F487212
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 974 | 463 | 1948 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300044765|Ga0466970_0432150|Ga0466970_0432150_92_454 |
| Length | 120 |
| Sequence | MVESIARVRHIRVTPMKARRVVNMIRGKQAQEALAILKFAPQGASEPVYKLVASAIANARVKQDLYVSRAFVDEGTTLKRFQPRAQGRAFRINKRTSHITIVLATPDEVEDAKATKKASK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 2 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 90 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 149 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 150 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 151 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 170 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 171 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 172 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 173 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 174 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 175 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 177 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 178 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 185 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 188 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 189 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 190 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 191 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 192 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 195 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 196 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 197 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 198 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 199 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 200 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 201 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 202 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 203 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 204 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 205 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 206 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 207 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 261 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 262 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 344 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 345 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 348 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 350 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 351 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 354 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 355 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 356 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 357 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 408 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 409 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 410 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 411 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 412 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 413 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 414 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 415 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 416 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 417 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 418 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 419 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 420 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 421 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 422 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 423 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 424 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 425 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 426 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 427 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 428 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 429 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 430 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 431 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 432 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 433 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 434 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 435 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 436 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 437 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 438 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 439 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 440 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 441 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 442 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 443 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 444 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 445 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 446 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 447 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 448 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 449 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 450 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 451 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 452 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 453 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 454 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 455 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 456 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 457 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 458 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 459 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 460 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 461 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 462 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 463 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.82 |
| Metatranscriptomes | 20.33 |
| Isolates | 5.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 7.7 |
| Nodule | 0 |
| Rhizoplane | 7.8 |
| Rhizosphere | 72.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466970_0432150 | 3300044765 | Bacteria | 753 |
| 2 | Ga0006779J45831_102222 | 3300003160 | Bacteria | 5110 |
| 3 | Ga0007427J51700_102557 | 3300003559 | Bacteria | 6979 |
| 4 | Ga0006781J51513_1004015 | 3300003568 | Bacteria | 4443 |
| 5 | Ga0006780_1005385 | 3300003735 | Bacteria | 6163 |
| 6 | Ga0055542_1013670 | 3300003762 | Bacteria | 1358 |
| 7 | Ga0065714_10085458 | 3300005288 | Bacteria | 2148 |
| 8 | Ga0070658_10009122 | 3300005327 | Bacteria | 7974 |
| 9 | Ga0070658_10037153 | 3300005327 | Bacteria | 3925 |
| 10 | Ga0070658_10233660 | 3300005327 | Bacteria | 1557 |
| 11 | Ga0070676_10260699 | 3300005328 | Bacteria | 1161 |
| 12 | Ga0070676_10664489 | 3300005328 | Bacteria | 758 |
| 13 | Ga0070683_101690325 | 3300005329 | Bacteria | 609 |
| 14 | Ga0070682_100104911 | 3300005337 | Bacteria | 1873 |
| 15 | Ga0070682_100319231 | 3300005337 | Bacteria | 1146 |
| 16 | Ga0070682_101277947 | 3300005337 | Bacteria | 623 |
| 17 | Ga0068868_100083784 | 3300005338 | Bacteria | 2560 |
| 18 | Ga0070660_100092686 | 3300005339 | Bacteria | 2385 |
| 19 | Ga0070660_100319902 | 3300005339 | Bacteria | 1274 |
