F487209

General Info

Members Datasets Scaffolds Average Seq Length
974 379 1948 101

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10837127|Ga0207709_108371272
Length 116
Sequence MPKRVLTGTVVSDKTDKTVVVRVERRVKHPLYGKIIKRSKKYHAHDEGNAFKEGEIVRIEETKPISKLKTWTVLGRVDSHAAPETGDEKPAKKSRAKKADAXTXXXPXAETAEAEA

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
222 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
223 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
224 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
225 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
226 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
229 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
230 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
231 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
232 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
233 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
234 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
235 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
236 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
237 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
238 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
318 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
319 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
320 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
321 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
322 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
323 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
324 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
325 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
326 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
327 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
328 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
329 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
330 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
331 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
332 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
333 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
334 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
335 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
336 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
337 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
340 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
341 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
342 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
343 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
344 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
345 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
346 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
347 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
356 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
359 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
360 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
363 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
364 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
365 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
366 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
367 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
368 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
369 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
370 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
371 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 3.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0
Rhizoplane 2.87
Rhizosphere 93.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10837127 3300025935 Bacteria 745
2 ARCol0yngRDRAFT_1001879 3300000652 Bacteria 1643
3 JGI24736J21556_1039045 3300001904 Bacteria 731
4 JGI24746J21847_1003169 3300001977 Bacteria 2589
5 JGI24747J21853_1000093 3300001978 Bacteria 3939
6 JGI24740J21852_10013756 3300001979 Bacteria 3009
7 JGI24740J21852_10014251 3300001979 Bacteria 2938
8 JGI24740J21852_10016530 3300001979 Bacteria 2665
9 JGI24740J21852_10018793 3300001979 Bacteria 2444
10 JGI24739J22299_10004701 3300001989 Bacteria 5214
11 JGI24739J22299_10017172 3300001989 Bacteria 2614
12 JGI24739J22299_10041398 3300001989 Bacteria 1533
13 JGI24737J22298_10034964 3300001990 Bacteria 1556
14 JGI24737J22298_10038364 3300001990 Bacteria 1475
15 JGI24743J22301_10001908 3300001991 Bacteria 3023
16 JGI24743J22301_10024914 3300001991 Bacteria 1157
17 JGI24750J21931_1011634 3300002070 Bacteria 1159
18 JGI24738J21930_10002011 3300002075 Bacteria 5464
19 JGI24738J21930_10009447 3300002075 Bacteria 2194
20 JGI24035J26624_1012237 3300002126 Bacteria 863
21 JGI24035J26624_1030949 3300002126 Bacteria 583
22 JGI24033J26618_1010989 3300002155 Bacteria 1073
23 JGI24751J29686_10022529 3300002459 Bacteria 1307
24 Ga0058862_12777297 3300004803 Bacteria 593
25 Ga0065704_10355948 3300005289 Bacteria 804
26 Ga0065712_10155000 3300005290 Bacteria 1341
27 Ga0065712_10505675 3300005290 Bacteria 646
28 Ga0065715_10118975 3300005293 Bacteria 2300
29 Ga0065715_10607502 3300005293 Bacteria 703
30 Ga0070658_10341661 3300005327 Bacteria 1280
31 Ga0070658_10400792 3300005327 Bacteria 1178
32 Ga0070658_10429124 3300005327 Bacteria 1137
33 Ga0070658_10737527 3300005327 Bacteria 855
34 Ga0070658_11285521 3300005327 Bacteria 635
35 Ga0070676_10010202 3300005328 Bacteria 5093
36 Ga0070676_10051799 3300005328 Bacteria 2411
37 Ga0070676_10053500 3300005328 Bacteria 2378
38 Ga0070676_10078650 3300005328 Bacteria 1995
39 Ga0070676_10579377 3300005328 Bacteria 807
40 Ga0070676_10610789 3300005328 Bacteria 787
41 Ga0070676_11491713 3300005328 Bacteria 520
42 Ga0070683_100069786 3300005329 Bacteria 3277
43 Ga0070683_100098656 3300005329 Bacteria 2749
44 Ga0070683_100353856 3300005329 Bacteria 1399
45 Ga0070683_102093677 3300005329 Bacteria 543
46 Ga0070690_100407722 3300005330 Bacteria 999
47 Ga0070690_100550912 3300005330 Bacteria 869
48 Ga0070690_100764651 3300005330 Bacteria 747
49 Ga0070670_100044177 3300005331 Bacteria 3831
50 Ga0070670_100565242 3300005331 Bacteria 1015
51 Ga0070670_100681496 3300005331 Bacteria 923
52 Ga0070677_10018552 3300005333 Bacteria 2506
53 Ga0070677_10226194 3300005333 Bacteria 916
54 Ga0070677_10267626 3300005333 Bacteria 856
55 Ga0068869_100000818 3300005334 Bacteria 17785
56 Ga0068869_100037366 3300005334 Bacteria 3452
57 Ga0070666_10189313 3300005335 Bacteria 1445
58 Ga0070666_11165924 3300005335 Bacteria 573
59 Ga0070680_100023536 3300005336 Bacteria 4913
60 Ga0070680_100118602 3300005336 Bacteria 2207
61 Ga0070682_100035504 3300005337 Bacteria 3044
62 Ga0070682_100761831 3300005337 Bacteria 782
63 Ga0070682_101041792 3300005337 Bacteria 681
64 Ga0068868_100000503 3300005338 Bacteria 26082
65 Ga0068868_101800465 3300005338 Bacteria 578
66 Ga0068868_101944680 3300005338 Bacteria 557
67 Ga0070660_100000856 3300005339 Bacteria 20282
68 Ga0070660_100068744 3300005339 Bacteria 2761
69 Ga0070660_100216064 3300005339 Bacteria 1557
70 Ga0070660_100216898 3300005339 Bacteria 1554
71 Ga0070660_100319439 3300005339 Bacteria 1275
72 Ga0070660_100391923 3300005339 Bacteria 1147
73 Ga0070660_100446603 3300005339 Bacteria 1072
74 Ga0070660_100522734 3300005339 Bacteria 988
75 Ga0070660_100820942 3300005339 Bacteria 782
76 Ga0070660_101022093 3300005339 Bacteria 699
77 Ga0070660_101370831 3300005339 Bacteria 600
78 Ga0070689_100047710 3300005340 Bacteria 3302
79 Ga0070689_100276215 3300005340 Bacteria 1392
80 Ga0070691_10387127 3300005341 Bacteria 785
81 Ga0070687_100054716 3300005343 Bacteria 2081
82 Ga0070661_100005082 3300005344 Bacteria 9075
83 Ga0070661_100175577 3300005344 Bacteria 1628
84 Ga0070661_100238517 3300005344 Bacteria 1399
85 Ga0070661_100262539 3300005344 Bacteria 1335
86 Ga0070661_100429134 3300005344 Bacteria 1049
87 Ga0070661_101550137 3300005344 Bacteria 559
88 Ga0070661_101815971 3300005344 Bacteria 517
89 Ga0070692_10845298 3300005345 Bacteria 628
90 Ga0070668_100048313 3300005347 Bacteria 3272
91 Ga0070668_100165736 3300005347 Bacteria 1795
92 Ga0070668_100172151 3300005347 Bacteria 1763
93 Ga0070668_100223211 3300005347 Bacteria 1555
94 Ga0070668_100636918 3300005347 Bacteria 936
95 Ga0070669_100000629 3300005353 Bacteria 26123
96 Ga0070669_100014400 3300005353 Bacteria 5629
97 Ga0070669_100410419 3300005353 Bacteria 1110
98 Ga0070669_100412972 3300005353 Bacteria 1106
99 Ga0070669_100801210 3300005353 Bacteria 801
100 Ga0070669_101222154 3300005353 Bacteria 649
101 Ga0070675_100324484 3300005354 Bacteria 1360
102 Ga0070675_100327789 3300005354 Bacteria 1353
103 Ga0070675_100631748 3300005354 Bacteria 972
104 Ga0070675_101151861 3300005354 Bacteria 714
105 Ga0070675_101265582 3300005354 Bacteria 679
106 Ga0070671_100052885 3300005355 Bacteria 3376
107 Ga0070671_100414389 3300005355 Bacteria 1153
108 Ga0070671_100575354 3300005355 Bacteria 972
109 Ga0070671_100689495 3300005355 Bacteria 886
110 Ga0070671_100926883 3300005355 Bacteria 761
111 Ga0070674_100083451 3300005356 Bacteria 2288
112 Ga0070674_100136408 3300005356 Bacteria 1836
113 Ga0070674_101254129 3300005356 Bacteria 660
114 Ga0070673_100061829 3300005364 Bacteria 2972
115 Ga0070673_100108285 3300005364 Bacteria 2300
116 Ga0070673_100163371 3300005364 Bacteria 1895
117 Ga0070673_100346002 3300005364 Bacteria 1318
118 Ga0070673_101148749 3300005364 Bacteria 726
