10290377 3300025315 Bacteria 725
482 Ga0207697_10296289 3300025315 Bacteria 717
483 Ga0207656_10106981 3300025321 Bacteria 1288
484 Ga0207656_10138223 3300025321 Bacteria 1147
485 Ga0207656_10151740 3300025321 Bacteria 1098
486 Ga0207656_10156984 3300025321 Bacteria 1080
487 Ga0207656_10178943 3300025321 Bacteria 1017
488 Ga0207656_10211827 3300025321 Bacteria 939
489 Ga0207656_10348212 3300025321 Bacteria 739
490 Ga0207682_10000725 3300025893 Bacteria 15303
491 Ga0207682_10003929 3300025893 Bacteria 6347
492 Ga0207682_10028381 3300025893 Bacteria 2233
493 Ga0207682_10069616 3300025893 Bacteria 1488
494 Ga0207642_10006251 3300025899 Bacteria 3951
495 Ga0207710_10134024 3300025900 Bacteria 1191
496 Ga0207688_10022082 3300025901 Bacteria 3482
497 Ga0207688_10397661 3300025901 Bacteria 854
498 Ga0207680_10012299 3300025903 Bacteria 4355
499 Ga0207680_10028426 3300025903 Bacteria 3128
500 Ga0207680_10175924 3300025903 Bacteria 1444
501 Ga0207680_10384721 3300025903 Bacteria 990
502 Ga0207685_10010306 3300025905 Bacteria 2753
503 Ga0207685_10809541 3300025905 Bacteria 516
504 Ga0207645_10017365 3300025907 Bacteria 4750
505 Ga0207645_10043897 3300025907 Bacteria 2861
506 Ga0207645_10044206 3300025907 Bacteria 2851
507 Ga0207645_10207552 3300025907 Bacteria 1290
508 Ga0207645_10880130 3300025907 Bacteria 609
509 Ga0207643_10454013 3300025908 Bacteria 816
510 Ga0207643_10924215 3300025908 Bacteria 565
511 Ga0207705_10199362 3300025909 Bacteria 1516
512 Ga0207705_10276262 3300025909 Bacteria 1285
513 Ga0207705_10371493 3300025909 Bacteria 1104
514 Ga0207705_10623561 3300025909 Bacteria 839
515 Ga0207654_10184095 3300025911 Bacteria 1364
516 Ga0207707_10315409 3300025912 Bacteria 1350
517 Ga0207707_11387295 3300025912 Bacteria 561
518 Ga0207695_10123068 3300025913 Bacteria 2560
519 Ga0207695_10985088 3300025913 Bacteria 723
520 Ga0207671_10000808 3300025914 Bacteria 39539
521 Ga0207671_10563606 3300025914 Bacteria 908
522 Ga0207660_10050947 3300025917 Bacteria 2942
523 Ga0207662_10008920 3300025918 Bacteria 5502
524 Ga0207662_10391099 3300025918 Bacteria 941
525 Ga0207662_10476268 3300025918 Bacteria 857
526 Ga0207657_10590231 3300025919 Bacteria 867
527 Ga0207657_10593843 3300025919 Bacteria 864
528 Ga0207649_10003067 3300025920 Bacteria 9172
529 Ga0207649_10046343 3300025920 Bacteria 2670
530 Ga0207649_10331111 3300025920 Bacteria 1122
531 Ga0207649_10592186 3300025920 Bacteria 852
532 Ga0207649_10679938 3300025920 Bacteria 797
533 Ga0207649_10904275 3300025920 Bacteria 692
534 Ga0207649_11135429 3300025920 Bacteria 617
535 Ga0207649_11421429 3300025920 Bacteria 549
536 Ga0207652_10003994 3300025921 Bacteria 12057
537 Ga0207652_11033990 3300025921 Bacteria 721
538 Ga0207652_11362930 3300025921 Unclassified 612
539 Ga0207681_10078779 3300025923 Bacteria 2320
540 Ga0207681_10128908 3300025923 Bacteria 1867
541 Ga0207681_10283872 3300025923 Bacteria 1304
542 Ga0207694_10037673 3300025924 Bacteria 3715
543 Ga0207694_10432688 3300025924 Bacteria 1097
544 Ga0207694_10698338 3300025924 Bacteria 856
545 Ga0207694_10906448 3300025924 Bacteria 745
546 Ga0207650_10000913 3300025925 Bacteria 22271
547 Ga0207650_10009570 3300025925 Bacteria 6627
548 Ga0207650_10033279 3300025925 Bacteria 3732
549 Ga0207650_10157405 3300025925 Bacteria 1797
550 Ga0207650_10301228 3300025925 Bacteria 1309
551 Ga0207659_10000189 3300025926 Bacteria 36771
552 Ga0207659_10028616 3300025926 Bacteria 3789
553 Ga0207659_10088146 3300025926 Bacteria 2311
554 Ga0207659_10098332 3300025926 Bacteria 2200
555 Ga0207659_10142039 3300025926 Bacteria 1865
556 Ga0207659_10521296 3300025926 Bacteria 1008
557 Ga0207687_10090230 3300025927 Bacteria 2233
558 Ga0207644_10018141 3300025931 Bacteria 4758
559 Ga0207644_10032530 3300025931 Bacteria 3639
560 Ga0207644_10040242 3300025931 Bacteria 3303
561 Ga0207644_10176881 3300025931 Bacteria 1670
562 Ga0207644_10363015 3300025931 Bacteria 1178
563 Ga0207644_10695873 3300025931 Bacteria 847
564 Ga0207644_10893404 3300025931 Bacteria 744
565 Ga0207644_11360521 3300025931 Bacteria 596
566 Ga0207690_10180979 3300025932 Bacteria 1587
567 Ga0207690_10317820 3300025932 Bacteria 1223
568 Ga0207690_10977548 3300025932 Bacteria 704
569 Ga0207690_10987519 3300025932 Bacteria 700
570 Ga0207690_11633755 3300025932 Bacteria 538
571 Ga0207706_10019673 3300025933 Bacteria 6074
572 Ga0207706_10046513 3300025933 Bacteria 3841
573 Ga0207706_10056711 3300025933 Bacteria 3453
574 Ga0207706_10249464 3300025933 Bacteria 1551
575 Ga0207706_10375740 3300025933 Bacteria 1234
576 Ga0207706_10557269 3300025933 Bacteria 986
577 Ga0207706_10776691 3300025933 Bacteria 815
578 Ga0207706_11333898 3300025933 Bacteria 592
579 Ga0207706_11526059 3300025933 Bacteria 544
580 Ga0207686_10057830 3300025934 Bacteria 2443
581 Ga0207686_10455454 3300025934 Bacteria 985
582 Ga0207709_10249456 3300025935 Bacteria 1296
583 Ga0207709_10375095 3300025935 Bacteria 1081
584 Ga0207709_10941137 3300025935 Bacteria 704
585 Ga0207709_11641056 3300025935 Bacteria 534
586 Ga0207670_10420861 3300025936 Bacteria 1072
587 Ga0207670_10726512 3300025936 Bacteria 823
588 Ga0207669_10251821 3300025937 Bacteria 1315
589 Ga0207669_10290215 3300025937 Bacteria 1238
590 Ga0207669_10355436 3300025937 Bacteria 1133
591 Ga0207669_10355444 3300025937 Bacteria 1133
592 Ga0207669_10356794 3300025937 Bacteria 1131
593 Ga0207669_10483492 3300025937 Bacteria 987
594 Ga0207669_10722280 3300025937 Bacteria 820
595 Ga0207704_10003998 3300025938 Bacteria 6711
596 Ga0207704_10051709 3300025938 Bacteria 2486
597 Ga0207704_10247305 3300025938 Bacteria 1336
598 Ga0207704_10463995 3300025938 Bacteria 1013
599 Ga0207704_10629573 3300025938 Bacteria 881
600 Ga0207665_10067160 3300025939 Bacteria 2441
601 Ga0207691_10002491 3300025940 Bacteria 18008
602 Ga0207691_10022344 3300025940 Bacteria 5967
603 Ga0207691_10036304 3300025940 Bacteria 4566
604 Ga0207691_10046984 3300025940 Bacteria 3964
605 Ga0207691_10060239 3300025940 Bacteria 3449
606 Ga0207691_10064120 3300025940 Bacteria 3330
607 Ga0207691_10115269 3300025940 Bacteria 2386