| 20 | Ga0070661_100175362 | 3300005344 | Bacteria | 1629 |
| 21 | Ga0070668_100021493 | 3300005347 | Bacteria | 4875 |
| 22 | Ga0070669_100662421 | 3300005353 | Bacteria | 879 |
| 23 | Ga0070675_100169397 | 3300005354 | Bacteria | 1882 |
| 24 | Ga0070675_100543105 | 3300005354 | Bacteria | 1050 |
| 25 | Ga0070671_100053010 | 3300005355 | Bacteria | 3372 |
| 26 | Ga0070674_100270580 | 3300005356 | Bacteria | 1342 |
| 27 | Ga0070659_100003025 | 3300005366 | Bacteria | 11966 |
| 28 | Ga0070659_100021971 | 3300005366 | Bacteria | 4867 |
| 29 | Ga0070659_100398464 | 3300005366 | Bacteria | 1161 |
| 30 | Ga0070667_100042795 | 3300005367 | Bacteria | 3800 |
| 31 | Ga0070667_100964873 | 3300005367 | Bacteria | 795 |
| 32 | Ga0070710_10076760 | 3300005437 | Bacteria | 1940 |
| 33 | Ga0070663_100016293 | 3300005455 | Bacteria | 4823 |
| 34 | Ga0070663_100482593 | 3300005455 | Bacteria | 1026 |
| 35 | Ga0070663_101607008 | 3300005455 | Bacteria | 580 |
| 36 | Ga0070678_100231593 | 3300005456 | Bacteria | 1540 |
| 37 | Ga0068867_101541069 | 3300005459 | Bacteria | 620 |
| 38 | Ga0070685_10061812 | 3300005466 | Bacteria | 2194 |
| 39 | Ga0068853_100213800 | 3300005539 | Bacteria | 1758 |
| 40 | Ga0068853_100225354 | 3300005539 | Bacteria | 1713 |
| 41 | Ga0068853_100923825 | 3300005539 | Bacteria | 839 |
| 42 | Ga0070672_100066968 | 3300005543 | Bacteria | 2844 |
| 43 | Ga0070672_100705050 | 3300005543 | Bacteria | 884 |
| 44 | Ga0070672_101452822 | 3300005543 | Bacteria | 614 |
| 45 | Ga0070696_101062391 | 3300005546 | Bacteria | 679 |
| 46 | Ga0070693_100509741 | 3300005547 | Bacteria | 855 |
| 47 | Ga0070665_100077562 | 3300005548 | Bacteria | 3329 |
| 48 | Ga0068855_100047986 | 3300005563 | Bacteria | 5042 |
| 49 | Ga0068855_101352310 | 3300005563 | Bacteria | 735 |
| 50 | Ga0070664_100778979 | 3300005564 | Bacteria | 894 |
| 51 | Ga0068857_100258301 | 3300005577 | Bacteria | 1598 |
| 52 | Ga0068857_100304925 | 3300005577 | Bacteria | 1468 |
| 53 | Ga0068857_100375993 | 3300005577 | Bacteria | 1318 |
| 54 | Ga0068854_100203793 | 3300005578 | Bacteria | 1557 |
| 55 | Ga0068856_100096240 | 3300005614 | Bacteria | 2949 |
| 56 | Ga0068856_100748277 | 3300005614 | Bacteria | 997 |
| 57 | Ga0068856_101258935 | 3300005614 | Bacteria | 755 |
| 58 | Ga0068852_101894449 | 3300005616 | Bacteria | 618 |
| 59 | Ga0068852_102108933 | 3300005616 | Bacteria | 585 |
| 60 | Ga0068859_100436457 | 3300005617 | Bacteria | 1406 |
| 61 | Ga0068864_100500730 | 3300005618 | Bacteria | 1169 |
| 62 | Ga0068861_100331014 | 3300005719 | Bacteria | 1329 |
| 63 | Ga0068861_100901026 | 3300005719 | Bacteria | 838 |
| 64 | Ga0068851_10000022 | 3300005834 | Bacteria | 129607 |
| 65 | Ga0068870_10016699 | 3300005840 | Bacteria | 3514 |
| 66 | Ga0068870_10789556 | 3300005840 | Bacteria | 662 |
| 67 | Ga0068863_101020068 | 3300005841 | Bacteria | 830 |
| 68 | Ga0068863_101308821 | 3300005841 | Bacteria | 732 |
| 69 | Ga0068858_100199980 | 3300005842 | Bacteria | 1889 |
| 70 | Ga0068862_100612731 | 3300005844 | Bacteria | 1046 |
| 71 | Ga0075365_10012248 | 3300006038 | Bacteria | 5084 |
| 72 | Ga0075365_10020292 | 3300006038 | Bacteria | 4118 |
| 73 | Ga0075365_10227022 | 3300006038 | Bacteria | 1310 |
| 74 | Ga0075365_10512919 | 3300006038 | Bacteria | 848 |
| 75 | Ga0075368_10014257 | 3300006042 | Bacteria | 2933 |
| 76 | Ga0075363_100225976 | 3300006048 | Bacteria | 1074 |
| 77 | Ga0075364_10130497 | 3300006051 | Bacteria | 1686 |
| 78 | Ga0075364_10198269 | 3300006051 | Bacteria | 1360 |
| 79 | Ga0075364_10212027 | 3300006051 | Bacteria | 1313 |
| 80 | Ga0075364_10227910 | 3300006051 | Bacteria | 1265 |
| 81 | Ga0075364_10432842 | 3300006051 | Bacteria | 898 |
| 82 | Ga0075364_10849750 | 3300006051 | Bacteria | 622 |
| 83 | Ga0075432_10221675 | 3300006058 | Bacteria | 757 |
| 84 | Ga0075367_10009009 | 3300006178 | Bacteria | 5197 |
| 85 | Ga0075367_10167146 | 3300006178 | Bacteria | 1369 |
| 86 | Ga0075367_10777194 | 3300006178 | Bacteria | 610 |
| 87 | Ga0075369_10017704 | 3300006186 | Bacteria | 2893 |
| 88 | Ga0075369_10414775 | 3300006186 | Bacteria | 635 |
| 89 | Ga0075366_10091361 | 3300006195 | Bacteria | 1823 |
| 90 | Ga0097621_100143128 | 3300006237 | Bacteria | 2045 |
| 91 | Ga0097621_100613252 | 3300006237 | Bacteria | 995 |
| 92 | Ga0075370_10048588 | 3300006353 | Bacteria | 2403 |
| 93 | Ga0075428_100682344 | 3300006844 | Bacteria | 1095 |
| 94 | Ga0068865_100792830 | 3300006881 | Bacteria | 817 |
| 95 | Ga0097620_100436474 | 3300006931 | Bacteria | 1406 |
| 96 | Ga0105244_10004765 | 3300009036 | Bacteria | 9234 |
| 97 | Ga0105244_10034581 | 3300009036 | Bacteria | 2659 |
| 98 | Ga0105244_10197391 | 3300009036 | Bacteria | 950 |
| 99 | Ga0105244_10208538 | 3300009036 | Bacteria | 920 |
| 100 | Ga0105240_10070946 | 3300009093 | Bacteria | 4308 |
| 101 | Ga0105240_10557413 | 3300009093 | Bacteria | 1267 |
| 102 | Ga0105245_10255698 | 3300009098 | Bacteria | 1703 |
| 103 | Ga0105245_11476153 | 3300009098 | Bacteria | 731 |
| 104 | Ga0105247_10242894 | 3300009101 | Bacteria | 1228 |
| 105 | Ga0105247_10316428 | 3300009101 | Bacteria | 1087 |
| 106 | Ga0105247_10928869 | 3300009101 | Bacteria | 674 |
| 107 | Ga0105247_11271724 | 3300009101 | Bacteria | 589 |
| 108 | Ga0105243_10179204 | 3300009148 | Bacteria | 1841 |
| 109 | Ga0105243_10253700 | 3300009148 | Bacteria | 1572 |
| 110 | Ga0105243_10613788 | 3300009148 | Bacteria | 1049 |
| 111 | Ga0105243_11234098 | 3300009148 | Bacteria | 762 |
| 112 | Ga0105243_11356396 | 3300009148 | Bacteria | 730 |
| 113 | Ga0105241_10028364 | 3300009174 | Bacteria | 4171 |
| 114 | Ga0105248_10410272 | 3300009177 | Bacteria | 1525 |
| 115 | Ga0105248_10463031 | 3300009177 | Bacteria | 1429 |
| 116 | Ga0105248_11228235 | 3300009177 | Bacteria | 847 |
| 117 | Ga0105237_10031122 | 3300009545 | Bacteria | 5412 |
| 118 | Ga0105237_10669691 | 3300009545 | Bacteria | 1044 |
| 119 | Ga0105237_12131497 | 3300009545 | Bacteria | 570 |
| 120 | Ga0105238_10027288 | 3300009551 | Bacteria | 5817 |
| 121 | Ga0105238_10438248 | 3300009551 | Bacteria | 1303 |
| 122 | Ga0105238_12491186 | 3300009551 | Bacteria | 553 |
| 123 | Ga0105249_10086228 | 3300009553 | Bacteria | 2928 |
| 124 | Ga0105249_12050801 | 3300009553 | Bacteria | 645 |
| 125 | Ga0105028_137232 | 3300009993 | Bacteria | 547 |
| 126 | Ga0105239_10267366 | 3300010375 | Bacteria | 1923 |
| 127 | Ga0105239_11621087 | 3300010375 | Bacteria | 748 |
| 128 | Ga0105239_11851537 | 3300010375 | Bacteria | 699 |
| 129 | Ga0105246_11237319 | 3300011119 | Bacteria | 689 |
| 130 | Ga0105246_12463316 | 3300011119 | Bacteria | 511 |
| 131 | Ga0157373_10142177 | 3300013100 | Bacteria | 1688 |
| 132 | Ga0157371_10013796 | 3300013102 | Bacteria | 6121 |
| 133 | Ga0157371_10538714 | 3300013102 | Bacteria | 865 |
| 134 | Ga0157371_11401264 | 3300013102 | Bacteria | 543 |
| 135 | Ga0157370_10010513 | 3300013104 | Bacteria | 9746 |
| 136 | Ga0157370_10259819 | 3300013104 | Bacteria | 1605 |
| 137 | Ga0157370_10604984 | 3300013104 | Bacteria | 1003 |
| 138 | Ga0157370_10764268 | 3300013104 | Bacteria | 880 |
| 139 | Ga0157370_11306663 | 3300013104 | Bacteria | 653 |
| 140 | Ga0157370_11361098 | 3300013104 | Bacteria | 639 |
| 141 | Ga0157369_10002930 | 3300013105 | Bacteria | 20411 |
| 142 | Ga0157369_10059481 | 3300013105 | Bacteria | 4120 |
| 143 | Ga0157369_10619795 | 3300013105 | Bacteria | 1116 |
| 144 | Ga0157369_11086173 | 3300013105 | Bacteria | 818 |