119 Ga0070673_101854462 3300005364 Bacteria 571
120 Ga0070688_100709846 3300005365 Bacteria 779
121 Ga0070688_100781062 3300005365 Bacteria 745
122 Ga0070659_100000159 3300005366 Bacteria 51703
123 Ga0070659_100019777 3300005366 Bacteria 5110
124 Ga0070659_100050233 3300005366 Bacteria 3279
125 Ga0070659_100085064 3300005366 Bacteria 2529
126 Ga0070659_100180715 3300005366 Bacteria 1731
127 Ga0070659_100207119 3300005366 Bacteria 1615
128 Ga0070659_100354521 3300005366 Bacteria 1231
129 Ga0070659_100536414 3300005366 Bacteria 1000
130 Ga0070659_100599640 3300005366 Bacteria 946
131 Ga0070659_100646513 3300005366 Bacteria 911
132 Ga0070659_100906754 3300005366 Bacteria 770
133 Ga0070659_101187355 3300005366 Bacteria 674
134 Ga0070667_100122021 3300005367 Bacteria 2267
135 Ga0070667_100227080 3300005367 Bacteria 1664
136 Ga0070667_100367644 3300005367 Bacteria 1304
137 Ga0070667_100379723 3300005367 Bacteria 1283
138 Ga0070667_101004056 3300005367 Bacteria 779
139 Ga0070667_101173374 3300005367 Bacteria 718
140 Ga0070667_101604263 3300005367 Bacteria 611
141 Ga0070667_101919716 3300005367 Bacteria 557
142 Ga0070714_100056706 3300005435 Bacteria 3351
143 Ga0070714_100671559 3300005435 Bacteria 998
144 Ga0070713_100050613 3300005436 Bacteria 3432
145 Ga0070713_100069700 3300005436 Bacteria 2966
146 Ga0070713_100962767 3300005436 Bacteria 822
147 Ga0070701_10975624 3300005438 Bacteria 590
148 Ga0070700_100339671 3300005441 Bacteria 1110
149 Ga0070700_101199834 3300005441 Bacteria 634
150 Ga0070694_100137169 3300005444 Bacteria 1774
151 Ga0070694_101451177 3300005444 Bacteria 580
152 Ga0070663_100093833 3300005455 Bacteria 2227
153 Ga0070663_100116425 3300005455 Bacteria 2014
154 Ga0070663_100193102 3300005455 Bacteria 1585
155 Ga0070663_100309159 3300005455 Bacteria 1268
156 Ga0070663_100613316 3300005455 Bacteria 916
157 Ga0070663_101149239 3300005455 Bacteria 680
158 Ga0070663_101275535 3300005455 Bacteria 647
159 Ga0070678_100346739 3300005456 Bacteria 1275
160 Ga0070678_100529486 3300005456 Bacteria 1044
161 Ga0070678_100538940 3300005456 Bacteria 1035
162 Ga0070678_100873853 3300005456 Bacteria 820
163 Ga0070678_100994812 3300005456 Bacteria 770
164 Ga0070678_102264402 3300005456 Bacteria 515
165 Ga0070662_100006334 3300005457 Bacteria 7622
166 Ga0070662_100046007 3300005457 Bacteria 3134
167 Ga0070662_100131009 3300005457 Bacteria 1933
168 Ga0070662_100198282 3300005457 Bacteria 1591
169 Ga0070662_100205294 3300005457 Bacteria 1565
170 Ga0070662_100282561 3300005457 Bacteria 1344
171 Ga0070662_100365666 3300005457 Bacteria 1184
172 Ga0070662_100399094 3300005457 Bacteria 1134
173 Ga0070662_100776878 3300005457 Bacteria 813
174 Ga0070662_101334424 3300005457 Bacteria 617
175 Ga0070662_101474987 3300005457 Bacteria 586
176 Ga0070662_101479597 3300005457 Bacteria 585
177 Ga0070681_10078346 3300005458 Bacteria 3261
178 Ga0070681_10173552 3300005458 Bacteria 2077
179 Ga0070681_10185659 3300005458 Bacteria 2000
180 Ga0070681_10347110 3300005458 Bacteria 1394
181 Ga0070681_11026971 3300005458 Bacteria 745
182 Ga0070681_11417371 3300005458 Bacteria 618
183 Ga0070681_11592212 3300005458 Bacteria 578
184 Ga0068867_100073076 3300005459 Bacteria 2568
185 Ga0068867_100960524 3300005459 Bacteria 772
186 Ga0068867_101027929 3300005459 Bacteria 749
187 Ga0068867_101040081 3300005459 Bacteria 744
188 Ga0070706_100347792 3300005467 Bacteria 1382
189 Ga0070679_100021489 3300005530 Bacteria 6301
190 Ga0070679_100120024 3300005530 Bacteria 2614
191 Ga0070679_100162637 3300005530 Bacteria 2206
192 Ga0070679_100349464 3300005530 Bacteria 1426
193 Ga0070679_100539296 3300005530 Bacteria 1110
194 Ga0070679_100674267 3300005530 Bacteria 976
195 Ga0070679_101347275 3300005530 Bacteria 660
196 Ga0070679_101533503 3300005530 Bacteria 613
197 Ga0070684_100026768 3300005535 Bacteria 4861
198 Ga0070684_100521258 3300005535 Bacteria 1101
199 Ga0068853_100006563 3300005539 Bacteria 9268
200 Ga0068853_100048090 3300005539 Bacteria 3662
201 Ga0068853_100140615 3300005539 Bacteria 2167
202 Ga0068853_100332366 3300005539 Bacteria 1410
203 Ga0068853_100483502 3300005539 Bacteria 1167
204 Ga0068853_100505405 3300005539 Bacteria 1141
205 Ga0068853_100717252 3300005539 Bacteria 954
206 Ga0068853_101127849 3300005539 Bacteria 756
207 Ga0068853_101962194 3300005539 Bacteria 568
208 Ga0068853_102087437 3300005539 Bacteria 549
209 Ga0070672_100034217 3300005543 Bacteria 3855
210 Ga0070672_100163299 3300005543 Bacteria 1849
211 Ga0070672_100500162 3300005543 Bacteria 1051
212 Ga0070686_100006821 3300005544 Bacteria 6358
213 Ga0070686_100635649 3300005544 Bacteria 845
214 Ga0070686_100718227 3300005544 Bacteria 798
215 Ga0070686_101070608 3300005544 Bacteria 664
216 Ga0070696_100017763 3300005546 Bacteria 4802
217 Ga0070696_101637849 3300005546 Bacteria 553
218 Ga0070693_100377735 3300005547 Bacteria 977
219 Ga0070665_100000109 3300005548 Bacteria 155026
220 Ga0070665_100043393 3300005548 Bacteria 4519
221 Ga0070665_100206398 3300005548 Bacteria 1965
222 Ga0070665_100603624 3300005548 Bacteria 1110
223 Ga0070665_100762368 3300005548 Bacteria 981
224 Ga0070665_100984786 3300005548 Bacteria 855
225 Ga0070704_100360441 3300005549 Bacteria 1230
226 Ga0070704_100825827 3300005549 Bacteria 830
227 Ga0068855_100015141 3300005563 Bacteria 9286
228 Ga0068855_100105371 3300005563 Bacteria 3242
229 Ga0068855_100611241 3300005563 Bacteria 1174
230 Ga0070664_100009199 3300005564 Bacteria 8020
231 Ga0070664_100036985 3300005564 Bacteria 4103
232 Ga0070664_100313743 3300005564 Bacteria 1419
233 Ga0070664_100348538 3300005564 Bacteria 1346
234 Ga0070664_100523701 3300005564 Bacteria 1094
235 Ga0070664_101234403 3300005564 Bacteria 705
236 Ga0070664_101330684 3300005564 Bacteria 679
237 Ga0070664_101989273 3300005564 Bacteria 551
238 Ga0068857_100001240 3300005577 Bacteria 19917
239 Ga0068857_100081460 3300005577 Bacteria 2890
240 Ga0068857_100338640 3300005577 Bacteria 1391
241 Ga0068854_100069127 3300005578 Bacteria 2577
242 Ga0068854_100107638 3300005578 Bacteria 2099
243 Ga0068854_100178480 3300005578 Bacteria 1657
244 Ga0068854_100339428 3300005578 Bacteria 1226
245 Ga0068854_100442745 3300005578 Bacteria 1083
246 Ga0068854_100596528 3300005578 Bacteria 942
247 Ga0068854_100825706 3300005578 Bacteria 810
248 Ga0068854_101208344 3300005578 Bacteria 677
249 Ga0068854_102289180 3300005578 Bacteria 500
250 Ga0068856_100037437 3300005614 Bacteria 4760
251 Ga0068856_100197589 3300005614 Bacteria 2025
252 Ga0068856_100597663 3300005614 Bacteria 1124
253 Ga0068856_102107645 3300005614 Bacteria 573
254 Ga0068856_102149226 3300005614 Bacteria 567
255 Ga0070702_101217904 3300005615 Bacteria 608
256 Ga0068852_100050407 3300005616 Bacteria 3567
257 Ga0068852_100198305 3300005616 Bacteria 1898
258 Ga0068852_100604109 3300005616 Bacteria 1101
259 Ga0068852_100628931 3300005616 Bacteria 1079
260 Ga0068852_100664241 3300005616 Bacteria 1050
261 Ga0068852_101248002 3300005616 Bacteria 765
262 Ga0068852_101410952 3300005616 Bacteria 718
263 Ga0068852_101852917 3300005616 Bacteria 625
264 Ga0068852_102159041 3300005616 Bacteria 578
265 Ga0068859_100126053 3300005617 Bacteria 2629
266 Ga0068859_100159089 3300005617 Bacteria 2337
267 Ga0068859_101121375 3300005617 Bacteria 865
268 Ga0068864_100027151 3300005618 Bacteria 4832
269 Ga0068864_100039730 3300005618 Bacteria 4021
270 Ga0068864_100343739 3300005618 Bacteria 1406
271 Ga0068864_100405857 3300005618 Bacteria 1295
272 Ga0068864_100830304 3300005618 Bacteria 910
273 Ga0068866_10003975 3300005718 Bacteria 6068
274 Ga0068866_10052860 3300005718 Bacteria 2074
275 Ga0068866_10530988 3300005718 Bacteria 783
276 Ga0068866_11209482 3300005718 Bacteria 546
277 Ga0068861_100479359 3300005719 Bacteria 1120
278 Ga0068861_101012682 3300005719 Bacteria 793
279 Ga0068861_101247906 3300005719 Bacteria 721
280 Ga0068851_10135179 3300005834 Bacteria 1336
281 Ga0068851_10139493 3300005834 Bacteria 1317
282 Ga0068851_10827555 3300005834 Bacteria 576
283 Ga0068870_10048181 3300005840 Bacteria 2243
284 Ga0068870_10200896 3300005840 Bacteria 1209
285 Ga0068870_10226293 3300005840 Bacteria 1148
286 Ga0068870_10254201 3300005840 Bacteria 1090
287 Ga0068863_100007187 3300005841 Bacteria 10925
288 Ga0068863_100065396 3300005841 Bacteria 3440
289 Ga0068863_100107296 3300005841 Bacteria 2657
290 Ga0068863_100653954 3300005841 Bacteria 1042
291 Ga0068858_100038580 3300005842 Bacteria 4431
292 Ga0068860_100024823 3300005843 Bacteria 5789
293 Ga0068860_100055558 3300005843 Bacteria 3764
294 Ga0068860_100917028 3300005843 Bacteria 892
295 Ga0068860_100976430 3300005843 Bacteria 864
296 Ga0068860_102433548 3300005843 Bacteria 543
297 Ga0068862_100059849 3300005844 Bacteria 3271
298 Ga0068862_100740417 3300005844 Bacteria 955
299 Ga0081540_1013216 3300005983 Bacteria 5381
300 Ga0075364_10797790 3300006051 Bacteria 644
301 Ga0070712_100043947 3300006175 Bacteria 3078
302 Ga0097621_100226679 3300006237 Bacteria 1630
303 Ga0097621_101684572 3300006237 Bacteria 604
304 Ga0075370_10027199 3300006353 Bacteria 3172
305 Ga0075370_10203686 3300006353 Bacteria 1167
306 Ga0068871_100103667 3300006358 Bacteria 2385
307 Ga0068871_100903466 3300006358 Bacteria 819
308 Ga0068871_102127036 3300006358 Bacteria 535
309 Ga0075428_100554460 3300006844 Bacteria 1228
310 Ga0068865_100043424 3300006881 Bacteria 3071
311 Ga0068865_100046986 3300006881 Bacteria 2964