608 Ga0207691_10276681 3300025940 Bacteria 1445
609 Ga0207691_10416591 3300025940 Bacteria 1145
610 Ga0207691_10538816 3300025940 Bacteria 990
611 Ga0207691_11295023 3300025940 Bacteria 602
612 Ga0207691_11332922 3300025940 Bacteria 592
613 Ga0207711_10175231 3300025941 Bacteria 1948
614 Ga0207711_10199640 3300025941 Bacteria 1825
615 Ga0207711_10432966 3300025941 Bacteria 1224
616 Ga0207711_10905306 3300025941 Bacteria 820
617 Ga0207689_10023257 3300025942 Bacteria 5204
618 Ga0207689_10030492 3300025942 Bacteria 4494
619 Ga0207689_10604887 3300025942 Bacteria 922
620 Ga0207661_10025979 3300025944 Bacteria 4457
621 Ga0207661_10104735 3300025944 Bacteria 2382
622 Ga0207679_10294931 3300025945 Bacteria 1395
623 Ga0207679_10936490 3300025945 Bacteria 793
624 Ga0207679_11172985 3300025945 Bacteria 705
625 Ga0207679_12167833 3300025945 Bacteria 504
626 Ga0207667_10238026 3300025949 Bacteria 1863
627 Ga0207651_10006755 3300025960 Bacteria 6045
628 Ga0207651_10036579 3300025960 Bacteria 3206
629 Ga0207651_10261065 3300025960 Bacteria 1422
630 Ga0207651_10384276 3300025960 Bacteria 1190
631 Ga0207651_10663526 3300025960 Bacteria 916
632 Ga0207651_11726224 3300025960 Bacteria 564
633 Ga0207712_10158752 3300025961 Bacteria 1755
634 Ga0207712_10365122 3300025961 Bacteria 1204
635 Ga0207668_10154213 3300025972 Bacteria 1782
636 Ga0207668_10239930 3300025972 Bacteria 1466
637 Ga0207668_10581705 3300025972 Bacteria 973
638 Ga0207668_11032804 3300025972 Bacteria 735
639 Ga0207640_10064285 3300025981 Bacteria 2442
640 Ga0207640_10106518 3300025981 Bacteria 1978
641 Ga0207640_10345483 3300025981 Bacteria 1193
642 Ga0207640_10464869 3300025981 Bacteria 1046
643 Ga0207640_10727442 3300025981 Bacteria 853
644 Ga0207640_11092677 3300025981 Bacteria 705
645 Ga0207658_10259502 3300025986 Bacteria 1480
646 Ga0207658_10356188 3300025986 Bacteria 1275
647 Ga0207677_10006180 3300026023 Bacteria 6546
648 Ga0207677_10008231 3300026023 Bacteria 5812
649 Ga0207677_10243194 3300026023 Bacteria 1457
650 Ga0207677_10249684 3300026023 Bacteria 1440
651 Ga0207677_10374579 3300026023 Bacteria 1200
652 Ga0207677_10576931 3300026023 Bacteria 984
653 Ga0207677_10746347 3300026023 Bacteria 872
654 Ga0207677_10865955 3300026023 Bacteria 813
655 Ga0207703_10019219 3300026035 Bacteria 5337
656 Ga0207639_10168564 3300026041 Bacteria 1852
657 Ga0207639_10182817 3300026041 Bacteria 1785
658 Ga0207639_10393961 3300026041 Bacteria 1246
659 Ga0207639_10612436 3300026041 Bacteria 1005
660 Ga0207639_10765798 3300026041 Bacteria 898
661 Ga0207639_11162988 3300026041 Bacteria 724
662 Ga0207678_10098284 3300026067 Bacteria 2501
663 Ga0207678_10433145 3300026067 Bacteria 1141
664 Ga0207678_10809591 3300026067 Bacteria 827
665 Ga0207678_10856175 3300026067 Bacteria 803
666 Ga0207708_10033764 3300026075 Bacteria 3889
667 Ga0207708_10613258 3300026075 Bacteria 923
668 Ga0207708_10623155 3300026075 Bacteria 916
669 Ga0207702_10159617 3300026078 Bacteria 2058
670 Ga0207702_10629741 3300026078 Bacteria 1054
671 Ga0207702_10821268 3300026078 Bacteria 919
672 Ga0207702_10900339 3300026078 Bacteria 877
673 Ga0207702_11058535 3300026078 Bacteria 805
674 Ga0207641_10102813 3300026088 Bacteria 2520
675 Ga0207641_10145771 3300026088 Bacteria 2141
676 Ga0207641_10243287 3300026088 Bacteria 1677
677 Ga0207641_10853699 3300026088 Bacteria 902
678 Ga0207648_10001050 3300026089 Bacteria 30933
679 Ga0207648_10017069 3300026089 Bacteria 6617
680 Ga0207648_10020934 3300026089 Bacteria 5889
681 Ga0207648_10025462 3300026089 Bacteria 5269
682 Ga0207648_10038664 3300026089 Bacteria 4198
683 Ga0207648_10062807 3300026089 Bacteria 3238
684 Ga0207648_10077331 3300026089 Bacteria 2901
685 Ga0207648_10292324 3300026089 Bacteria 1459
686 Ga0207648_12067787 3300026089 Bacteria 531
687 Ga0207676_10010740 3300026095 Bacteria 6529
688 Ga0207676_10012969 3300026095 Bacteria 5985
689 Ga0207676_10017091 3300026095 Bacteria 5255
690 Ga0207676_10112784 3300026095 Bacteria 2278
691 Ga0207676_10365923 3300026095 Bacteria 1338
692 Ga0207676_10714042 3300026095 Bacteria 972
693 Ga0207676_11128801 3300026095 Bacteria 775
694 Ga0207676_11427397 3300026095 Bacteria 688
695 Ga0207674_10037357 3300026116 Bacteria 5052
696 Ga0207674_10284228 3300026116 Bacteria 1603
697 Ga0207674_11617705 3300026116 Unclassified 616
698 Ga0207675_100009210 3300026118 Bacteria 9259
699 Ga0207675_100013996 3300026118 Bacteria 7479
700 Ga0207675_100017970 3300026118 Bacteria 6596
701 Ga0207675_100112605 3300026118 Bacteria 2568
702 Ga0207675_100174563 3300026118 Bacteria 2056
703 Ga0207675_101810132 3300026118 Bacteria 630
704 Ga0207683_10040810 3300026121 Bacteria 4052
705 Ga0207683_10111933 3300026121 Bacteria 2445
706 Ga0207683_10126252 3300026121 Bacteria 2299
707 Ga0207683_10153083 3300026121 Bacteria 2082
708 Ga0207683_10218485 3300026121 Bacteria 1736
709 Ga0207683_10374633 3300026121 Bacteria 1308
710 Ga0207683_10386693 3300026121 Bacteria 1286
711 Ga0207683_10488608 3300026121 Bacteria 1137
712 Ga0207683_10488687 3300026121 Bacteria 1136
713 Ga0207683_10899242 3300026121 Bacteria 822
714 Ga0207683_12163852 3300026121 Bacteria 504
715 Ga0207683_12165804 3300026121 Bacteria 504
716 Ga0207698_10208020 3300026142 Bacteria 1758
717 Ga0207698_10446682 3300026142 Bacteria 1247
718 Ga0207698_10505164 3300026142 Bacteria 1177
719 Ga0207698_10671196 3300026142 Bacteria 1029
720 Ga0207698_11049577 3300026142 Bacteria 827
721 Ga0207698_11255847 3300026142 Bacteria 755
722 Ga0207698_11448840 3300026142 Bacteria 702
723 Ga0209971_1176159 3300027682 Bacteria 527
724 Ga0209998_10190354 3300027717 Bacteria 535
725 Ga0209974_10453080 3300027876 Bacteria 509
726 Ga0268266_10186889 3300028379 Bacteria 1890
727 Ga0268266_10196117 3300028379 Bacteria 1846
728 Ga0268266_10415357 3300028379 Bacteria 1274
729 Ga0268266_10483353 3300028379 Bacteria 1181
730 Ga0268266_10588612 3300028379 Bacteria 1068
731 Ga0268266_10766275 3300028379 Bacteria 932
732 Ga0268265_10130233 3300028380 Bacteria 2089
733 Ga0268265_10155930 3300028380 Bacteria 1932
734 Ga0268265_10302348 3300028380 Bacteria 1441