| 145 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 146 | Ga0157374_11218046 | 3300013296 | Bacteria | 774 |
| 147 | Ga0163162_10286172 | 3300013306 | Bacteria | 1780 |
| 148 | Ga0163162_10407681 | 3300013306 | Bacteria | 1492 |
| 149 | Ga0163162_11148220 | 3300013306 | Bacteria | 881 |
| 150 | Ga0163162_11942760 | 3300013306 | Bacteria | 674 |
| 151 | Ga0157372_10200302 | 3300013307 | Bacteria | 2312 |
| 152 | Ga0157372_10395974 | 3300013307 | Bacteria | 1609 |
| 153 | Ga0157372_10548809 | 3300013307 | Bacteria | 1347 |
| 154 | Ga0157372_10877162 | 3300013307 | Bacteria | 1041 |
| 155 | Ga0157375_10832200 | 3300013308 | Bacteria | 1070 |
| 156 | Ga0157375_11467728 | 3300013308 | Bacteria | 804 |
| 157 | Ga0163163_10056462 | 3300014325 | Bacteria | 3881 |
| 158 | Ga0163163_10473800 | 3300014325 | Bacteria | 1313 |
| 159 | Ga0157380_10596703 | 3300014326 | Bacteria | 1092 |
| 160 | Ga0157380_10856607 | 3300014326 | Bacteria | 931 |
| 161 | Ga0157380_11821864 | 3300014326 | Bacteria | 668 |
| 162 | Ga0157377_10823293 | 3300014745 | Bacteria | 687 |
| 163 | Ga0157379_10079829 | 3300014968 | Bacteria | 2930 |
| 164 | Ga0157376_10983722 | 3300014969 | Bacteria | 865 |
| 165 | Ga0157376_11573093 | 3300014969 | Bacteria | 691 |
| 166 | Ga0157376_12651451 | 3300014969 | Bacteria | 541 |
| 167 | Ga0163161_10180586 | 3300017792 | Bacteria | 1618 |
| 168 | Ga0163161_10406459 | 3300017792 | Bacteria | 1093 |
| 169 | Ga0163161_10669137 | 3300017792 | Bacteria | 862 |
| 170 | Ga0163161_11043176 | 3300017792 | Bacteria | 700 |
| 171 | Ga0197907_10274436 | 3300020069 | Bacteria | 814 |
| 172 | Ga0197907_10555491 | 3300020069 | Bacteria | 1294 |
| 173 | Ga0206349_1158906 | 3300020075 | Bacteria | 750 |
| 174 | Ga0206349_1702118 | 3300020075 | Bacteria | 760 |
| 175 | Ga0206355_1137396 | 3300020076 | Bacteria | 2655 |
| 176 | Ga0206355_1343386 | 3300020076 | Bacteria | 1466 |
| 177 | Ga0206355_1409600 | 3300020076 | Bacteria | 1297 |
| 178 | Ga0206355_1642509 | 3300020076 | Bacteria | 1217 |
| 179 | Ga0206355_1689445 | 3300020076 | Bacteria | 1243 |
| 180 | Ga0206351_10537763 | 3300020077 | Bacteria | 1970 |
| 181 | Ga0206352_10962140 | 3300020078 | Bacteria | 507 |
| 182 | Ga0206350_11103668 | 3300020080 | Bacteria | 841 |
| 183 | Ga0206354_10603441 | 3300020081 | Bacteria | 851 |
| 184 | Ga0206353_11035842 | 3300020082 | Bacteria | 4726 |
| 185 | Ga0206353_11100958 | 3300020082 | Bacteria | 1244 |
| 186 | Ga0154015_1337298 | 3300020610 | Bacteria | 778 |
| 187 | Ga0224712_10195694 | 3300022467 | Bacteria | 917 |
| 188 | Ga0224712_10327531 | 3300022467 | Bacteria | 721 |
| 189 | Ga0224712_10631531 | 3300022467 | Bacteria | 524 |
| 190 | Ga0256744_120521 | 3300023309 | Bacteria | 1056 |
| 191 | Ga0209646_1000013 | 3300025246 | Bacteria | 565830 |
| 192 | Ga0209646_1000014 | 3300025246 | Bacteria | 550484 |
| 193 | Ga0209148_1019038 | 3300025254 | Bacteria | 1145 |
| 194 | Ga0209025_1103719 | 3300025294 | Bacteria | 892 |
| 195 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 196 | Ga0207655_1000386 | 3300025728 | Bacteria | 61740 |
| 197 | Ga0207655_1093316 | 3300025728 | Bacteria | 1054 |
| 198 | Ga0207682_10106898 | 3300025893 | Bacteria | 1228 |
| 199 | Ga0207692_10014203 | 3300025898 | Bacteria | 3475 |
| 200 | Ga0207692_10293942 | 3300025898 | Bacteria | 987 |
| 201 | Ga0207710_10236693 | 3300025900 | Bacteria | 910 |
| 202 | Ga0207688_10069625 | 3300025901 | Bacteria | 1994 |
| 203 | Ga0207688_10750778 | 3300025901 | Bacteria | 618 |
| 204 | Ga0207680_10278281 | 3300025903 | Bacteria | 1162 |
| 205 | Ga0207647_10076267 | 3300025904 | Bacteria | 2016 |
| 206 | Ga0207645_10296018 | 3300025907 | Bacteria | 1077 |
| 207 | Ga0207643_10107470 | 3300025908 | Bacteria | 1641 |
| 208 | Ga0207643_10267142 | 3300025908 | Bacteria | 1058 |
| 209 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 210 | Ga0207705_10067626 | 3300025909 | Bacteria | 2586 |
| 211 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 212 | Ga0207695_10100413 | 3300025913 | Bacteria | 2890 |
| 213 | Ga0207695_10138337 | 3300025913 | Bacteria | 2387 |
| 214 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 215 | Ga0207671_10082507 | 3300025914 | Bacteria | 2412 |
| 216 | Ga0207671_11121203 | 3300025914 | Bacteria | 617 |
| 217 | Ga0207663_10638057 | 3300025916 | Bacteria | 840 |
| 218 | Ga0207657_10005997 | 3300025919 | Bacteria | 12644 |
| 219 | Ga0207657_10036712 | 3300025919 | Bacteria | 4384 |
| 220 | Ga0207657_10904799 | 3300025919 | Bacteria | 680 |
| 221 | Ga0207649_11068311 | 3300025920 | Bacteria | 636 |
| 222 | Ga0207652_11109821 | 3300025921 | Bacteria | 691 |
| 223 | Ga0207652_11369443 | 3300025921 | Bacteria | 611 |
| 224 | Ga0207681_10766295 | 3300025923 | Bacteria | 805 |
| 225 | Ga0207694_10000057 | 3300025924 | Bacteria | 146441 |
| 226 | Ga0207694_10602481 | 3300025924 | Bacteria | 924 |
| 227 | Ga0207650_10493042 | 3300025925 | Bacteria | 1023 |
| 228 | Ga0207659_10208411 | 3300025926 | Bacteria | 1565 |
| 229 | Ga0207659_10371726 | 3300025926 | Bacteria | 1190 |
| 230 | Ga0207687_10903461 | 3300025927 | Bacteria | 756 |
| 231 | Ga0207644_10207643 | 3300025931 | Bacteria | 1547 |
| 232 | Ga0207644_10848829 | 3300025931 | Bacteria | 765 |
| 233 | Ga0207690_10003803 | 3300025932 | Bacteria | 8937 |
| 234 | Ga0207690_10095961 | 3300025932 | Bacteria | 2107 |
| 235 | Ga0207690_10287694 | 3300025932 | Bacteria | 1282 |
| 236 | Ga0207709_10037724 | 3300025935 | Bacteria | 2873 |
| 237 | Ga0207709_10046229 | 3300025935 | Bacteria | 2641 |
| 238 | Ga0207709_10236921 | 3300025935 | Bacteria | 1325 |
| 239 | Ga0207709_11321513 | 3300025935 | Bacteria | 596 |
| 240 | Ga0207669_10366408 | 3300025937 | Bacteria | 1118 |
| 241 | Ga0207691_10382609 | 3300025940 | Bacteria | 1201 |
| 242 | Ga0207711_10022131 | 3300025941 | Bacteria | 5314 |
| 243 | Ga0207711_10668680 | 3300025941 | Bacteria | 969 |
| 244 | Ga0207661_11246513 | 3300025944 | Bacteria | 684 |
| 245 | Ga0207667_10035600 | 3300025949 | Bacteria | 5340 |
| 246 | Ga0207667_10069574 | 3300025949 | Bacteria | 3663 |
| 247 | Ga0207667_10655227 | 3300025949 | Bacteria | 1055 |
| 248 | Ga0207668_10867954 | 3300025972 | Bacteria | 802 |
| 249 | Ga0207668_11775902 | 3300025972 | Bacteria | 557 |
| 250 | Ga0207640_10260817 | 3300025981 | Bacteria | 1350 |
| 251 | Ga0207658_10551283 | 3300025986 | Bacteria | 1032 |
| 252 | Ga0207658_10605749 | 3300025986 | Bacteria | 984 |
| 253 | Ga0207677_10541056 | 3300026023 | Bacteria | 1013 |
| 254 | Ga0207703_10001453 | 3300026035 | Bacteria | 21613 |
| 255 | Ga0207703_12347938 | 3300026035 | Bacteria | 509 |
| 256 | Ga0207639_10056116 | 3300026041 | Bacteria | 3018 |
| 257 | Ga0207639_10193937 | 3300026041 | Bacteria | 1737 |
| 258 | Ga0207639_10195614 | 3300026041 | Bacteria | 1730 |
| 259 | Ga0207678_10027691 | 3300026067 | Bacteria | 4947 |
| 260 | Ga0207678_10349298 | 3300026067 | Bacteria | 1275 |
| 261 | Ga0207678_10479024 | 3300026067 | Bacteria | 1084 |
| 262 | Ga0207678_10999169 | 3300026067 | Bacteria | 740 |
| 263 | Ga0207678_11004479 | 3300026067 | Bacteria | 738 |
| 264 | Ga0207678_11158563 | 3300026067 | Bacteria | 685 |
| 265 | Ga0207702_10200036 | 3300026078 | Bacteria | 1851 |
| 266 | Ga0207702_10818798 | 3300026078 | Bacteria | 921 |
| 267 | Ga0207702_11799327 | 3300026078 | Bacteria | 605 |
| 268 | Ga0207648_11209788 | 3300026089 | Bacteria | 710 |
| 269 | Ga0207676_10139684 | 3300026095 | Bacteria | 2072 |
