F487212

General Info

Members Datasets Scaffolds Average Seq Length
974 463 1948 130

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0432150|Ga0466970_0432150_92_454
Length 120
Sequence MVESIARVRHIRVTPMKARRVVNMIRGKQAQEALAILKFAPQGASEPVYKLVASAIANARVKQDLYVSRAFVDEGTTLKRFQPRAQGRAFRINKRTSHITIVLATPDEVEDAKATKKASK

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
90 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
150 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
151 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
172 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
176 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
177 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
178 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
181 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
182 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
185 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
190 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
191 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
192 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
200 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
201 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
202 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
203 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
204 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
344 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
345 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
346 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
347 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
350 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
351 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
352 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
353 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
354 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
355 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
356 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
357 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
408 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
409 2643221546 Microbacterium sp. Root53 Isolate Unclassified
410 2643221553 Microbacterium sp. Root553 Isolate Unclassified
411 2643221566 Microbacterium sp. Root166 Isolate Unclassified
412 2643221597 Microbacterium sp. Root180 Isolate Unclassified
413 2643221630 Microbacterium sp. Root322 Isolate Unclassified
414 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
415 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
416 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
417 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
418 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
419 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
420 2773857759 Microbacterium sp. 1294 Isolate Unclassified
421 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
422 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
423 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
424 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
425 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
426 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
427 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
428 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
429 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
430 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
431 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
432 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
433 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
434 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
435 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
436 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
437 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
438 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
439 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
440 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
441 2919069694 Microbacterium sp. 1154 Isolate Unclassified
442 2919395869 Microbacterium resistens 2980 Isolate Unclassified
443 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
444 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
445 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
446 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
447 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
448 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
449 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
450 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
451 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
452 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
453 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
454 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
455 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
456 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
457 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
458 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
459 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
460 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
461 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
462 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
463 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.82
Metatranscriptomes 20.33
Isolates 5.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 7.7
Nodule 0
Rhizoplane 7.8
Rhizosphere 72.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0432150 3300044765 Bacteria 753
2 Ga0006779J45831_102222 3300003160 Bacteria 5110
3 Ga0007427J51700_102557 3300003559 Bacteria 6979
4 Ga0006781J51513_1004015 3300003568 Bacteria 4443
5 Ga0006780_1005385 3300003735 Bacteria 6163
6 Ga0055542_1013670 3300003762 Bacteria 1358
7 Ga0065714_10085458 3300005288 Bacteria 2148
8 Ga0070658_10009122 3300005327 Bacteria 7974
9 Ga0070658_10037153 3300005327 Bacteria 3925
10 Ga0070658_10233660 3300005327 Bacteria 1557
11 Ga0070676_10260699 3300005328 Bacteria 1161
12 Ga0070676_10664489 3300005328 Bacteria 758
13 Ga0070683_101690325 3300005329 Bacteria 609
14 Ga0070682_100104911 3300005337 Bacteria 1873
15 Ga0070682_100319231 3300005337 Bacteria 1146
16 Ga0070682_101277947 3300005337 Bacteria 623
17 Ga0068868_100083784 3300005338 Bacteria 2560
18 Ga0070660_100092686 3300005339 Bacteria 2385
19 Ga0070660_100319902 3300005339 Bacteria 1274
20 Ga0070661_100175362 3300005344 Bacteria 1629
21 Ga0070668_100021493 3300005347 Bacteria 4875
22 Ga0070669_100662421 3300005353 Bacteria 879
23 Ga0070675_100169397 3300005354 Bacteria 1882
24 Ga0070675_100543105 3300005354 Bacteria 1050
25 Ga0070671_100053010 3300005355 Bacteria 3372
26 Ga0070674_100270580 3300005356 Bacteria 1342
27 Ga0070659_100003025 3300005366 Bacteria 11966
28 Ga0070659_100021971 3300005366 Bacteria 4867
29 Ga0070659_100398464 3300005366 Bacteria 1161
30 Ga0070667_100042795 3300005367 Bacteria 3800
31 Ga0070667_100964873 3300005367 Bacteria 795
32 Ga0070710_10076760 3300005437 Bacteria 1940
33 Ga0070663_100016293 3300005455 Bacteria 4823
34 Ga0070663_100482593 3300005455 Bacteria 1026
35 Ga0070663_101607008 3300005455 Bacteria 580
36 Ga0070678_100231593 3300005456 Bacteria 1540
37 Ga0068867_101541069 3300005459 Bacteria 620
38 Ga0070685_10061812 3300005466 Bacteria 2194
39 Ga0068853_100213800 3300005539 Bacteria 1758
40 Ga0068853_100225354 3300005539 Bacteria 1713
41 Ga0068853_100923825 3300005539 Bacteria 839
42 Ga0070672_100066968 3300005543 Bacteria 2844
43 Ga0070672_100705050 3300005543 Bacteria 884
44 Ga0070672_101452822 3300005543 Bacteria 614
45 Ga0070696_101062391 3300005546 Bacteria 679
46 Ga0070693_100509741 3300005547 Bacteria 855
47 Ga0070665_100077562 3300005548 Bacteria 3329
48 Ga0068855_100047986 3300005563 Bacteria 5042
49 Ga0068855_101352310 3300005563 Bacteria 735
50 Ga0070664_100778979 3300005564 Bacteria 894
51 Ga0068857_100258301 3300005577 Bacteria 1598
52 Ga0068857_100304925 3300005577 Bacteria 1468
53 Ga0068857_100375993 3300005577 Bacteria 1318
54 Ga0068854_100203793 3300005578 Bacteria 1557
55 Ga0068856_100096240 3300005614 Bacteria 2949
56 Ga0068856_100748277 3300005614 Bacteria 997
57 Ga0068856_101258935 3300005614 Bacteria 755
58 Ga0068852_101894449 3300005616 Bacteria 618
59 Ga0068852_102108933 3300005616 Bacteria 585
60 Ga0068859_100436457 3300005617 Bacteria 1406
61 Ga0068864_100500730 3300005618 Bacteria 1169
62 Ga0068861_100331014 3300005719 Bacteria 1329
63 Ga0068861_100901026 3300005719 Bacteria 838
64 Ga0068851_10000022 3300005834 Bacteria 129607
65 Ga0068870_10016699 3300005840 Bacteria 3514
66 Ga0068870_10789556 3300005840 Bacteria 662
67 Ga0068863_101020068 3300005841 Bacteria 830
68 Ga0068863_101308821 3300005841 Bacteria 732
69 Ga0068858_100199980 3300005842 Bacteria 1889
70 Ga0068862_100612731 3300005844 Bacteria 1046
71 Ga0075365_10012248 3300006038 Bacteria 5084
72 Ga0075365_10020292 3300006038 Bacteria 4118
73 Ga0075365_10227022 3300006038 Bacteria 1310
74 Ga0075365_10512919 3300006038 Bacteria 848
75 Ga0075368_10014257 3300006042 Bacteria 2933
76 Ga0075363_100225976 3300006048 Bacteria 1074
77 Ga0075364_10130497 3300006051 Bacteria 1686
78 Ga0075364_10198269 3300006051 Bacteria 1360
79 Ga0075364_10212027 3300006051 Bacteria 1313
80 Ga0075364_10227910 3300006051 Bacteria 1265
81 Ga0075364_10432842 3300006051 Bacteria 898