735 Ga0268265_10329869 3300028380 Bacteria 1385
736 Ga0268264_10010116 3300028381 Bacteria 7806
737 Ga0268264_10216090 3300028381 Bacteria 1762
738 Ga0268264_10430402 3300028381 Bacteria 1274
739 Ga0268264_10483122 3300028381 Bacteria 1205
740 Ga0307517_10219604 3300028786 Bacteria 1157
741 Ga0307515_10000191 3300028794 Bacteria 149201
742 Ga0307515_10204109 3300028794 Bacteria 1843
743 Ga0307513_10241228 3300031456 Bacteria 1612
744 Ga0307513_10866818 3300031456 Bacteria 610
745 Ga0307509_10079558 3300031507 Bacteria 3393
746 Ga0307408_100087773 3300031548 Bacteria 2341
747 Ga0307516_10000254 3300031730 Bacteria 68771
748 Ga0307516_10031298 3300031730 Bacteria 5363
749 Ga0307405_10019062 3300031731 Bacteria 3801
750 Ga0307405_10231283 3300031731 Bacteria 1363
751 Ga0307405_10610104 3300031731 Bacteria 892
752 Ga0307413_10038148 3300031824 Bacteria 2782
753 Ga0307413_10328609 3300031824 Bacteria 1171
754 Ga0307413_11204990 3300031824 Bacteria 658
755 Ga0307410_10012223 3300031852 Bacteria 4953
756 Ga0307410_10099902 3300031852 Bacteria 2078
757 Ga0307410_11527741 3300031852 Bacteria 589
758 Ga0307406_10022580 3300031901 Bacteria 3734
759 Ga0307406_10184957 3300031901 Bacteria 1520
760 Ga0307407_10033866 3300031903 Bacteria 2791
761 Ga0307407_10239113 3300031903 Bacteria 1238
762 Ga0307407_10313447 3300031903 Bacteria 1098
763 Ga0307412_10016388 3300031911 Bacteria 4414
764 Ga0307412_10274935 3300031911 Bacteria 1320
765 Ga0307412_10314711 3300031911 Bacteria 1243
766 Ga0307412_11516339 3300031911 Bacteria 610
767 Ga0307409_100001576 3300031995 Bacteria 11368
768 Ga0307409_100300756 3300031995 Bacteria 1492
769 Ga0307409_100843065 3300031995 Bacteria 927
770 Ga0307409_100939520 3300031995 Bacteria 880
771 Ga0307416_100001923 3300032002 Bacteria 11600
772 Ga0307416_100076333 3300032002 Bacteria 2808
773 Ga0307416_100419595 3300032002 Bacteria 1382
774 Ga0307416_101245998 3300032002 Bacteria 849
775 Ga0307416_102148113 3300032002 Bacteria 660
776 Ga0307411_10009826 3300032005 Bacteria 5059
777 Ga0307411_10024755 3300032005 Bacteria 3584
778 Ga0307411_11067351 3300032005 Bacteria 726
779 Ga0307411_11218013 3300032005 Bacteria 683
780 Ga0307411_11313255 3300032005 Bacteria 659
781 Ga0307415_100074130 3300032126 Bacteria 2404
782 Ga0373930_0076066 3300034816 Bacteria 770
783 Ga0373948_0048606 3300034817 Bacteria 906
784 Ga0373959_0091513 3300034820 Bacteria 713
785 Ga0373938_0011101 3300034957 Bacteria 1669
786 Ga0373926_0070870 3300035083 Bacteria 1280
787 Ga0373940_0083197 3300035088 Bacteria 949
788 Ga0373944_0010740 3300035089 Bacteria 2501
789 Ga0373944_0160282 3300035089 Bacteria 798
790 Ga0373949_0024439 3300035090 Bacteria 1405
791 Ga0373951_0229139 3300035091 Bacteria 551
792 Ga0373952_0077468 3300035092 Bacteria 842
793 Ga0373923_0118788 3300035111 Bacteria 1180
794 Ga0373939_0411611 3300035114 Bacteria 562
795 Ga0373954_0269983 3300035118 Bacteria 838
796 Ga0373956_0036705 3300035119 Bacteria 2164
797 Ga0373946_0111453 3300035171 Bacteria 1239
798 Ga0373946_0162806 3300035171 Bacteria 1049
799 Ga0373946_0525150 3300035171 Bacteria 609
800 Ga0373955_0214586 3300035172 Bacteria 1148
801 Ga0373955_0244715 3300035172 Bacteria 1075
802 Ga0373961_0160173 3300035241 Bacteria 772
803 Ga0373924_0564452 3300035410 Bacteria 513
804 Ga0373931_0004801 3300035691 Bacteria 6204
805 Ga0373935_0030710 3300035692 Bacteria 3331
806 Ga0373927_0439112 3300035695 Bacteria 862
807 Ga0373933_0292065 3300035724 Bacteria 1054
808 Ga0373933_0383816 3300035724 Bacteria 915
809 Ga0373947_0666259 3300035725 Bacteria 710
810 Ga0373937_0161905 3300036401 Bacteria 2098
811 Ga0373937_0210205 3300036401 Bacteria 1831
812 Ga0373937_1129495 3300036401 Bacteria 732
813 Ga0373937_1531714 3300036401 Bacteria 614
814 Ga0373925_0004683 3300037068 Bacteria 10322
815 Ga0373925_0239360 3300037068 Bacteria 1453
816 Ga0373925_0295789 3300037068 Bacteria 1306
817 Ga0436365_1570775 3300039437 Bacteria 807
818 Ga0436365_1878872 3300039437 Bacteria 4411
819 Ga0436361_0376061 3300039447 Bacteria 200571
820 Ga0436363_1315143 3300039450 Bacteria 4526
821 Ga0451789_1257448 3300041443 Bacteria 581
822 Ga0451791_1178732 3300041451 Bacteria 826
823 Ga0451797_0024097 3300041453 Bacteria 662
824 Ga0451797_0182074 3300041453 Bacteria 793
825 Ga0451795_1526863 3300041456 Bacteria 551
826 Ga0451795_1640012 3300041456 Bacteria 584
827 Ga0451798_0162675 3300041458 Unclassified 629
828 Ga0451798_0537668 3300041458 Bacteria 1903
829 Ga0451800_0361784 3300041459 Bacteria 749
830 Ga0451800_0425630 3300041459 Bacteria 808
831 Ga0451802_0181316 3300041460 Bacteria 671
832 Ga0451802_0227888 3300041460 Bacteria 586
833 Ga0451802_1108283 3300041460 Bacteria 3753
834 Ga0451804_0420921 3300041463 Bacteria 1853
835 Ga0451804_1130280 3300041463 Bacteria 863
836 Ga0451807_2633116 3300041486 Bacteria 568
837 Ga0451841_0660538 3300041498 Bacteria 1024
838 Ga0451841_0913474 3300041498 Bacteria 508
839 Ga0451847_0580709 3300041503 Bacteria 754
840 Ga0451849_1316584 3300041505 Bacteria 630
841 Ga0451851_0104455 3300041507 Bacteria 2301
842 Ga0451851_0279755 3300041507 Bacteria 520
843 Ga0451853_0463049 3300041512 Bacteria 855
844 Ga0451853_2526968 3300041512 Bacteria 757
845 Ga0451853_3410975 3300041512 Bacteria 882
846 Ga0439441_072363 3300042001 Bacteria 741
847 Ga0439448_0265163 3300042005 Bacteria 607
848 Ga0439456_176370 3300042013 Bacteria 503
849 Ga0450888_075937 3300042126 Bacteria 511
850 Ga0450897_015541 3300042128 Bacteria 778
851 Ga0439458_0162222 3300042157 Bacteria 602
852 Ga0439464_0019626 3300042439 Bacteria 1846
853 Ga0439464_0193506 3300042439 Bacteria 647
854 Ga0439464_0212305 3300042439 Bacteria 619
855 Ga0450918_000075 3300042531 Bacteria 20738
856 Ga0451577_0001353 3300042876 Bacteria 33109
857 Ga0451577_1257332 3300042876 Bacteria 659
858 Ga0439440_0164943 3300042993 Bacteria 641
859 Ga0453684_0006474 3300044712 Bacteria 22221
860 Ga0466968_0025097 3300044735 Bacteria 2439
861 Ga0495629_0411126 3300046459 Bacteria 919
862 Ga0495580_0035100 3300046472 Bacteria 3606