| 270 | Ga0207676_11241686 | 3300026095 | Bacteria | 739 |
| 271 | Ga0207674_10131056 | 3300026116 | Bacteria | 2470 |
| 272 | Ga0207674_10257091 | 3300026116 | Bacteria | 1693 |
| 273 | Ga0207675_100409019 | 3300026118 | Bacteria | 1338 |
| 274 | Ga0207683_10092851 | 3300026121 | Bacteria | 2689 |
| 275 | Ga0207683_10250969 | 3300026121 | Bacteria | 1615 |
| 276 | Ga0207698_10084580 | 3300026142 | Bacteria | 2572 |
| 277 | Ga0207698_11374576 | 3300026142 | Bacteria | 721 |
| 278 | Ga0209813_10023881 | 3300027866 | Bacteria | 1742 |
| 279 | Ga0268265_10299071 | 3300028380 | Bacteria | 1448 |
| 280 | Ga0307515_10448326 | 3300028794 | Bacteria | 906 |
| 281 | Ga0311001_1065528 | 3300029277 | Bacteria | 710 |
| 282 | Ga0311001_1074009 | 3300029277 | Bacteria | 625 |
| 283 | Ga0311001_1077971 | 3300029277 | Bacteria | 841 |
| 284 | Ga0316181_1207534 | 3300030744 | Bacteria | 701 |
| 285 | Ga0265769_102572 | 3300030888 | Bacteria | 960 |
| 286 | Ga0307408_100294688 | 3300031548 | Bacteria | 1356 |
| 287 | Ga0307408_100875136 | 3300031548 | Bacteria | 820 |
| 288 | Ga0307514_10047781 | 3300031649 | Bacteria | 3339 |
| 289 | Ga0307405_10197141 | 3300031731 | Bacteria | 1459 |
| 290 | Ga0307405_10319573 | 3300031731 | Bacteria | 1185 |
| 291 | Ga0307405_10394275 | 3300031731 | Bacteria | 1082 |
| 292 | Ga0307405_10826035 | 3300031731 | Bacteria | 778 |
| 293 | Ga0307405_11858120 | 3300031731 | Bacteria | 536 |
| 294 | Ga0307413_10370817 | 3300031824 | Bacteria | 1112 |
| 295 | Ga0307413_10558962 | 3300031824 | Bacteria | 929 |
| 296 | Ga0307413_11513760 | 3300031824 | Bacteria | 593 |
| 297 | Ga0307413_11721430 | 3300031824 | Bacteria | 559 |
| 298 | Ga0307413_12162400 | 3300031824 | Bacteria | 504 |
| 299 | Ga0307410_10008732 | 3300031852 | Bacteria | 5638 |
| 300 | Ga0307410_10447093 | 3300031852 | Bacteria | 1053 |
| 301 | Ga0307410_10675328 | 3300031852 | Bacteria | 868 |
| 302 | Ga0307406_10000938 | 3300031901 | Bacteria | 16294 |
| 303 | Ga0307406_10216849 | 3300031901 | Bacteria | 1419 |
| 304 | Ga0307406_10401571 | 3300031901 | Bacteria | 1086 |
| 305 | Ga0307406_10427104 | 3300031901 | Bacteria | 1057 |
| 306 | Ga0307406_10459435 | 3300031901 | Bacteria | 1023 |
| 307 | Ga0307406_10479838 | 3300031901 | Bacteria | 1004 |
| 308 | Ga0307407_10117652 | 3300031903 | Bacteria | 1679 |
| 309 | Ga0307407_10301390 | 3300031903 | Bacteria | 1117 |
| 310 | Ga0307412_10198673 | 3300031911 | Bacteria | 1521 |
| 311 | Ga0307412_10278485 | 3300031911 | Bacteria | 1312 |
| 312 | Ga0307412_10387768 | 3300031911 | Bacteria | 1133 |
| 313 | Ga0307412_10897432 | 3300031911 | Bacteria | 776 |
| 314 | Ga0307409_100004394 | 3300031995 | Bacteria | 7914 |
| 315 | Ga0307409_100989842 | 3300031995 | Bacteria | 858 |
| 316 | Ga0307409_101939674 | 3300031995 | Bacteria | 618 |
| 317 | Ga0307409_102024175 | 3300031995 | Bacteria | 605 |
| 318 | Ga0307416_100005285 | 3300032002 | Bacteria | 7910 |
| 319 | Ga0307416_100744123 | 3300032002 | Bacteria | 1072 |
| 320 | Ga0307416_101469148 | 3300032002 | Bacteria | 787 |
| 321 | Ga0307414_10269756 | 3300032004 | Bacteria | 1424 |
| 322 | Ga0307414_10309586 | 3300032004 | Bacteria | 1340 |
| 323 | Ga0307414_10520607 | 3300032004 | Bacteria | 1055 |
| 324 | Ga0307411_12059527 | 3300032005 | Bacteria | 533 |
| 325 | Ga0307415_100008614 | 3300032126 | Bacteria | 5665 |
| 326 | Ga0307415_100201386 | 3300032126 | Bacteria | 1580 |
| 327 | Ga0307415_100607553 | 3300032126 | Bacteria | 974 |
| 328 | Ga0307415_100960089 | 3300032126 | Bacteria | 792 |
| 329 | Ga0307415_101084235 | 3300032126 | Bacteria | 749 |
| 330 | Ga0395899_0162658 | 3300037312 | Bacteria | 1576 |
| 331 | Ga0395900_0006982 | 3300037418 | Bacteria | 11701 |
| 332 | Ga0395900_0263054 | 3300037418 | Bacteria | 1722 |
| 333 | Ga0395900_0438975 | 3300037418 | Bacteria | 1263 |
| 334 | Ga0395900_0451389 | 3300037418 | Bacteria | 1242 |
| 335 | Ga0395898_0019914 | 3300037466 | Bacteria | 6823 |
| 336 | Ga0395898_0852468 | 3300037466 | Bacteria | 850 |
| 337 | Ga0395901_0085857 | 3300038443 | Bacteria | 3290 |
| 338 | Ga0237816_11011 | 3300039145 | Bacteria | 516 |
| 339 | Ga0439436_0041933 | 3300041404 | Bacteria | 1309 |
| 340 | Ga0439439_0059326 | 3300041406 | Bacteria | 1014 |
| 341 | Ga0439461_0053344 | 3300041410 | Bacteria | 902 |
| 342 | Ga0439461_0111934 | 3300041410 | Bacteria | 675 |
| 343 | Ga0439466_0121782 | 3300041411 | Bacteria | 805 |
| 344 | Ga0439465_0022200 | 3300041413 | Bacteria | 1993 |
| 345 | Ga0439465_0072314 | 3300041413 | Bacteria | 1157 |
| 346 | Ga0439465_0081676 | 3300041413 | Bacteria | 1097 |
| 347 | Ga0451787_246423 | 3300041441 | Bacteria | 550 |
| 348 | Ga0451790_16668 | 3300041444 | Bacteria | 891 |
| 349 | Ga0451794_51954 | 3300041446 | Bacteria | 1045 |
| 350 | Ga0451791_0252410 | 3300041451 | Bacteria | 1057 |
| 351 | Ga0451791_0522425 | 3300041451 | Bacteria | 544 |
| 352 | Ga0451791_0885182 | 3300041451 | Bacteria | 1060 |
| 353 | Ga0451791_0946463 | 3300041451 | Bacteria | 689 |
| 354 | Ga0451791_1667512 | 3300041451 | Bacteria | 1376 |
| 355 | Ga0451793_0114708 | 3300041452 | Bacteria | 707 |
| 356 | Ga0451793_0364734 | 3300041452 | Bacteria | 514 |
| 357 | Ga0451797_0447299 | 3300041453 | Bacteria | 900 |
| 358 | Ga0451797_0573731 | 3300041453 | Bacteria | 662 |
| 359 | Ga0451797_1305345 | 3300041453 | Bacteria | 630 |
| 360 | Ga0451795_0457218 | 3300041456 | Bacteria | 1099 |
| 361 | Ga0451795_0898513 | 3300041456 | Bacteria | 753 |
| 362 | Ga0451795_1334679 | 3300041456 | Bacteria | 516 |
| 363 | Ga0451800_0760376 | 3300041459 | Bacteria | 708 |
| 364 | Ga0451802_0834053 | 3300041460 | Bacteria | 658 |
| 365 | Ga0451802_1970844 | 3300041460 | Bacteria | 552 |
| 366 | Ga0451805_062275 | 3300041461 | Bacteria | 604 |
| 367 | Ga0451805_105826 | 3300041461 | Bacteria | 667 |
| 368 | Ga0451804_0489240 | 3300041463 | Bacteria | 1143 |
| 369 | Ga0451807_2527770 | 3300041486 | Bacteria | 616 |
| 370 | Ga0451807_2680378 | 3300041486 | Bacteria | 1321 |
| 371 | Ga0451833_1022863 | 3300041491 | Bacteria | 603 |
| 372 | Ga0451837_0158494 | 3300041494 | Bacteria | 1146 |
| 373 | Ga0451841_0676603 | 3300041498 | Bacteria | 1556 |
| 374 | Ga0451845_0769710 | 3300041501 | Bacteria | 537 |
| 375 | Ga0451847_0326429 | 3300041503 | Bacteria | 624 |
| 376 | Ga0451855_0157124 | 3300041511 | Bacteria | 933 |
| 377 | Ga0451855_1282023 | 3300041511 | Bacteria | 582 |
| 378 | Ga0451855_1919360 | 3300041511 | Bacteria | 711 |
| 379 | Ga0451853_0210551 | 3300041512 | Bacteria | 687 |
| 380 | Ga0451853_0362195 | 3300041512 | Bacteria | 675 |
| 381 | Ga0451853_1287593 | 3300041512 | Bacteria | 858 |
| 382 | Ga0451853_3699793 | 3300041512 | Bacteria | 755 |
| 383 | Ga0439431_0023873 | 3300041997 | Bacteria | 1484 |
| 384 | Ga0439431_0058250 | 3300041997 | Bacteria | 1012 |
| 385 | Ga0439442_040323 | 3300042002 | Bacteria | 980 |
| 386 | Ga0439449_0386704 | 3300042007 | Bacteria | 531 |
| 387 | Ga0439457_082023 | 3300042014 | Bacteria | 742 |
| 388 | Ga0439463_024047 | 3300042016 | Bacteria | 1526 |
| 389 | Ga0450920_023388 | 3300042122 | Bacteria | 1198 |
| 390 | Ga0450923_019939 | 3300042125 | Bacteria | 1296 |
| 391 | Ga0450902_017328 | 3300042137 | Bacteria | 1177 |
| 392 | Ga0450905_019201 | 3300042142 | Bacteria | 1000 |
| 393 | Ga0450905_024562 | 3300042142 | Bacteria | 903 |
| 394 | Ga0450906_071078 | 3300042145 | Bacteria | 623 |
| 395 | Ga0450910_074924 | 3300042147 | Bacteria | 586 |
| 396 | Ga0439446_0171586 | 3300042156 | Bacteria | 722 |