312 Ga0068865_100102182 3300006881 Bacteria 2100
313 Ga0097620_100126056 3300006931 Bacteria 2629
314 Ga0097620_100159093 3300006931 Bacteria 2337
315 Ga0097620_101121394 3300006931 Bacteria 865
316 Ga0105240_10748030 3300009093 Bacteria 1063
317 Ga0105240_11442723 3300009093 Bacteria 723
318 Ga0111539_10049029 3300009094 Bacteria 5039
319 Ga0105245_10016330 3300009098 Bacteria 6473
320 Ga0105247_10401966 3300009101 Bacteria 976
321 Ga0105243_10624126 3300009148 Bacteria 1041
322 Ga0105243_10771110 3300009148 Bacteria 945
323 Ga0105243_10784775 3300009148 Bacteria 937
324 Ga0105243_10871297 3300009148 Bacteria 893
325 Ga0105243_11406823 3300009148 Bacteria 718
326 Ga0105241_10550035 3300009174 Bacteria 1036
327 Ga0105241_12456592 3300009174 Bacteria 521
328 Ga0105242_10408082 3300009176 Bacteria 1270
329 Ga0105242_10513532 3300009176 Bacteria 1142
330 Ga0105242_10760144 3300009176 Bacteria 955
331 Ga0105242_13205126 3300009176 Bacteria 508
332 Ga0105242_13291482 3300009176 Bacteria 502
333 Ga0105248_10167518 3300009177 Bacteria 2476
334 Ga0105248_10290323 3300009177 Bacteria 1842
335 Ga0105237_11973270 3300009545 Bacteria 592
336 Ga0105237_12238686 3300009545 Bacteria 556
337 Ga0105238_10225832 3300009551 Bacteria 1849
338 Ga0105238_10369808 3300009551 Bacteria 1424
339 Ga0105238_11278814 3300009551 Bacteria 759
340 Ga0105249_10095687 3300009553 Bacteria 2785
341 Ga0105249_10910788 3300009553 Bacteria 946
342 Ga0105249_11264950 3300009553 Bacteria 809
343 Ga0105239_10559446 3300010375 Bacteria 1303
344 Ga0105239_10820945 3300010375 Bacteria 1066
345 Ga0105239_11107818 3300010375 Bacteria 911
346 Ga0105239_11198662 3300010375 Bacteria 875
347 Ga0105239_12061939 3300010375 Bacteria 662
348 Ga0105246_10000509 3300011119 Bacteria 21149
349 Ga0105246_10321325 3300011119 Bacteria 1258
350 Ga0105246_11900995 3300011119 Bacteria 571
351 Ga0157315_1069576 3300012508 Bacteria 514
352 Ga0157373_10005510 3300013100 Bacteria 9493
353 Ga0157373_10254455 3300013100 Bacteria 1242
354 Ga0157373_10328033 3300013100 Bacteria 1089
355 Ga0157373_10410003 3300013100 Bacteria 972
356 Ga0157373_10517864 3300013100 Bacteria 863
357 Ga0157373_10588246 3300013100 Bacteria 809
358 Ga0157373_11109641 3300013100 Bacteria 594
359 Ga0157373_11305592 3300013100 Bacteria 549
360 Ga0157373_11416179 3300013100 Bacteria 529
361 Ga0157371_10007997 3300013102 Bacteria 8472
362 Ga0157371_10166420 3300013102 Bacteria 1575
363 Ga0157371_10229047 3300013102 Bacteria 1335
364 Ga0157371_10285809 3300013102 Bacteria 1192
365 Ga0157371_10286670 3300013102 Bacteria 1190
366 Ga0157371_10928159 3300013102 Bacteria 661
367 Ga0157371_11177019 3300013102 Bacteria 590
368 Ga0157371_11265788 3300013102 Bacteria 570
369 Ga0157371_11279530 3300013102 Bacteria 567
370 Ga0157371_11336977 3300013102 Bacteria 555
371 Ga0157370_10043208 3300013104 Bacteria 4338
372 Ga0157370_10226225 3300013104 Bacteria 1732
373 Ga0157370_10423619 3300013104 Bacteria 1224
374 Ga0157370_11102801 3300013104 Bacteria 717
375 Ga0157370_11145640 3300013104 Bacteria 702
376 Ga0157370_12076679 3300013104 Bacteria 509
377 Ga0157369_10009878 3300013105 Bacteria 10902
378 Ga0157369_10292797 3300013105 Bacteria 1694
379 Ga0157369_10896778 3300013105 Bacteria 909
380 Ga0157369_12195472 3300013105 Bacteria 560
381 Ga0157374_10872881 3300013296 Bacteria 917
382 Ga0157378_10013311 3300013297 Bacteria 7192
383 Ga0163162_10941008 3300013306 Bacteria 975
384 Ga0163162_11872607 3300013306 Bacteria 686
385 Ga0157372_10053657 3300013307 Bacteria 4494
386 Ga0157372_10313469 3300013307 Bacteria 1826
387 Ga0157372_10604465 3300013307 Bacteria 1278
388 Ga0157372_10897899 3300013307 Bacteria 1028
389 Ga0157372_11661011 3300013307 Bacteria 735
390 Ga0157372_11667291 3300013307 Bacteria 734
391 Ga0157372_13171538 3300013307 Bacteria 524
392 Ga0157375_10094445 3300013308 Bacteria 3059
393 Ga0157375_10115487 3300013308 Bacteria 2787
394 Ga0157375_10195634 3300013308 Bacteria 2177
395 Ga0157375_11503823 3300013308 Bacteria 795
396 Ga0157375_12247204 3300013308 Bacteria 650
397 Ga0157375_13003000 3300013308 Bacteria 563
398 Ga0163163_11639853 3300014325 Bacteria 704
399 Ga0163163_11815037 3300014325 Bacteria 670
400 Ga0157380_10015607 3300014326 Bacteria 5584
401 Ga0157380_10486234 3300014326 Bacteria 1195
402 Ga0182008_10872208 3300014497 Bacteria 528
403 Ga0157377_10411252 3300014745 Bacteria 924
404 Ga0157377_10763675 3300014745 Bacteria 709
405 Ga0157377_11101043 3300014745 Bacteria 608
406 Ga0157379_10297109 3300014968 Bacteria 1472
407 Ga0157376_12138659 3300014969 Bacteria 598
408 Ga0157376_12540583 3300014969 Bacteria 552
409 Ga0163161_10838394 3300017792 Bacteria 775
410 Ga0163161_11113539 3300017792 Bacteria 679
411 Ga0163161_11401245 3300017792 Bacteria 610
412 Ga0213875_10002383 3300021388 Bacteria 11310
413 Ga0207673_1007893 3300025290 Bacteria 1341
414 Ga0207697_10001580 3300025315 Bacteria 12319
415 Ga0207697_10155092 3300025315 Bacteria 997
416 Ga0207656_10260033 3300025321 Bacteria 852
417 Ga0207656_10490042 3300025321 Bacteria 623
418 Ga0207682_10006590 3300025893 Bacteria 4672
419 Ga0207682_10037111 3300025893 Bacteria 1974
420 Ga0207682_10044219 3300025893 Bacteria 1825
421 Ga0207682_10079304 3300025893 Bacteria 1404
422 Ga0207642_10132110 3300025899 Bacteria 1304
423 Ga0207688_10014017 3300025901 Bacteria 4359
424 Ga0207688_10100962 3300025901 Bacteria 1666
425 Ga0207688_10238346 3300025901 Bacteria 1100
426 Ga0207680_10027292 3300025903 Bacteria 3177
427 Ga0207680_10088416 3300025903 Bacteria 1964
428 Ga0207680_10453340 3300025903 Bacteria 910
429 Ga0207647_10098634 3300025904 Bacteria 1736
430 Ga0207647_10187881 3300025904 Bacteria 1198
431 Ga0207647_10455522 3300025904 Bacteria 717
432 Ga0207699_10097684 3300025906 Bacteria 1856
433 Ga0207645_10014351 3300025907 Bacteria 5302
434 Ga0207645_10080063 3300025907 Bacteria 2094
435 Ga0207645_10119048 3300025907 Bacteria 1713
436 Ga0207645_10133680 3300025907 Bacteria 1615
437 Ga0207645_10294633 3300025907 Bacteria 1079
438 Ga0207643_10159093 3300025908 Bacteria 1358
439 Ga0207705_10010569 3300025909 Bacteria 6709
440 Ga0207705_10017991 3300025909 Bacteria 5054
441 Ga0207705_10034908 3300025909 Bacteria 3597
442 Ga0207705_10047839 3300025909 Bacteria 3076
443 Ga0207705_10135683 3300025909 Bacteria 1834
444 Ga0207705_10164590 3300025909 Bacteria 1667
445 Ga0207705_10240137 3300025909 Bacteria 1380
446 Ga0207705_10240723 3300025909 Bacteria 1378
447 Ga0207705_10267294 3300025909 Bacteria 1307
448 Ga0207705_10808515 3300025909 Bacteria 727
449 Ga0207684_10250813 3300025910 Bacteria 1527
450 Ga0207654_10288149 3300025911 Bacteria 1113
451 Ga0207654_10561040 3300025911 Bacteria 812
452 Ga0207707_10010695 3300025912 Bacteria 7973
453 Ga0207707_10015290 3300025912 Bacteria 6682
454 Ga0207707_10082443 3300025912 Bacteria 2808
455 Ga0207707_10307830 3300025912 Bacteria 1369
456 Ga0207707_10956477 3300025912 Bacteria 705
457 Ga0207695_10443933 3300025913 Bacteria 1181
458 Ga0207671_10027805 3300025914 Bacteria 4228
459 Ga0207671_10807983 3300025914 Bacteria 743
460 Ga0207693_10054041 3300025915 Bacteria 3151
461 Ga0207660_10001822 3300025917 Bacteria 14210
462 Ga0207660_10020588 3300025917 Bacteria 4429
463 Ga0207660_10109591 3300025917 Bacteria 2075
464 Ga0207660_10158879 3300025917 Bacteria 1742
465 Ga0207662_10238078 3300025918 Bacteria 1191
466 Ga0207662_10328317 3300025918 Bacteria 1023
467 Ga0207662_10772475 3300025918 Bacteria 676
468 Ga0207657_10007226 3300025919 Bacteria 11407
469 Ga0207657_10008454 3300025919 Bacteria 10441
470 Ga0207657_10161926 3300025919 Bacteria 1817
471 Ga0207657_10284535 3300025919 Bacteria 1312
472 Ga0207657_10655341 3300025919 Bacteria 817
473 Ga0207649_10025135 3300025920 Bacteria 3470
474 Ga0207649_10038123 3300025920 Bacteria 2908
475 Ga0207649_10056612 3300025920 Bacteria 2449
476 Ga0207649_10074348 3300025920 Bacteria 2180
477 Ga0207649_10302235 3300025920 Bacteria 1170
478 Ga0207649_11204670 3300025920 Bacteria 598
479 Ga0207652_10007690 3300025921 Bacteria 8666
480 Ga0207652_10020809 3300025921 Bacteria 5407
481 Ga0207652_10041841 3300025921 Bacteria 3897
482 Ga0207652_10294948 3300025921 Bacteria 1463
483 Ga0207652_10352117 3300025921 Bacteria 1329
484 Ga0207681_10001216 3300025923 Bacteria 16580
485 Ga0207681_10001410 3300025923 Bacteria 15520
486 Ga0207681_10175028 3300025923 Bacteria 1630
487 Ga0207681_10509348 3300025923 Bacteria 986
488 Ga0207681_10670728 3300025923 Bacteria 860
489 Ga0207694_10020458 3300025924 Bacteria 5007
490 Ga0207694_10150789 3300025924 Bacteria 1873
491 Ga0207650_10010619 3300025925 Bacteria 6323
492 Ga0207650_10033934 3300025925 Bacteria 3699
493 Ga0207650_10970928 3300025925 Bacteria 722
494 Ga0207650_11111693 3300025925 Bacteria 673
495 Ga0207659_10001819 3300025926 Bacteria 12629
496 Ga0207659_10186071 3300025926 Bacteria 1649
497 Ga0207659_10447937 3300025926 Bacteria 1087
498 Ga0207659_10480446 3300025926 Bacteria 1050
499 Ga0207659_10563603 3300025926 Bacteria 969
500 Ga0207659_11008156 3300025926 Bacteria 716
501 Ga0207687_10033387 3300025927 Bacteria 3491
502 Ga0207687_10097198 3300025927 Bacteria 2160
503 Ga0207700_10050620 3300025928 Bacteria 3096
504 Ga0207664_10113562 3300025929 Bacteria 2256
505 Ga0207664_11071056 3300025929 Bacteria 721
506 Ga0207644_10007126 3300025931 Bacteria 7287
507 Ga0207644_10013980 3300025931 Bacteria 5364