863 Ga0495582_0122099 3300046473 Bacteria 1468
864 Ga0495662_0150853 3300046476 Bacteria 1145
865 Ga0495610_0018172 3300046512 Bacteria 3979
866 Ga0495620_0145710 3300046515 Bacteria 925
867 Ga0495620_0354768 3300046515 Bacteria 556
868 Ga0495628_0425675 3300046516 Bacteria 967
869 Ga0495628_1154398 3300046516 Bacteria 527
870 Ga0495632_0107252 3300046519 Bacteria 1313
871 Ga0495654_0236292 3300046530 Bacteria 767
872 Ga0495640_0211526 3300046533 Bacteria 1226
873 Ga0495640_0553282 3300046533 Bacteria 697
874 Ga0495586_0101742 3300046535 Bacteria 1595
875 Ga0495587_0734277 3300046536 Unclassified 541
876 Ga0495598_0303288 3300046537 Bacteria 605
877 Ga0495621_0177144 3300046539 Bacteria 849
878 Ga0495621_0457265 3300046539 Bacteria 547
879 Ga0495645_0218962 3300046543 Bacteria 1281
880 Ga0495645_0966754 3300046543 Bacteria 502
881 Ga0495633_0364923 3300046558 Bacteria 654
882 Ga0495656_0650507 3300046615 Bacteria 566
883 Ga0495668_0520039 3300046616 Bacteria 656
884 Ga0495611_0274090 3300046648 Bacteria 780
885 Ga0495625_0005772 3300046660 Bacteria 11192
886 Ga0495635_0497593 3300046663 Bacteria 803
887 Ga0495635_0962027 3300046663 Bacteria 545
888 Ga0495623_0369829 3300046679 Bacteria 777
889 Ga0495647_0038717 3300046681 Bacteria 1804
890 Ga0495647_0166447 3300046681 Bacteria 953
891 Ga0495658_0015916 3300046683 Bacteria 3866
892 Ga0495658_0075446 3300046683 Bacteria 1968
893 Ga0495658_0174708 3300046683 Bacteria 1331
894 Ga0495658_0274123 3300046683 Bacteria 1064
895 Ga0495658_0362831 3300046683 Bacteria 921
896 Ga0495658_0532797 3300046683 Bacteria 752
897 Ga0495613_0084712 3300046689 Bacteria 2301
898 Ga0495613_1093267 3300046689 Unclassified 509
899 Ga0495670_0306392 3300046691 Bacteria 852
900 Ga0495676_0382241 3300047321 Bacteria 937
901 Ga0495681_0393987 3300047470 Bacteria 519
902 Ga0495684_0108451 3300047471 Bacteria 2097
903 Ga0495686_0130669 3300047472 Bacteria 1489
904 Ga0495615_0139808 3300048090 Bacteria 714
905 Ga0496100_0323352 3300048903 Bacteria 1159
906 Ga0496100_0549204 3300048903 Bacteria 894
907 Ga0496100_0998384 3300048903 Bacteria 659
908 Ga0496101_0119392 3300048904 Bacteria 1992
909 Ga0496103_0324954 3300048906 Bacteria 989
910 Ga0496104_0008841 3300048907 Bacteria 8953
911 Ga0496104_0147333 3300048907 Bacteria 2261
912 Ga0496104_0397604 3300048907 Bacteria 1290
913 Ga0496105_0059786 3300048908 Bacteria 3145
914 Ga0496105_0154988 3300048908 Bacteria 1882
915 Ga0496105_0825661 3300048908 Bacteria 703
916 Ga0496106_0192393 3300048909 Bacteria 1622
917 Ga0496106_0278486 3300048909 Bacteria 1340
918 Ga0496107_0119919 3300048910 Bacteria 1937
919 Ga0496108_0130837 3300048911 Bacteria 2157
920 Ga0496108_0204984 3300048911 Bacteria 1711
921 Ga0496108_1503077 3300048911 Bacteria 560
922 Ga0496109_0098011 3300048912 Bacteria 2718
923 Ga0496109_0162683 3300048912 Bacteria 2091
924 Ga0496109_0627133 3300048912 Bacteria 1012
925 Ga0496110_0167874 3300048913 Bacteria 1990
926 Ga0496110_0172128 3300048913 Bacteria 1965
927 Ga0496110_0422460 3300048913 Bacteria 1215
928 Ga0496111_0794761 3300048914 Bacteria 685
929 Ga0496113_0228840 3300048916 Bacteria 1482
930 Ga0496114_0052168 3300048917 Bacteria 3407
931 Ga0496114_0797284 3300048917 Bacteria 823
932 Ga0496114_1268649 3300048917 Bacteria 623
933 Ga0496115_0030587 3300048918 Bacteria 4237
934 Ga0496115_1459923 3300048918 Bacteria 503
935 Ga0496125_0331353 3300048928 Bacteria 918
936 Ga0501079_1672772 3300049741 Bacteria 500
937 Ga0501081_0748108 3300049743 Bacteria 735
938 nmdc:mga03683_47620_c2 3300050489 Bacteria 998
939 nmdc:mga03n38_119825_c1 3300050490 Bacteria 1292
940 nmdc:mga03n38_651268_c1 3300050490 Bacteria 604
941 nmdc:mga03n38_902856_c1 3300050490 Bacteria 519
942 nmdc:mga00v17_1011743_c1 3300050491 Bacteria 523
943 nmdc:mga0k408_213015_c1 3300050493 Bacteria 1154
944 nmdc:mga0k408_261538_c1 3300050493 Bacteria 1033
945 nmdc:mga0k408_2772_c1 3300050493 Bacteria 9313
946 nmdc:mga0k408_33626_c1 3300050493 Bacteria 2933
947 nmdc:mga0k408_48695_c1 3300050493 Bacteria 2452
948 nmdc:mga0k408_698136_c1 3300050493 Bacteria 595
949 nmdc:mga0k408_859493_c1 3300050493 Bacteria 527
950 nmdc:mga0k408_88833_c1 3300050493 Bacteria 1815
951 nmdc:mga06z11_431626_c1 3300050494 Bacteria 795
952 nmdc:mga05p37_1271046_c1 3300050507 Bacteria 753
953 nmdc:mga08y16_1323210_c1 3300050511 Bacteria 686
954 nmdc:mga08y16_369155_c1 3300050511 Bacteria 1472
955 nmdc:mga0n895_103732_c1 3300050512 Bacteria 2855
956 nmdc:mga0rr50_1274026_c1 3300050513 Bacteria 624
957 nmdc:mga0sz30_288303_c1 3300050516 Bacteria 731
958 Ga0495601_0024573 3300053077 Bacteria 3712
959 Ga0495612_0109924 3300053078 Bacteria 1179
960 Ga0495612_0420894 3300053078 Bacteria 608
961 Ga0495595_0190648 3300053084 Bacteria 1019
962 Ga0495595_0406689 3300053084 Bacteria 690
963 Ga0495619_0155441 3300053085 Bacteria 1578
964 Ga0500578_0000002 3300053086 Bacteria 293507
965 Ga0500578_0773424 3300053086 Bacteria 510
966 Ga0500658_0012730 3300053134 Bacteria 3106
967 Ga0500604_0325706 3300053151 Bacteria 533
968 Ga0500587_000275 3300053739 Bacteria 5679
969 Ga0590071_000456 3300059421 Bacteria 11882
970 Ga0590074_051835 3300059423 Bacteria 752
971 2587755163 2585428062 Bacteria 6842168
972 2643969512 2643221592 Bacteria 6608788
973 2644143812 2643221625 Bacteria 6512927
974 2644276482 2643221648 Bacteria 6521465
975 rootL2_10003300
976 rootH1_10031410
977 JGI26145J50221_1001962
978 Ga0065165_1003031
979 Ga0065712_10056070
980 Ga0065715_10120848
981 Ga0070658_10182587
982 Ga0070658_10289100
983 Ga0070658_10613061
984 Ga0070676_10007895
985 Ga0070676_10011958
986 Ga0070676_10030674
987 Ga0070676_10152281
988 Ga0070676_10165762
989 Ga0070676_10202608
990 Ga0070676_10235372
991 Ga0070676_10278163
992 Ga0070683_100039749
993 Ga0070683_100557719
994 Ga0070683_101344516
995 Ga0070690_100116392
996 Ga0070690_100367271
997 Ga0070690_100558543
998 Ga0070670_100000334
999 Ga0070670_100044516
1000 Ga0070670_100060634
1001 Ga0070670_100075077
1002 Ga0070670_100087706
1003 Ga0070670_100220336
1004 Ga0070670_100645234
1005 Ga0070670_100864623
1006 Ga0070670_101289499