82 Ga0075364_10849750 3300006051 Bacteria 622
83 Ga0075432_10221675 3300006058 Bacteria 757
84 Ga0075367_10009009 3300006178 Bacteria 5197
85 Ga0075367_10167146 3300006178 Bacteria 1369
86 Ga0075367_10777194 3300006178 Bacteria 610
87 Ga0075369_10017704 3300006186 Bacteria 2893
88 Ga0075369_10414775 3300006186 Bacteria 635
89 Ga0075366_10091361 3300006195 Bacteria 1823
90 Ga0097621_100143128 3300006237 Bacteria 2045
91 Ga0097621_100613252 3300006237 Bacteria 995
92 Ga0075370_10048588 3300006353 Bacteria 2403
93 Ga0075428_100682344 3300006844 Bacteria 1095
94 Ga0068865_100792830 3300006881 Bacteria 817
95 Ga0097620_100436474 3300006931 Bacteria 1406
96 Ga0105244_10004765 3300009036 Bacteria 9234
97 Ga0105244_10034581 3300009036 Bacteria 2659
98 Ga0105244_10197391 3300009036 Bacteria 950
99 Ga0105244_10208538 3300009036 Bacteria 920
100 Ga0105240_10070946 3300009093 Bacteria 4308
101 Ga0105240_10557413 3300009093 Bacteria 1267
102 Ga0105245_10255698 3300009098 Bacteria 1703
103 Ga0105245_11476153 3300009098 Bacteria 731
104 Ga0105247_10242894 3300009101 Bacteria 1228
105 Ga0105247_10316428 3300009101 Bacteria 1087
106 Ga0105247_10928869 3300009101 Bacteria 674
107 Ga0105247_11271724 3300009101 Bacteria 589
108 Ga0105243_10179204 3300009148 Bacteria 1841
109 Ga0105243_10253700 3300009148 Bacteria 1572
110 Ga0105243_10613788 3300009148 Bacteria 1049
111 Ga0105243_11234098 3300009148 Bacteria 762
112 Ga0105243_11356396 3300009148 Bacteria 730
113 Ga0105241_10028364 3300009174 Bacteria 4171
114 Ga0105248_10410272 3300009177 Bacteria 1525
115 Ga0105248_10463031 3300009177 Bacteria 1429
116 Ga0105248_11228235 3300009177 Bacteria 847
117 Ga0105237_10031122 3300009545 Bacteria 5412
118 Ga0105237_10669691 3300009545 Bacteria 1044
119 Ga0105237_12131497 3300009545 Bacteria 570
120 Ga0105238_10027288 3300009551 Bacteria 5817
121 Ga0105238_10438248 3300009551 Bacteria 1303
122 Ga0105238_12491186 3300009551 Bacteria 553
123 Ga0105249_10086228 3300009553 Bacteria 2928
124 Ga0105249_12050801 3300009553 Bacteria 645
125 Ga0105028_137232 3300009993 Bacteria 547
126 Ga0105239_10267366 3300010375 Bacteria 1923
127 Ga0105239_11621087 3300010375 Bacteria 748
128 Ga0105239_11851537 3300010375 Bacteria 699
129 Ga0105246_11237319 3300011119 Bacteria 689
130 Ga0105246_12463316 3300011119 Bacteria 511
131 Ga0157373_10142177 3300013100 Bacteria 1688
132 Ga0157371_10013796 3300013102 Bacteria 6121
133 Ga0157371_10538714 3300013102 Bacteria 865
134 Ga0157371_11401264 3300013102 Bacteria 543
135 Ga0157370_10010513 3300013104 Bacteria 9746
136 Ga0157370_10259819 3300013104 Bacteria 1605
137 Ga0157370_10604984 3300013104 Bacteria 1003
138 Ga0157370_10764268 3300013104 Bacteria 880
139 Ga0157370_11306663 3300013104 Bacteria 653
140 Ga0157370_11361098 3300013104 Bacteria 639
141 Ga0157369_10002930 3300013105 Bacteria 20411
142 Ga0157369_10059481 3300013105 Bacteria 4120
143 Ga0157369_10619795 3300013105 Bacteria 1116
144 Ga0157369_11086173 3300013105 Bacteria 818
145 Ga0171462_1001 3300013250 Bacteria 1135406
146 Ga0157374_11218046 3300013296 Bacteria 774
147 Ga0163162_10286172 3300013306 Bacteria 1780
148 Ga0163162_10407681 3300013306 Bacteria 1492
149 Ga0163162_11148220 3300013306 Bacteria 881
150 Ga0163162_11942760 3300013306 Bacteria 674
151 Ga0157372_10200302 3300013307 Bacteria 2312
152 Ga0157372_10395974 3300013307 Bacteria 1609
153 Ga0157372_10548809 3300013307 Bacteria 1347
154 Ga0157372_10877162 3300013307 Bacteria 1041
155 Ga0157375_10832200 3300013308 Bacteria 1070
156 Ga0157375_11467728 3300013308 Bacteria 804
157 Ga0163163_10056462 3300014325 Bacteria 3881
158 Ga0163163_10473800 3300014325 Bacteria 1313
159 Ga0157380_10596703 3300014326 Bacteria 1092
160 Ga0157380_10856607 3300014326 Bacteria 931
161 Ga0157380_11821864 3300014326 Bacteria 668
162 Ga0157377_10823293 3300014745 Bacteria 687
163 Ga0157379_10079829 3300014968 Bacteria 2930
164 Ga0157376_10983722 3300014969 Bacteria 865
165 Ga0157376_11573093 3300014969 Bacteria 691
166 Ga0157376_12651451 3300014969 Bacteria 541
167 Ga0163161_10180586 3300017792 Bacteria 1618
168 Ga0163161_10406459 3300017792 Bacteria 1093
169 Ga0163161_10669137 3300017792 Bacteria 862
170 Ga0163161_11043176 3300017792 Bacteria 700
171 Ga0197907_10274436 3300020069 Bacteria 814
172 Ga0197907_10555491 3300020069 Bacteria 1294
173 Ga0206349_1158906 3300020075 Bacteria 750
174 Ga0206349_1702118 3300020075 Bacteria 760
175 Ga0206355_1137396 3300020076 Bacteria 2655
176 Ga0206355_1343386 3300020076 Bacteria 1466
177 Ga0206355_1409600 3300020076 Bacteria 1297
178 Ga0206355_1642509 3300020076 Bacteria 1217
179 Ga0206355_1689445 3300020076 Bacteria 1243
180 Ga0206351_10537763 3300020077 Bacteria 1970
181 Ga0206352_10962140 3300020078 Bacteria 507
182 Ga0206350_11103668 3300020080 Bacteria 841
183 Ga0206354_10603441 3300020081 Bacteria 851
184 Ga0206353_11035842 3300020082 Bacteria 4726
185 Ga0206353_11100958 3300020082 Bacteria 1244
186 Ga0154015_1337298 3300020610 Bacteria 778
187 Ga0224712_10195694 3300022467 Bacteria 917
188 Ga0224712_10327531 3300022467 Bacteria 721
189 Ga0224712_10631531 3300022467 Bacteria 524
190 Ga0256744_120521 3300023309 Bacteria 1056
191 Ga0209646_1000013 3300025246 Bacteria 565830
192 Ga0209646_1000014 3300025246 Bacteria 550484
193 Ga0209148_1019038 3300025254 Bacteria 1145
194 Ga0209025_1103719 3300025294 Bacteria 892
195 Ga0207656_10000005 3300025321 Bacteria 490514
196 Ga0207655_1000386 3300025728 Bacteria 61740
197 Ga0207655_1093316 3300025728 Bacteria 1054
198 Ga0207682_10106898 3300025893 Bacteria 1228
199 Ga0207692_10014203 3300025898 Bacteria 3475
200 Ga0207692_10293942 3300025898 Bacteria 987
201 Ga0207710_10236693 3300025900 Bacteria 910
202 Ga0207688_10069625 3300025901 Bacteria 1994
203 Ga0207688_10750778 3300025901 Bacteria 618
204 Ga0207680_10278281 3300025903 Bacteria 1162
205 Ga0207647_10076267 3300025904 Bacteria 2016
206 Ga0207645_10296018 3300025907 Bacteria 1077
207 Ga0207643_10107470 3300025908 Bacteria 1641
208 Ga0207643_10267142 3300025908 Bacteria 1058
209 Ga0207705_10000001 3300025909 Bacteria 2061880
210 Ga0207705_10067626 3300025909 Bacteria 2586
211 Ga0207654_10000001 3300025911 Bacteria 1816198
212 Ga0207695_10100413 3300025913 Bacteria 2890
213 Ga0207695_10138337 3300025913 Bacteria 2387
214 Ga0207671_10000016 3300025914 Bacteria 435413
215 Ga0207671_10082507 3300025914 Bacteria 2412
216 Ga0207671_11121203 3300025914 Bacteria 617
217 Ga0207663_10638057 3300025916 Bacteria 840
218 Ga0207657_10005997 3300025919 Bacteria 12644
219 Ga0207657_10036712 3300025919 Bacteria 4384
220 Ga0207657_10904799 3300025919 Bacteria 680
221 Ga0207649_11068311 3300025920 Bacteria 636
222 Ga0207652_11109821 3300025921 Bacteria 691
223 Ga0207652_11369443 3300025921 Bacteria 611
224 Ga0207681_10766295 3300025923 Bacteria 805
225 Ga0207694_10000057 3300025924 Bacteria 146441
226 Ga0207694_10602481 3300025924 Bacteria 924
227 Ga0207650_10493042 3300025925 Bacteria 1023
228 Ga0207659_10208411 3300025926 Bacteria 1565
229 Ga0207659_10371726 3300025926 Bacteria 1190
230 Ga0207687_10903461 3300025927 Bacteria 756
231 Ga0207644_10207643 3300025931 Bacteria 1547
232 Ga0207644_10848829 3300025931 Bacteria 765
233 Ga0207690_10003803 3300025932 Bacteria 8937
234 Ga0207690_10095961 3300025932 Bacteria 2107
235 Ga0207690_10287694 3300025932 Bacteria 1282
236 Ga0207709_10037724 3300025935 Bacteria 2873
237 Ga0207709_10046229 3300025935 Bacteria 2641
238 Ga0207709_10236921 3300025935 Bacteria 1325
239 Ga0207709_11321513 3300025935 Bacteria 596
240 Ga0207669_10366408 3300025937 Bacteria 1118
241 Ga0207691_10382609 3300025940 Bacteria 1201
242 Ga0207711_10022131 3300025941 Bacteria 5314
243 Ga0207711_10668680 3300025941 Bacteria 969
244 Ga0207661_11246513 3300025944 Bacteria 684
245 Ga0207667_10035600 3300025949 Bacteria 5340
246 Ga0207667_10069574 3300025949 Bacteria 3663
247 Ga0207667_10655227 3300025949 Bacteria 1055
248 Ga0207668_10867954 3300025972 Bacteria 802
249 Ga0207668_11775902 3300025972 Bacteria 557
250 Ga0207640_10260817 3300025981 Bacteria 1350
251 Ga0207658_10551283 3300025986 Bacteria 1032
252 Ga0207658_10605749 3300025986 Bacteria 984
253 Ga0207677_10541056 3300026023 Bacteria 1013
254 Ga0207703_10001453 3300026035 Bacteria 21613
255 Ga0207703_12347938 3300026035 Bacteria 509
256 Ga0207639_10056116 3300026041 Bacteria 3018
257 Ga0207639_10193937 3300026041 Bacteria 1737
258 Ga0207639_10195614 3300026041 Bacteria 1730
259 Ga0207678_10027691 3300026067 Bacteria 4947
260 Ga0207678_10349298 3300026067 Bacteria 1275
261 Ga0207678_10479024 3300026067 Bacteria 1084
262 Ga0207678_10999169 3300026067 Bacteria 740
263 Ga0207678_11004479 3300026067 Bacteria 738
264 Ga0207678_11158563 3300026067 Bacteria 685
265 Ga0207702_10200036 3300026078 Bacteria 1851
266 Ga0207702_10818798 3300026078 Bacteria 921
267 Ga0207702_11799327 3300026078 Bacteria 605
268 Ga0207648_11209788 3300026089 Bacteria 710
269 Ga0207676_10139684 3300026095 Bacteria 2072
270 Ga0207676_11241686 3300026095 Bacteria 739
271 Ga0207674_10131056 3300026116 Bacteria 2470
272 Ga0207674_10257091 3300026116 Bacteria 1693
273 Ga0207675_100409019 3300026118 Bacteria 1338
274 Ga0207683_10092851 3300026121 Bacteria 2689
275 Ga0207683_10250969 3300026121 Bacteria 1615
276 Ga0207698_10084580 3300026142 Bacteria 2572
277 Ga0207698_11374576 3300026142 Bacteria 721
278 Ga0209813_10023881 3300027866 Bacteria 1742