508 Ga0207644_10048326 3300025931 Bacteria 3041
509 Ga0207644_10322344 3300025931 Bacteria 1249
510 Ga0207644_11049824 3300025931 Bacteria 684
511 Ga0207690_10000177 3300025932 Bacteria 49108
512 Ga0207690_10000269 3300025932 Bacteria 37187
513 Ga0207690_10038277 3300025932 Bacteria 3120
514 Ga0207690_10064522 3300025932 Bacteria 2501
515 Ga0207690_10107572 3300025932 Bacteria 2003
516 Ga0207690_10255501 3300025932 Bacteria 1355
517 Ga0207690_10262224 3300025932 Bacteria 1339
518 Ga0207690_10419946 3300025932 Bacteria 1070
519 Ga0207690_10531377 3300025932 Bacteria 954
520 Ga0207690_10684231 3300025932 Bacteria 842
521 Ga0207690_11186222 3300025932 Bacteria 637
522 Ga0207690_11353127 3300025932 Bacteria 595
523 Ga0207706_10003370 3300025933 Bacteria 15282
524 Ga0207706_10018915 3300025933 Bacteria 6194
525 Ga0207706_10071843 3300025933 Bacteria 3044
526 Ga0207706_10389007 3300025933 Bacteria 1210
527 Ga0207706_10739915 3300025933 Bacteria 838
528 Ga0207686_10505483 3300025934 Bacteria 938
529 Ga0207709_10143267 3300025935 Bacteria 1645
530 Ga0207709_10421837 3300025935 Bacteria 1025
531 Ga0207709_10501609 3300025935 Bacteria 947
532 Ga0207670_10050504 3300025936 Bacteria 2788
533 Ga0207670_11273301 3300025936 Bacteria 623
534 Ga0207669_10049338 3300025937 Bacteria 2508
535 Ga0207669_10151386 3300025937 Bacteria 1625
536 Ga0207669_10259227 3300025937 Bacteria 1299
537 Ga0207669_10341408 3300025937 Bacteria 1153
538 Ga0207665_10285364 3300025939 Bacteria 1230
539 Ga0207691_10017921 3300025940 Bacteria 6710
540 Ga0207691_10065305 3300025940 Bacteria 3295
541 Ga0207691_10111073 3300025940 Bacteria 2438
542 Ga0207691_10497122 3300025940 Bacteria 1036
543 Ga0207691_11042129 3300025940 Bacteria 682
544 Ga0207711_10005245 3300025941 Bacteria 10986
545 Ga0207711_10451445 3300025941 Bacteria 1197
546 Ga0207689_10001430 3300025942 Bacteria 22793
547 Ga0207689_11642635 3300025942 Bacteria 534
548 Ga0207661_10065471 3300025944 Bacteria 2950
549 Ga0207661_10330715 3300025944 Bacteria 1371
550 Ga0207661_10746909 3300025944 Bacteria 900
551 Ga0207661_10982852 3300025944 Bacteria 777
552 Ga0207679_10000847 3300025945 Bacteria 19669
553 Ga0207679_10093962 3300025945 Bacteria 2327
554 Ga0207679_10135257 3300025945 Bacteria 1984
555 Ga0207679_10158209 3300025945 Bacteria 1852
556 Ga0207679_10178447 3300025945 Bacteria 1755
557 Ga0207679_10339989 3300025945 Bacteria 1305
558 Ga0207679_10578265 3300025945 Bacteria 1010
559 Ga0207667_10001985 3300025949 Bacteria 25649
560 Ga0207667_10011764 3300025949 Bacteria 10144
561 Ga0207667_10101780 3300025949 Bacteria 2963
562 Ga0207667_10218235 3300025949 Bacteria 1954
563 Ga0207651_10009326 3300025960 Bacteria 5363
564 Ga0207651_10048052 3300025960 Bacteria 2881
565 Ga0207651_10114630 3300025960 Bacteria 2030
566 Ga0207712_10298502 3300025961 Bacteria 1321
567 Ga0207668_10147285 3300025972 Bacteria 1818
568 Ga0207668_10843873 3300025972 Bacteria 813
569 Ga0207668_11158750 3300025972 Bacteria 694
570 Ga0207640_10278315 3300025981 Bacteria 1313
571 Ga0207640_10343662 3300025981 Bacteria 1196
572 Ga0207640_10664670 3300025981 Bacteria 889
573 Ga0207640_10761978 3300025981 Bacteria 835
574 Ga0207640_10837990 3300025981 Bacteria 799
575 Ga0207658_10061742 3300025986 Bacteria 2801
576 Ga0207658_10085128 3300025986 Bacteria 2434
577 Ga0207658_10087856 3300025986 Bacteria 2401
578 Ga0207658_10177450 3300025986 Bacteria 1760
579 Ga0207677_10000280 3300026023 Bacteria 38160
580 Ga0207677_10003619 3300026023 Bacteria 8198
581 Ga0207677_10004741 3300026023 Bacteria 7330
582 Ga0207703_10059329 3300026035 Bacteria 3125
583 Ga0207639_10000506 3300026041 Bacteria 26998
584 Ga0207639_10000546 3300026041 Bacteria 25792
585 Ga0207639_10035809 3300026041 Bacteria 3674
586 Ga0207639_10430629 3300026041 Bacteria 1194
587 Ga0207639_10686907 3300026041 Bacteria 949
588 Ga0207639_11244883 3300026041 Bacteria 698
589 Ga0207678_10018649 3300026067 Bacteria 6091
590 Ga0207678_10285641 3300026067 Bacteria 1417
591 Ga0207678_10335491 3300026067 Bacteria 1302
592 Ga0207678_10433514 3300026067 Bacteria 1141
593 Ga0207678_10781320 3300026067 Bacteria 843
594 Ga0207678_11375557 3300026067 Bacteria 624
595 Ga0207708_10078244 3300026075 Bacteria 2539
596 Ga0207702_10510906 3300026078 Bacteria 1172
597 Ga0207702_10551431 3300026078 Bacteria 1128
598 Ga0207702_12394038 3300026078 Bacteria 515
599 Ga0207641_10008723 3300026088 Bacteria 8374
600 Ga0207641_10093799 3300026088 Bacteria 2631
601 Ga0207641_10149900 3300026088 Bacteria 2111
602 Ga0207641_10533915 3300026088 Bacteria 1142
603 Ga0207648_10364114 3300026089 Bacteria 1305
604 Ga0207676_10002446 3300026095 Bacteria 13232
605 Ga0207676_10308549 3300026095 Bacteria 1447
606 Ga0207676_10319616 3300026095 Bacteria 1424
607 Ga0207676_10617797 3300026095 Bacteria 1043
608 Ga0207676_10894480 3300026095 Bacteria 870
609 Ga0207674_10082611 3300026116 Bacteria 3213
610 Ga0207674_10310449 3300026116 Bacteria 1526
611 Ga0207674_10313815 3300026116 Bacteria 1517
612 Ga0207674_10496906 3300026116 Bacteria 1179
613 Ga0207674_10514937 3300026116 Bacteria 1156
614 Ga0207674_10853581 3300026116 Bacteria 878
615 Ga0207675_100174406 3300026118 Bacteria 2057
616 Ga0207683_10083383 3300026121 Bacteria 2841
617 Ga0207683_10441725 3300026121 Bacteria 1199
618 Ga0207683_11325301 3300026121 Bacteria 666
619 Ga0207698_10004433 3300026142 Bacteria 8553
620 Ga0207698_10340172 3300026142 Bacteria 1413
621 Ga0207698_10354306 3300026142 Bacteria 1387
622 Ga0207698_10512455 3300026142 Bacteria 1169
623 Ga0207698_10852564 3300026142 Bacteria 916
624 Ga0207698_11912994 3300026142 Bacteria 608
625 Ga0209973_1011055 3300027252 Bacteria 1077
626 Ga0209996_1008647 3300027395 Bacteria 1335
627 Ga0209983_1004203 3300027665 Bacteria 3037
628 Ga0209974_10037628 3300027876 Bacteria 1607
629 Ga0209974_10099227 3300027876 Bacteria 1016
630 Ga0207428_10035157 3300027907 Bacteria 4097
631 Ga0207428_10173610 3300027907 Bacteria 1631
632 Ga0268266_10000560 3300028379 Bacteria 51866
633 Ga0268266_10042149 3300028379 Bacteria 3897
634 Ga0268266_10154292 3300028379 Bacteria 2072
635 Ga0268266_10970087 3300028379 Bacteria 822
636 Ga0268266_12129024 3300028379 Bacteria 533
637 Ga0268264_10020846 3300028381 Bacteria 5356
638 Ga0268264_10102800 3300028381 Bacteria 2487
639 Ga0268264_10263119 3300028381 Bacteria 1608
640 Ga0265334_10204119 3300028573 Bacteria 686
641 Ga0307408_100665004 3300031548 Bacteria 933
642 Ga0307405_10081478 3300031731 Bacteria 2115
643 Ga0307405_10163502 3300031731 Bacteria 1579
644 Ga0307405_10168016 3300031731 Bacteria 1561
645 Ga0307405_10934805 3300031731 Bacteria 736
646 Ga0316577_10313917 3300031733 Bacteria 889
647 Ga0307413_10006332 3300031824 Bacteria 5390
648 Ga0307413_10013663 3300031824 Bacteria 4091
649 Ga0307413_10028039 3300031824 Bacteria 3129
650 Ga0307413_10167639 3300031824 Bacteria 1550
651 Ga0307413_10317911 3300031824 Bacteria 1188
652 Ga0307413_10421458 3300031824 Bacteria 1051
653 Ga0307413_10478860 3300031824 Bacteria 994
654 Ga0307410_10024402 3300031852 Bacteria 3776
655 Ga0307410_10049651 3300031852 Bacteria 2817
656 Ga0307410_10077088 3300031852 Bacteria 2329
657 Ga0307410_10395288 3300031852 Bacteria 1115
658 Ga0307410_10634391 3300031852 Bacteria 894
659 Ga0307410_10978761 3300031852 Bacteria 728
660 Ga0307410_12080478 3300031852 Bacteria 507
661 Ga0307406_10025076 3300031901 Bacteria 3566
662 Ga0307406_10082769 3300031901 Bacteria 2138
663 Ga0307406_10961693 3300031901 Bacteria 730
664 Ga0307406_11261483 3300031901 Bacteria 644
665 Ga0307407_10052219 3300031903 Bacteria 2346
666 Ga0307407_10237933 3300031903 Bacteria 1240
667 Ga0307407_10280614 3300031903 Bacteria 1153
668 Ga0307407_10424584 3300031903 Bacteria 959
669 Ga0307407_10460872 3300031903 Bacteria 924
670 Ga0307407_10737298 3300031903 Bacteria 745
671 Ga0307407_11009296 3300031903 Bacteria 643
672 Ga0307412_10006281 3300031911 Bacteria 6709
673 Ga0307412_10007362 3300031911 Bacteria 6241
674 Ga0307412_10317908 3300031911 Bacteria 1237
675 Ga0307412_10377609 3300031911 Bacteria 1146
676 Ga0307412_10631200 3300031911 Bacteria 911
677 Ga0307412_10949935 3300031911 Bacteria 756
678 Ga0307412_11340628 3300031911 Bacteria 645
679 Ga0307412_11489718 3300031911 Bacteria 615
680 Ga0307409_100008797 3300031995 Bacteria 6155
681 Ga0307409_100213679 3300031995 Bacteria 1735
682 Ga0307409_100223784 3300031995 Bacteria 1700
683 Ga0307409_100274488 3300031995 Bacteria 1554
684 Ga0307409_100582139 3300031995 Bacteria 1103
685 Ga0307409_101078946 3300031995 Bacteria 823
686 Ga0307409_101186176 3300031995 Bacteria 786
687 Ga0307416_100033309 3300032002 Bacteria 3904
688 Ga0307416_100076982 3300032002 Bacteria 2799
689 Ga0307416_100300821 3300032002 Bacteria 1594
690 Ga0307416_100669216 3300032002 Bacteria 1124
691 Ga0307416_100819797 3300032002 Bacteria 1027
692 Ga0307416_100945398 3300032002 Bacteria 963
693 Ga0307416_102134966 3300032002 Bacteria 662
694 Ga0307416_102790282 3300032002 Bacteria 584
695 Ga0307414_10007849 3300032004 Bacteria 6018
696 Ga0307414_10066505 3300032004 Bacteria 2577
697 Ga0307414_10228529 3300032004 Bacteria 1532
698 Ga0307414_10285696 3300032004 Bacteria 1388
699 Ga0307414_10329620 3300032004 Bacteria 1302
700 Ga0307414_10665800 3300032004 Bacteria 939
701 Ga0307414_11371847 3300032004 Bacteria 656
702 Ga0307414_11914796 3300032004 Bacteria 553
703 Ga0307411_10068268 3300032005 Bacteria 2395