1007 Ga0070677_10006421
1008 Ga0070677_10006836
1009 Ga0070677_10008378
1010 Ga0070677_10081611
1011 Ga0070677_10096075
1012 Ga0070677_10117753
1013 Ga0070677_10137535
1014 Ga0070677_10213302
1015 Ga0070677_10245694
1016 Ga0070677_10450072
1017 Ga0068869_100013349
1018 Ga0068869_100284837
1019 Ga0068869_100378101
1020 Ga0068869_100611001
1021 Ga0068869_100802983
1022 Ga0070666_10003466
1023 Ga0070666_10596720
1024 Ga0070666_10635016
1025 Ga0070666_10677108
1026 Ga0070666_11039612
1027 Ga0070680_100012537
1028 Ga0068868_100010821
1029 Ga0068868_100055602
1030 Ga0068868_100079519
1031 Ga0068868_100336794
1032 Ga0068868_100400257
1033 Ga0068868_100656203
1034 Ga0068868_100856291
1035 Ga0068868_100893892
1036 Ga0070660_100120719
1037 Ga0070660_100293410
1038 Ga0070660_100618286
1039 Ga0070689_100252613
1040 Ga0070689_100564921
1041 Ga0070687_100105520
1042 Ga0070687_100367005
1043 Ga0070687_100694693
1044 Ga0070687_101539852
1045 Ga0070661_100022092
1046 Ga0070661_100123527
1047 Ga0070661_100150066
1048 Ga0070661_100323746
1049 Ga0070661_100595266
1050 Ga0070661_101402844
1051 Ga0070692_10358886
1052 Ga0070692_11380430
1053 Ga0070668_100030279
1054 Ga0070668_100064311
1055 Ga0070668_100526822
1056 Ga0070668_100860308
1057 Ga0070668_101247167
1058 Ga0070669_100046349
1059 Ga0070669_100118475
1060 Ga0070669_100148531
1061 Ga0070669_100398760
1062 Ga0070669_101096316
1063 Ga0070675_100009823
1064 Ga0070675_100037083
1065 Ga0070675_100048867
1066 Ga0070675_100072089
1067 Ga0070675_100095821
1068 Ga0070675_100145848
1069 Ga0070675_100161112
1070 Ga0070675_100671595
1071 Ga0070675_101026303
1072 Ga0070675_101329059
1073 Ga0070675_101827236
1074 Ga0070671_100004257
1075 Ga0070671_100010829
1076 Ga0070671_100010852
1077 Ga0070671_100035500
1078 Ga0070671_100054208
1079 Ga0070671_100151034
1080 Ga0070671_100352284
1081 Ga0070671_100431186
1082 Ga0070671_100541482
1083 Ga0070671_100549835
1084 Ga0070671_100601713
1085 Ga0070671_100621150
1086 Ga0070671_100746480
1087 Ga0070671_100853014
1088 Ga0070674_100000872
1089 Ga0070674_100017499
1090 Ga0070674_100020439
1091 Ga0070674_100042928
1092 Ga0070674_100061607
1093 Ga0070674_100422050
1094 Ga0070674_100780396
1095 Ga0070674_100790631
1096 Ga0070673_100002229
1097 Ga0070673_100029463
1098 Ga0070673_100209803
1099 Ga0070673_100283599
1100 Ga0070673_100482213
1101 Ga0070673_100917931
1102 Ga0070673_101102563
1103 Ga0070673_101157201
1104 Ga0070688_100227549
1105 Ga0070659_100052563
1106 Ga0070659_100238971
1107 Ga0070659_100896862
1108 Ga0070659_101373298
1109 Ga0070659_102036705
1110 Ga0070667_100001505
1111 Ga0070667_100032551
1112 Ga0070667_100063471
1113 Ga0070667_100177233
1114 Ga0070667_100282605
1115 Ga0070667_101867480
1116 Ga0070701_10412031
1117 Ga0070705_100773616
1118 Ga0070700_100486279
1119 Ga0070700_100511520
1120 Ga0070700_100735827
1121 Ga0070663_100022288
1122 Ga0070663_100122435
1123 Ga0070663_100416214
1124 Ga0070663_100780688
1125 Ga0070663_100848311
1126 Ga0070678_100017379
1127 Ga0070678_100093244
1128 Ga0070678_100185327
1129 Ga0070678_100322701
1130 Ga0070678_100721715
1131 Ga0070678_100743803
1132 Ga0070678_100757931
1133 Ga0070678_100966038
1134 Ga0070678_101937979
1135 Ga0070662_100029907
1136 Ga0070662_100213825
1137 Ga0070662_100310989
1138 Ga0070662_100759759
1139 Ga0070662_101136506
1140 Ga0070662_101239250
1141 Ga0070662_101297301
1142 Ga0070681_10177627
1143 Ga0070681_10410491
1144 Ga0068867_100010980
1145 Ga0068867_100011650
1146 Ga0068867_100027355
1147 Ga0068867_100029135
1148 Ga0068867_100138386
1149 Ga0068867_100314874
1150 Ga0068867_100987307
1151 Ga0068867_101212099
1152 Ga0068867_101993781
1153 Ga0070685_10082173
1154 Ga0070699_100317735
1155 Ga0070679_100000691
1156 Ga0070679_100159319
1157 Ga0070679_100940739
1158 Ga0070684_100054576
1159 Ga0068853_100076200
1160 Ga0068853_100102309
1161 Ga0068853_100170182
1162 Ga0068853_100345747
1163 Ga0068853_100652212
1164 Ga0068853_100816421
1165 Ga0068853_101437684
1166 Ga0068853_101617743
1167 Ga0068853_101716184
1168 Ga0068853_101757731
1169 Ga0070672_100012438
1170 Ga0070672_100019128
1171 Ga0070672_100021770
1172 Ga0070672_100080708
1173 Ga0070672_100096056
1174 Ga0070672_100132447
1175 Ga0070672_100189735
1176 Ga0070672_100198784
1177 Ga0070672_100364095
1178 Ga0070672_100540986
1179 Ga0070672_100636990
1180 Ga0070672_100796211
1181 Ga0070672_101648803
1182 Ga0070686_100446543
1183 Ga0070686_100856101
1184 Ga0070686_101555188
1185 Ga0070686_101577993
1186 Ga0070695_100279361
1187 Ga0070693_100030221
1188 Ga0070693_100111203
1189 Ga0070693_100671530
1190 Ga0070665_100073467
1191 Ga0070665_100526607
1192 Ga0070665_100806133
1193 Ga0070665_100819728
1194 Ga0070665_101247166
1195 Ga0070665_101909177
1196 Ga0070665_102106153
1197 Ga0068855_100224232
1198 Ga0070664_100175279
1199 Ga0070664_100224547
1200 Ga0070664_100533145
1201 Ga0070664_100540979
1202 Ga0070664_101200706
1203 Ga0070664_101369863
1204 Ga0070664_102074130
1205 Ga0068857_100302591
1206 Ga0068857_100771888
1207 Ga0068857_101253612
1208 Ga0068857_102213244
1209 Ga0068854_100066733
1210 Ga0068854_100111211
1211 Ga0068854_100114061
1212 Ga0068854_100129258
1213 Ga0068854_100273394
1214 Ga0068854_101407492
1215 Ga0068856_100259013
1216 Ga0068856_100793270
1217 Ga0070702_100119007
1218 Ga0070702_101699598
1219 Ga0070702_101862658
1220 Ga0068852_100030611
1221 Ga0068852_100117867
1222 Ga0068852_100141286
1223 Ga0068852_100326162
1224 Ga0068852_100328621
1225 Ga0068852_100661751
1226 Ga0068852_101191661
1227 Ga0068852_101241726
1228 Ga0068852_101462184
1229 Ga0068852_101511748
1230 Ga0068852_101694245
1231 Ga0068859_100121582
1232 Ga0068859_100238610
1233 Ga0068859_100685257
1234 Ga0068859_101688161
1235 Ga0068864_100007117
1236 Ga0068864_100032020
1237 Ga0068864_100377487
1238 Ga0068864_100380656
1239 Ga0068864_100604369
1240 Ga0068864_100673773
1241 Ga0068864_101029247
1242 Ga0068864_101794862
1243 Ga0068866_10007228
1244 Ga0068866_10195782
1245 Ga0068866_10564443
1246 Ga0068861_100000343
1247 Ga0068861_100011955
1248 Ga0068861_100321369
1249 Ga0068861_101121144