| 397 | Ga0450909_036270 | 3300042185 | Bacteria | 754 |
| 398 | Ga0439459_0055691 | 3300042438 | Bacteria | 881 |
| 399 | Ga0439459_0105076 | 3300042438 | Bacteria | 696 |
| 400 | Ga0439464_0203545 | 3300042439 | Bacteria | 632 |
| 401 | Ga0450918_002834 | 3300042531 | Bacteria | 3257 |
| 402 | Ga0450918_020516 | 3300042531 | Bacteria | 1155 |
| 403 | Ga0466972_0106471 | 3300044658 | Bacteria | 1326 |
| 404 | Ga0466972_0412879 | 3300044658 | Bacteria | 633 |
| 405 | Ga0466965_0000003 | 3300044683 | Bacteria | 265985 |
| 406 | Ga0466965_0023372 | 3300044683 | Bacteria | 2985 |
| 407 | Ga0466965_0279776 | 3300044683 | Bacteria | 901 |
| 408 | Ga0466968_0162456 | 3300044735 | Bacteria | 1031 |
| 409 | Ga0466970_0000027 | 3300044765 | Bacteria | 56103 |
| 410 | Ga0466957_0481872 | 3300044842 | Bacteria | 858 |
| 411 | Ga0466958_0181544 | 3300045836 | Bacteria | 1335 |
| 412 | Ga0466958_0842770 | 3300045836 | Bacteria | 598 |
| 413 | Ga0466967_0086122 | 3300045976 | Bacteria | 2846 |
| 414 | Ga0495627_001687 | 3300046453 | Bacteria | 12164 |
| 415 | Ga0495590_0327161 | 3300046457 | Bacteria | 580 |
| 416 | Ga0495638_0063229 | 3300046460 | Bacteria | 2282 |
| 417 | Ga0495638_0115266 | 3300046460 | Bacteria | 1593 |
| 418 | Ga0495650_0002639 | 3300046471 | Bacteria | 14025 |
| 419 | Ga0495650_0093875 | 3300046471 | Bacteria | 1137 |
| 420 | Ga0495650_0109089 | 3300046471 | Bacteria | 1030 |
| 421 | Ga0495639_0351832 | 3300046475 | Bacteria | 740 |
| 422 | Ga0495620_0160846 | 3300046515 | Bacteria | 872 |
| 423 | Ga0495620_0343423 | 3300046515 | Bacteria | 566 |
| 424 | Ga0495631_0197683 | 3300046518 | Bacteria | 860 |
| 425 | Ga0495632_0104569 | 3300046519 | Bacteria | 1333 |
| 426 | Ga0495643_0095066 | 3300046522 | Bacteria | 1533 |
| 427 | Ga0495643_0370741 | 3300046522 | Bacteria | 637 |
| 428 | Ga0495663_0203307 | 3300046525 | Bacteria | 692 |
| 429 | Ga0495654_0029667 | 3300046530 | Bacteria | 2788 |
| 430 | Ga0495587_0586571 | 3300046536 | Bacteria | 614 |
| 431 | Ga0495598_0021497 | 3300046537 | Bacteria | 1717 |
| 432 | Ga0495645_0050080 | 3300046543 | Bacteria | 3041 |
| 433 | Ga0495645_0323490 | 3300046543 | Bacteria | 1001 |
| 434 | Ga0495645_0478378 | 3300046543 | Bacteria | 782 |
| 435 | Ga0495633_0473560 | 3300046558 | Bacteria | 565 |
| 436 | Ga0495656_0023242 | 3300046615 | Bacteria | 2438 |
| 437 | Ga0495625_0678898 | 3300046660 | Bacteria | 610 |
| 438 | Ga0495658_0375610 | 3300046683 | Bacteria | 905 |
| 439 | Ga0495624_0891625 | 3300046690 | Bacteria | 524 |
| 440 | Ga0495671_0122328 | 3300046692 | Bacteria | 1269 |
| 441 | Ga0495649_0160447 | 3300046694 | Bacteria | 1179 |
| 442 | Ga0495600_0274860 | 3300046809 | Bacteria | 1068 |
| 443 | Ga0495672_0011493 | 3300047320 | Bacteria | 6245 |
| 444 | Ga0495686_0067922 | 3300047472 | Bacteria | 2200 |
| 445 | Ga0495686_0227840 | 3300047472 | Bacteria | 1057 |
| 446 | Ga0495686_0246858 | 3300047472 | Bacteria | 1004 |
| 447 | Ga0495602_0601624 | 3300048088 | Bacteria | 756 |
| 448 | Ga0495615_0301450 | 3300048090 | Bacteria | 519 |
| 449 | Ga0496100_0011682 | 3300048903 | Bacteria | 5004 |
| 450 | Ga0496100_0025779 | 3300048903 | Bacteria | 3597 |
| 451 | Ga0496100_0410090 | 3300048903 | Bacteria | 1033 |
| 452 | Ga0496101_0002898 | 3300048904 | Bacteria | 10559 |
| 453 | Ga0496101_0123527 | 3300048904 | Bacteria | 1959 |
| 454 | Ga0496102_0089571 | 3300048905 | Bacteria | 2847 |
| 455 | Ga0496102_0188751 | 3300048905 | Bacteria | 1942 |
| 456 | Ga0496103_0010181 | 3300048906 | Bacteria | 5560 |
| 457 | Ga0496103_0024216 | 3300048906 | Bacteria | 3662 |
| 458 | Ga0496104_0015491 | 3300048907 | Bacteria | 6903 |
| 459 | Ga0496104_0171501 | 3300048907 | Bacteria | 2080 |
| 460 | Ga0496104_0579457 | 3300048907 | Bacteria | 1033 |
| 461 | Ga0496104_1294508 | 3300048907 | Bacteria | 632 |
| 462 | Ga0496104_1381368 | 3300048907 | Bacteria | 607 |
| 463 | Ga0496105_0009192 | 3300048908 | Bacteria | 7715 |
| 464 | Ga0496105_0045124 | 3300048908 | Bacteria | 3636 |
| 465 | Ga0496105_0145356 | 3300048908 | Bacteria | 1950 |
| 466 | Ga0496105_0278400 | 3300048908 | Bacteria | 1349 |
| 467 | Ga0496105_0350452 | 3300048908 | Bacteria | 1179 |
| 468 | Ga0496105_0939262 | 3300048908 | Bacteria | 650 |
| 469 | Ga0496106_0117833 | 3300048909 | Bacteria | 2073 |
| 470 | Ga0496107_0001328 | 3300048910 | Bacteria | 15168 |
| 471 | Ga0496107_0227663 | 3300048910 | Bacteria | 1387 |
| 472 | Ga0496108_0047565 | 3300048911 | Bacteria | 3586 |
| 473 | Ga0496108_0378828 | 3300048911 | Bacteria | 1235 |
| 474 | Ga0496108_1577978 | 3300048911 | Bacteria | 544 |
| 475 | Ga0496109_0016841 | 3300048912 | Bacteria | 6396 |
| 476 | Ga0496109_0042506 | 3300048912 | Bacteria | 4117 |
| 477 | Ga0496109_0219854 | 3300048912 | Bacteria | 1786 |
| 478 | Ga0496109_1907855 | 3300048912 | Bacteria | 526 |
| 479 | Ga0496110_0036804 | 3300048913 | Bacteria | 4251 |
| 480 | Ga0496110_0567031 | 3300048913 | Bacteria | 1031 |
| 481 | Ga0496111_0012648 | 3300048914 | Bacteria | 5719 |
| 482 | Ga0496111_0138419 | 3300048914 | Bacteria | 1804 |
| 483 | Ga0496111_0236721 | 3300048914 | Bacteria | 1356 |
| 484 | Ga0496111_0282014 | 3300048914 | Bacteria | 1232 |
| 485 | Ga0496111_0968826 | 3300048914 | Bacteria | 610 |
| 486 | Ga0496112_0020079 | 3300048915 | Bacteria | 6325 |
| 487 | Ga0496113_0005620 | 3300048916 | Bacteria | 7845 |
| 488 | Ga0496113_0258695 | 3300048916 | Bacteria | 1390 |
| 489 | Ga0496113_1150051 | 3300048916 | Bacteria | 607 |
| 490 | Ga0496114_0002463 | 3300048917 | Bacteria | 14129 |
| 491 | Ga0496114_0194217 | 3300048917 | Bacteria | 1776 |
| 492 | Ga0496114_0265025 | 3300048917 | Bacteria | 1513 |
| 493 | Ga0496114_0297517 | 3300048917 | Bacteria | 1425 |
| 494 | Ga0496114_0487680 | 3300048917 | Bacteria | 1090 |
| 495 | Ga0496114_0518177 | 3300048917 | Bacteria | 1054 |
| 496 | Ga0496115_0002702 | 3300048918 | Bacteria | 12733 |
| 497 | Ga0496115_0045726 | 3300048918 | Bacteria | 3495 |
| 498 | Ga0496115_0092488 | 3300048918 | Bacteria | 2472 |
| 499 | Ga0496115_0216657 | 3300048918 | Bacteria | 1580 |
| 500 | Ga0496115_0327444 | 3300048918 | Bacteria | 1252 |
| 501 | Ga0496116_0021611 | 3300048919 | Bacteria | 4845 |
| 502 | Ga0496116_0267126 | 3300048919 | Bacteria | 839 |
| 503 | Ga0496117_0000362 | 3300048920 | Bacteria | 79224 |
| 504 | Ga0496117_0003610 | 3300048920 | Bacteria | 17825 |
| 505 | Ga0496117_0004032 | 3300048920 | Bacteria | 16539 |
| 506 | Ga0496117_0006530 | 3300048920 | Bacteria | 11750 |
| 507 | Ga0496117_0009885 | 3300048920 | Bacteria | 8783 |
| 508 | Ga0496117_0059887 | 3300048920 | Bacteria | 2627 |
| 509 | Ga0496117_0108984 | 3300048920 | Bacteria | 1730 |
| 510 | Ga0496117_0546609 | 3300048920 | Bacteria | 552 |
| 511 | Ga0496118_0002856 | 3300048921 | Bacteria | 22535 |
| 512 | Ga0496118_0043816 | 3300048921 | Bacteria | 3512 |
| 513 | Ga0496119_0000720 | 3300048922 | Bacteria | 44520 |
| 514 | Ga0496119_0006250 | 3300048922 | Bacteria | 11123 |
| 515 | Ga0496119_0025618 | 3300048922 | Bacteria | 4113 |
| 516 | Ga0496119_0046717 | 3300048922 | Bacteria | 2700 |
| 517 | Ga0496119_0049436 | 3300048922 | Bacteria | 2600 |
| 518 | Ga0496119_0190207 | 3300048922 | Bacteria | 1070 |
| 519 | Ga0496119_0192228 | 3300048922 | Bacteria | 1062 |
| 520 | Ga0496119_0251481 | 3300048922 | Bacteria | 891 |
| 521 | Ga0496119_0275352 | 3300048922 | Bacteria | 839 |
| 522 | Ga0496119_0316247 | 3300048922 | Bacteria | 765 |
| 523 | Ga0496119_0336832 | 3300048922 | Bacteria | 734 |