704 Ga0307411_10122210 3300032005 Bacteria 1886
705 Ga0307411_10214177 3300032005 Bacteria 1490
706 Ga0307411_10797295 3300032005 Bacteria 831
707 Ga0307411_11279503 3300032005 Bacteria 667
708 Ga0307411_11799666 3300032005 Bacteria 568
709 Ga0307415_100013861 3300032126 Bacteria 4719
710 Ga0307415_100021742 3300032126 Bacteria 3949
711 Ga0307415_100114402 3300032126 Bacteria 2008
712 Ga0307415_102317474 3300032126 Bacteria 527
713 Ga0316593_10451106 3300032168 Bacteria 502
714 Ga0373950_0078250 3300034818 Bacteria 687
715 Ga0373928_0016664 3300035084 Bacteria 1506
716 Ga0373957_0040331 3300035120 Bacteria 1755
717 Ga0373960_0161630 3300035121 Bacteria 771
718 Ga0373943_0563626 3300035170 Bacteria 669
719 Ga0373955_0008414 3300035172 Bacteria 4791
720 Ga0316574_0866235 3300035398 Bacteria 548
721 Ga0373937_1628249 3300036401 Bacteria 593
722 Ga0316584_0035209 3300036712 Bacteria 3715
723 Ga0395899_0007993 3300037312 Bacteria 8146
724 Ga0395899_0013946 3300037312 Bacteria 6138
725 Ga0395899_0264432 3300037312 Bacteria 1175
726 Ga0395899_0292639 3300037312 Bacteria 1104
727 Ga0395900_0083278 3300037418 Bacteria 3286
728 Ga0395900_0194851 3300037418 Bacteria 2053
729 Ga0395900_0841374 3300037418 Bacteria 843
730 Ga0395900_1074753 3300037418 Bacteria 722
731 Ga0395900_1737885 3300037418 Bacteria 534
732 Ga0395898_0025999 3300037466 Bacteria 5895
733 Ga0395898_0182566 3300037466 Bacteria 2005
734 Ga0395898_0252346 3300037466 Bacteria 1682
735 Ga0395898_0383507 3300037466 Bacteria 1340
736 Ga0395898_0704429 3300037466 Bacteria 951
737 Ga0395905_0022623 3300037471 Bacteria 5942
738 Ga0395905_0028473 3300037471 Bacteria 5267
739 Ga0395905_0090995 3300037471 Bacteria 2860
740 Ga0395905_0132278 3300037471 Bacteria 2346
741 Ga0395905_0133221 3300037471 Bacteria 2337
742 Ga0395905_0198595 3300037471 Bacteria 1880
743 Ga0395905_0418774 3300037471 Bacteria 1235
744 Ga0395905_0783940 3300037471 Bacteria 856
745 Ga0395905_1487605 3300037471 Bacteria 581
746 Ga0436364_0191800 3300037853 Bacteria 21312
747 Ga0395901_0007805 3300038443 Bacteria 10798
748 Ga0395901_0024866 3300038443 Bacteria 6147
749 Ga0395901_0061803 3300038443 Bacteria 3897
750 Ga0395901_0134888 3300038443 Bacteria 2594
751 Ga0395901_0187775 3300038443 Bacteria 2167
752 Ga0395901_0338586 3300038443 Bacteria 1554
753 Ga0395901_1436039 3300038443 Bacteria 647
754 Ga0436362_1193729 3300039453 Bacteria 1788
755 Ga0451787_459980 3300041441 Bacteria 817
756 Ga0451791_1508793 3300041451 Bacteria 1102
757 Ga0451793_1497605 3300041452 Bacteria 538
758 Ga0451802_0750262 3300041460 Bacteria 988
759 Ga0451807_1314240 3300041486 Bacteria 705
760 Ga0451807_1521528 3300041486 Bacteria 1661
761 Ga0451835_1097491 3300041492 Bacteria 706
762 Ga0439445_0056098 3300042004 Bacteria 1071
763 Ga0439448_0009707 3300042005 Bacteria 2842
764 Ga0439455_0009478 3300042012 Bacteria 2115
765 Ga0450914_001359 3300042118 Bacteria 1513
766 Ga0450890_002421 3300042127 Bacteria 2569
767 Ga0450890_063737 3300042127 Bacteria 581
768 Ga0450898_064238 3300042134 Bacteria 726
769 Ga0450903_027883 3300042138 Bacteria 858
770 Ga0450905_007522 3300042142 Bacteria 1483
771 Ga0450905_045308 3300042142 Bacteria 707
772 Ga0450889_001840 3300042144 Bacteria 2142
773 Ga0450908_055914 3300042184 Bacteria 689
774 Ga0439464_0032905 3300042439 Bacteria 1458
775 Ga0450893_0034117 3300042532 Bacteria 915
776 Ga0466964_0117948 3300044706 Bacteria 1192
777 Ga0453684_0589842 3300044712 Bacteria 1219
778 Ga0466970_0190443 3300044765 Bacteria 1139
779 Ga0466959_1045572 3300045049 Bacteria 543
780 Ga0466967_1411303 3300045976 Bacteria 693
781 Ga0495627_141469 3300046453 Bacteria 674
782 Ga0495591_146653 3300046458 Bacteria 568
783 Ga0495638_0609638 3300046460 Bacteria 535
784 Ga0495639_0091087 3300046475 Bacteria 1431
785 Ga0495584_0194524 3300046491 Bacteria 1031
786 Ga0495585_0183374 3300046492 Bacteria 1075
787 Ga0495585_0199962 3300046492 Bacteria 1018
788 Ga0495596_0068721 3300046500 Bacteria 1377
789 Ga0495620_0236348 3300046515 Bacteria 698
790 Ga0495631_0455152 3300046518 Bacteria 545
791 Ga0495643_0008456 3300046522 Bacteria 6513
792 Ga0495643_0163664 3300046522 Bacteria 1093
793 Ga0495644_0116642 3300046523 Bacteria 1015
794 Ga0495663_0011738 3300046525 Bacteria 2439
795 Ga0495663_0027571 3300046525 Bacteria 1667
796 Ga0495642_0006927 3300046528 Bacteria 4348
797 Ga0495642_0198495 3300046528 Bacteria 874
798 Ga0495598_0001912 3300046537 Bacteria 4214
799 Ga0495598_0026244 3300046537 Bacteria 1595
800 Ga0495621_0001529 3300046539 Bacteria 6017
801 Ga0495621_0024686 3300046539 Bacteria 2010
802 Ga0495633_0001763 3300046558 Bacteria 16049
803 Ga0495633_0006943 3300046558 Bacteria 6620
804 Ga0495656_0065142 3300046615 Bacteria 1602
805 Ga0495656_0142011 3300046615 Bacteria 1152
806 Ga0495668_0000015 3300046616 Bacteria 441932
807 Ga0495668_0094683 3300046616 Bacteria 1635
808 Ga0495668_0352166 3300046616 Bacteria 808
809 Ga0495611_0296615 3300046648 Bacteria 746
810 Ga0495625_0150482 3300046660 Bacteria 1565
811 Ga0495659_0209451 3300046664 Bacteria 802
812 Ga0495659_0340268 3300046664 Bacteria 639
813 Ga0495669_0109559 3300046684 Bacteria 1288
814 Ga0495669_0340880 3300046684 Bacteria 724
815 Ga0495669_0486829 3300046684 Bacteria 600
816 Ga0495670_0135285 3300046691 Bacteria 1286
817 Ga0495670_0184132 3300046691 Bacteria 1103
818 Ga0495670_0192156 3300046691 Bacteria 1079
819 Ga0495636_0034127 3300047318 Bacteria 2093
820 Ga0495636_0284058 3300047318 Bacteria 771
821 Ga0495636_0318340 3300047318 Bacteria 730
822 Ga0495687_126941 3300047443 Bacteria 910
823 Ga0495677_0013756 3300047445 Bacteria 2945
824 Ga0495677_0032597 3300047445 Bacteria 1898
825 Ga0495602_0204583 3300048088 Bacteria 1503
826 Ga0495615_0184324 3300048090 Bacteria 637
827 Ga0496100_0498983 3300048903 Bacteria 937
828 Ga0496101_0058162 3300048904 Bacteria 2798
829 Ga0496102_0073258 3300048905 Bacteria 3148
830 Ga0496103_0248535 3300048906 Bacteria 1144
831 Ga0496103_0527624 3300048906 Bacteria 754
832 Ga0496104_0233272 3300048907 Bacteria 1752
833 Ga0496105_0099456 3300048908 Bacteria 2402
834 Ga0496106_0104161 3300048909 Bacteria 2203
835 Ga0496106_1398590 3300048909 Bacteria 541
836 Ga0496107_0672454 3300048910 Bacteria 762
837 Ga0496108_0002412 3300048911 Bacteria 14934
838 Ga0496108_1311596 3300048911 Bacteria 608
839 Ga0496109_0483138 3300048912 Bacteria 1169
840 Ga0496109_1214475 3300048912 Bacteria 690
841 Ga0496109_1420993 3300048912 Bacteria 629
842 Ga0496109_1811389 3300048912 Bacteria 543
843 Ga0496110_0129769 3300048913 Bacteria 2275
844 Ga0496112_0231197 3300048915 Bacteria 1803
845 Ga0496112_0901762 3300048915 Bacteria 806
846 Ga0496113_0007329 3300048916 Bacteria 7083
847 Ga0496114_0077569 3300048917 Bacteria 2801
848 Ga0496114_0993002 3300048917 Bacteria 722
849 Ga0496118_0116184 3300048921 Bacteria 1759
850 Ga0496124_0172056 3300048927 Bacteria 1676
851 Ga0496125_0075514 3300048928 Bacteria 2608
852 Ga0496126_0085637 3300048929 Bacteria 2778
853 Ga0501306_000838 3300049127 Bacteria 2619
854 Ga0501306_026640 3300049127 Bacteria 838
855 Ga0501308_007923 3300049128 Bacteria 1124
856 Ga0501308_022943 3300049128 Bacteria 793
857 Ga0501309_023014 3300049129 Bacteria 884
858 Ga0501310_011121 3300049130 Bacteria 1015
859 Ga0501305_016359 3300049161 Bacteria 1057
860 Ga0501307_006419 3300049162 Bacteria 1270
861 Ga0501311_030381 3300049527 Bacteria 780
862 Ga0501315_022135 3300049531 Bacteria 865
863 Ga0501317_023645 3300049533 Bacteria 849
864 Ga0501317_079770 3300049533 Bacteria 565
865 Ga0501323_008029 3300049539 Bacteria 1217
866 Ga0501325_017052 3300049541 Bacteria 731
867 Ga0501331_08352 3300049547 Bacteria 627
868 Ga0501332_14767 3300049548 Bacteria 551
869 Ga0501333_010290 3300049549 Bacteria 665
870 Ga0501031_0264674 3300049568 Bacteria 1117
871 Ga0501031_0954625 3300049568 Bacteria 548
872 Ga0501033_0650681 3300049570 Bacteria 720
873 Ga0501034_0327027 3300049571 Bacteria 1465
874 Ga0501036_0515517 3300049572 Bacteria 994
875 Ga0501036_0846681 3300049572 Bacteria 752
876 Ga0501037_0431585 3300049573 Bacteria 901
877 Ga0501038_0523257 3300049574 Bacteria 905
878 Ga0501038_0962889 3300049574 Bacteria 628
879 Ga0501043_0559977 3300049579 Bacteria 848
880 Ga0501043_0682574 3300049579 Bacteria 752
881 Ga0501047_0321903 3300049581 Bacteria 1386
882 Ga0501048_0141577 3300049582 Bacteria 1701
883 Ga0501067_0558376 3300049583 Bacteria 641
884 Ga0501068_0379364 3300049584 Bacteria 910
885 Ga0501070_0762815 3300049586 Bacteria 762
886 Ga0501077_0874163 3300049593 Bacteria 578
887 Ga0501202_017564 3300049652 Bacteria 1398
888 Ga0501207_018859 3300049654 Bacteria 1088
889 Ga0501209_003930 3300049656 Bacteria 2519
890 Ga0501217_083079 3300049661 Bacteria 889
891 Ga0501223_033956 3300049663 Bacteria 992
892 Ga0501224_023162 3300049664 Bacteria 927
893 Ga0501224_036587 3300049664 Bacteria 739
894 Ga0501227_020680 3300049665 Bacteria 1512
895 Ga0501227_023780 3300049665 Bacteria 1426
896 Ga0501230_126966 3300049667 Bacteria 568
897 Ga0501233_007733 3300049668 Bacteria 2054
898 Ga0501235_011970 3300049669 Bacteria 1906
899 Ga0501235_048786 3300049669 Bacteria 978
900 Ga0501236_011992 3300049670 Bacteria 1161
901 Ga0501242_009981 3300049674 Bacteria 1129
902 Ga0501247_012855 3300049677 Bacteria 1023
903 Ga0501249_004729 3300049679 Bacteria 2773
904 Ga0501258_025909 3300049687 Bacteria 716
905 Ga0501259_030091 3300049688 Bacteria 1020