1250 Ga0068861_102572670
1251 Ga0068851_10002903
1252 Ga0068851_10010554
1253 Ga0068851_10056524
1254 Ga0068851_10133644
1255 Ga0068851_10164200
1256 Ga0068851_10193935
1257 Ga0068851_10507855
1258 Ga0068851_10812046
1259 Ga0068870_10063592
1260 Ga0068870_10118521
1261 Ga0068870_10897942
1262 Ga0068863_100065326
1263 Ga0068863_100115186
1264 Ga0068863_100130049
1265 Ga0068863_100177120
1266 Ga0068863_100413570
1267 Ga0068863_101323130
1268 Ga0068863_102318511
1269 Ga0068858_100001875
1270 Ga0068858_100005928
1271 Ga0068858_100261499
1272 Ga0068858_100652105
1273 Ga0068860_100000707
1274 Ga0068860_100000715
1275 Ga0068860_100104922
1276 Ga0068860_100189597
1277 Ga0068862_100011541
1278 Ga0068862_100014347
1279 Ga0068862_100068622
1280 Ga0068862_100415803
1281 Ga0070717_11540018
1282 Ga0075368_10088381
1283 Ga0075363_100328174
1284 Ga0070715_10096131
1285 Ga0070715_10253411
1286 Ga0070715_10931147
1287 Ga0075362_10086726
1288 Ga0075362_10277468
1289 Ga0075362_10458263
1290 Ga0075362_10545978
1291 Ga0075367_10496110
1292 Ga0075366_10170362
1293 Ga0075366_10541221
1294 Ga0075366_10607848
1295 Ga0075366_10640360
1296 Ga0075366_10779250
1297 Ga0097621_100011190
1298 Ga0097621_100044489
1299 Ga0097621_100044639
1300 Ga0097621_100093928
1301 Ga0097621_102331765
1302 Ga0068871_100020020
1303 Ga0068871_100277044
1304 Ga0068871_100373397
1305 Ga0068871_100484828
1306 Ga0068871_101751292
1307 Ga0068865_100007045
1308 Ga0068865_100024062
1309 Ga0068865_100046341
1310 Ga0068865_100092367
1311 Ga0068865_100267267
1312 Ga0097620_100121581
1313 Ga0097620_100238594
1314 Ga0097620_100685274
1315 Ga0097620_101688261
1316 Ga0075435_100172515
1317 Ga0105250_10473094
1318 Ga0105240_10055798
1319 Ga0105240_10277408
1320 Ga0105240_12534235
1321 Ga0111539_11849977
1322 Ga0105245_10064976
1323 Ga0105245_10329579
1324 Ga0105245_12341658
1325 Ga0105247_10067959
1326 Ga0105247_11447209
1327 Ga0105247_11489538
1328 Ga0114129_11646705
1329 Ga0105243_10113425
1330 Ga0105243_10132427
1331 Ga0105243_10341295
1332 Ga0105243_10870838
1333 Ga0105243_11316347
1334 Ga0105241_10371778
1335 Ga0105241_11742821
1336 Ga0105242_10305956
1337 Ga0105242_10709211
1338 Ga0105242_11118956
1339 Ga0105242_11582279
1340 Ga0105242_12948473
1341 Ga0105248_10002863
1342 Ga0105248_10059166
1343 Ga0105248_10617720
1344 Ga0105248_10714340
1345 Ga0105248_10715923
1346 Ga0105237_10000367
1347 Ga0105238_10040068
1348 Ga0105238_10401529
1349 Ga0105238_10487169
1350 Ga0105238_10940719
1351 Ga0105238_12134239
1352 Ga0105249_10089453
1353 Ga0105249_10133828
1354 Ga0105249_10631708
1355 Ga0105249_10669065
1356 Ga0105249_11228564
1357 Ga0105249_12146313
1358 Ga0105239_10000150
1359 Ga0105239_10276434
1360 Ga0105246_10352684
1361 Ga0105246_10761488
1362 Ga0105246_11093499
1363 Ga0105246_11817416
1364 Ga0157337_1038356
1365 Ga0157324_1038928
1366 Ga0157342_1031486
1367 Ga0157327_1075180
1368 Ga0157373_10025385
1369 Ga0157373_10186599
1370 Ga0157371_10072827
1371 Ga0157371_10128765
1372 Ga0157370_10185786
1373 Ga0157370_10216969
1374 Ga0157370_10808849
1375 Ga0157369_10304210
1376 Ga0157369_10473092
1377 Ga0157369_11770209
1378 Ga0157369_11993140
1379 Ga0157374_10011711
1380 Ga0157374_10167425
1381 Ga0157374_10497068
1382 Ga0157374_10866612
1383 Ga0157378_10009725
1384 Ga0157378_10128783
1385 Ga0157378_10770619
1386 Ga0157378_11235427
1387 Ga0163162_10005242
1388 Ga0163162_10033576
1389 Ga0163162_10060697
1390 Ga0163162_10087073
1391 Ga0163162_10445140
1392 Ga0163162_10771061
1393 Ga0163162_10934425
1394 Ga0163162_11106003
1395 Ga0157372_10155294
1396 Ga0157372_10324538
1397 Ga0157372_10683649
1398 Ga0157372_10688085
1399 Ga0157375_10050873
1400 Ga0157375_10075875
1401 Ga0157375_10159639
1402 Ga0157375_10234397
1403 Ga0157375_10387830
1404 Ga0157375_10496673
1405 Ga0157375_10916976
1406 Ga0157375_11111808
1407 Ga0157375_11532370
1408 Ga0157375_11561389
1409 Ga0163163_10014367
1410 Ga0163163_10529428
1411 Ga0163163_11098699
1412 Ga0163163_11138890
1413 Ga0163163_11420162
1414 Ga0163163_12367296
1415 Ga0163163_12479108
1416 Ga0157380_10011753
1417 Ga0157380_10021172
1418 Ga0157380_10061204
1419 Ga0157380_10166331
1420 Ga0157380_10281277
1421 Ga0157380_10625553
1422 Ga0157380_11209550
1423 Ga0157380_12583851
1424 Ga0157377_10017799
1425 Ga0157377_10296155
1426 Ga0157377_11613543
1427 Ga0157379_10000528
1428 Ga0157379_10034268
1429 Ga0157379_10034425
1430 Ga0157379_10376614
1431 Ga0157379_10411811
1432 Ga0157379_10809452
1433 Ga0157379_11107729
1434 Ga0157376_10014036
1435 Ga0157376_10130516
1436 Ga0157376_10199089
1437 Ga0157376_10762639
1438 Ga0157376_11214602
1439 Ga0157376_11397944
1440 Ga0182005_1053602
1441 Ga0163161_10005129
1442 Ga0163161_10085881
1443 Ga0163161_10484359
1444 Ga0163161_10830353
1445 Ga0163161_11527848
1446 Ga0163161_12049609
1447 Ga0213872_10000016
1448 Ga0213876_10055319
1449 Ga0209565_1070607
1450 Ga0209673_1027766
1451 Ga0209758_1006025
1452 Ga0209050_1001091
1453 Ga0209257_1102802
1454 Ga0207697_10096614
1455 Ga0207697_10290377
1456 Ga0207697_10296289
1457 Ga0207656_10106981
1458 Ga0207656_10138223
1459 Ga0207656_10151740
1460 Ga0207656_10156984
1461 Ga0207656_10178943
1462 Ga0207656_10211827
1463 Ga0207656_10348212
1464 Ga0207682_10000725
1465 Ga0207682_10003929
1466 Ga0207682_10028381
1467 Ga0207682_10069616
1468 Ga0207642_10006251
1469 Ga0207710_10134024
1470 Ga0207688_10022082
1471 Ga0207688_10397661
1472 Ga0207680_10012299
1473 Ga0207680_10028426
1474 Ga0207680_10175924
1475 Ga0207680_10384721
1476 Ga0207685_10010306
1477 Ga0207685_10809541
1478 Ga0207645_10017365
1479 Ga0207645_10043897
1480 Ga0207645_10044206
1481 Ga0207645_10207552
1482 Ga0207645_10880130
1483 Ga0207643_10454013
1484 Ga0207643_10924215
1485 Ga0207705_10199362
1486 Ga0207705_10276262
1487 Ga0207705_10371493
1488 Ga0207705_10623561
1489 Ga0207654_10184095
1490 Ga0207707_10315409
1491 Ga0207707_11387295
1492 Ga0207695_10123068
1493 Ga0207695_10985088
1494 Ga0207671_10000808
1495 Ga0207671_10563606
1496 Ga0207660_10050947
1497 Ga0207662_10008920
1498 Ga0207662_10391099
1499 Ga0207662_10476268
1500 Ga0207657_10590231