| 524 | Ga0496119_0453570 | 3300048922 | Bacteria | 604 |
| 525 | Ga0496120_0007276 | 3300048923 | Bacteria | 8270 |
| 526 | Ga0496120_0013513 | 3300048923 | Bacteria | 5495 |
| 527 | Ga0496120_0022013 | 3300048923 | Bacteria | 4015 |
| 528 | Ga0496120_0038694 | 3300048923 | Bacteria | 2820 |
| 529 | Ga0496120_0109839 | 3300048923 | Bacteria | 1442 |
| 530 | Ga0496120_0221924 | 3300048923 | Bacteria | 902 |
| 531 | Ga0496121_0000497 | 3300048924 | Bacteria | 75061 |
| 532 | Ga0496121_0026877 | 3300048924 | Bacteria | 5404 |
| 533 | Ga0496122_0000022 | 3300048925 | Bacteria | 388704 |
| 534 | Ga0496122_0000799 | 3300048925 | Bacteria | 60347 |
| 535 | Ga0496122_0005147 | 3300048925 | Bacteria | 15769 |
| 536 | Ga0496122_0010341 | 3300048925 | Bacteria | 9645 |
| 537 | Ga0496122_0026775 | 3300048925 | Bacteria | 4956 |
| 538 | Ga0496122_0119930 | 3300048925 | Bacteria | 1699 |
| 539 | Ga0496122_0435742 | 3300048925 | Bacteria | 654 |
| 540 | Ga0496122_0523403 | 3300048925 | Bacteria | 571 |
| 541 | Ga0496123_0000009 | 3300048926 | Bacteria | 509486 |
| 542 | Ga0496123_0000016 | 3300048926 | Bacteria | 424330 |
| 543 | Ga0496123_0002420 | 3300048926 | Bacteria | 23276 |
| 544 | Ga0496123_0020865 | 3300048926 | Bacteria | 5109 |
| 545 | Ga0496123_0083824 | 3300048926 | Bacteria | 1925 |
| 546 | Ga0496123_0182963 | 3300048926 | Bacteria | 1092 |
| 547 | Ga0496123_0237916 | 3300048926 | Bacteria | 906 |
| 548 | Ga0496124_0002766 | 3300048927 | Bacteria | 22302 |
| 549 | Ga0496124_0006965 | 3300048927 | Bacteria | 12143 |
| 550 | Ga0496124_0046380 | 3300048927 | Bacteria | 3721 |
| 551 | Ga0496125_0001491 | 3300048928 | Bacteria | 33565 |
| 552 | Ga0496125_0002578 | 3300048928 | Bacteria | 23316 |
| 553 | Ga0496125_0016052 | 3300048928 | Bacteria | 7209 |
| 554 | Ga0496125_0029529 | 3300048928 | Bacteria | 4925 |
| 555 | Ga0496125_0123889 | 3300048928 | Bacteria | 1836 |
| 556 | Ga0496126_0002077 | 3300048929 | Bacteria | 28059 |
| 557 | Ga0496126_0002563 | 3300048929 | Bacteria | 24311 |
| 558 | Ga0496126_0015145 | 3300048929 | Bacteria | 7768 |
| 559 | Ga0496126_0020288 | 3300048929 | Bacteria | 6523 |
| 560 | Ga0496126_0029883 | 3300048929 | Bacteria | 5173 |
| 561 | Ga0496126_0089792 | 3300048929 | Bacteria | 2704 |
| 562 | Ga0496126_0141466 | 3300048929 | Bacteria | 2070 |
| 563 | Ga0496126_0263130 | 3300048929 | Bacteria | 1433 |
| 564 | Ga0496126_0392660 | 3300048929 | Bacteria | 1127 |
| 565 | Ga0501306_000074 | 3300049127 | Bacteria | 5266 |
| 566 | Ga0501306_000560 | 3300049127 | Bacteria | 2934 |
| 567 | Ga0501306_009610 | 3300049127 | Bacteria | 1202 |
| 568 | Ga0501306_044904 | 3300049127 | Bacteria | 695 |
| 569 | Ga0501306_091381 | 3300049127 | Bacteria | 535 |
| 570 | Ga0501308_002157 | 3300049128 | Bacteria | 1693 |
| 571 | Ga0501308_004467 | 3300049128 | Bacteria | 1350 |
| 572 | Ga0501309_000615 | 3300049129 | Bacteria | 3018 |
| 573 | Ga0501309_003216 | 3300049129 | Bacteria | 1832 |
| 574 | Ga0501309_021404 | 3300049129 | Bacteria | 909 |
| 575 | Ga0501309_056572 | 3300049129 | Bacteria | 625 |
| 576 | Ga0501310_002153 | 3300049130 | Bacteria | 1850 |
| 577 | Ga0501310_006171 | 3300049130 | Bacteria | 1251 |
| 578 | Ga0501310_007007 | 3300049130 | Bacteria | 1197 |
| 579 | Ga0501310_007679 | 3300049130 | Bacteria | 1156 |
| 580 | Ga0501310_020196 | 3300049130 | Bacteria | 825 |
| 581 | Ga0501341_01921 | 3300049131 | Bacteria | 1087 |
| 582 | Ga0501341_03734 | 3300049131 | Bacteria | 870 |
| 583 | Ga0501341_04190 | 3300049131 | Bacteria | 837 |
| 584 | Ga0501304_001479 | 3300049160 | Bacteria | 1516 |
| 585 | Ga0501304_025540 | 3300049160 | Bacteria | 606 |
| 586 | Ga0501304_029583 | 3300049160 | Bacteria | 577 |
| 587 | Ga0501304_030253 | 3300049160 | Bacteria | 573 |
| 588 | Ga0501305_003699 | 3300049161 | Bacteria | 1750 |
| 589 | Ga0501305_090353 | 3300049161 | Bacteria | 560 |
| 590 | Ga0501307_000930 | 3300049162 | Bacteria | 2264 |
| 591 | Ga0501307_007279 | 3300049162 | Bacteria | 1217 |
| 592 | Ga0501307_013113 | 3300049162 | Bacteria | 997 |
| 593 | Ga0501307_013962 | 3300049162 | Bacteria | 975 |
| 594 | Ga0501307_018450 | 3300049162 | Bacteria | 887 |
| 595 | Ga0501307_030182 | 3300049162 | Bacteria | 748 |
| 596 | Ga0501307_039061 | 3300049162 | Bacteria | 684 |
| 597 | Ga0501311_000216 | 3300049527 | Bacteria | 3430 |
| 598 | Ga0501311_003504 | 3300049527 | Bacteria | 1606 |
| 599 | Ga0501311_006499 | 3300049527 | Bacteria | 1319 |
| 600 | Ga0501311_024279 | 3300049527 | Bacteria | 843 |
| 601 | Ga0501311_064511 | 3300049527 | Bacteria | 598 |
| 602 | Ga0501312_011327 | 3300049528 | Bacteria | 1210 |
| 603 | Ga0501312_016522 | 3300049528 | Bacteria | 1057 |
| 604 | Ga0501312_037408 | 3300049528 | Bacteria | 782 |
| 605 | Ga0501312_040937 | 3300049528 | Bacteria | 757 |
| 606 | Ga0501313_005880 | 3300049529 | Bacteria | 1311 |
| 607 | Ga0501313_071242 | 3300049529 | Bacteria | 504 |
| 608 | Ga0501314_002632 | 3300049530 | Bacteria | 1401 |
| 609 | Ga0501314_021280 | 3300049530 | Bacteria | 676 |
| 610 | Ga0501315_002877 | 3300049531 | Bacteria | 1672 |
| 611 | Ga0501315_020592 | 3300049531 | Bacteria | 887 |
| 612 | Ga0501315_047156 | 3300049531 | Bacteria | 668 |
| 613 | Ga0501316_000435 | 3300049532 | Bacteria | 2848 |
| 614 | Ga0501316_009910 | 3300049532 | Bacteria | 1077 |
| 615 | Ga0501316_013098 | 3300049532 | Bacteria | 977 |
| 616 | Ga0501316_013217 | 3300049532 | Bacteria | 974 |
| 617 | Ga0501316_023780 | 3300049532 | Bacteria | 788 |
| 618 | Ga0501317_001951 | 3300049533 | Bacteria | 1875 |
| 619 | Ga0501317_011943 | 3300049533 | Bacteria | 1064 |
| 620 | Ga0501317_014096 | 3300049533 | Bacteria | 1008 |
| 621 | Ga0501317_026782 | 3300049533 | Bacteria | 815 |
| 622 | Ga0501317_076255 | 3300049533 | Bacteria | 573 |
| 623 | Ga0501318_000070 | 3300049534 | Bacteria | 4287 |
| 624 | Ga0501318_013616 | 3300049534 | Bacteria | 948 |
| 625 | Ga0501318_050164 | 3300049534 | Bacteria | 618 |
| 626 | Ga0501318_061498 | 3300049534 | Bacteria | 577 |
| 627 | Ga0501319_000088 | 3300049535 | Bacteria | 3164 |
| 628 | Ga0501319_004101 | 3300049535 | Bacteria | 1002 |
| 629 | Ga0501319_006052 | 3300049535 | Bacteria | 883 |
| 630 | Ga0501320_002053 | 3300049536 | Bacteria | 1570 |
| 631 | Ga0501320_013226 | 3300049536 | Bacteria | 878 |
| 632 | Ga0501321_000212 | 3300049537 | Bacteria | 3321 |
| 633 | Ga0501321_007064 | 3300049537 | Bacteria | 1158 |
| 634 | Ga0501321_010938 | 3300049537 | Bacteria | 1004 |
| 635 | Ga0501323_005116 | 3300049539 | Bacteria | 1420 |
| 636 | Ga0501323_006917 | 3300049539 | Bacteria | 1280 |
| 637 | Ga0501323_007033 | 3300049539 | Bacteria | 1274 |
| 638 | Ga0501324_001941 | 3300049540 | Bacteria | 1449 |
| 639 | Ga0501324_008804 | 3300049540 | Bacteria | 895 |
| 640 | Ga0501325_001231 | 3300049541 | Bacteria | 1524 |
| 641 | Ga0501325_003351 | 3300049541 | Bacteria | 1162 |
| 642 | Ga0501325_012426 | 3300049541 | Bacteria | 801 |
| 643 | Ga0501326_08559 | 3300049542 | Bacteria | 596 |
| 644 | Ga0501327_10274 | 3300049543 | Bacteria | 616 |
| 645 | Ga0501330_006252 | 3300049546 | Bacteria | 776 |
| 646 | Ga0501330_008606 | 3300049546 | Bacteria | 702 |
| 647 | Ga0501330_010575 | 3300049546 | Bacteria | 656 |
| 648 | Ga0501330_015283 | 3300049546 | Bacteria | 582 |
| 649 | Ga0501331_07226 | 3300049547 | Bacteria | 658 |
| 650 | Ga0501332_02792 | 3300049548 | Bacteria | 991 |
| 651 | Ga0501332_07209 | 3300049548 | Bacteria | 707 |