906 Ga0501221_008753 3300049704 Bacteria 1765
907 Ga0501221_062856 3300049704 Bacteria 862
908 Ga0501225_0199593 3300049705 Bacteria 634
909 Ga0501229_007666 3300049706 Bacteria 1344
910 Ga0501229_068883 3300049706 Bacteria 551
911 Ga0501234_044575 3300049707 Bacteria 730
912 Ga0501245_023887 3300049708 Bacteria 974
913 Ga0501080_0387161 3300049742 Bacteria 1259
914 Ga0501263_009652 3300049760 Bacteria 1171
915 Ga0501266_059406 3300049763 Bacteria 608
916 Ga0501268_002670 3300049765 Bacteria 2370
917 Ga0501269_030469 3300049766 Bacteria 692
918 Ga0501270_003549 3300049767 Bacteria 1692
919 Ga0501270_022303 3300049767 Bacteria 976
920 Ga0501272_004803 3300049769 Bacteria 1411
921 Ga0501273_017092 3300049770 Bacteria 955
922 Ga0501279_047942 3300049775 Bacteria 671
923 Ga0501283_024826 3300049779 Bacteria 978
924 Ga0501035_0131440 3300049822 Bacteria 2182
925 Ga0501035_0830284 3300049822 Bacteria 736
926 Ga0501044_0125511 3300049823 Bacteria 2564
927 Ga0501044_0397430 3300049823 Bacteria 1291
928 Ga0501044_0453144 3300049823 Bacteria 1189
929 Ga0501044_0708825 3300049823 Bacteria 891
930 nmdc:mga0k408_228818_c1 3300050493 Bacteria 1110
931 nmdc:mga0k408_32647_c2 3300050493 Bacteria 2605
932 nmdc:mga0k408_522685_c1 3300050493 Bacteria 702
933 nmdc:mga07m45_657375_c1 3300050496 Bacteria 604
934 nmdc:mga07m45_827549_c1 3300050496 Bacteria 530
935 nmdc:mga08y16_41479_c1 3300050511 Bacteria 4821
936 nmdc:mga08y16_464139_c1 3300050511 Bacteria 1290
937 nmdc:mga08y16_641725_c1 3300050511 Bacteria 1067
938 nmdc:mga0a205_1076465_c1 3300050515 Bacteria 651
939 nmdc:mga0sz30_451822_c1 3300050516 Bacteria 577
940 Ga0500643_000004 3300053087 Bacteria 857484
941 Ga0500646_0044762 3300053090 Bacteria 1257
942 Ga0500651_0317216 3300053093 Bacteria 891
943 Ga0500641_0143334 3300053096 Bacteria 1032
944 Ga0500594_0128169 3300053118 Bacteria 802
945 Ga0500658_0037508 3300053134 Bacteria 1928
946 Ga0500658_0280466 3300053134 Bacteria 766
947 Ga0500568_0029423 3300053139 Bacteria 2280
948 Ga0500568_0331591 3300053139 Bacteria 552
949 Ga0500573_0193356 3300053140 Bacteria 1085
950 Ga0500573_0352658 3300053140 Bacteria 714
951 Ga0500577_0351829 3300053142 Bacteria 644
952 Ga0500588_0156598 3300053146 Bacteria 827
953 Ga0500604_0000014 3300053151 Bacteria 92128
954 Ga0500604_0170103 3300053151 Bacteria 745
955 Ga0500604_0177694 3300053151 Bacteria 729
956 Ga0500616_0000591 3300053153 Bacteria 44073
957 Ga0500616_0017759 3300053153 Bacteria 4031
958 Ga0500616_0079586 3300053153 Bacteria 1650
959 Ga0500627_0000009 3300053158 Bacteria 153203
960 Ga0500611_009334 3300053727 Bacteria 1551
961 Ga0500587_009422 3300053739 Bacteria 1246
962 Ga0590075_097433 3300059424 Bacteria 765
963 Ga0587066_047644 3300059490 Bacteria 832
964 Ga0587077_052520 3300059493 Bacteria 858
965 Ga0587077_070117 3300059493 Bacteria 781
966 Ga0587077_085823 3300059493 Bacteria 731
967 Ga0587080_058462 3300059503 Bacteria 745
968 Ga0587106_052800 3300059605 Bacteria 725
969 Ga0587106_111079 3300059605 Bacteria 571
970 Ga0587101_018736 3300059623 Bacteria 973
971 Ga0587067_042667 3300059640 Bacteria 888
972 Ga0587068_026673 3300059641 Bacteria 979
973 Ga0587079_107574 3300059647 Bacteria 674
974 Ga0587071_043474 3300060344 Bacteria 908
975 Ga0207709_10837127
976 ARCol0yngRDRAFT_1001879
977 JGI24736J21556_1039045
978 JGI24746J21847_1003169
979 JGI24747J21853_1000093
980 JGI24740J21852_10013756
981 JGI24740J21852_10014251
982 JGI24740J21852_10016530
983 JGI24740J21852_10018793
984 JGI24739J22299_10004701
985 JGI24739J22299_10017172
986 JGI24739J22299_10041398
987 JGI24737J22298_10034964
988 JGI24737J22298_10038364
989 JGI24743J22301_10001908
990 JGI24743J22301_10024914
991 JGI24750J21931_1011634
992 JGI24738J21930_10002011
993 JGI24738J21930_10009447
994 JGI24035J26624_1012237
995 JGI24035J26624_1030949
996 JGI24033J26618_1010989
997 JGI24751J29686_10022529
998 Ga0058862_12777297
999 Ga0065704_10355948
1000 Ga0065712_10155000
1001 Ga0065712_10505675
1002 Ga0065715_10118975
1003 Ga0065715_10607502
1004 Ga0070658_10341661
1005 Ga0070658_10400792
1006 Ga0070658_10429124
1007 Ga0070658_10737527
1008 Ga0070658_11285521
1009 Ga0070676_10010202
1010 Ga0070676_10051799
1011 Ga0070676_10053500
1012 Ga0070676_10078650
1013 Ga0070676_10579377
1014 Ga0070676_10610789
1015 Ga0070676_11491713
1016 Ga0070683_100069786
1017 Ga0070683_100098656
1018 Ga0070683_100353856
1019 Ga0070683_102093677
1020 Ga0070690_100407722
1021 Ga0070690_100550912
1022 Ga0070690_100764651
1023 Ga0070670_100044177
1024 Ga0070670_100565242
1025 Ga0070670_100681496
1026 Ga0070677_10018552
1027 Ga0070677_10226194
1028 Ga0070677_10267626
1029 Ga0068869_100000818
1030 Ga0068869_100037366
1031 Ga0070666_10189313
1032 Ga0070666_11165924
1033 Ga0070680_100023536
1034 Ga0070680_100118602
1035 Ga0070682_100035504
1036 Ga0070682_100761831
1037 Ga0070682_101041792
1038 Ga0068868_100000503
1039 Ga0068868_101800465
1040 Ga0068868_101944680
1041 Ga0070660_100000856
1042 Ga0070660_100068744
1043 Ga0070660_100216064
1044 Ga0070660_100216898
1045 Ga0070660_100319439
1046 Ga0070660_100391923
1047 Ga0070660_100446603
1048 Ga0070660_100522734
1049 Ga0070660_100820942
1050 Ga0070660_101022093
1051 Ga0070660_101370831
1052 Ga0070689_100047710
1053 Ga0070689_100276215
1054 Ga0070691_10387127
1055 Ga0070687_100054716
1056 Ga0070661_100005082
1057 Ga0070661_100175577
1058 Ga0070661_100238517
1059 Ga0070661_100262539
1060 Ga0070661_100429134
1061 Ga0070661_101550137
1062 Ga0070661_101815971
1063 Ga0070692_10845298
1064 Ga0070668_100048313
1065 Ga0070668_100165736
1066 Ga0070668_100172151
1067 Ga0070668_100223211
1068 Ga0070668_100636918
1069 Ga0070669_100000629
1070 Ga0070669_100014400
1071 Ga0070669_100410419
1072 Ga0070669_100412972
1073 Ga0070669_100801210
1074 Ga0070669_101222154
1075 Ga0070675_100324484
1076 Ga0070675_100327789
1077 Ga0070675_100631748
1078 Ga0070675_101151861
1079 Ga0070675_101265582
1080 Ga0070671_100052885
1081 Ga0070671_100414389
1082 Ga0070671_100575354
1083 Ga0070671_100689495
1084 Ga0070671_100926883
1085 Ga0070674_100083451
1086 Ga0070674_100136408
1087 Ga0070674_101254129
1088 Ga0070673_100061829
1089 Ga0070673_100108285
1090 Ga0070673_100163371
1091 Ga0070673_100346002
1092 Ga0070673_101148749
1093 Ga0070673_101854462
1094 Ga0070688_100709846
1095 Ga0070688_100781062
1096 Ga0070659_100000159
1097 Ga0070659_100019777
1098 Ga0070659_100050233
1099 Ga0070659_100085064
1100 Ga0070659_100180715
1101 Ga0070659_100207119
1102 Ga0070659_100354521
1103 Ga0070659_100536414
1104 Ga0070659_100599640
1105 Ga0070659_100646513
1106 Ga0070659_100906754
1107 Ga0070659_101187355
1108 Ga0070667_100122021
1109 Ga0070667_100227080
1110 Ga0070667_100367644
1111 Ga0070667_100379723
1112 Ga0070667_101004056
1113 Ga0070667_101173374
1114 Ga0070667_101604263
1115 Ga0070667_101919716
1116 Ga0070714_100056706
1117 Ga0070714_100671559
1118 Ga0070713_100050613
1119 Ga0070713_100069700
1120 Ga0070713_100962767
1121 Ga0070701_10975624
1122 Ga0070700_100339671
1123 Ga0070700_101199834
1124 Ga0070694_100137169
1125 Ga0070694_101451177
1126 Ga0070663_100093833
1127 Ga0070663_100116425
1128 Ga0070663_100193102
1129 Ga0070663_100309159
1130 Ga0070663_100613316
1131 Ga0070663_101149239
1132 Ga0070663_101275535
1133 Ga0070678_100346739
1134 Ga0070678_100529486
1135 Ga0070678_100538940
1136 Ga0070678_100873853
1137 Ga0070678_100994812
1138 Ga0070678_102264402
1139 Ga0070662_100006334
1140 Ga0070662_100046007
1141 Ga0070662_100131009
1142 Ga0070662_100198282
1143 Ga0070662_100205294
1144 Ga0070662_100282561
1145 Ga0070662_100365666
1146 Ga0070662_100399094
1147 Ga0070662_100776878
1148 Ga0070662_101334424
1149 Ga0070662_101474987
1150 Ga0070662_101479597
1151 Ga0070681_10078346
1152 Ga0070681_10173552
1153 Ga0070681_10185659
1154 Ga0070681_10347110
1155 Ga0070681_11026971
1156 Ga0070681_11417371
1157 Ga0070681_11592212
1158 Ga0068867_100073076
1159 Ga0068867_100960524
1160 Ga0068867_101027929
1161 Ga0068867_101040081
1162 Ga0070706_100347792
1163 Ga0070679_100021489
1164 Ga0070679_100120024
1165 Ga0070679_100162637
1166 Ga0070679_100349464
1167 Ga0070679_100539296
1168 Ga0070679_100674267
1169 Ga0070679_101347275
1170 Ga0070679_101533503
1171 Ga0070684_100026768
1172 Ga0070684_100521258
1173 Ga0068853_100006563
1174 Ga0068853_100048090
1175 Ga0068853_100140615
1176 Ga0068853_100332366
1177 Ga0068853_100483502
1178 Ga0068853_100505405
1179 Ga0068853_100717252
1180 Ga0068853_101127849
1181 Ga0068853_101962194
1182 Ga0068853_102087437
1183 Ga0070672_100034217
1184 Ga0070672_100163299
1185 Ga0070672_100500162
1186 Ga0070686_100006821
1187 Ga0070686_100635649
1188 Ga0070686_100718227
1189 Ga0070686_101070608
1190 Ga0070696_100017763
1191 Ga0070696_101637849
1192 Ga0070693_100377735
1193 Ga0070665_100000109
1194 Ga0070665_100043393
1195 Ga0070665_100206398
1196 Ga0070665_100603624
1197 Ga0070665_100762368
1198 Ga0070665_100984786
1199 Ga0070704_100360441
1200 Ga0070704_100825827
1201 Ga0068855_100015141
1202 Ga0068855_100105371
1203 Ga0068855_100611241
1204 Ga0070664_100009199
1205 Ga0070664_100036985
1206 Ga0070664_100313743
1207 Ga0070664_100348538
1208 Ga0070664_100523701
1209 Ga0070664_101234403
1210 Ga0070664_101330684
1211 Ga0070664_101989273
1212 Ga0068857_100001240
1213 Ga0068857_100081460
1214 Ga0068857_100338640
1215 Ga0068854_100069127
1216 Ga0068854_100107638
1217 Ga0068854_100178480
1218 Ga0068854_100339428