279 Ga0268265_10299071 3300028380 Bacteria 1448
280 Ga0307515_10448326 3300028794 Bacteria 906
281 Ga0311001_1065528 3300029277 Bacteria 710
282 Ga0311001_1074009 3300029277 Bacteria 625
283 Ga0311001_1077971 3300029277 Bacteria 841
284 Ga0316181_1207534 3300030744 Bacteria 701
285 Ga0265769_102572 3300030888 Bacteria 960
286 Ga0307408_100294688 3300031548 Bacteria 1356
287 Ga0307408_100875136 3300031548 Bacteria 820
288 Ga0307514_10047781 3300031649 Bacteria 3339
289 Ga0307405_10197141 3300031731 Bacteria 1459
290 Ga0307405_10319573 3300031731 Bacteria 1185
291 Ga0307405_10394275 3300031731 Bacteria 1082
292 Ga0307405_10826035 3300031731 Bacteria 778
293 Ga0307405_11858120 3300031731 Bacteria 536
294 Ga0307413_10370817 3300031824 Bacteria 1112
295 Ga0307413_10558962 3300031824 Bacteria 929
296 Ga0307413_11513760 3300031824 Bacteria 593
297 Ga0307413_11721430 3300031824 Bacteria 559
298 Ga0307413_12162400 3300031824 Bacteria 504
299 Ga0307410_10008732 3300031852 Bacteria 5638
300 Ga0307410_10447093 3300031852 Bacteria 1053
301 Ga0307410_10675328 3300031852 Bacteria 868
302 Ga0307406_10000938 3300031901 Bacteria 16294
303 Ga0307406_10216849 3300031901 Bacteria 1419
304 Ga0307406_10401571 3300031901 Bacteria 1086
305 Ga0307406_10427104 3300031901 Bacteria 1057
306 Ga0307406_10459435 3300031901 Bacteria 1023
307 Ga0307406_10479838 3300031901 Bacteria 1004
308 Ga0307407_10117652 3300031903 Bacteria 1679
309 Ga0307407_10301390 3300031903 Bacteria 1117
310 Ga0307412_10198673 3300031911 Bacteria 1521
311 Ga0307412_10278485 3300031911 Bacteria 1312
312 Ga0307412_10387768 3300031911 Bacteria 1133
313 Ga0307412_10897432 3300031911 Bacteria 776
314 Ga0307409_100004394 3300031995 Bacteria 7914
315 Ga0307409_100989842 3300031995 Bacteria 858
316 Ga0307409_101939674 3300031995 Bacteria 618
317 Ga0307409_102024175 3300031995 Bacteria 605
318 Ga0307416_100005285 3300032002 Bacteria 7910
319 Ga0307416_100744123 3300032002 Bacteria 1072
320 Ga0307416_101469148 3300032002 Bacteria 787
321 Ga0307414_10269756 3300032004 Bacteria 1424
322 Ga0307414_10309586 3300032004 Bacteria 1340
323 Ga0307414_10520607 3300032004 Bacteria 1055
324 Ga0307411_12059527 3300032005 Bacteria 533
325 Ga0307415_100008614 3300032126 Bacteria 5665
326 Ga0307415_100201386 3300032126 Bacteria 1580
327 Ga0307415_100607553 3300032126 Bacteria 974
328 Ga0307415_100960089 3300032126 Bacteria 792
329 Ga0307415_101084235 3300032126 Bacteria 749
330 Ga0395899_0162658 3300037312 Bacteria 1576
331 Ga0395900_0006982 3300037418 Bacteria 11701
332 Ga0395900_0263054 3300037418 Bacteria 1722
333 Ga0395900_0438975 3300037418 Bacteria 1263
334 Ga0395900_0451389 3300037418 Bacteria 1242
335 Ga0395898_0019914 3300037466 Bacteria 6823
336 Ga0395898_0852468 3300037466 Bacteria 850
337 Ga0395901_0085857 3300038443 Bacteria 3290
338 Ga0237816_11011 3300039145 Bacteria 516
339 Ga0439436_0041933 3300041404 Bacteria 1309
340 Ga0439439_0059326 3300041406 Bacteria 1014
341 Ga0439461_0053344 3300041410 Bacteria 902
342 Ga0439461_0111934 3300041410 Bacteria 675
343 Ga0439466_0121782 3300041411 Bacteria 805
344 Ga0439465_0022200 3300041413 Bacteria 1993
345 Ga0439465_0072314 3300041413 Bacteria 1157
346 Ga0439465_0081676 3300041413 Bacteria 1097
347 Ga0451787_246423 3300041441 Bacteria 550
348 Ga0451790_16668 3300041444 Bacteria 891
349 Ga0451794_51954 3300041446 Bacteria 1045
350 Ga0451791_0252410 3300041451 Bacteria 1057
351 Ga0451791_0522425 3300041451 Bacteria 544
352 Ga0451791_0885182 3300041451 Bacteria 1060
353 Ga0451791_0946463 3300041451 Bacteria 689
354 Ga0451791_1667512 3300041451 Bacteria 1376
355 Ga0451793_0114708 3300041452 Bacteria 707
356 Ga0451793_0364734 3300041452 Bacteria 514
357 Ga0451797_0447299 3300041453 Bacteria 900
358 Ga0451797_0573731 3300041453 Bacteria 662
359 Ga0451797_1305345 3300041453 Bacteria 630
360 Ga0451795_0457218 3300041456 Bacteria 1099
361 Ga0451795_0898513 3300041456 Bacteria 753
362 Ga0451795_1334679 3300041456 Bacteria 516
363 Ga0451800_0760376 3300041459 Bacteria 708
364 Ga0451802_0834053 3300041460 Bacteria 658
365 Ga0451802_1970844 3300041460 Bacteria 552
366 Ga0451805_062275 3300041461 Bacteria 604
367 Ga0451805_105826 3300041461 Bacteria 667
368 Ga0451804_0489240 3300041463 Bacteria 1143
369 Ga0451807_2527770 3300041486 Bacteria 616
370 Ga0451807_2680378 3300041486 Bacteria 1321
371 Ga0451833_1022863 3300041491 Bacteria 603
372 Ga0451837_0158494 3300041494 Bacteria 1146
373 Ga0451841_0676603 3300041498 Bacteria 1556
374 Ga0451845_0769710 3300041501 Bacteria 537
375 Ga0451847_0326429 3300041503 Bacteria 624
376 Ga0451855_0157124 3300041511 Bacteria 933
377 Ga0451855_1282023 3300041511 Bacteria 582
378 Ga0451855_1919360 3300041511 Bacteria 711
379 Ga0451853_0210551 3300041512 Bacteria 687
380 Ga0451853_0362195 3300041512 Bacteria 675
381 Ga0451853_1287593 3300041512 Bacteria 858
382 Ga0451853_3699793 3300041512 Bacteria 755
383 Ga0439431_0023873 3300041997 Bacteria 1484
384 Ga0439431_0058250 3300041997 Bacteria 1012
385 Ga0439442_040323 3300042002 Bacteria 980
386 Ga0439449_0386704 3300042007 Bacteria 531
387 Ga0439457_082023 3300042014 Bacteria 742
388 Ga0439463_024047 3300042016 Bacteria 1526
389 Ga0450920_023388 3300042122 Bacteria 1198
390 Ga0450923_019939 3300042125 Bacteria 1296
391 Ga0450902_017328 3300042137 Bacteria 1177
392 Ga0450905_019201 3300042142 Bacteria 1000
393 Ga0450905_024562 3300042142 Bacteria 903
394 Ga0450906_071078 3300042145 Bacteria 623
395 Ga0450910_074924 3300042147 Bacteria 586
396 Ga0439446_0171586 3300042156 Bacteria 722
397 Ga0450909_036270 3300042185 Bacteria 754
398 Ga0439459_0055691 3300042438 Bacteria 881
399 Ga0439459_0105076 3300042438 Bacteria 696
400 Ga0439464_0203545 3300042439 Bacteria 632
401 Ga0450918_002834 3300042531 Bacteria 3257
402 Ga0450918_020516 3300042531 Bacteria 1155
403 Ga0466972_0106471 3300044658 Bacteria 1326
404 Ga0466972_0412879 3300044658 Bacteria 633
405 Ga0466965_0000003 3300044683 Bacteria 265985
406 Ga0466965_0023372 3300044683 Bacteria 2985
407 Ga0466965_0279776 3300044683 Bacteria 901
408 Ga0466968_0162456 3300044735 Bacteria 1031
409 Ga0466970_0000027 3300044765 Bacteria 56103
410 Ga0466957_0481872 3300044842 Bacteria 858
411 Ga0466958_0181544 3300045836 Bacteria 1335
412 Ga0466958_0842770 3300045836 Bacteria 598
413 Ga0466967_0086122 3300045976 Bacteria 2846
414 Ga0495627_001687 3300046453 Bacteria 12164
415 Ga0495590_0327161 3300046457 Bacteria 580
416 Ga0495638_0063229 3300046460 Bacteria 2282
417 Ga0495638_0115266 3300046460 Bacteria 1593
418 Ga0495650_0002639 3300046471 Bacteria 14025
419 Ga0495650_0093875 3300046471 Bacteria 1137
420 Ga0495650_0109089 3300046471 Bacteria 1030
421 Ga0495639_0351832 3300046475 Bacteria 740
422 Ga0495620_0160846 3300046515 Bacteria 872
423 Ga0495620_0343423 3300046515 Bacteria 566
424 Ga0495631_0197683 3300046518 Bacteria 860
425 Ga0495632_0104569 3300046519 Bacteria 1333
426 Ga0495643_0095066 3300046522 Bacteria 1533
427 Ga0495643_0370741 3300046522 Bacteria 637
428 Ga0495663_0203307 3300046525 Bacteria 692
429 Ga0495654_0029667 3300046530 Bacteria 2788
430 Ga0495587_0586571 3300046536 Bacteria 614
431 Ga0495598_0021497 3300046537 Bacteria 1717
432 Ga0495645_0050080 3300046543 Bacteria 3041
433 Ga0495645_0323490 3300046543 Bacteria 1001
434 Ga0495645_0478378 3300046543 Bacteria 782
435 Ga0495633_0473560 3300046558 Bacteria 565
436 Ga0495656_0023242 3300046615 Bacteria 2438
437 Ga0495625_0678898 3300046660 Bacteria 610
438 Ga0495658_0375610 3300046683 Bacteria 905
439 Ga0495624_0891625 3300046690 Bacteria 524
440 Ga0495671_0122328 3300046692 Bacteria 1269
441 Ga0495649_0160447 3300046694 Bacteria 1179
442 Ga0495600_0274860 3300046809 Bacteria 1068
443 Ga0495672_0011493 3300047320 Bacteria 6245
444 Ga0495686_0067922 3300047472 Bacteria 2200
445 Ga0495686_0227840 3300047472 Bacteria 1057
446 Ga0495686_0246858 3300047472 Bacteria 1004
447 Ga0495602_0601624 3300048088 Bacteria 756
448 Ga0495615_0301450 3300048090 Bacteria 519
449 Ga0496100_0011682 3300048903 Bacteria 5004
450 Ga0496100_0025779 3300048903 Bacteria 3597
451 Ga0496100_0410090 3300048903 Bacteria 1033
452 Ga0496101_0002898 3300048904 Bacteria 10559
453 Ga0496101_0123527 3300048904 Bacteria 1959
454 Ga0496102_0089571 3300048905 Bacteria 2847
455 Ga0496102_0188751 3300048905 Bacteria 1942
456 Ga0496103_0010181 3300048906 Bacteria 5560
457 Ga0496103_0024216 3300048906 Bacteria 3662
458 Ga0496104_0015491 3300048907 Bacteria 6903
459 Ga0496104_0171501 3300048907 Bacteria 2080
460 Ga0496104_0579457 3300048907 Bacteria 1033
461 Ga0496104_1294508 3300048907 Bacteria 632
462 Ga0496104_1381368 3300048907 Bacteria 607
463 Ga0496105_0009192 3300048908 Bacteria 7715
464 Ga0496105_0045124 3300048908 Bacteria 3636
465 Ga0496105_0145356 3300048908 Bacteria 1950
466 Ga0496105_0278400 3300048908 Bacteria 1349
467 Ga0496105_0350452 3300048908 Bacteria 1179
468 Ga0496105_0939262 3300048908 Bacteria 650
469 Ga0496106_0117833 3300048909 Bacteria 2073
470 Ga0496107_0001328 3300048910 Bacteria 15168
471 Ga0496107_0227663 3300048910 Bacteria 1387
472 Ga0496108_0047565 3300048911 Bacteria 3586
473 Ga0496108_0378828 3300048911 Bacteria 1235
474 Ga0496108_1577978 3300048911 Bacteria 544
475 Ga0496109_0016841 3300048912 Bacteria 6396
476 Ga0496109_0042506 3300048912 Bacteria 4117
477 Ga0496109_0219854 3300048912 Bacteria 1786
478 Ga0496109_1907855 3300048912 Bacteria 526
479 Ga0496110_0036804 3300048913 Bacteria 4251