| 652 | Ga0501334_13800 | 3300049550 | Bacteria | 608 |
| 653 | Ga0501335_012651 | 3300049551 | Bacteria | 836 |
| 654 | Ga0501336_004708 | 3300049552 | Bacteria | 966 |
| 655 | Ga0501337_005088 | 3300049553 | Bacteria | 873 |
| 656 | Ga0501338_11695 | 3300049554 | Bacteria | 600 |
| 657 | Ga0501340_002551 | 3300049556 | Bacteria | 1058 |
| 658 | Ga0501340_011976 | 3300049556 | Bacteria | 652 |
| 659 | Ga0501340_012709 | 3300049556 | Bacteria | 641 |
| 660 | Ga0501031_0053231 | 3300049568 | Bacteria | 2637 |
| 661 | Ga0501031_0154726 | 3300049568 | Bacteria | 1498 |
| 662 | Ga0501031_0185874 | 3300049568 | Bacteria | 1357 |
| 663 | Ga0501031_0233826 | 3300049568 | Bacteria | 1196 |
| 664 | Ga0501032_0003386 | 3300049569 | Bacteria | 12226 |
| 665 | Ga0501032_0011095 | 3300049569 | Bacteria | 6474 |
| 666 | Ga0501032_0017365 | 3300049569 | Bacteria | 5052 |
| 667 | Ga0501033_0002214 | 3300049570 | Bacteria | 16754 |
| 668 | Ga0501033_0004032 | 3300049570 | Bacteria | 11861 |
| 669 | Ga0501033_0004858 | 3300049570 | Bacteria | 10708 |
| 670 | Ga0501033_0147016 | 3300049570 | Bacteria | 1701 |
| 671 | Ga0501033_0357914 | 3300049570 | Bacteria | 1022 |
| 672 | Ga0501034_0002490 | 3300049571 | Bacteria | 22119 |
| 673 | Ga0501034_0008687 | 3300049571 | Bacteria | 10701 |
| 674 | Ga0501034_0022444 | 3300049571 | Bacteria | 6431 |
| 675 | Ga0501034_0032413 | 3300049571 | Bacteria | 5306 |
| 676 | Ga0501034_0057847 | 3300049571 | Bacteria | 3897 |
| 677 | Ga0501034_0078054 | 3300049571 | Bacteria | 3316 |
| 678 | Ga0501034_0208027 | 3300049571 | Bacteria | 1912 |
| 679 | Ga0501034_0213629 | 3300049571 | Bacteria | 1883 |
| 680 | Ga0501034_0240972 | 3300049571 | Bacteria | 1754 |
| 681 | Ga0501034_0290985 | 3300049571 | Bacteria | 1571 |
| 682 | Ga0501034_0557893 | 3300049571 | Bacteria | 1054 |
| 683 | Ga0501034_1091062 | 3300049571 | Bacteria | 679 |
| 684 | Ga0501034_1264223 | 3300049571 | Bacteria | 615 |
| 685 | Ga0501034_1574227 | 3300049571 | Bacteria | 530 |
| 686 | Ga0501036_0039389 | 3300049572 | Bacteria | 3998 |
| 687 | Ga0501036_0240730 | 3300049572 | Bacteria | 1517 |
| 688 | Ga0501036_0544297 | 3300049572 | Bacteria | 965 |
| 689 | Ga0501036_0656143 | 3300049572 | Bacteria | 868 |
| 690 | Ga0501036_0670647 | 3300049572 | Bacteria | 858 |
| 691 | Ga0501036_0943498 | 3300049572 | Bacteria | 707 |
| 692 | Ga0501037_0001422 | 3300049573 | Bacteria | 17565 |
| 693 | Ga0501037_0084416 | 3300049573 | Bacteria | 2299 |
| 694 | Ga0501037_0160205 | 3300049573 | Bacteria | 1604 |
| 695 | Ga0501037_0232969 | 3300049573 | Bacteria | 1292 |
| 696 | Ga0501037_0309292 | 3300049573 | Bacteria | 1096 |
| 697 | Ga0501037_0901739 | 3300049573 | Bacteria | 579 |
| 698 | Ga0501038_0003511 | 3300049574 | Bacteria | 14597 |
| 699 | Ga0501038_0021820 | 3300049574 | Bacteria | 5744 |
| 700 | Ga0501038_0126029 | 3300049574 | Bacteria | 2107 |
| 701 | Ga0501038_0344075 | 3300049574 | Bacteria | 1162 |
| 702 | Ga0501038_0370455 | 3300049574 | Bacteria | 1113 |
| 703 | Ga0501038_0573279 | 3300049574 | Bacteria | 856 |
| 704 | Ga0501039_0008941 | 3300049575 | Bacteria | 7631 |
| 705 | Ga0501039_0114351 | 3300049575 | Bacteria | 2111 |
| 706 | Ga0501039_0388898 | 3300049575 | Bacteria | 1095 |
| 707 | Ga0501039_0565281 | 3300049575 | Bacteria | 892 |
| 708 | Ga0501039_0828073 | 3300049575 | Bacteria | 722 |
| 709 | Ga0501039_0886832 | 3300049575 | Bacteria | 694 |
| 710 | Ga0501039_0967576 | 3300049575 | Bacteria | 662 |
| 711 | Ga0501040_0348686 | 3300049576 | Bacteria | 1060 |
| 712 | Ga0501040_0705388 | 3300049576 | Bacteria | 730 |
| 713 | Ga0501042_0009674 | 3300049578 | Bacteria | 6437 |
| 714 | Ga0501042_0098304 | 3300049578 | Bacteria | 2104 |
| 715 | Ga0501042_0292483 | 3300049578 | Bacteria | 1177 |
| 716 | Ga0501042_0998805 | 3300049578 | Bacteria | 610 |
| 717 | Ga0501043_0016944 | 3300049579 | Bacteria | 5710 |
| 718 | Ga0501043_0048230 | 3300049579 | Bacteria | 3348 |
| 719 | Ga0501043_0065288 | 3300049579 | Bacteria | 2858 |
| 720 | Ga0501043_0100265 | 3300049579 | Bacteria | 2276 |
| 721 | Ga0501043_0784689 | 3300049579 | Bacteria | 690 |
| 722 | Ga0501046_0013742 | 3300049580 | Bacteria | 6845 |
| 723 | Ga0501046_0023204 | 3300049580 | Bacteria | 5106 |
| 724 | Ga0501047_0001782 | 3300049581 | Bacteria | 20821 |
| 725 | Ga0501047_0006944 | 3300049581 | Bacteria | 10634 |
| 726 | Ga0501047_0034189 | 3300049581 | Bacteria | 4908 |
| 727 | Ga0501048_0013228 | 3300049582 | Bacteria | 6124 |
| 728 | Ga0501048_0016304 | 3300049582 | Bacteria | 5476 |
| 729 | Ga0501048_0022961 | 3300049582 | Bacteria | 4560 |
| 730 | Ga0501048_0291761 | 3300049582 | Bacteria | 1160 |
| 731 | Ga0501048_0411271 | 3300049582 | Bacteria | 967 |
| 732 | Ga0501067_0023885 | 3300049583 | Bacteria | 3390 |
| 733 | Ga0501067_0400834 | 3300049583 | Bacteria | 765 |
| 734 | Ga0501068_0045634 | 3300049584 | Bacteria | 2640 |
| 735 | Ga0501068_0087080 | 3300049584 | Bacteria | 1923 |
| 736 | Ga0501068_0666368 | 3300049584 | Bacteria | 680 |
| 737 | Ga0501069_0035485 | 3300049585 | Bacteria | 2748 |
| 738 | Ga0501069_0037626 | 3300049585 | Bacteria | 2670 |
| 739 | Ga0501069_0106583 | 3300049585 | Bacteria | 1593 |
| 740 | Ga0501069_0429571 | 3300049585 | Bacteria | 784 |
| 741 | Ga0501069_0735944 | 3300049585 | Bacteria | 596 |
| 742 | Ga0501070_0000874 | 3300049586 | Bacteria | 27417 |
| 743 | Ga0501070_0014598 | 3300049586 | Bacteria | 6610 |
| 744 | Ga0501070_0015639 | 3300049586 | Bacteria | 6379 |
| 745 | Ga0501070_0048708 | 3300049586 | Bacteria | 3519 |
| 746 | Ga0501070_0170892 | 3300049586 | Bacteria | 1790 |
| 747 | Ga0501070_0183881 | 3300049586 | Bacteria | 1719 |
| 748 | Ga0501070_0236614 | 3300049586 | Bacteria | 1495 |
| 749 | Ga0501071_0000119 | 3300049587 | Bacteria | 31338 |
| 750 | Ga0501071_0175141 | 3300049587 | Bacteria | 1607 |
| 751 | Ga0501071_0432562 | 3300049587 | Bacteria | 1006 |
| 752 | Ga0501072_0160959 | 3300049588 | Bacteria | 1790 |
| 753 | Ga0501072_0570567 | 3300049588 | Bacteria | 893 |
| 754 | Ga0501073_0000030 | 3300049589 | Bacteria | 115949 |
| 755 | Ga0501073_0041926 | 3300049589 | Bacteria | 3232 |
| 756 | Ga0501073_0124032 | 3300049589 | Bacteria | 1790 |
| 757 | Ga0501073_0143186 | 3300049589 | Bacteria | 1656 |
| 758 | Ga0501073_0510672 | 3300049589 | Bacteria | 831 |
| 759 | Ga0501073_0611871 | 3300049589 | Bacteria | 752 |
| 760 | Ga0501074_0028983 | 3300049590 | Bacteria | 4010 |
| 761 | Ga0501074_0109265 | 3300049590 | Bacteria | 1979 |
| 762 | Ga0501074_0257172 | 3300049590 | Bacteria | 1242 |
| 763 | Ga0501074_0499410 | 3300049590 | Bacteria | 862 |
| 764 | Ga0501075_0709706 | 3300049591 | Bacteria | 766 |
| 765 | Ga0501076_0378201 | 3300049592 | Bacteria | 1164 |
| 766 | Ga0501076_1528786 | 3300049592 | Bacteria | 548 |
| 767 | Ga0501077_0914008 | 3300049593 | Bacteria | 565 |
| 768 | Ga0501214_034494 | 3300049659 | Bacteria | 710 |
| 769 | Ga0501080_0000208 | 3300049742 | Bacteria | 43436 |
| 770 | Ga0501080_0079834 | 3300049742 | Bacteria | 3041 |
| 771 | Ga0501080_0119382 | 3300049742 | Bacteria | 2444 |
| 772 | Ga0501080_1194266 | 3300049742 | Bacteria | 654 |
| 773 | Ga0501080_1661248 | 3300049742 | Bacteria | 540 |
| 774 | Ga0501081_0628195 | 3300049743 | Bacteria | 805 |
| 775 | Ga0501083_0015538 | 3300049744 | Bacteria | 5329 |
| 776 | Ga0501083_0039761 | 3300049744 | Bacteria | 3194 |
| 777 | Ga0501083_0142584 | 3300049744 | Bacteria | 1569 |
| 778 | Ga0501083_0227432 | 3300049744 | Bacteria | 1215 |