1501 Ga0207657_10593843
1502 Ga0207649_10003067
1503 Ga0207649_10046343
1504 Ga0207649_10331111
1505 Ga0207649_10592186
1506 Ga0207649_10679938
1507 Ga0207649_10904275
1508 Ga0207649_11135429
1509 Ga0207649_11421429
1510 Ga0207652_10003994
1511 Ga0207652_11033990
1512 Ga0207652_11362930
1513 Ga0207681_10078779
1514 Ga0207681_10128908
1515 Ga0207681_10283872
1516 Ga0207694_10037673
1517 Ga0207694_10432688
1518 Ga0207694_10698338
1519 Ga0207694_10906448
1520 Ga0207650_10000913
1521 Ga0207650_10009570
1522 Ga0207650_10033279
1523 Ga0207650_10157405
1524 Ga0207650_10301228
1525 Ga0207659_10000189
1526 Ga0207659_10028616
1527 Ga0207659_10088146
1528 Ga0207659_10098332
1529 Ga0207659_10142039
1530 Ga0207659_10521296
1531 Ga0207687_10090230
1532 Ga0207644_10018141
1533 Ga0207644_10032530
1534 Ga0207644_10040242
1535 Ga0207644_10176881
1536 Ga0207644_10363015
1537 Ga0207644_10695873
1538 Ga0207644_10893404
1539 Ga0207644_11360521
1540 Ga0207690_10180979
1541 Ga0207690_10317820
1542 Ga0207690_10977548
1543 Ga0207690_10987519
1544 Ga0207690_11633755
1545 Ga0207706_10019673
1546 Ga0207706_10046513
1547 Ga0207706_10056711
1548 Ga0207706_10249464
1549 Ga0207706_10375740
1550 Ga0207706_10557269
1551 Ga0207706_10776691
1552 Ga0207706_11333898
1553 Ga0207706_11526059
1554 Ga0207686_10057830
1555 Ga0207686_10455454
1556 Ga0207709_10249456
1557 Ga0207709_10375095
1558 Ga0207709_10941137
1559 Ga0207709_11641056
1560 Ga0207670_10420861
1561 Ga0207670_10726512
1562 Ga0207669_10251821
1563 Ga0207669_10290215
1564 Ga0207669_10355436
1565 Ga0207669_10355444
1566 Ga0207669_10356794
1567 Ga0207669_10483492
1568 Ga0207669_10722280
1569 Ga0207704_10003998
1570 Ga0207704_10051709
1571 Ga0207704_10247305
1572 Ga0207704_10463995
1573 Ga0207704_10629573
1574 Ga0207665_10067160
1575 Ga0207691_10002491
1576 Ga0207691_10022344
1577 Ga0207691_10036304
1578 Ga0207691_10046984
1579 Ga0207691_10060239
1580 Ga0207691_10064120
1581 Ga0207691_10115269
1582 Ga0207691_10276681
1583 Ga0207691_10416591
1584 Ga0207691_10538816
1585 Ga0207691_11295023
1586 Ga0207691_11332922
1587 Ga0207711_10175231
1588 Ga0207711_10199640
1589 Ga0207711_10432966
1590 Ga0207711_10905306
1591 Ga0207689_10023257
1592 Ga0207689_10030492
1593 Ga0207689_10604887
1594 Ga0207661_10025979
1595 Ga0207661_10104735
1596 Ga0207679_10294931
1597 Ga0207679_10936490
1598 Ga0207679_11172985
1599 Ga0207679_12167833
1600 Ga0207667_10238026
1601 Ga0207651_10006755
1602 Ga0207651_10036579
1603 Ga0207651_10261065
1604 Ga0207651_10384276
1605 Ga0207651_10663526
1606 Ga0207651_11726224
1607 Ga0207712_10158752
1608 Ga0207712_10365122
1609 Ga0207668_10154213
1610 Ga0207668_10239930
1611 Ga0207668_10581705
1612 Ga0207668_11032804
1613 Ga0207640_10064285
1614 Ga0207640_10106518
1615 Ga0207640_10345483
1616 Ga0207640_10464869
1617 Ga0207640_10727442
1618 Ga0207640_11092677
1619 Ga0207658_10259502
1620 Ga0207658_10356188
1621 Ga0207677_10006180
1622 Ga0207677_10008231
1623 Ga0207677_10243194
1624 Ga0207677_10249684
1625 Ga0207677_10374579
1626 Ga0207677_10576931
1627 Ga0207677_10746347
1628 Ga0207677_10865955
1629 Ga0207703_10019219
1630 Ga0207639_10168564
1631 Ga0207639_10182817
1632 Ga0207639_10393961
1633 Ga0207639_10612436
1634 Ga0207639_10765798
1635 Ga0207639_11162988
1636 Ga0207678_10098284
1637 Ga0207678_10433145
1638 Ga0207678_10809591
1639 Ga0207678_10856175
1640 Ga0207708_10033764
1641 Ga0207708_10613258
1642 Ga0207708_10623155
1643 Ga0207702_10159617
1644 Ga0207702_10629741
1645 Ga0207702_10821268
1646 Ga0207702_10900339
1647 Ga0207702_11058535
1648 Ga0207641_10102813
1649 Ga0207641_10145771
1650 Ga0207641_10243287
1651 Ga0207641_10853699
1652 Ga0207648_10001050
1653 Ga0207648_10017069
1654 Ga0207648_10020934
1655 Ga0207648_10025462
1656 Ga0207648_10038664
1657 Ga0207648_10062807
1658 Ga0207648_10077331
1659 Ga0207648_10292324
1660 Ga0207648_12067787
1661 Ga0207676_10010740
1662 Ga0207676_10012969
1663 Ga0207676_10017091
1664 Ga0207676_10112784
1665 Ga0207676_10365923
1666 Ga0207676_10714042
1667 Ga0207676_11128801
1668 Ga0207676_11427397
1669 Ga0207674_10037357
1670 Ga0207674_10284228
1671 Ga0207674_11617705
1672 Ga0207675_100009210
1673 Ga0207675_100013996
1674 Ga0207675_100017970
1675 Ga0207675_100112605
1676 Ga0207675_100174563
1677 Ga0207675_101810132
1678 Ga0207683_10040810
1679 Ga0207683_10111933
1680 Ga0207683_10126252
1681 Ga0207683_10153083
1682 Ga0207683_10218485
1683 Ga0207683_10374633
1684 Ga0207683_10386693
1685 Ga0207683_10488608
1686 Ga0207683_10488687
1687 Ga0207683_10899242
1688 Ga0207683_12163852
1689 Ga0207683_12165804
1690 Ga0207698_10208020
1691 Ga0207698_10446682
1692 Ga0207698_10505164
1693 Ga0207698_10671196
1694 Ga0207698_11049577
1695 Ga0207698_11255847
1696 Ga0207698_11448840
1697 Ga0209971_1176159
1698 Ga0209998_10190354
1699 Ga0209974_10453080
1700 Ga0268266_10186889
1701 Ga0268266_10196117
1702 Ga0268266_10415357
1703 Ga0268266_10483353
1704 Ga0268266_10588612
1705 Ga0268266_10766275
1706 Ga0268265_10130233
1707 Ga0268265_10155930
1708 Ga0268265_10302348
1709 Ga0268265_10329869
1710 Ga0268264_10010116
1711 Ga0268264_10216090
1712 Ga0268264_10430402
1713 Ga0268264_10483122
1714 Ga0307517_10219604
1715 Ga0307515_10000191
1716 Ga0307515_10204109
1717 Ga0307513_10241228
1718 Ga0307513_10866818
1719 Ga0307509_10079558
1720 Ga0307408_100087773
1721 Ga0307516_10000254
1722 Ga0307516_10031298
1723 Ga0307405_10019062
1724 Ga0307405_10231283
1725 Ga0307405_10610104
1726 Ga0307413_10038148
1727 Ga0307413_10328609
1728 Ga0307413_11204990
1729 Ga0307410_10012223
1730 Ga0307410_10099902
1731 Ga0307410_11527741
1732 Ga0307406_10022580
1733 Ga0307406_10184957
1734 Ga0307407_10033866
1735 Ga0307407_10239113
1736 Ga0307407_10313447
1737 Ga0307412_10016388
1738 Ga0307412_10274935
1739 Ga0307412_10314711
1740 Ga0307412_11516339
1741 Ga0307409_100001576
1742 Ga0307409_100300756
1743 Ga0307409_100843065
1744 Ga0307409_100939520
1745 Ga0307416_100001923
1746 Ga0307416_100076333
1747 Ga0307416_100419595
1748 Ga0307416_101245998
1749 Ga0307416_102148113
1750 Ga0307411_10009826
1751 Ga0307411_10024755