480 Ga0496110_0567031 3300048913 Bacteria 1031
481 Ga0496111_0012648 3300048914 Bacteria 5719
482 Ga0496111_0138419 3300048914 Bacteria 1804
483 Ga0496111_0236721 3300048914 Bacteria 1356
484 Ga0496111_0282014 3300048914 Bacteria 1232
485 Ga0496111_0968826 3300048914 Bacteria 610
486 Ga0496112_0020079 3300048915 Bacteria 6325
487 Ga0496113_0005620 3300048916 Bacteria 7845
488 Ga0496113_0258695 3300048916 Bacteria 1390
489 Ga0496113_1150051 3300048916 Bacteria 607
490 Ga0496114_0002463 3300048917 Bacteria 14129
491 Ga0496114_0194217 3300048917 Bacteria 1776
492 Ga0496114_0265025 3300048917 Bacteria 1513
493 Ga0496114_0297517 3300048917 Bacteria 1425
494 Ga0496114_0487680 3300048917 Bacteria 1090
495 Ga0496114_0518177 3300048917 Bacteria 1054
496 Ga0496115_0002702 3300048918 Bacteria 12733
497 Ga0496115_0045726 3300048918 Bacteria 3495
498 Ga0496115_0092488 3300048918 Bacteria 2472
499 Ga0496115_0216657 3300048918 Bacteria 1580
500 Ga0496115_0327444 3300048918 Bacteria 1252
501 Ga0496116_0021611 3300048919 Bacteria 4845
502 Ga0496116_0267126 3300048919 Bacteria 839
503 Ga0496117_0000362 3300048920 Bacteria 79224
504 Ga0496117_0003610 3300048920 Bacteria 17825
505 Ga0496117_0004032 3300048920 Bacteria 16539
506 Ga0496117_0006530 3300048920 Bacteria 11750
507 Ga0496117_0009885 3300048920 Bacteria 8783
508 Ga0496117_0059887 3300048920 Bacteria 2627
509 Ga0496117_0108984 3300048920 Bacteria 1730
510 Ga0496117_0546609 3300048920 Bacteria 552
511 Ga0496118_0002856 3300048921 Bacteria 22535
512 Ga0496118_0043816 3300048921 Bacteria 3512
513 Ga0496119_0000720 3300048922 Bacteria 44520
514 Ga0496119_0006250 3300048922 Bacteria 11123
515 Ga0496119_0025618 3300048922 Bacteria 4113
516 Ga0496119_0046717 3300048922 Bacteria 2700
517 Ga0496119_0049436 3300048922 Bacteria 2600
518 Ga0496119_0190207 3300048922 Bacteria 1070
519 Ga0496119_0192228 3300048922 Bacteria 1062
520 Ga0496119_0251481 3300048922 Bacteria 891
521 Ga0496119_0275352 3300048922 Bacteria 839
522 Ga0496119_0316247 3300048922 Bacteria 765
523 Ga0496119_0336832 3300048922 Bacteria 734
524 Ga0496119_0453570 3300048922 Bacteria 604
525 Ga0496120_0007276 3300048923 Bacteria 8270
526 Ga0496120_0013513 3300048923 Bacteria 5495
527 Ga0496120_0022013 3300048923 Bacteria 4015
528 Ga0496120_0038694 3300048923 Bacteria 2820
529 Ga0496120_0109839 3300048923 Bacteria 1442
530 Ga0496120_0221924 3300048923 Bacteria 902
531 Ga0496121_0000497 3300048924 Bacteria 75061
532 Ga0496121_0026877 3300048924 Bacteria 5404
533 Ga0496122_0000022 3300048925 Bacteria 388704
534 Ga0496122_0000799 3300048925 Bacteria 60347
535 Ga0496122_0005147 3300048925 Bacteria 15769
536 Ga0496122_0010341 3300048925 Bacteria 9645
537 Ga0496122_0026775 3300048925 Bacteria 4956
538 Ga0496122_0119930 3300048925 Bacteria 1699
539 Ga0496122_0435742 3300048925 Bacteria 654
540 Ga0496122_0523403 3300048925 Bacteria 571
541 Ga0496123_0000009 3300048926 Bacteria 509486
542 Ga0496123_0000016 3300048926 Bacteria 424330
543 Ga0496123_0002420 3300048926 Bacteria 23276
544 Ga0496123_0020865 3300048926 Bacteria 5109
545 Ga0496123_0083824 3300048926 Bacteria 1925
546 Ga0496123_0182963 3300048926 Bacteria 1092
547 Ga0496123_0237916 3300048926 Bacteria 906
548 Ga0496124_0002766 3300048927 Bacteria 22302
549 Ga0496124_0006965 3300048927 Bacteria 12143
550 Ga0496124_0046380 3300048927 Bacteria 3721
551 Ga0496125_0001491 3300048928 Bacteria 33565
552 Ga0496125_0002578 3300048928 Bacteria 23316
553 Ga0496125_0016052 3300048928 Bacteria 7209
554 Ga0496125_0029529 3300048928 Bacteria 4925
555 Ga0496125_0123889 3300048928 Bacteria 1836
556 Ga0496126_0002077 3300048929 Bacteria 28059
557 Ga0496126_0002563 3300048929 Bacteria 24311
558 Ga0496126_0015145 3300048929 Bacteria 7768
559 Ga0496126_0020288 3300048929 Bacteria 6523
560 Ga0496126_0029883 3300048929 Bacteria 5173
561 Ga0496126_0089792 3300048929 Bacteria 2704
562 Ga0496126_0141466 3300048929 Bacteria 2070
563 Ga0496126_0263130 3300048929 Bacteria 1433
564 Ga0496126_0392660 3300048929 Bacteria 1127
565 Ga0501306_000074 3300049127 Bacteria 5266
566 Ga0501306_000560 3300049127 Bacteria 2934
567 Ga0501306_009610 3300049127 Bacteria 1202
568 Ga0501306_044904 3300049127 Bacteria 695
569 Ga0501306_091381 3300049127 Bacteria 535
570 Ga0501308_002157 3300049128 Bacteria 1693
571 Ga0501308_004467 3300049128 Bacteria 1350
572 Ga0501309_000615 3300049129 Bacteria 3018
573 Ga0501309_003216 3300049129 Bacteria 1832
574 Ga0501309_021404 3300049129 Bacteria 909
575 Ga0501309_056572 3300049129 Bacteria 625
576 Ga0501310_002153 3300049130 Bacteria 1850
577 Ga0501310_006171 3300049130 Bacteria 1251
578 Ga0501310_007007 3300049130 Bacteria 1197
579 Ga0501310_007679 3300049130 Bacteria 1156
580 Ga0501310_020196 3300049130 Bacteria 825
581 Ga0501341_01921 3300049131 Bacteria 1087
582 Ga0501341_03734 3300049131 Bacteria 870
583 Ga0501341_04190 3300049131 Bacteria 837
584 Ga0501304_001479 3300049160 Bacteria 1516
585 Ga0501304_025540 3300049160 Bacteria 606
586 Ga0501304_029583 3300049160 Bacteria 577
587 Ga0501304_030253 3300049160 Bacteria 573
588 Ga0501305_003699 3300049161 Bacteria 1750
589 Ga0501305_090353 3300049161 Bacteria 560
590 Ga0501307_000930 3300049162 Bacteria 2264
591 Ga0501307_007279 3300049162 Bacteria 1217
592 Ga0501307_013113 3300049162 Bacteria 997
593 Ga0501307_013962 3300049162 Bacteria 975
594 Ga0501307_018450 3300049162 Bacteria 887
595 Ga0501307_030182 3300049162 Bacteria 748
596 Ga0501307_039061 3300049162 Bacteria 684
597 Ga0501311_000216 3300049527 Bacteria 3430
598 Ga0501311_003504 3300049527 Bacteria 1606
599 Ga0501311_006499 3300049527 Bacteria 1319
600 Ga0501311_024279 3300049527 Bacteria 843
601 Ga0501311_064511 3300049527 Bacteria 598
602 Ga0501312_011327 3300049528 Bacteria 1210
603 Ga0501312_016522 3300049528 Bacteria 1057
604 Ga0501312_037408 3300049528 Bacteria 782
605 Ga0501312_040937 3300049528 Bacteria 757
606 Ga0501313_005880 3300049529 Bacteria 1311
607 Ga0501313_071242 3300049529 Bacteria 504
608 Ga0501314_002632 3300049530 Bacteria 1401
609 Ga0501314_021280 3300049530 Bacteria 676
610 Ga0501315_002877 3300049531 Bacteria 1672
611 Ga0501315_020592 3300049531 Bacteria 887
612 Ga0501315_047156 3300049531 Bacteria 668
613 Ga0501316_000435 3300049532 Bacteria 2848
614 Ga0501316_009910 3300049532 Bacteria 1077
615 Ga0501316_013098 3300049532 Bacteria 977
616 Ga0501316_013217 3300049532 Bacteria 974
617 Ga0501316_023780 3300049532 Bacteria 788
618 Ga0501317_001951 3300049533 Bacteria 1875
619 Ga0501317_011943 3300049533 Bacteria 1064
620 Ga0501317_014096 3300049533 Bacteria 1008
621 Ga0501317_026782 3300049533 Bacteria 815
622 Ga0501317_076255 3300049533 Bacteria 573
623 Ga0501318_000070 3300049534 Bacteria 4287
624 Ga0501318_013616 3300049534 Bacteria 948
625 Ga0501318_050164 3300049534 Bacteria 618
626 Ga0501318_061498 3300049534 Bacteria 577
627 Ga0501319_000088 3300049535 Bacteria 3164
628 Ga0501319_004101 3300049535 Bacteria 1002
629 Ga0501319_006052 3300049535 Bacteria 883
630 Ga0501320_002053 3300049536 Bacteria 1570
631 Ga0501320_013226 3300049536 Bacteria 878
632 Ga0501321_000212 3300049537 Bacteria 3321
633 Ga0501321_007064 3300049537 Bacteria 1158
634 Ga0501321_010938 3300049537 Bacteria 1004
635 Ga0501323_005116 3300049539 Bacteria 1420
636 Ga0501323_006917 3300049539 Bacteria 1280
637 Ga0501323_007033 3300049539 Bacteria 1274
638 Ga0501324_001941 3300049540 Bacteria 1449
639 Ga0501324_008804 3300049540 Bacteria 895
640 Ga0501325_001231 3300049541 Bacteria 1524
641 Ga0501325_003351 3300049541 Bacteria 1162
642 Ga0501325_012426 3300049541 Bacteria 801
643 Ga0501326_08559 3300049542 Bacteria 596
644 Ga0501327_10274 3300049543 Bacteria 616
645 Ga0501330_006252 3300049546 Bacteria 776
646 Ga0501330_008606 3300049546 Bacteria 702
647 Ga0501330_010575 3300049546 Bacteria 656
648 Ga0501330_015283 3300049546 Bacteria 582
649 Ga0501331_07226 3300049547 Bacteria 658
650 Ga0501332_02792 3300049548 Bacteria 991
651 Ga0501332_07209 3300049548 Bacteria 707
652 Ga0501334_13800 3300049550 Bacteria 608
653 Ga0501335_012651 3300049551 Bacteria 836
654 Ga0501336_004708 3300049552 Bacteria 966
655 Ga0501337_005088 3300049553 Bacteria 873
656 Ga0501338_11695 3300049554 Bacteria 600
657 Ga0501340_002551 3300049556 Bacteria 1058
658 Ga0501340_011976 3300049556 Bacteria 652
659 Ga0501340_012709 3300049556 Bacteria 641
660 Ga0501031_0053231 3300049568 Bacteria 2637
661 Ga0501031_0154726 3300049568 Bacteria 1498
662 Ga0501031_0185874 3300049568 Bacteria 1357
663 Ga0501031_0233826 3300049568 Bacteria 1196
664 Ga0501032_0003386 3300049569 Bacteria 12226
665 Ga0501032_0011095 3300049569 Bacteria 6474
666 Ga0501032_0017365 3300049569 Bacteria 5052
667 Ga0501033_0002214 3300049570 Bacteria 16754
668 Ga0501033_0004032 3300049570 Bacteria 11861
669 Ga0501033_0004858 3300049570 Bacteria 10708
670 Ga0501033_0147016 3300049570 Bacteria 1701
671 Ga0501033_0357914 3300049570 Bacteria 1022
672 Ga0501034_0002490 3300049571 Bacteria 22119
673 Ga0501034_0008687 3300049571 Bacteria 10701
674 Ga0501034_0022444 3300049571 Bacteria 6431
675 Ga0501034_0032413 3300049571 Bacteria 5306
676 Ga0501034_0057847 3300049571 Bacteria 3897
677 Ga0501034_0078054 3300049571 Bacteria 3316
678 Ga0501034_0208027 3300049571 Bacteria 1912
679 Ga0501034_0213629 3300049571 Bacteria 1883
680 Ga0501034_0240972 3300049571 Bacteria 1754
681 Ga0501034_0290985 3300049571 Bacteria 1571