1219 Ga0068854_100442745
1220 Ga0068854_100596528
1221 Ga0068854_100825706
1222 Ga0068854_101208344
1223 Ga0068854_102289180
1224 Ga0068856_100037437
1225 Ga0068856_100197589
1226 Ga0068856_100597663
1227 Ga0068856_102107645
1228 Ga0068856_102149226
1229 Ga0070702_101217904
1230 Ga0068852_100050407
1231 Ga0068852_100198305
1232 Ga0068852_100604109
1233 Ga0068852_100628931
1234 Ga0068852_100664241
1235 Ga0068852_101248002
1236 Ga0068852_101410952
1237 Ga0068852_101852917
1238 Ga0068852_102159041
1239 Ga0068859_100126053
1240 Ga0068859_100159089
1241 Ga0068859_101121375
1242 Ga0068864_100027151
1243 Ga0068864_100039730
1244 Ga0068864_100343739
1245 Ga0068864_100405857
1246 Ga0068864_100830304
1247 Ga0068866_10003975
1248 Ga0068866_10052860
1249 Ga0068866_10530988
1250 Ga0068866_11209482
1251 Ga0068861_100479359
1252 Ga0068861_101012682
1253 Ga0068861_101247906
1254 Ga0068851_10135179
1255 Ga0068851_10139493
1256 Ga0068851_10827555
1257 Ga0068870_10048181
1258 Ga0068870_10200896
1259 Ga0068870_10226293
1260 Ga0068870_10254201
1261 Ga0068863_100007187
1262 Ga0068863_100065396
1263 Ga0068863_100107296
1264 Ga0068863_100653954
1265 Ga0068858_100038580
1266 Ga0068860_100024823
1267 Ga0068860_100055558
1268 Ga0068860_100917028
1269 Ga0068860_100976430
1270 Ga0068860_102433548
1271 Ga0068862_100059849
1272 Ga0068862_100740417
1273 Ga0081540_1013216
1274 Ga0075364_10797790
1275 Ga0070712_100043947
1276 Ga0097621_100226679
1277 Ga0097621_101684572
1278 Ga0075370_10027199
1279 Ga0075370_10203686
1280 Ga0068871_100103667
1281 Ga0068871_100903466
1282 Ga0068871_102127036
1283 Ga0075428_100554460
1284 Ga0068865_100043424
1285 Ga0068865_100046986
1286 Ga0068865_100102182
1287 Ga0097620_100126056
1288 Ga0097620_100159093
1289 Ga0097620_101121394
1290 Ga0105240_10748030
1291 Ga0105240_11442723
1292 Ga0111539_10049029
1293 Ga0105245_10016330
1294 Ga0105247_10401966
1295 Ga0105243_10624126
1296 Ga0105243_10771110
1297 Ga0105243_10784775
1298 Ga0105243_10871297
1299 Ga0105243_11406823
1300 Ga0105241_10550035
1301 Ga0105241_12456592
1302 Ga0105242_10408082
1303 Ga0105242_10513532
1304 Ga0105242_10760144
1305 Ga0105242_13205126
1306 Ga0105242_13291482
1307 Ga0105248_10167518
1308 Ga0105248_10290323
1309 Ga0105237_11973270
1310 Ga0105237_12238686
1311 Ga0105238_10225832
1312 Ga0105238_10369808
1313 Ga0105238_11278814
1314 Ga0105249_10095687
1315 Ga0105249_10910788
1316 Ga0105249_11264950
1317 Ga0105239_10559446
1318 Ga0105239_10820945
1319 Ga0105239_11107818
1320 Ga0105239_11198662
1321 Ga0105239_12061939
1322 Ga0105246_10000509
1323 Ga0105246_10321325
1324 Ga0105246_11900995
1325 Ga0157315_1069576
1326 Ga0157373_10005510
1327 Ga0157373_10254455
1328 Ga0157373_10328033
1329 Ga0157373_10410003
1330 Ga0157373_10517864
1331 Ga0157373_10588246
1332 Ga0157373_11109641
1333 Ga0157373_11305592
1334 Ga0157373_11416179
1335 Ga0157371_10007997
1336 Ga0157371_10166420
1337 Ga0157371_10229047
1338 Ga0157371_10285809
1339 Ga0157371_10286670
1340 Ga0157371_10928159
1341 Ga0157371_11177019
1342 Ga0157371_11265788
1343 Ga0157371_11279530
1344 Ga0157371_11336977
1345 Ga0157370_10043208
1346 Ga0157370_10226225
1347 Ga0157370_10423619
1348 Ga0157370_11102801
1349 Ga0157370_11145640
1350 Ga0157370_12076679
1351 Ga0157369_10009878
1352 Ga0157369_10292797
1353 Ga0157369_10896778
1354 Ga0157369_12195472
1355 Ga0157374_10872881
1356 Ga0157378_10013311
1357 Ga0163162_10941008
1358 Ga0163162_11872607
1359 Ga0157372_10053657
1360 Ga0157372_10313469
1361 Ga0157372_10604465
1362 Ga0157372_10897899
1363 Ga0157372_11661011
1364 Ga0157372_11667291
1365 Ga0157372_13171538
1366 Ga0157375_10094445
1367 Ga0157375_10115487
1368 Ga0157375_10195634
1369 Ga0157375_11503823
1370 Ga0157375_12247204
1371 Ga0157375_13003000
1372 Ga0163163_11639853
1373 Ga0163163_11815037
1374 Ga0157380_10015607
1375 Ga0157380_10486234
1376 Ga0182008_10872208
1377 Ga0157377_10411252
1378 Ga0157377_10763675
1379 Ga0157377_11101043
1380 Ga0157379_10297109
1381 Ga0157376_12138659
1382 Ga0157376_12540583
1383 Ga0163161_10838394
1384 Ga0163161_11113539
1385 Ga0163161_11401245
1386 Ga0213875_10002383
1387 Ga0207673_1007893
1388 Ga0207697_10001580
1389 Ga0207697_10155092
1390 Ga0207656_10260033
1391 Ga0207656_10490042
1392 Ga0207682_10006590
1393 Ga0207682_10037111
1394 Ga0207682_10044219
1395 Ga0207682_10079304
1396 Ga0207642_10132110
1397 Ga0207688_10014017
1398 Ga0207688_10100962
1399 Ga0207688_10238346
1400 Ga0207680_10027292
1401 Ga0207680_10088416
1402 Ga0207680_10453340
1403 Ga0207647_10098634
1404 Ga0207647_10187881
1405 Ga0207647_10455522
1406 Ga0207699_10097684
1407 Ga0207645_10014351
1408 Ga0207645_10080063
1409 Ga0207645_10119048
1410 Ga0207645_10133680
1411 Ga0207645_10294633
1412 Ga0207643_10159093
1413 Ga0207705_10010569
1414 Ga0207705_10017991
1415 Ga0207705_10034908
1416 Ga0207705_10047839
1417 Ga0207705_10135683
1418 Ga0207705_10164590
1419 Ga0207705_10240137
1420 Ga0207705_10240723
1421 Ga0207705_10267294
1422 Ga0207705_10808515
1423 Ga0207684_10250813
1424 Ga0207654_10288149
1425 Ga0207654_10561040
1426 Ga0207707_10010695
1427 Ga0207707_10015290
1428 Ga0207707_10082443
1429 Ga0207707_10307830
1430 Ga0207707_10956477
1431 Ga0207695_10443933
1432 Ga0207671_10027805
1433 Ga0207671_10807983
1434 Ga0207693_10054041
1435 Ga0207660_10001822
1436 Ga0207660_10020588
1437 Ga0207660_10109591
1438 Ga0207660_10158879
1439 Ga0207662_10238078
1440 Ga0207662_10328317
1441 Ga0207662_10772475
1442 Ga0207657_10007226
1443 Ga0207657_10008454
1444 Ga0207657_10161926
1445 Ga0207657_10284535
1446 Ga0207657_10655341
1447 Ga0207649_10025135
1448 Ga0207649_10038123
1449 Ga0207649_10056612
1450 Ga0207649_10074348
1451 Ga0207649_10302235
1452 Ga0207649_11204670
1453 Ga0207652_10007690
1454 Ga0207652_10020809
1455 Ga0207652_10041841
1456 Ga0207652_10294948
1457 Ga0207652_10352117
1458 Ga0207681_10001216
1459 Ga0207681_10001410
1460 Ga0207681_10175028
1461 Ga0207681_10509348
1462 Ga0207681_10670728
1463 Ga0207694_10020458
1464 Ga0207694_10150789
1465 Ga0207650_10010619
1466 Ga0207650_10033934
1467 Ga0207650_10970928
1468 Ga0207650_11111693
1469 Ga0207659_10001819
1470 Ga0207659_10186071
1471 Ga0207659_10447937
1472 Ga0207659_10480446
1473 Ga0207659_10563603
1474 Ga0207659_11008156
1475 Ga0207687_10033387
1476 Ga0207687_10097198
1477 Ga0207700_10050620
1478 Ga0207664_10113562
1479 Ga0207664_11071056
1480 Ga0207644_10007126
1481 Ga0207644_10013980
1482 Ga0207644_10048326
1483 Ga0207644_10322344
1484 Ga0207644_11049824
1485 Ga0207690_10000177
1486 Ga0207690_10000269
1487 Ga0207690_10038277
1488 Ga0207690_10064522
1489 Ga0207690_10107572
1490 Ga0207690_10255501
1491 Ga0207690_10262224
1492 Ga0207690_10419946
1493 Ga0207690_10531377
1494 Ga0207690_10684231
1495 Ga0207690_11186222
1496 Ga0207690_11353127
1497 Ga0207706_10003370
1498 Ga0207706_10018915
1499 Ga0207706_10071843
1500 Ga0207706_10389007
1501 Ga0207706_10739915
1502 Ga0207686_10505483
1503 Ga0207709_10143267
1504 Ga0207709_10421837
1505 Ga0207709_10501609
1506 Ga0207670_10050504
1507 Ga0207670_11273301
1508 Ga0207669_10049338
1509 Ga0207669_10151386
1510 Ga0207669_10259227
1511 Ga0207669_10341408
1512 Ga0207665_10285364
1513 Ga0207691_10017921
1514 Ga0207691_10065305
1515 Ga0207691_10111073
1516 Ga0207691_10497122
1517 Ga0207691_11042129
1518 Ga0207711_10005245
1519 Ga0207711_10451445
1520 Ga0207689_10001430
1521 Ga0207689_11642635
1522 Ga0207661_10065471
1523 Ga0207661_10330715
1524 Ga0207661_10746909
1525 Ga0207661_10982852
1526 Ga0207679_10000847
1527 Ga0207679_10093962
1528 Ga0207679_10135257
1529 Ga0207679_10158209
1530 Ga0207679_10178447
1531 Ga0207679_10339989
1532 Ga0207679_10578265
1533 Ga0207667_10001985
1534 Ga0207667_10011764
1535 Ga0207667_10101780
1536 Ga0207667_10218235
1537 Ga0207651_10009326
1538 Ga0207651_10048052
1539 Ga0207651_10114630
1540 Ga0207712_10298502
1541 Ga0207668_10147285
1542 Ga0207668_10843873
1543 Ga0207668_11158750
1544 Ga0207640_10278315
1545 Ga0207640_10343662
1546 Ga0207640_10664670
1547 Ga0207640_10761978
1548 Ga0207640_10837990
1549 Ga0207658_10061742
1550 Ga0207658_10085128
1551 Ga0207658_10087856
1552 Ga0207658_10177450
1553 Ga0207677_10000280
1554 Ga0207677_10003619
1555 Ga0207677_10004741
1556 Ga0207703_10059329
1557 Ga0207639_10000506
1558 Ga0207639_10000546
1559 Ga0207639_10035809
1560 Ga0207639_10430629
1561 Ga0207639_10686907
1562 Ga0207639_11244883
1563 Ga0207678_10018649
1564 Ga0207678_10285641
1565 Ga0207678_10335491
1566 Ga0207678_10433514
1567 Ga0207678_10781320
1568 Ga0207678_11375557
1569 Ga0207708_10078244
1570 Ga0207702_10510906
1571 Ga0207702_10551431
1572 Ga0207702_12394038
1573 Ga0207641_10008723
1574 Ga0207641_10093799
1575 Ga0207641_10149900
1576 Ga0207641_10533915
1577 Ga0207648_10364114
1578 Ga0207676_10002446
1579 Ga0207676_10308549
1580 Ga0207676_10319616
1581 Ga0207676_10617797
1582 Ga0207676_10894480
1583 Ga0207674_10082611
1584 Ga0207674_10310449
1585 Ga0207674_10313815
1586 Ga0207674_10496906
1587 Ga0207674_10514937
1588 Ga0207674_10853581
1589 Ga0207675_100174406
1590 Ga0207683_10083383
1591 Ga0207683_10441725
1592 Ga0207683_11325301
1593 Ga0207698_10004433
1594 Ga0207698_10340172
1595 Ga0207698_10354306
1596 Ga0207698_10512455
1597 Ga0207698_10852564
1598 Ga0207698_11912994
1599 Ga0209973_1011055
1600 Ga0209996_1008647
1601 Ga0209983_1004203
1602 Ga0209974_10037628
1603 Ga0209974_10099227
1604 Ga0207428_10035157
1605 Ga0207428_10173610
1606 Ga0268266_10000560