1752 Ga0307411_11067351
1753 Ga0307411_11218013
1754 Ga0307411_11313255
1755 Ga0307415_100074130
1756 Ga0373930_0076066
1757 Ga0373948_0048606
1758 Ga0373959_0091513
1759 Ga0373938_0011101
1760 Ga0373926_0070870
1761 Ga0373940_0083197
1762 Ga0373944_0010740
1763 Ga0373944_0160282
1764 Ga0373949_0024439
1765 Ga0373951_0229139
1766 Ga0373952_0077468
1767 Ga0373923_0118788
1768 Ga0373939_0411611
1769 Ga0373954_0269983
1770 Ga0373956_0036705
1771 Ga0373946_0111453
1772 Ga0373946_0162806
1773 Ga0373946_0525150
1774 Ga0373955_0214586
1775 Ga0373955_0244715
1776 Ga0373961_0160173
1777 Ga0373924_0564452
1778 Ga0373931_0004801
1779 Ga0373935_0030710
1780 Ga0373927_0439112
1781 Ga0373933_0292065
1782 Ga0373933_0383816
1783 Ga0373947_0666259
1784 Ga0373937_0161905
1785 Ga0373937_0210205
1786 Ga0373937_1129495
1787 Ga0373937_1531714
1788 Ga0373925_0004683
1789 Ga0373925_0239360
1790 Ga0373925_0295789
1791 Ga0436365_1570775
1792 Ga0436365_1878872
1793 Ga0436361_0376061
1794 Ga0436363_1315143
1795 Ga0451789_1257448
1796 Ga0451791_1178732
1797 Ga0451797_0024097
1798 Ga0451797_0182074
1799 Ga0451795_1526863
1800 Ga0451795_1640012
1801 Ga0451798_0162675
1802 Ga0451798_0537668
1803 Ga0451800_0361784
1804 Ga0451800_0425630
1805 Ga0451802_0181316
1806 Ga0451802_0227888
1807 Ga0451802_1108283
1808 Ga0451804_0420921
1809 Ga0451804_1130280
1810 Ga0451807_2633116
1811 Ga0451841_0660538
1812 Ga0451841_0913474
1813 Ga0451847_0580709
1814 Ga0451849_1316584
1815 Ga0451851_0104455
1816 Ga0451851_0279755
1817 Ga0451853_0463049
1818 Ga0451853_2526968
1819 Ga0451853_3410975
1820 Ga0439441_072363
1821 Ga0439448_0265163
1822 Ga0439456_176370
1823 Ga0450888_075937
1824 Ga0450897_015541
1825 Ga0439458_0162222
1826 Ga0439464_0019626
1827 Ga0439464_0193506
1828 Ga0439464_0212305
1829 Ga0450918_000075
1830 Ga0451577_0001353
1831 Ga0451577_1257332
1832 Ga0439440_0164943
1833 Ga0453684_0006474
1834 Ga0466968_0025097
1835 Ga0495629_0411126
1836 Ga0495580_0035100
1837 Ga0495582_0122099
1838 Ga0495662_0150853
1839 Ga0495610_0018172
1840 Ga0495620_0145710
1841 Ga0495620_0354768
1842 Ga0495628_0425675
1843 Ga0495628_1154398
1844 Ga0495632_0107252
1845 Ga0495654_0236292
1846 Ga0495640_0211526
1847 Ga0495640_0553282
1848 Ga0495586_0101742
1849 Ga0495587_0734277
1850 Ga0495598_0303288
1851 Ga0495621_0177144
1852 Ga0495621_0457265
1853 Ga0495645_0218962
1854 Ga0495645_0966754
1855 Ga0495633_0364923
1856 Ga0495656_0650507
1857 Ga0495668_0520039
1858 Ga0495611_0274090
1859 Ga0495625_0005772
1860 Ga0495635_0497593
1861 Ga0495635_0962027
1862 Ga0495623_0369829
1863 Ga0495647_0038717
1864 Ga0495647_0166447
1865 Ga0495658_0015916
1866 Ga0495658_0075446
1867 Ga0495658_0174708
1868 Ga0495658_0274123
1869 Ga0495658_0362831
1870 Ga0495658_0532797
1871 Ga0495613_0084712
1872 Ga0495613_1093267
1873 Ga0495670_0306392
1874 Ga0495676_0382241
1875 Ga0495681_0393987
1876 Ga0495684_0108451
1877 Ga0495686_0130669
1878 Ga0495615_0139808
1879 Ga0496100_0323352
1880 Ga0496100_0549204
1881 Ga0496100_0998384
1882 Ga0496101_0119392
1883 Ga0496103_0324954
1884 Ga0496104_0008841
1885 Ga0496104_0147333
1886 Ga0496104_0397604
1887 Ga0496105_0059786
1888 Ga0496105_0154988
1889 Ga0496105_0825661
1890 Ga0496106_0192393
1891 Ga0496106_0278486
1892 Ga0496107_0119919
1893 Ga0496108_0130837
1894 Ga0496108_0204984
1895 Ga0496108_1503077
1896 Ga0496109_0098011
1897 Ga0496109_0162683
1898 Ga0496109_0627133
1899 Ga0496110_0167874
1900 Ga0496110_0172128
1901 Ga0496110_0422460
1902 Ga0496111_0794761
1903 Ga0496113_0228840
1904 Ga0496114_0052168
1905 Ga0496114_0797284
1906 Ga0496114_1268649
1907 Ga0496115_0030587
1908 Ga0496115_1459923
1909 Ga0496125_0331353
1910 Ga0501079_1672772
1911 Ga0501081_0748108
1912 nmdc:mga03683_47620_c2
1913 nmdc:mga03n38_119825_c1
1914 nmdc:mga03n38_651268_c1
1915 nmdc:mga03n38_902856_c1
1916 nmdc:mga00v17_1011743_c1
1917 nmdc:mga0k408_213015_c1
1918 nmdc:mga0k408_261538_c1
1919 nmdc:mga0k408_2772_c1
1920 nmdc:mga0k408_33626_c1
1921 nmdc:mga0k408_48695_c1
1922 nmdc:mga0k408_698136_c1
1923 nmdc:mga0k408_859493_c1
1924 nmdc:mga0k408_88833_c1
1925 nmdc:mga06z11_431626_c1
1926 nmdc:mga05p37_1271046_c1
1927 nmdc:mga08y16_1323210_c1
1928 nmdc:mga08y16_369155_c1
1929 nmdc:mga0n895_103732_c1
1930 nmdc:mga0rr50_1274026_c1
1931 nmdc:mga0sz30_288303_c1
1932 Ga0495601_0024573
1933 Ga0495612_0109924
1934 Ga0495612_0420894
1935 Ga0495595_0190648
1936 Ga0495595_0406689
1937 Ga0495619_0155441
1938 Ga0500578_0000002
1939 Ga0500578_0773424
1940 Ga0500658_0012730
1941 Ga0500604_0325706
1942 Ga0500587_000275
1943 Ga0590071_000456
1944 Ga0590074_051835
1945 2587755163
1946 2643969512
1947 2644143812
1948 2644276482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09838

DUF2065

Uncharacterized protein conserved in bacteria (DUF2065)

8

62

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tdd-assembly1.cif.gz_B bam_5924 docking domain 0.7426 28 57
6tdd-assembly1.cif.gz_B bam_5924 docking domain 0.5246 28 57
8oik-assembly2.cif.gz_B d-phat domain (ntd) of human samd4a 0.4644 1 52
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.4122 6 43
8oik-assembly2.cif.gz_B d-phat domain (ntd) of human samd4a 0.3856 1 52
ID Description Score Start End Superfamily
3o3nB01 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4879 15 46 1.20.1270.370
af_F1Q9B1_426_616_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.348 7 58 1.20.1250.20
af_O45806_8_315_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.336 5 47 1.20.1070.10
af_F1Q9B1_426_616_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2919 7 58 1.20.1250.20
3o3nB01 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.2917 15 46 1.20.1270.370
ID Description Score Start End GO Terms
AF-F7YIS7-F1-model_v4 deleted 0.8481 6 59
AF-A0A1C3H6S6-F1-model_v4 Inner membrane protein YjeT (Clustered with HflC) 0.8438 6 61 GO:0016020
AF-A0A1Y5RGA7-F1-model_v4 DUF2065 domain-containing protein 0.8364 6 59 GO:0016020
AF-A0A1X4J229-F1-model_v4 DUF2065 domain-containing protein 0.8184 6 60 GO:0016020
AF-A0A225NGH8-F1-model_v4 DUF2065 domain-containing protein 0.7839 6 60 GO:0016020

Map