682 Ga0501034_0557893 3300049571 Bacteria 1054
683 Ga0501034_1091062 3300049571 Bacteria 679
684 Ga0501034_1264223 3300049571 Bacteria 615
685 Ga0501034_1574227 3300049571 Bacteria 530
686 Ga0501036_0039389 3300049572 Bacteria 3998
687 Ga0501036_0240730 3300049572 Bacteria 1517
688 Ga0501036_0544297 3300049572 Bacteria 965
689 Ga0501036_0656143 3300049572 Bacteria 868
690 Ga0501036_0670647 3300049572 Bacteria 858
691 Ga0501036_0943498 3300049572 Bacteria 707
692 Ga0501037_0001422 3300049573 Bacteria 17565
693 Ga0501037_0084416 3300049573 Bacteria 2299
694 Ga0501037_0160205 3300049573 Bacteria 1604
695 Ga0501037_0232969 3300049573 Bacteria 1292
696 Ga0501037_0309292 3300049573 Bacteria 1096
697 Ga0501037_0901739 3300049573 Bacteria 579
698 Ga0501038_0003511 3300049574 Bacteria 14597
699 Ga0501038_0021820 3300049574 Bacteria 5744
700 Ga0501038_0126029 3300049574 Bacteria 2107
701 Ga0501038_0344075 3300049574 Bacteria 1162
702 Ga0501038_0370455 3300049574 Bacteria 1113
703 Ga0501038_0573279 3300049574 Bacteria 856
704 Ga0501039_0008941 3300049575 Bacteria 7631
705 Ga0501039_0114351 3300049575 Bacteria 2111
706 Ga0501039_0388898 3300049575 Bacteria 1095
707 Ga0501039_0565281 3300049575 Bacteria 892
708 Ga0501039_0828073 3300049575 Bacteria 722
709 Ga0501039_0886832 3300049575 Bacteria 694
710 Ga0501039_0967576 3300049575 Bacteria 662
711 Ga0501040_0348686 3300049576 Bacteria 1060
712 Ga0501040_0705388 3300049576 Bacteria 730
713 Ga0501042_0009674 3300049578 Bacteria 6437
714 Ga0501042_0098304 3300049578 Bacteria 2104
715 Ga0501042_0292483 3300049578 Bacteria 1177
716 Ga0501042_0998805 3300049578 Bacteria 610
717 Ga0501043_0016944 3300049579 Bacteria 5710
718 Ga0501043_0048230 3300049579 Bacteria 3348
719 Ga0501043_0065288 3300049579 Bacteria 2858
720 Ga0501043_0100265 3300049579 Bacteria 2276
721 Ga0501043_0784689 3300049579 Bacteria 690
722 Ga0501046_0013742 3300049580 Bacteria 6845
723 Ga0501046_0023204 3300049580 Bacteria 5106
724 Ga0501047_0001782 3300049581 Bacteria 20821
725 Ga0501047_0006944 3300049581 Bacteria 10634
726 Ga0501047_0034189 3300049581 Bacteria 4908
727 Ga0501048_0013228 3300049582 Bacteria 6124
728 Ga0501048_0016304 3300049582 Bacteria 5476
729 Ga0501048_0022961 3300049582 Bacteria 4560
730 Ga0501048_0291761 3300049582 Bacteria 1160
731 Ga0501048_0411271 3300049582 Bacteria 967
732 Ga0501067_0023885 3300049583 Bacteria 3390
733 Ga0501067_0400834 3300049583 Bacteria 765
734 Ga0501068_0045634 3300049584 Bacteria 2640
735 Ga0501068_0087080 3300049584 Bacteria 1923
736 Ga0501068_0666368 3300049584 Bacteria 680
737 Ga0501069_0035485 3300049585 Bacteria 2748
738 Ga0501069_0037626 3300049585 Bacteria 2670
739 Ga0501069_0106583 3300049585 Bacteria 1593
740 Ga0501069_0429571 3300049585 Bacteria 784
741 Ga0501069_0735944 3300049585 Bacteria 596
742 Ga0501070_0000874 3300049586 Bacteria 27417
743 Ga0501070_0014598 3300049586 Bacteria 6610
744 Ga0501070_0015639 3300049586 Bacteria 6379
745 Ga0501070_0048708 3300049586 Bacteria 3519
746 Ga0501070_0170892 3300049586 Bacteria 1790
747 Ga0501070_0183881 3300049586 Bacteria 1719
748 Ga0501070_0236614 3300049586 Bacteria 1495
749 Ga0501071_0000119 3300049587 Bacteria 31338
750 Ga0501071_0175141 3300049587 Bacteria 1607
751 Ga0501071_0432562 3300049587 Bacteria 1006
752 Ga0501072_0160959 3300049588 Bacteria 1790
753 Ga0501072_0570567 3300049588 Bacteria 893
754 Ga0501073_0000030 3300049589 Bacteria 115949
755 Ga0501073_0041926 3300049589 Bacteria 3232
756 Ga0501073_0124032 3300049589 Bacteria 1790
757 Ga0501073_0143186 3300049589 Bacteria 1656
758 Ga0501073_0510672 3300049589 Bacteria 831
759 Ga0501073_0611871 3300049589 Bacteria 752
760 Ga0501074_0028983 3300049590 Bacteria 4010
761 Ga0501074_0109265 3300049590 Bacteria 1979
762 Ga0501074_0257172 3300049590 Bacteria 1242
763 Ga0501074_0499410 3300049590 Bacteria 862
764 Ga0501075_0709706 3300049591 Bacteria 766
765 Ga0501076_0378201 3300049592 Bacteria 1164
766 Ga0501076_1528786 3300049592 Bacteria 548
767 Ga0501077_0914008 3300049593 Bacteria 565
768 Ga0501214_034494 3300049659 Bacteria 710
769 Ga0501080_0000208 3300049742 Bacteria 43436
770 Ga0501080_0079834 3300049742 Bacteria 3041
771 Ga0501080_0119382 3300049742 Bacteria 2444
772 Ga0501080_1194266 3300049742 Bacteria 654
773 Ga0501080_1661248 3300049742 Bacteria 540
774 Ga0501081_0628195 3300049743 Bacteria 805
775 Ga0501083_0015538 3300049744 Bacteria 5329
776 Ga0501083_0039761 3300049744 Bacteria 3194
777 Ga0501083_0142584 3300049744 Bacteria 1569
778 Ga0501083_0227432 3300049744 Bacteria 1215
779 Ga0501035_0013885 3300049822 Bacteria 7432
780 Ga0501035_0023629 3300049822 Bacteria 5640
781 Ga0501035_0360044 3300049822 Bacteria 1216
782 Ga0501035_0478328 3300049822 Bacteria 1027
783 Ga0501044_0001222 3300049823 Bacteria 30539
784 Ga0501044_0001531 3300049823 Bacteria 27116
785 Ga0501044_0021477 3300049823 Bacteria 6884
786 Ga0501044_0180571 3300049823 Bacteria 2077
787 Ga0501044_0705061 3300049823 Bacteria 894
788 Ga0501044_0743427 3300049823 Bacteria 863
789 Ga0501045_0114911 3300049824 Bacteria 1996
790 nmdc:mga03n38_210369_c1 3300050490 Bacteria 1011
791 nmdc:mga00v17_100204_c1 3300050491 Bacteria 1828
792 nmdc:mga00v17_113028_c1 3300050491 Bacteria 1724
793 nmdc:mga00v17_138040_c1 3300050491 Bacteria 1562
794 nmdc:mga00v17_165640_c1 3300050491 Bacteria 1424
795 nmdc:mga00v17_197603_c1 3300050491 Bacteria 1300
796 nmdc:mga00v17_231678_c1 3300050491 Bacteria 1197
797 nmdc:mga00v17_441872_c1 3300050491 Bacteria 845
798 nmdc:mga00v17_473228_c1 3300050491 Bacteria 813
799 nmdc:mga00v17_534563_c1 3300050491 Bacteria 759
800 nmdc:mga00v17_6859_c1 3300050491 Bacteria 6054
801 nmdc:mga00v17_702801_c1 3300050491 Bacteria 648
802 nmdc:mga0yw44_134716_c1 3300050492 Bacteria 1602
803 nmdc:mga0yw44_19106_c1 3300050492 Bacteria 3772
804 nmdc:mga0yw44_277_c1 3300050492 Bacteria 17596
805 nmdc:mga0yw44_593875_c1 3300050492 Bacteria 752
806 nmdc:mga0k408_226215_c1 3300050493 Bacteria 1117
807 nmdc:mga06z11_203705_c1 3300050494 Bacteria 1150
808 nmdc:mga06z11_23458_c1 3300050494 Bacteria 2899
809 nmdc:mga06z11_261886_c1 3300050494 Bacteria 1020
810 nmdc:mga04h51_226028_c1 3300050495 Bacteria 743
811 nmdc:mga04h51_27870_c1 3300050495 Bacteria 1759
812 nmdc:mga07m45_290131_c1 3300050496 Bacteria 952
813 nmdc:mga07m45_8187_c1 3300050496 Bacteria 5365
814 nmdc:mga08y16_357908_c1 3300050511 Bacteria 1498
815 nmdc:mga08y16_462766_c1 3300050511 Bacteria 1292
816 nmdc:mga0sz30_216985_c1 3300050516 Bacteria 850
817 nmdc:mga0sz30_308280_c1 3300050516 Bacteria 706
818 Ga0500635_0003539 3300053080 Bacteria 3944
819 Ga0500651_0004271 3300053093 Bacteria 7981
820 Ga0500650_0021930 3300053098 Bacteria 2820
821 Ga0500654_209616 3300053099 Bacteria 573
822 Ga0500556_0000020 3300053104 Bacteria 185929
823 Ga0500608_074519 3300053122 Bacteria 1610
824 Ga0500652_077661 3300053131 Bacteria 1381
825 Ga0500655_001124 3300053133 Bacteria 5107
826 Ga0500559_0070462 3300053136 Bacteria 1573
827 Ga0500559_0456316 3300053136 Bacteria 590
828 Ga0500568_0000038 3300053139 Bacteria 134267
829 Ga0500568_0002756 3300053139 Bacteria 10167
830 Ga0500573_0193781 3300053140 Bacteria 1083
831 Ga0500573_0241740 3300053140 Bacteria 935
832 Ga0500573_0293371 3300053140 Bacteria 816
833 Ga0500573_0349543 3300053140 Bacteria 718
834 Ga0500573_0443580 3300053140 Bacteria 602
835 Ga0500573_0540548 3300053140 Bacteria 518
836 Ga0500573_0555269 3300053140 Bacteria 507
837 Ga0500577_0122216 3300053142 Bacteria 1084
838 Ga0500577_0303883 3300053142 Bacteria 696
839 Ga0500606_169749 3300053152 Bacteria 694
840 Ga0500616_0000027 3300053153 Bacteria 441053
841 Ga0500616_0026699 3300053153 Bacteria 3194
842 Ga0500636_0249477 3300053177 Bacteria 906
843 Ga0500645_081041 3300053730 Bacteria 926
844 Ga0501084_0133108 3300054114 Bacteria 2093
845 Ga0501084_1524162 3300054114 Bacteria 559
846 Ga0587084_000004 3300059477 Bacteria 10690
847 Ga0587084_097638 3300059477 Bacteria 591
848 Ga0587093_051773 3300059478 Bacteria 650
849 Ga0587070_007986 3300059491 Bacteria 1485
850 Ga0587070_061502 3300059491 Bacteria 778
851 Ga0587073_0026582 3300059492 Bacteria 1161
852 Ga0587077_025220 3300059493 Bacteria 1089
853 Ga0587077_096467 3300059493 Bacteria 703
854 Ga0587080_108714 3300059503 Bacteria 602
855 Ga0587082_055807 3300059504 Bacteria 766
856 Ga0587082_065931 3300059504 Bacteria 725
857 Ga0587083_0124197 3300059505 Bacteria 670
858 Ga0587086_028379 3300059507 Bacteria 809
859 Ga0587086_051210 3300059507 Bacteria 666
860 Ga0587088_018103 3300059508 Bacteria 1142
861 Ga0587088_062998 3300059508 Bacteria 756
862 Ga0587089_017250 3300059509 Bacteria 969
863 Ga0587090_000311 3300059510 Bacteria 3800
864 Ga0587090_051852 3300059510 Bacteria 754
865 Ga0587092_005842 3300059512 Bacteria 1536
866 Ga0587094_001057 3300059513 Bacteria 2469
867 Ga0587095_002206 3300059514 Bacteria 1291
868 Ga0587095_004022 3300059514 Bacteria 1063
869 Ga0587098_000186 3300059604 Bacteria 3178
870 Ga0587106_013695 3300059605 Bacteria 1107
871 Ga0587106_016615 3300059605 Bacteria 1042
872 Ga0587106_154271 3300059605 Bacteria 513
873 Ga0587125_000024 3300059607 Bacteria 4952
874 Ga0587129_005457 3300059608 Bacteria 868
875 Ga0587099_005271 3300059622 Bacteria 1156
876 Ga0587101_000011 3300059623 Bacteria 8540
877 Ga0587101_007043 3300059623 Bacteria 1314
878 Ga0587101_064909 3300059623 Bacteria 660
879 Ga0587113_011663 3300059625 Bacteria 825
880 Ga0587115_000112 3300059626 Bacteria 4239