1607 Ga0268266_10042149
1608 Ga0268266_10154292
1609 Ga0268266_10970087
1610 Ga0268266_12129024
1611 Ga0268264_10020846
1612 Ga0268264_10102800
1613 Ga0268264_10263119
1614 Ga0265334_10204119
1615 Ga0307408_100665004
1616 Ga0307405_10081478
1617 Ga0307405_10163502
1618 Ga0307405_10168016
1619 Ga0307405_10934805
1620 Ga0316577_10313917
1621 Ga0307413_10006332
1622 Ga0307413_10013663
1623 Ga0307413_10028039
1624 Ga0307413_10167639
1625 Ga0307413_10317911
1626 Ga0307413_10421458
1627 Ga0307413_10478860
1628 Ga0307410_10024402
1629 Ga0307410_10049651
1630 Ga0307410_10077088
1631 Ga0307410_10395288
1632 Ga0307410_10634391
1633 Ga0307410_10978761
1634 Ga0307410_12080478
1635 Ga0307406_10025076
1636 Ga0307406_10082769
1637 Ga0307406_10961693
1638 Ga0307406_11261483
1639 Ga0307407_10052219
1640 Ga0307407_10237933
1641 Ga0307407_10280614
1642 Ga0307407_10424584
1643 Ga0307407_10460872
1644 Ga0307407_10737298
1645 Ga0307407_11009296
1646 Ga0307412_10006281
1647 Ga0307412_10007362
1648 Ga0307412_10317908
1649 Ga0307412_10377609
1650 Ga0307412_10631200
1651 Ga0307412_10949935
1652 Ga0307412_11340628
1653 Ga0307412_11489718
1654 Ga0307409_100008797
1655 Ga0307409_100213679
1656 Ga0307409_100223784
1657 Ga0307409_100274488
1658 Ga0307409_100582139
1659 Ga0307409_101078946
1660 Ga0307409_101186176
1661 Ga0307416_100033309
1662 Ga0307416_100076982
1663 Ga0307416_100300821
1664 Ga0307416_100669216
1665 Ga0307416_100819797
1666 Ga0307416_100945398
1667 Ga0307416_102134966
1668 Ga0307416_102790282
1669 Ga0307414_10007849
1670 Ga0307414_10066505
1671 Ga0307414_10228529
1672 Ga0307414_10285696
1673 Ga0307414_10329620
1674 Ga0307414_10665800
1675 Ga0307414_11371847
1676 Ga0307414_11914796
1677 Ga0307411_10068268
1678 Ga0307411_10122210
1679 Ga0307411_10214177
1680 Ga0307411_10797295
1681 Ga0307411_11279503
1682 Ga0307411_11799666
1683 Ga0307415_100013861
1684 Ga0307415_100021742
1685 Ga0307415_100114402
1686 Ga0307415_102317474
1687 Ga0316593_10451106
1688 Ga0373950_0078250
1689 Ga0373928_0016664
1690 Ga0373957_0040331
1691 Ga0373960_0161630
1692 Ga0373943_0563626
1693 Ga0373955_0008414
1694 Ga0316574_0866235
1695 Ga0373937_1628249
1696 Ga0316584_0035209
1697 Ga0395899_0007993
1698 Ga0395899_0013946
1699 Ga0395899_0264432
1700 Ga0395899_0292639
1701 Ga0395900_0083278
1702 Ga0395900_0194851
1703 Ga0395900_0841374
1704 Ga0395900_1074753
1705 Ga0395900_1737885
1706 Ga0395898_0025999
1707 Ga0395898_0182566
1708 Ga0395898_0252346
1709 Ga0395898_0383507
1710 Ga0395898_0704429
1711 Ga0395905_0022623
1712 Ga0395905_0028473
1713 Ga0395905_0090995
1714 Ga0395905_0132278
1715 Ga0395905_0133221
1716 Ga0395905_0198595
1717 Ga0395905_0418774
1718 Ga0395905_0783940
1719 Ga0395905_1487605
1720 Ga0436364_0191800
1721 Ga0395901_0007805
1722 Ga0395901_0024866
1723 Ga0395901_0061803
1724 Ga0395901_0134888
1725 Ga0395901_0187775
1726 Ga0395901_0338586
1727 Ga0395901_1436039
1728 Ga0436362_1193729
1729 Ga0451787_459980
1730 Ga0451791_1508793
1731 Ga0451793_1497605
1732 Ga0451802_0750262
1733 Ga0451807_1314240
1734 Ga0451807_1521528
1735 Ga0451835_1097491
1736 Ga0439445_0056098
1737 Ga0439448_0009707
1738 Ga0439455_0009478
1739 Ga0450914_001359
1740 Ga0450890_002421
1741 Ga0450890_063737
1742 Ga0450898_064238
1743 Ga0450903_027883
1744 Ga0450905_007522
1745 Ga0450905_045308
1746 Ga0450889_001840
1747 Ga0450908_055914
1748 Ga0439464_0032905
1749 Ga0450893_0034117
1750 Ga0466964_0117948
1751 Ga0453684_0589842
1752 Ga0466970_0190443
1753 Ga0466959_1045572
1754 Ga0466967_1411303
1755 Ga0495627_141469
1756 Ga0495591_146653
1757 Ga0495638_0609638
1758 Ga0495639_0091087
1759 Ga0495584_0194524
1760 Ga0495585_0183374
1761 Ga0495585_0199962
1762 Ga0495596_0068721
1763 Ga0495620_0236348
1764 Ga0495631_0455152
1765 Ga0495643_0008456
1766 Ga0495643_0163664
1767 Ga0495644_0116642
1768 Ga0495663_0011738
1769 Ga0495663_0027571
1770 Ga0495642_0006927
1771 Ga0495642_0198495
1772 Ga0495598_0001912
1773 Ga0495598_0026244
1774 Ga0495621_0001529
1775 Ga0495621_0024686
1776 Ga0495633_0001763
1777 Ga0495633_0006943
1778 Ga0495656_0065142
1779 Ga0495656_0142011
1780 Ga0495668_0000015
1781 Ga0495668_0094683
1782 Ga0495668_0352166
1783 Ga0495611_0296615
1784 Ga0495625_0150482
1785 Ga0495659_0209451
1786 Ga0495659_0340268
1787 Ga0495669_0109559
1788 Ga0495669_0340880
1789 Ga0495669_0486829
1790 Ga0495670_0135285
1791 Ga0495670_0184132
1792 Ga0495670_0192156
1793 Ga0495636_0034127
1794 Ga0495636_0284058
1795 Ga0495636_0318340
1796 Ga0495687_126941
1797 Ga0495677_0013756
1798 Ga0495677_0032597
1799 Ga0495602_0204583
1800 Ga0495615_0184324
1801 Ga0496100_0498983
1802 Ga0496101_0058162
1803 Ga0496102_0073258
1804 Ga0496103_0248535
1805 Ga0496103_0527624
1806 Ga0496104_0233272
1807 Ga0496105_0099456
1808 Ga0496106_0104161
1809 Ga0496106_1398590
1810 Ga0496107_0672454
1811 Ga0496108_0002412
1812 Ga0496108_1311596
1813 Ga0496109_0483138
1814 Ga0496109_1214475
1815 Ga0496109_1420993
1816 Ga0496109_1811389
1817 Ga0496110_0129769
1818 Ga0496112_0231197
1819 Ga0496112_0901762
1820 Ga0496113_0007329
1821 Ga0496114_0077569
1822 Ga0496114_0993002
1823 Ga0496118_0116184
1824 Ga0496124_0172056
1825 Ga0496125_0075514
1826 Ga0496126_0085637
1827 Ga0501306_000838
1828 Ga0501306_026640
1829 Ga0501308_007923
1830 Ga0501308_022943
1831 Ga0501309_023014
1832 Ga0501310_011121
1833 Ga0501305_016359
1834 Ga0501307_006419
1835 Ga0501311_030381
1836 Ga0501315_022135
1837 Ga0501317_023645
1838 Ga0501317_079770
1839 Ga0501323_008029
1840 Ga0501325_017052
1841 Ga0501331_08352
1842 Ga0501332_14767
1843 Ga0501333_010290
1844 Ga0501031_0264674
1845 Ga0501031_0954625
1846 Ga0501033_0650681
1847 Ga0501034_0327027
1848 Ga0501036_0515517
1849 Ga0501036_0846681
1850 Ga0501037_0431585
1851 Ga0501038_0523257
1852 Ga0501038_0962889
1853 Ga0501043_0559977
1854 Ga0501043_0682574
1855 Ga0501047_0321903
1856 Ga0501048_0141577
1857 Ga0501067_0558376
1858 Ga0501068_0379364
1859 Ga0501070_0762815
1860 Ga0501077_0874163
1861 Ga0501202_017564
1862 Ga0501207_018859
1863 Ga0501209_003930
1864 Ga0501217_083079
1865 Ga0501223_033956
1866 Ga0501224_023162
1867 Ga0501224_036587
1868 Ga0501227_020680
1869 Ga0501227_023780
1870 Ga0501230_126966
1871 Ga0501233_007733
1872 Ga0501235_011970
1873 Ga0501235_048786
1874 Ga0501236_011992
1875 Ga0501242_009981
1876 Ga0501247_012855
1877 Ga0501249_004729
1878 Ga0501258_025909
1879 Ga0501259_030091
1880 Ga0501221_008753
1881 Ga0501221_062856
1882 Ga0501225_0199593
1883 Ga0501229_007666
1884 Ga0501229_068883
1885 Ga0501234_044575
1886 Ga0501245_023887
1887 Ga0501080_0387161
1888 Ga0501263_009652
1889 Ga0501266_059406
1890 Ga0501268_002670
1891 Ga0501269_030469
1892 Ga0501270_003549
1893 Ga0501270_022303
1894 Ga0501272_004803
1895 Ga0501273_017092
1896 Ga0501279_047942
1897 Ga0501283_024826
1898 Ga0501035_0131440
1899 Ga0501035_0830284
1900 Ga0501044_0125511
1901 Ga0501044_0397430
1902 Ga0501044_0453144
1903 Ga0501044_0708825
1904 nmdc:mga0k408_228818_c1
1905 nmdc:mga0k408_32647_c2
1906 nmdc:mga0k408_522685_c1
1907 nmdc:mga07m45_657375_c1
1908 nmdc:mga07m45_827549_c1
1909 nmdc:mga08y16_41479_c1
1910 nmdc:mga08y16_464139_c1
1911 nmdc:mga08y16_641725_c1
1912 nmdc:mga0a205_1076465_c1
1913 nmdc:mga0sz30_451822_c1
1914 Ga0500643_000004
1915 Ga0500646_0044762
1916 Ga0500651_0317216
1917 Ga0500641_0143334
1918 Ga0500594_0128169
1919 Ga0500658_0037508
1920 Ga0500658_0280466
1921 Ga0500568_0029423
1922 Ga0500568_0331591
1923 Ga0500573_0193356
1924 Ga0500573_0352658
1925 Ga0500577_0351829
1926 Ga0500588_0156598
1927 Ga0500604_0000014
1928 Ga0500604_0170103
1929 Ga0500604_0177694
1930 Ga0500616_0000591
1931 Ga0500616_0017759
1932 Ga0500616_0079586
1933 Ga0500627_0000009
1934 Ga0500611_009334
1935 Ga0500587_009422
1936 Ga0590075_097433
1937 Ga0587066_047644
1938 Ga0587077_052520
1939 Ga0587077_070117
1940 Ga0587077_085823
1941 Ga0587080_058462
1942 Ga0587106_052800
1943 Ga0587106_111079
1944 Ga0587101_018736
1945 Ga0587067_042667
1946 Ga0587068_026673
1947 Ga0587079_107574
1948 Ga0587071_043474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

8

75

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n0b-assembly1.cif.gz_C structure of gtpase domain of human septin 7 at high resolution 0.7164 3 28
1mhx-assembly1.cif.gz_A crystal structures of the redesigned protein g variant nug1 0.664 1 24
6sgz-assembly1.cif.gz_E structure of protomer 2 of the esx-3 core complex 0.59 3 31
8ahn-assembly1.cif.gz_A sin nombre virus gn in complex with fab snv-42 0.5409 1 27
4hbo-assembly5.cif.gz_E-4 crystal structure of rubella virus capsid protein (residues 127-277) 0.5114 3 34
ID Description Score Start End Superfamily
af_Q9Y5W8_578_693_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7678 3 26 3.30.1520.10
1mhxA00 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.664 1 24 3.10.20.10
2kvtA00 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;YaiA protein 0.6094 1 30 3.30.730.30
1v1pB01 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.5907 2 27 3.10.20.120
af_A0A0R0F689_28_193_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.559 3 27 1.10.520.10
ID Description Score Start End GO Terms
AF-A0A7J4TU54-F1-model_v4 30S ribosomal protein S17 0.4161 13 94 GO:0003735
GO:0006412
GO:0022627
AF-A0A3M0UDJ2-F1-model_v4 deleted 0.388 1 94
AF-A0A3M0UDJ2-F1-model_v4 deleted 0.3787 1 94
AF-A0A3L7GX34-F1-model_v4 deleted 0.3782 4 83
AF-A0A178E386-F1-model_v4 Uncharacterized protein 0.3616 4 78

Map