881 Ga0587117_012574 3300059627 Bacteria 1070
882 Ga0587122_054708 3300059628 Bacteria 525
883 Ga0587127_015589 3300059629 Bacteria 636
884 Ga0587128_000332 3300059630 Bacteria 3269
885 Ga0587128_053974 3300059630 Bacteria 741
886 Ga0587068_028950 3300059641 Bacteria 950
887 Ga0587068_069517 3300059641 Bacteria 692
888 Ga0587069_009037 3300059642 Bacteria 1276
889 Ga0587069_012760 3300059642 Bacteria 1145
890 Ga0587072_014536 3300059643 Bacteria 1327
891 Ga0587072_055636 3300059643 Bacteria 803
892 Ga0587075_046591 3300059644 Bacteria 744
893 Ga0587076_026022 3300059645 Bacteria 1005
894 Ga0587076_044515 3300059645 Bacteria 842
895 Ga0587076_045923 3300059645 Bacteria 834
896 Ga0587078_083251 3300059646 Bacteria 516
897 Ga0587079_013651 3300059647 Bacteria 1349
898 Ga0587079_080182 3300059647 Bacteria 745
899 Ga0587102_012056 3300059649 Bacteria 877
900 Ga0587102_028304 3300059649 Bacteria 672
901 Ga0587104_005156 3300059650 Bacteria 854
902 Ga0587105_017585 3300059651 Bacteria 604
903 Ga0587107_000354 3300059652 Bacteria 2862
904 Ga0587107_014792 3300059652 Bacteria 1008
905 Ga0587107_019950 3300059652 Bacteria 925
906 Ga0587110_012784 3300059654 Bacteria 870
907 Ga0587114_109321 3300059655 Bacteria 548
908 Ga0587119_025599 3300059658 Bacteria 779
909 Ga0587120_007104 3300059659 Bacteria 894
910 Ga0587124_000015 3300059660 Bacteria 5332
911 Ga0587096_02006 3300060247 Bacteria 740
912 Ga0587071_015645 3300060344 Bacteria 1333
913 Ga0587071_027227 3300060344 Bacteria 1082
914 Ga0587071_049865 3300060344 Bacteria 863
915 Ga0587111_0003826 3300060346 Bacteria 2182
916 Ga0587111_0031991 3300060346 Bacteria 1080
917 Ga0501082_0795512 3300060353 Bacteria 827
918 2588107948 2585428157 Bacteria 3018951
919 2643732582 2643221542 Bacteria 3563959
920 2643753713 2643221546 Bacteria 2910897
921 2643786352 2643221553 Bacteria 3544260
922 2643847785 2643221566 Bacteria 3460379
923 2643994812 2643221597 Bacteria 3347721
924 2644171382 2643221630 Bacteria 3601215
925 2644197850 2643221635 Bacteria 2632343
926 2644681052 2643221724 Bacteria 3593515
927 2730230515 2728369380 Bacteria 3620317
928 2747952122 2747842429 Bacteria 3914386
929 2758224802 2757320536 Bacteria 3629334
930 2774378926 2773857758 Bacteria 3592392
931 2774382013 2773857759 Bacteria 2963774
932 2774400772 2773857763 Bacteria 4180068
933 2808628774 2808606306 Bacteria 3608896
934 2808884765 2808606368 Bacteria 3174172
935 2809226247 2808606447 Bacteria 3572005
936 2812322084 2811994872 Bacteria 4121241
937 2821268996 2821268502 Bacteria 3750023
938 2833709886 2833709550 Bacteria 4008291
939 2844854316 2844852863 Bacteria 3849151
940 2852632506 2852632344 Bacteria 3463163
941 2852647584 2852646457 Bacteria 3408613
942 2852678576 2852677369 Bacteria 3768884
943 2857722755 2857720070 Bacteria 3189373
944 2857725834 2857723135 Bacteria 4217853
945 2857730662 2857729791 Bacteria 4040535
946 2870622179 2870622029 Bacteria 3643329
947 2870629391 2870628048 Bacteria 3696012
948 2897564327 2897561785 Bacteria 3256946
949 2904510388 2904509784 Bacteria 3520416
950 2906801162 2906799679 Bacteria 4031749
951 2908678394 2908678064 Bacteria 3482747
952 2919070718 2919069694 Bacteria 3622919
953 2919397187 2919395869 Bacteria 3704152
954 2928093825 2928090899 Bacteria 3158267
955 2928121468 2928121344 Bacteria 3972376
956 2945968751 2945968032 Bacteria 4111363
957 2946036575 2946033335 Bacteria 3835514
958 2946045192 2946041624 Bacteria 4191385
959 2946084041 2946080515 Bacteria 4310960
960 2966926525 2966924647 Bacteria 3268643
961 2974294872 2974294766 Bacteria 3767688
962 2974325328 2974324384 Bacteria 3750535
963 2977230290 2977228692 Bacteria 3450105
964 2977239094 2977236895 Bacteria 3569373
965 2977265508 2977264416 Bacteria 3750737
966 2984543121 2984542743 Bacteria 3569378
967 2984582488 2984580707 Bacteria 3351387
968 8004184521 8004182704 Bacteria 3391155
969 8004213327 8004212874 Bacteria 2861420
970 8016255127 8016254467 Bacteria 3797036
971 8045832188 8045830549 Bacteria 4444727
972 8055035305 8055034563 Bacteria 3562128
973 8056039387 8056037122 Bacteria 3854319
974 8057347405 8057345674 Bacteria 4160394
975 Ga0466970_0432150
976 Ga0006779J45831_102222
977 Ga0007427J51700_102557
978 Ga0006781J51513_1004015
979 Ga0006780_1005385
980 Ga0055542_1013670
981 Ga0065714_10085458
982 Ga0070658_10009122
983 Ga0070658_10037153
984 Ga0070658_10233660
985 Ga0070676_10260699
986 Ga0070676_10664489
987 Ga0070683_101690325
988 Ga0070682_100104911
989 Ga0070682_100319231
990 Ga0070682_101277947
991 Ga0068868_100083784
992 Ga0070660_100092686
993 Ga0070660_100319902
994 Ga0070661_100175362
995 Ga0070668_100021493
996 Ga0070669_100662421
997 Ga0070675_100169397
998 Ga0070675_100543105
999 Ga0070671_100053010
1000 Ga0070674_100270580
1001 Ga0070659_100003025
1002 Ga0070659_100021971
1003 Ga0070659_100398464
1004 Ga0070667_100042795
1005 Ga0070667_100964873
1006 Ga0070710_10076760
1007 Ga0070663_100016293
1008 Ga0070663_100482593
1009 Ga0070663_101607008
1010 Ga0070678_100231593
1011 Ga0068867_101541069
1012 Ga0070685_10061812
1013 Ga0068853_100213800
1014 Ga0068853_100225354
1015 Ga0068853_100923825
1016 Ga0070672_100066968
1017 Ga0070672_100705050
1018 Ga0070672_101452822
1019 Ga0070696_101062391
1020 Ga0070693_100509741
1021 Ga0070665_100077562
1022 Ga0068855_100047986
1023 Ga0068855_101352310
1024 Ga0070664_100778979
1025 Ga0068857_100258301
1026 Ga0068857_100304925
1027 Ga0068857_100375993
1028 Ga0068854_100203793
1029 Ga0068856_100096240
1030 Ga0068856_100748277
1031 Ga0068856_101258935
1032 Ga0068852_101894449
1033 Ga0068852_102108933
1034 Ga0068859_100436457
1035 Ga0068864_100500730
1036 Ga0068861_100331014
1037 Ga0068861_100901026
1038 Ga0068851_10000022
1039 Ga0068870_10016699
1040 Ga0068870_10789556
1041 Ga0068863_101020068
1042 Ga0068863_101308821
1043 Ga0068858_100199980
1044 Ga0068862_100612731
1045 Ga0075365_10012248
1046 Ga0075365_10020292
1047 Ga0075365_10227022
1048 Ga0075365_10512919
1049 Ga0075368_10014257
1050 Ga0075363_100225976
1051 Ga0075364_10130497
1052 Ga0075364_10198269
1053 Ga0075364_10212027
1054 Ga0075364_10227910
1055 Ga0075364_10432842
1056 Ga0075364_10849750
1057 Ga0075432_10221675
1058 Ga0075367_10009009
1059 Ga0075367_10167146
1060 Ga0075367_10777194
1061 Ga0075369_10017704
1062 Ga0075369_10414775
1063 Ga0075366_10091361
1064 Ga0097621_100143128
1065 Ga0097621_100613252
1066 Ga0075370_10048588
1067 Ga0075428_100682344
1068 Ga0068865_100792830
1069 Ga0097620_100436474
1070 Ga0105244_10004765
1071 Ga0105244_10034581
1072 Ga0105244_10197391
1073 Ga0105244_10208538
1074 Ga0105240_10070946
1075 Ga0105240_10557413
1076 Ga0105245_10255698
1077 Ga0105245_11476153
1078 Ga0105247_10242894
1079 Ga0105247_10316428
1080 Ga0105247_10928869
1081 Ga0105247_11271724
1082 Ga0105243_10179204
1083 Ga0105243_10253700
1084 Ga0105243_10613788
1085 Ga0105243_11234098
1086 Ga0105243_11356396
1087 Ga0105241_10028364
1088 Ga0105248_10410272
1089 Ga0105248_10463031
1090 Ga0105248_11228235
1091 Ga0105237_10031122
1092 Ga0105237_10669691
1093 Ga0105237_12131497
1094 Ga0105238_10027288
1095 Ga0105238_10438248
1096 Ga0105238_12491186
1097 Ga0105249_10086228
1098 Ga0105249_12050801
1099 Ga0105028_137232
1100 Ga0105239_10267366
1101 Ga0105239_11621087
1102 Ga0105239_11851537
1103 Ga0105246_11237319
1104 Ga0105246_12463316
1105 Ga0157373_10142177
1106 Ga0157371_10013796
1107 Ga0157371_10538714
1108 Ga0157371_11401264
1109 Ga0157370_10010513
1110 Ga0157370_10259819
1111 Ga0157370_10604984
1112 Ga0157370_10764268
1113 Ga0157370_11306663
1114 Ga0157370_11361098
1115 Ga0157369_10002930
1116 Ga0157369_10059481
1117 Ga0157369_10619795
1118 Ga0157369_11086173
1119 Ga0171462_1001
1120 Ga0157374_11218046
1121 Ga0163162_10286172
1122 Ga0163162_10407681
1123 Ga0163162_11148220
1124 Ga0163162_11942760
1125 Ga0157372_10200302
1126 Ga0157372_10395974
1127 Ga0157372_10548809
1128 Ga0157372_10877162
1129 Ga0157375_10832200
1130 Ga0157375_11467728
1131 Ga0163163_10056462
1132 Ga0163163_10473800
1133 Ga0157380_10596703
1134 Ga0157380_10856607
1135 Ga0157380_11821864
1136 Ga0157377_10823293
1137 Ga0157379_10079829
1138 Ga0157376_10983722
1139 Ga0157376_11573093
1140 Ga0157376_12651451
1141 Ga0163161_10180586
1142 Ga0163161_10406459
1143 Ga0163161_10669137
1144 Ga0163161_11043176
1145 Ga0197907_10274436
1146 Ga0197907_10555491
1147 Ga0206349_1158906
1148 Ga0206349_1702118
1149 Ga0206355_1137396
1150 Ga0206355_1343386
1151 Ga0206355_1409600
1152 Ga0206355_1642509
1153 Ga0206355_1689445
1154 Ga0206351_10537763
1155 Ga0206352_10962140
1156 Ga0206350_11103668
1157 Ga0206354_10603441
1158 Ga0206353_11035842
1159 Ga0206353_11100958
1160 Ga0154015_1337298
1161 Ga0224712_10195694
1162 Ga0224712_10327531
1163 Ga0224712_10631531
1164 Ga0256744_120521
1165 Ga0209646_1000013
1166 Ga0209646_1000014
1167 Ga0209148_1019038
1168 Ga0209025_1103719
1169 Ga0207656_10000005
1170 Ga0207655_1000386
1171 Ga0207655_1093316
1172 Ga0207682_10106898
1173 Ga0207692_10014203
1174 Ga0207692_10293942
1175 Ga0207710_10236693
1176 Ga0207688_10069625
1177 Ga0207688_10750778
1178 Ga0207680_10278281
1179 Ga0207647_10076267
1180 Ga0207645_10296018
1181 Ga0207643_10107470
1182 Ga0207643_10267142
1183 Ga0207705_10000001
1184 Ga0207705_10067626
1185 Ga0207654_10000001
1186 Ga0207695_10100413
1187 Ga0207695_10138337
1188 Ga0207671_10000016
1189 Ga0207671_10082507
1190 Ga0207671_11121203
1191 Ga0207663_10638057
1192 Ga0207657_10005997
1193 Ga0207657_10036712
1194 Ga0207657_10904799
1195 Ga0207649_11068311
1196 Ga0207652_11109821
1197 Ga0207652_11369443
1198 Ga0207681_10766295
1199 Ga0207694_10000057
1200 Ga0207694_10602481
1201 Ga0207650_10493042
1202 Ga0207659_10208411
1203 Ga0207659_10371726
1204 Ga0207687_10903461
1205 Ga0207644_10207643
1206 Ga0207644_10848829
1207 Ga0207690_10003803
1208 Ga0207690_10095961
1209 Ga0207690_10287694
1210 Ga0207709_10037724
1211 Ga0207709_10046229
1212 Ga0207709_10236921
1213 Ga0207709_11321513
1214 Ga0207669_10366408
1215 Ga0207691_10382609
1216 Ga0207711_10022131
1217 Ga0207711_10668680
1218 Ga0207661_11246513
1219 Ga0207667_10035600
1220 Ga0207667_10069574
1221 Ga0207667_10655227
1222 Ga0207668_10867954
1223 Ga0207668_11775902
1224 Ga0207640_10260817
1225 Ga0207658_10551283
1226 Ga0207658_10605749
1227 Ga0207677_10541056
1228 Ga0207703_10001453
1229 Ga0207703_12347938
1230 Ga0207639_10056116
1231 Ga0207639_10193937
1232 Ga0207639_10195614
1233 Ga0207678_10027691
1234 Ga0207678_10349298
1235 Ga0207678_10479024
1236 Ga0207678_10999169
1237 Ga0207678_11004479
1238 Ga0207678_11158563
1239 Ga0207702_10200036
1240 Ga0207702_10818798
1241 Ga0207702_11799327
1242 Ga0207648_11209788
1243 Ga0207676_10139684
1244 Ga0207676_11241686
1245 Ga0207674_10131056
1246 Ga0207674_10257091
1247 Ga0207675_100409019
1248 Ga0207683_10092851
1249 Ga0207683_10250969
1250 Ga0207698_10084580
1251 Ga0207698_11374576
1252 Ga0209813_10023881
1253 Ga0268265_10299071
1254 Ga0307515_10448326
1255 Ga0311001_1065528
1256 Ga0311001_1074009
1257 Ga0311001_1077971
1258 Ga0316181_1207534
1259 Ga0265769_102572
1260 Ga0307408_100294688
1261 Ga0307408_100875136
1262 Ga0307514_10047781
1263 Ga0307405_10197141
1264 Ga0307405_10319573
1265 Ga0307405_10394275
1266 Ga0307405_10826035
1267 Ga0307405_11858120
1268 Ga0307413_10370817
1269 Ga0307413_10558962
1270 Ga0307413_11513760
1271 Ga0307413_11721430
1272 Ga0307413_12162400
1273 Ga0307410_10008732
1274 Ga0307410_10447093
1275 Ga0307410_10675328
1276 Ga0307406_10000938
1277 Ga0307406_10216849
1278 Ga0307406_10401571
1279 Ga0307406_10427104
1280 Ga0307406_10459435
1281 Ga0307406_10479838
1282 Ga0307407_10117652
1283 Ga0307407_10301390
1284 Ga0307412_10198673
1285 Ga0307412_10278485
1286 Ga0307412_10387768
1287 Ga0307412_10897432
1288 Ga0307409_100004394
1289 Ga0307409_100989842
1290 Ga0307409_101939674
1291 Ga0307409_102024175
1292 Ga0307416_100005285
1293 Ga0307416_100744123
1294 Ga0307416_101469148
1295 Ga0307414_10269756
1296 Ga0307414_10309586
1297 Ga0307414_10520607
1298 Ga0307411_12059527
1299 Ga0307415_100008614
1300 Ga0307415_100201386
1301 Ga0307415_100607553
1302 Ga0307415_100960089
1303 Ga0307415_101084235
1304 Ga0395899_0162658
1305 Ga0395900_0006982
1306 Ga0395900_0263054
1307 Ga0395900_0438975
1308 Ga0395900_0451389
1309 Ga0395898_0019914
1310 Ga0395898_0852468
1311 Ga0395901_0085857
1312 Ga0237816_11011
1313 Ga0439436_0041933
1314 Ga0439439_0059326
1315 Ga0439461_0053344
1316 Ga0439461_0111934
1317 Ga0439466_0121782
1318 Ga0439465_0022200
1319 Ga0439465_0072314
1320 Ga0439465_0081676
1321 Ga0451787_246423
1322 Ga0451790_16668
1323 Ga0451794_51954
1324 Ga0451791_0252410
1325 Ga0451791_0522425
1326 Ga0451791_0885182
1327 Ga0451791_0946463
1328 Ga0451791_1667512
1329 Ga0451793_0114708
1330 Ga0451793_0364734
1331 Ga0451797_0447299
1332 Ga0451797_0573731
1333 Ga0451797_1305345
1334 Ga0451795_0457218
1335 Ga0451795_0898513
1336 Ga0451795_1334679
1337 Ga0451800_0760376
1338 Ga0451802_0834053
1339 Ga0451802_1970844
1340 Ga0451805_062275
1341 Ga0451805_105826
1342 Ga0451804_0489240
1343 Ga0451807_2527770
1344 Ga0451807_2680378
1345 Ga0451833_1022863
1346 Ga0451837_0158494
1347 Ga0451841_0676603
1348 Ga0451845_0769710
1349 Ga0451847_0326429
1350 Ga0451855_0157124
1351 Ga0451855_1282023
1352 Ga0451855_1919360
1353 Ga0451853_0210551
1354 Ga0451853_0362195
1355 Ga0451853_1287593
1356 Ga0451853_3699793
1357 Ga0439431_0023873
1358 Ga0439431_0058250
1359 Ga0439442_040323
1360 Ga0439449_0386704
1361 Ga0439457_082023
1362 Ga0439463_024047
1363 Ga0450920_023388
1364 Ga0450923_019939
1365 Ga0450902_017328
1366 Ga0450905_019201
1367 Ga0450905_024562
1368 Ga0450906_071078
1369 Ga0450910_074924
1370 Ga0439446_0171586
1371 Ga0450909_036270
1372 Ga0439459_0055691
1373 Ga0439459_0105076
1374 Ga0439464_0203545
1375 Ga0450918_002834
1376 Ga0450918_020516
1377 Ga0466972_0106471
1378 Ga0466972_0412879
1379 Ga0466965_0000003
1380 Ga0466965_0023372
1381 Ga0466965_0279776
1382 Ga0466968_0162456
1383 Ga0466970_0000027
1384 Ga0466957_0481872
1385 Ga0466958_0181544
1386 Ga0466958_0842770
1387 Ga0466967_0086122
1388 Ga0495627_001687
1389 Ga0495590_0327161
1390 Ga0495638_0063229
1391 Ga0495638_0115266
1392 Ga0495650_0002639
1393 Ga0495650_0093875
1394 Ga0495650_0109089
1395 Ga0495639_0351832
1396 Ga0495620_0160846
1397 Ga0495620_0343423
1398 Ga0495631_0197683
1399 Ga0495632_0104569
1400 Ga0495643_0095066
1401 Ga0495643_0370741
1402 Ga0495663_0203307
1403 Ga0495654_0029667
1404 Ga0495587_0586571
1405 Ga0495598_0021497
1406 Ga0495645_0050080
1407 Ga0495645_0323490
1408 Ga0495645_0478378
1409 Ga0495633_0473560
1410 Ga0495656_0023242
1411 Ga0495625_0678898
1412 Ga0495658_0375610
1413 Ga0495624_0891625
1414 Ga0495671_0122328
1415 Ga0495649_0160447
1416 Ga0495600_0274860
1417 Ga0495672_0011493
1418 Ga0495686_0067922
1419 Ga0495686_0227840
1420 Ga0495686_0246858
1421 Ga0495602_0601624
1422 Ga0495615_0301450
1423 Ga0496100_0011682
1424 Ga0496100_0025779
1425 Ga0496100_0410090
1426 Ga0496101_0002898
1427 Ga0496101_0123527
1428 Ga0496102_0089571
1429 Ga0496102_0188751
1430 Ga0496103_0010181
1431 Ga0496103_0024216
1432 Ga0496104_0015491
1433 Ga0496104_0171501
1434 Ga0496104_0579457
1435 Ga0496104_1294508
1436 Ga0496104_1381368
1437 Ga0496105_0009192
1438 Ga0496105_0045124
1439 Ga0496105_0145356
1440 Ga0496105_0278400
1441 Ga0496105_0350452
1442 Ga0496105_0939262
1443 Ga0496106_0117833
1444 Ga0496107_0001328
1445 Ga0496107_0227663
1446 Ga0496108_0047565
1447 Ga0496108_0378828
1448 Ga0496108_1577978
1449 Ga0496109_0016841
1450 Ga0496109_0042506
1451 Ga0496109_0219854
1452 Ga0496109_1907855
1453 Ga0496110_0036804
1454 Ga0496110_0567031
1455 Ga0496111_0012648
1456 Ga0496111_0138419
1457 Ga0496111_0236721
1458 Ga0496111_0282014
1459 Ga0496111_0968826
1460 Ga0496112_0020079
1461 Ga0496113_0005620
1462 Ga0496113_0258695
1463 Ga0496113_1150051
1464 Ga0496114_0002463
1465 Ga0496114_0194217
1466 Ga0496114_0265025
1467 Ga0496114_0297517
1468 Ga0496114_0487680
1469 Ga0496114_0518177
1470 Ga0496115_0002702
1471 Ga0496115_0045726
1472 Ga0496115_0092488
1473 Ga0496115_0216657
1474 Ga0496115_0327444
1475 Ga0496116_0021611
1476 Ga0496116_0267126
1477 Ga0496117_0000362
1478 Ga0496117_0003610
1479 Ga0496117_0004032
1480 Ga0496117_0006530
1481 Ga0496117_0009885
1482 Ga0496117_0059887
1483 Ga0496117_0108984
1484 Ga0496117_0546609
1485 Ga0496118_0002856
1486 Ga0496118_0043816
1487 Ga0496119_0000720
1488 Ga0496119_0006250
1489 Ga0496119_0025618
1490 Ga0496119_0046717
1491 Ga0496119_0049436
1492 Ga0496119_0190207
1493 Ga0496119_0192228
1494 Ga0496119_0251481
1495 Ga0496119_0275352
1496 Ga0496119_0316247
1497 Ga0496119_0336832
1498 Ga0496119_0453570
1499 Ga0496120_0007276
1500 Ga0496120_0013513
1501 Ga0496120_0022013
1502 Ga0496120_0038694
1503 Ga0496120_0109839
1504 Ga0496120_0221924
1505 Ga0496121_0000497
1506 Ga0496121_0026877
1507 Ga0496122_0000022
1508 Ga0496122_0000799
1509 Ga0496122_0005147
1510 Ga0496122_0010341
1511 Ga0496122_0026775
1512 Ga0496122_0119930
1513 Ga0496122_0435742
1514 Ga0496122_0523403
1515 Ga0496123_0000009
1516 Ga0496123_0000016
1517 Ga0496123_0002420
1518 Ga0496123_0020865
1519 Ga0496123_0083824
1520 Ga0496123_0182963
1521 Ga0496123_0237916
1522 Ga0496124_0002766
1523 Ga0496124_0006965
1524 Ga0496124_0046380
1525 Ga0496125_0001491
1526 Ga0496125_0002578
1527 Ga0496125_0016052
1528 Ga0496125_0029529
1529 Ga0496125_0123889
1530 Ga0496126_0002077
1531 Ga0496126_0002563
1532 Ga0496126_0015145
1533 Ga0496126_0020288
1534 Ga0496126_0029883
1535 Ga0496126_0089792
1536 Ga0496126_0141466
1537 Ga0496126_0263130
1538 Ga0496126_0392660
1539 Ga0501306_000074
1540 Ga0501306_000560
1541 Ga0501306_009610
1542 Ga0501306_044904
1543 Ga0501306_091381
1544 Ga0501308_002157
1545 Ga0501308_004467
1546 Ga0501309_000615
1547 Ga0501309_003216
1548 Ga0501309_021404
1549 Ga0501309_056572
1550 Ga0501310_002153
1551 Ga0501310_006171
1552 Ga0501310_007007
1553 Ga0501310_007679
1554 Ga0501310_020196
1555 Ga0501341_01921
1556 Ga0501341_03734
1557 Ga0501341_04190
1558 Ga0501304_001479
1559 Ga0501304_025540
1560 Ga0501304_029583
1561 Ga0501304_030253
1562 Ga0501305_003699
1563 Ga0501305_090353
1564 Ga0501307_000930
1565 Ga0501307_007279
1566 Ga0501307_013113
1567 Ga0501307_013962
1568 Ga0501307_018450
1569 Ga0501307_030182
1570 Ga0501307_039061
1571 Ga0501311_000216
1572 Ga0501311_003504
1573 Ga0501311_006499
1574 Ga0501311_024279
1575 Ga0501311_064511
1576 Ga0501312_011327
1577 Ga0501312_016522
1578 Ga0501312_037408
1579 Ga0501312_040937
1580 Ga0501313_005880
1581 Ga0501313_071242
1582 Ga0501314_002632
1583 Ga0501314_021280
1584 Ga0501315_002877
1585 Ga0501315_020592
1586 Ga0501315_047156
1587 Ga0501316_000435
1588 Ga0501316_009910
1589 Ga0501316_013098
1590 Ga0501316_013217
1591 Ga0501316_023780
1592 Ga0501317_001951
1593 Ga0501317_011943
1594 Ga0501317_014096
1595 Ga0501317_026782
1596 Ga0501317_076255
1597 Ga0501318_000070
1598 Ga0501318_013616
1599 Ga0501318_050164
1600 Ga0501318_061498
1601 Ga0501319_000088
1602 Ga0501319_004101
1603 Ga0501319_006052
1604 Ga0501320_002053
1605 Ga0501320_013226
1606 Ga0501321_000212
1607 Ga0501321_007064
1608 Ga0501321_010938
1609 Ga0501323_005116
1610 Ga0501323_006917
1611 Ga0501323_007033
1612 Ga0501324_001941
1613 Ga0501324_008804
1614 Ga0501325_001231
1615 Ga0501325_003351
1616 Ga0501325_012426
1617 Ga0501326_08559
1618 Ga0501327_10274
1619 Ga0501330_006252
1620 Ga0501330_008606
1621 Ga0501330_010575
1622 Ga0501330_015283
1623 Ga0501331_07226
1624 Ga0501332_02792
1625 Ga0501332_07209
1626 Ga0501334_13800
1627 Ga0501335_012651
1628 Ga0501336_004708
1629 Ga0501337_005088
1630 Ga0501338_11695
1631 Ga0501340_002551
1632 Ga0501340_011976
1633 Ga0501340_012709
1634 Ga0501031_0053231
1635 Ga0501031_0154726
1636 Ga0501031_0185874
1637 Ga0501031_0233826
1638 Ga0501032_0003386
1639 Ga0501032_0011095
1640 Ga0501032_0017365
1641 Ga0501033_0002214
1642 Ga0501033_0004032
1643 Ga0501033_0004858
1644 Ga0501033_0147016
1645 Ga0501033_0357914
1646 Ga0501034_0002490
1647 Ga0501034_0008687
1648 Ga0501034_0022444
1649 Ga0501034_0032413
1650 Ga0501034_0057847
1651 Ga0501034_0078054
1652 Ga0501034_0208027
1653 Ga0501034_0213629
1654 Ga0501034_0240972
1655 Ga0501034_0290985
1656 Ga0501034_0557893
1657 Ga0501034_1091062
1658 Ga0501034_1264223
1659 Ga0501034_1574227
1660 Ga0501036_0039389
1661 Ga0501036_0240730
1662 Ga0501036_0544297
1663 Ga0501036_0656143
1664 Ga0501036_0670647
1665 Ga0501036_0943498
1666 Ga0501037_0001422
1667 Ga0501037_0084416
1668 Ga0501037_0160205
1669 Ga0501037_0232969
1670 Ga0501037_0309292
1671 Ga0501037_0901739
1672 Ga0501038_0003511
1673 Ga0501038_0021820
1674 Ga0501038_0126029
1675 Ga0501038_0344075
1676 Ga0501038_0370455
1677 Ga0501038_0573279
1678 Ga0501039_0008941
1679 Ga0501039_0114351
1680 Ga0501039_0388898
1681 Ga0501039_0565281
1682 Ga0501039_0828073
1683 Ga0501039_0886832
1684 Ga0501039_0967576
1685 Ga0501040_0348686
1686 Ga0501040_0705388
1687 Ga0501042_0009674
1688 Ga0501042_0098304
1689 Ga0501042_0292483
1690 Ga0501042_0998805
1691 Ga0501043_0016944
1692 Ga0501043_0048230
1693 Ga0501043_0065288
1694 Ga0501043_0100265
1695 Ga0501043_0784689
1696 Ga0501046_0013742
1697 Ga0501046_0023204
1698 Ga0501047_0001782
1699 Ga0501047_0006944
1700 Ga0501047_0034189
1701 Ga0501048_0013228
1702 Ga0501048_0016304
1703 Ga0501048_0022961
1704 Ga0501048_0291761
1705 Ga0501048_0411271
1706 Ga0501067_0023885
1707 Ga0501067_0400834
1708 Ga0501068_0045634
1709 Ga0501068_0087080
1710 Ga0501068_0666368
1711 Ga0501069_0035485
1712 Ga0501069_0037626
1713 Ga0501069_0106583
1714 Ga0501069_0429571
1715 Ga0501069_0735944
1716 Ga0501070_0000874
1717 Ga0501070_0014598
1718 Ga0501070_0015639
1719 Ga0501070_0048708
1720 Ga0501070_0170892
1721 Ga0501070_0183881
1722 Ga0501070_0236614
1723 Ga0501071_0000119
1724 Ga0501071_0175141
1725 Ga0501071_0432562
1726 Ga0501072_0160959
1727 Ga0501072_0570567
1728 Ga0501073_0000030
1729 Ga0501073_0041926
1730 Ga0501073_0124032
1731 Ga0501073_0143186
1732 Ga0501073_0510672
1733 Ga0501073_0611871
1734 Ga0501074_0028983
1735 Ga0501074_0109265
1736 Ga0501074_0257172
1737 Ga0501074_0499410
1738 Ga0501075_0709706
1739 Ga0501076_0378201
1740 Ga0501076_1528786
1741 Ga0501077_0914008
1742 Ga0501214_034494
1743 Ga0501080_0000208
1744 Ga0501080_0079834
1745 Ga0501080_0119382
1746 Ga0501080_1194266
1747 Ga0501080_1661248
1748 Ga0501081_0628195
1749 Ga0501083_0015538
1750 Ga0501083_0039761
1751 Ga0501083_0142584
1752 Ga0501083_0227432
1753 Ga0501035_0013885
1754 Ga0501035_0023629
1755 Ga0501035_0360044
1756 Ga0501035_0478328
1757 Ga0501044_0001222
1758 Ga0501044_0001531
1759 Ga0501044_0021477
1760 Ga0501044_0180571
1761 Ga0501044_0705061
1762 Ga0501044_0743427
1763 Ga0501045_0114911
1764 nmdc:mga03n38_210369_c1
1765 nmdc:mga00v17_100204_c1
1766 nmdc:mga00v17_113028_c1
1767 nmdc:mga00v17_138040_c1
1768 nmdc:mga00v17_165640_c1
1769 nmdc:mga00v17_197603_c1
1770 nmdc:mga00v17_231678_c1
1771 nmdc:mga00v17_441872_c1
1772 nmdc:mga00v17_473228_c1
1773 nmdc:mga00v17_534563_c1
1774 nmdc:mga00v17_6859_c1
1775 nmdc:mga00v17_702801_c1
1776 nmdc:mga0yw44_134716_c1
1777 nmdc:mga0yw44_19106_c1
1778 nmdc:mga0yw44_277_c1
1779 nmdc:mga0yw44_593875_c1
1780 nmdc:mga0k408_226215_c1
1781 nmdc:mga06z11_203705_c1
1782 nmdc:mga06z11_23458_c1
1783 nmdc:mga06z11_261886_c1
1784 nmdc:mga04h51_226028_c1
1785 nmdc:mga04h51_27870_c1
1786 nmdc:mga07m45_290131_c1
1787 nmdc:mga07m45_8187_c1
1788 nmdc:mga08y16_357908_c1
1789 nmdc:mga08y16_462766_c1
1790 nmdc:mga0sz30_216985_c1
1791 nmdc:mga0sz30_308280_c1
1792 Ga0500635_0003539
1793 Ga0500651_0004271
1794 Ga0500650_0021930
1795 Ga0500654_209616
1796 Ga0500556_0000020
1797 Ga0500608_074519
1798 Ga0500652_077661
1799 Ga0500655_001124
1800 Ga0500559_0070462
1801 Ga0500559_0456316
1802 Ga0500568_0000038
1803 Ga0500568_0002756
1804 Ga0500573_0193781
1805 Ga0500573_0241740
1806 Ga0500573_0293371
1807 Ga0500573_0349543
1808 Ga0500573_0443580
1809 Ga0500573_0540548
1810 Ga0500573_0555269
1811 Ga0500577_0122216
1812 Ga0500577_0303883
1813 Ga0500606_169749
1814 Ga0500616_0000027
1815 Ga0500616_0026699
1816 Ga0500636_0249477
1817 Ga0500645_081041
1818 Ga0501084_0133108
1819 Ga0501084_1524162
1820 Ga0587084_000004
1821 Ga0587084_097638
1822 Ga0587093_051773
1823 Ga0587070_007986
1824 Ga0587070_061502
1825 Ga0587073_0026582
1826 Ga0587077_025220
1827 Ga0587077_096467
1828 Ga0587080_108714
1829 Ga0587082_055807
1830 Ga0587082_065931
1831 Ga0587083_0124197
1832 Ga0587086_028379
1833 Ga0587086_051210
1834 Ga0587088_018103
1835 Ga0587088_062998
1836 Ga0587089_017250
1837 Ga0587090_000311
1838 Ga0587090_051852
1839 Ga0587092_005842
1840 Ga0587094_001057
1841 Ga0587095_002206
1842 Ga0587095_004022
1843 Ga0587098_000186
1844 Ga0587106_013695
1845 Ga0587106_016615
1846 Ga0587106_154271
1847 Ga0587125_000024
1848 Ga0587129_005457
1849 Ga0587099_005271
1850 Ga0587101_000011
1851 Ga0587101_007043
1852 Ga0587101_064909
1853 Ga0587113_011663
1854 Ga0587115_000112
1855 Ga0587117_012574
1856 Ga0587122_054708
1857 Ga0587127_015589
1858 Ga0587128_000332
1859 Ga0587128_053974
1860 Ga0587068_028950
1861 Ga0587068_069517
1862 Ga0587069_009037
1863 Ga0587069_012760
1864 Ga0587072_014536
1865 Ga0587072_055636
1866 Ga0587075_046591
1867 Ga0587076_026022
1868 Ga0587076_044515
1869 Ga0587076_045923
1870 Ga0587078_083251
1871 Ga0587079_013651
1872 Ga0587079_080182
1873 Ga0587102_012056
1874 Ga0587102_028304
1875 Ga0587104_005156
1876 Ga0587105_017585
1877 Ga0587107_000354
1878 Ga0587107_014792
1879 Ga0587107_019950
1880 Ga0587110_012784
1881 Ga0587114_109321
1882 Ga0587119_025599
1883 Ga0587120_007104
1884 Ga0587124_000015
1885 Ga0587096_02006
1886 Ga0587071_015645
1887 Ga0587071_027227
1888 Ga0587071_049865
1889 Ga0587111_0003826
1890 Ga0587111_0031991
1891 Ga0501082_0795512
1892 2588107948
1893 2643732582
1894 2643753713
1895 2643786352
1896 2643847785
1897 2643994812
1898 2644171382
1899 2644197850
1900 2644681052
1901 2730230515
1902 2747952122
1903 2758224802
1904 2774378926
1905 2774382013
1906 2774400772
1907 2808628774
1908 2808884765
1909 2809226247
1910 2812322084
1911 2821268996
1912 2833709886
1913 2844854316
1914 2852632506
1915 2852647584
1916 2852678576
1917 2857722755
1918 2857725834
1919 2857730662
1920 2870622179
1921 2870629391
1922 2897564327
1923 2904510388
1924 2906801162
1925 2908678394
1926 2919070718
1927 2919397187
1928 2928093825
1929 2928121468
1930 2945968751
1931 2946036575
1932 2946045192
1933 2946084041
1934 2966926525
1935 2974294872
1936 2974325328
1937 2977230290
1938 2977239094
1939 2977265508
1940 2984543121
1941 2984582488
1942 8004184521
1943 8004213327
1944 8016255127
1945 8045832188
1946 8055035305
1947 8056039387
1948 8057347405

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00237

Ribosomal_L22

Ribosomal protein L22p/L17e

6

104

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c94-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9197 3 114
6czr-assembly2.cif.gz_2W the structure of amicetin bound to the 70s ribosome 0.9113 3 115
8c97-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9107 3 114
7nhn-assembly1.cif.gz_V vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9098 3 116
6pvk-assembly1.cif.gz_S bacterial 45srbga ribosomal particle class a 0.9076 4 116
ID Description Score Start End Superfamily
af_A0A0P0YAA5_35_146_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.904 3 117 3.90.470.10
af_P56795_7_145_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8956 2 115 3.90.470.10
af_P9WHC1_2_148_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.889 3 118 3.90.470.10
5jvgP00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.883 5 115 3.90.470.10
4g5uS00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.8809 3 115 3.90.470.10
ID Description Score Start End GO Terms
AF-A0A2P7AE44-F1-model_v4 deleted 0.9349 1 118
AF-A0A6L9XSY5-F1-model_v4 Large ribosomal subunit protein uL22 0.9338 1 116 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-C5CC57-F1-model_v4 Large ribosomal subunit protein uL22 (50S ribosomal protein L22) 0.9327 3 115 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A7Y4X9P2-F1-model_v4 Large ribosomal subunit protein uL22 0.9315 3 114 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-B7GND5-F1-model_v4 Large ribosomal subunit protein uL22 (50S ribosomal protein L22) 0.9305 3 115 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Map