| 779 | Ga0501035_0013885 | 3300049822 | Bacteria | 7432 |
| 780 | Ga0501035_0023629 | 3300049822 | Bacteria | 5640 |
| 781 | Ga0501035_0360044 | 3300049822 | Bacteria | 1216 |
| 782 | Ga0501035_0478328 | 3300049822 | Bacteria | 1027 |
| 783 | Ga0501044_0001222 | 3300049823 | Bacteria | 30539 |
| 784 | Ga0501044_0001531 | 3300049823 | Bacteria | 27116 |
| 785 | Ga0501044_0021477 | 3300049823 | Bacteria | 6884 |
| 786 | Ga0501044_0180571 | 3300049823 | Bacteria | 2077 |
| 787 | Ga0501044_0705061 | 3300049823 | Bacteria | 894 |
| 788 | Ga0501044_0743427 | 3300049823 | Bacteria | 863 |
| 789 | Ga0501045_0114911 | 3300049824 | Bacteria | 1996 |
| 790 | nmdc:mga03n38_210369_c1 | 3300050490 | Bacteria | 1011 |
| 791 | nmdc:mga00v17_100204_c1 | 3300050491 | Bacteria | 1828 |
| 792 | nmdc:mga00v17_113028_c1 | 3300050491 | Bacteria | 1724 |
| 793 | nmdc:mga00v17_138040_c1 | 3300050491 | Bacteria | 1562 |
| 794 | nmdc:mga00v17_165640_c1 | 3300050491 | Bacteria | 1424 |
| 795 | nmdc:mga00v17_197603_c1 | 3300050491 | Bacteria | 1300 |
| 796 | nmdc:mga00v17_231678_c1 | 3300050491 | Bacteria | 1197 |
| 797 | nmdc:mga00v17_441872_c1 | 3300050491 | Bacteria | 845 |
| 798 | nmdc:mga00v17_473228_c1 | 3300050491 | Bacteria | 813 |
| 799 | nmdc:mga00v17_534563_c1 | 3300050491 | Bacteria | 759 |
| 800 | nmdc:mga00v17_6859_c1 | 3300050491 | Bacteria | 6054 |
| 801 | nmdc:mga00v17_702801_c1 | 3300050491 | Bacteria | 648 |
| 802 | nmdc:mga0yw44_134716_c1 | 3300050492 | Bacteria | 1602 |
| 803 | nmdc:mga0yw44_19106_c1 | 3300050492 | Bacteria | 3772 |
| 804 | nmdc:mga0yw44_277_c1 | 3300050492 | Bacteria | 17596 |
| 805 | nmdc:mga0yw44_593875_c1 | 3300050492 | Bacteria | 752 |
| 806 | nmdc:mga0k408_226215_c1 | 3300050493 | Bacteria | 1117 |
| 807 | nmdc:mga06z11_203705_c1 | 3300050494 | Bacteria | 1150 |
| 808 | nmdc:mga06z11_23458_c1 | 3300050494 | Bacteria | 2899 |
| 809 | nmdc:mga06z11_261886_c1 | 3300050494 | Bacteria | 1020 |
| 810 | nmdc:mga04h51_226028_c1 | 3300050495 | Bacteria | 743 |
| 811 | nmdc:mga04h51_27870_c1 | 3300050495 | Bacteria | 1759 |
| 812 | nmdc:mga07m45_290131_c1 | 3300050496 | Bacteria | 952 |
| 813 | nmdc:mga07m45_8187_c1 | 3300050496 | Bacteria | 5365 |
| 814 | nmdc:mga08y16_357908_c1 | 3300050511 | Bacteria | 1498 |
| 815 | nmdc:mga08y16_462766_c1 | 3300050511 | Bacteria | 1292 |
| 816 | nmdc:mga0sz30_216985_c1 | 3300050516 | Bacteria | 850 |
| 817 | nmdc:mga0sz30_308280_c1 | 3300050516 | Bacteria | 706 |
| 818 | Ga0500635_0003539 | 3300053080 | Bacteria | 3944 |
| 819 | Ga0500651_0004271 | 3300053093 | Bacteria | 7981 |
| 820 | Ga0500650_0021930 | 3300053098 | Bacteria | 2820 |
| 821 | Ga0500654_209616 | 3300053099 | Bacteria | 573 |
| 822 | Ga0500556_0000020 | 3300053104 | Bacteria | 185929 |
| 823 | Ga0500608_074519 | 3300053122 | Bacteria | 1610 |
| 824 | Ga0500652_077661 | 3300053131 | Bacteria | 1381 |
| 825 | Ga0500655_001124 | 3300053133 | Bacteria | 5107 |
| 826 | Ga0500559_0070462 | 3300053136 | Bacteria | 1573 |
| 827 | Ga0500559_0456316 | 3300053136 | Bacteria | 590 |
| 828 | Ga0500568_0000038 | 3300053139 | Bacteria | 134267 |
| 829 | Ga0500568_0002756 | 3300053139 | Bacteria | 10167 |
| 830 | Ga0500573_0193781 | 3300053140 | Bacteria | 1083 |
| 831 | Ga0500573_0241740 | 3300053140 | Bacteria | 935 |
| 832 | Ga0500573_0293371 | 3300053140 | Bacteria | 816 |
| 833 | Ga0500573_0349543 | 3300053140 | Bacteria | 718 |
| 834 | Ga0500573_0443580 | 3300053140 | Bacteria | 602 |
| 835 | Ga0500573_0540548 | 3300053140 | Bacteria | 518 |
| 836 | Ga0500573_0555269 | 3300053140 | Bacteria | 507 |
| 837 | Ga0500577_0122216 | 3300053142 | Bacteria | 1084 |
| 838 | Ga0500577_0303883 | 3300053142 | Bacteria | 696 |
| 839 | Ga0500606_169749 | 3300053152 | Bacteria | 694 |
| 840 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 841 | Ga0500616_0026699 | 3300053153 | Bacteria | 3194 |
| 842 | Ga0500636_0249477 | 3300053177 | Bacteria | 906 |
| 843 | Ga0500645_081041 | 3300053730 | Bacteria | 926 |
| 844 | Ga0501084_0133108 | 3300054114 | Bacteria | 2093 |
| 845 | Ga0501084_1524162 | 3300054114 | Bacteria | 559 |
| 846 | Ga0587084_000004 | 3300059477 | Bacteria | 10690 |
| 847 | Ga0587084_097638 | 3300059477 | Bacteria | 591 |
| 848 | Ga0587093_051773 | 3300059478 | Bacteria | 650 |
| 849 | Ga0587070_007986 | 3300059491 | Bacteria | 1485 |
| 850 | Ga0587070_061502 | 3300059491 | Bacteria | 778 |
| 851 | Ga0587073_0026582 | 3300059492 | Bacteria | 1161 |
| 852 | Ga0587077_025220 | 3300059493 | Bacteria | 1089 |
| 853 | Ga0587077_096467 | 3300059493 | Bacteria | 703 |
| 854 | Ga0587080_108714 | 3300059503 | Bacteria | 602 |
| 855 | Ga0587082_055807 | 3300059504 | Bacteria | 766 |
| 856 | Ga0587082_065931 | 3300059504 | Bacteria | 725 |
| 857 | Ga0587083_0124197 | 3300059505 | Bacteria | 670 |
| 858 | Ga0587086_028379 | 3300059507 | Bacteria | 809 |
| 859 | Ga0587086_051210 | 3300059507 | Bacteria | 666 |
| 860 | Ga0587088_018103 | 3300059508 | Bacteria | 1142 |
| 861 | Ga0587088_062998 | 3300059508 | Bacteria | 756 |
| 862 | Ga0587089_017250 | 3300059509 | Bacteria | 969 |
| 863 | Ga0587090_000311 | 3300059510 | Bacteria | 3800 |
| 864 | Ga0587090_051852 | 3300059510 | Bacteria | 754 |
| 865 | Ga0587092_005842 | 3300059512 | Bacteria | 1536 |
| 866 | Ga0587094_001057 | 3300059513 | Bacteria | 2469 |
| 867 | Ga0587095_002206 | 3300059514 | Bacteria | 1291 |
| 868 | Ga0587095_004022 | 3300059514 | Bacteria | 1063 |
| 869 | Ga0587098_000186 | 3300059604 | Bacteria | 3178 |
| 870 | Ga0587106_013695 | 3300059605 | Bacteria | 1107 |
| 871 | Ga0587106_016615 | 3300059605 | Bacteria | 1042 |
| 872 | Ga0587106_154271 | 3300059605 | Bacteria | 513 |
| 873 | Ga0587125_000024 | 3300059607 | Bacteria | 4952 |
| 874 | Ga0587129_005457 | 3300059608 | Bacteria | 868 |
| 875 | Ga0587099_005271 | 3300059622 | Bacteria | 1156 |
| 876 | Ga0587101_000011 | 3300059623 | Bacteria | 8540 |
| 877 | Ga0587101_007043 | 3300059623 | Bacteria | 1314 |
| 878 | Ga0587101_064909 | 3300059623 | Bacteria | 660 |
| 879 | Ga0587113_011663 | 3300059625 | Bacteria | 825 |
| 880 | Ga0587115_000112 | 3300059626 | Bacteria | 4239 |
| 881 | Ga0587117_012574 | 3300059627 | Bacteria | 1070 |
| 882 | Ga0587122_054708 | 3300059628 | Bacteria | 525 |
| 883 | Ga0587127_015589 | 3300059629 | Bacteria | 636 |
| 884 | Ga0587128_000332 | 3300059630 | Bacteria | 3269 |
| 885 | Ga0587128_053974 | 3300059630 | Bacteria | 741 |
| 886 | Ga0587068_028950 | 3300059641 | Bacteria | 950 |
| 887 | Ga0587068_069517 | 3300059641 | Bacteria | 692 |
| 888 | Ga0587069_009037 | 3300059642 | Bacteria | 1276 |
| 889 | Ga0587069_012760 | 3300059642 | Bacteria | 1145 |
| 890 | Ga0587072_014536 | 3300059643 | Bacteria | 1327 |
| 891 | Ga0587072_055636 | 3300059643 | Bacteria | 803 |
| 892 | Ga0587075_046591 | 3300059644 | Bacteria | 744 |
| 893 | Ga0587076_026022 | 3300059645 | Bacteria | 1005 |
| 894 | Ga0587076_044515 | 3300059645 | Bacteria | 842 |
| 895 | Ga0587076_045923 | 3300059645 | Bacteria | 834 |
| 896 | Ga0587078_083251 | 3300059646 | Bacteria | 516 |
| 897 | Ga0587079_013651 | 3300059647 | Bacteria | 1349 |
| 898 | Ga0587079_080182 | 3300059647 | Bacteria | 745 |
| 899 | Ga0587102_012056 | 3300059649 | Bacteria | 877 |
| 900 | Ga0587102_028304 | 3300059649 | Bacteria | 672 |
| 901 | Ga0587104_005156 | 3300059650 | Bacteria | 854 |
| 902 | Ga0587105_017585 | 3300059651 | Bacteria | 604 |
| 903 | Ga0587107_000354 | 3300059652 | Bacteria | 2862 |
| 904 | Ga0587107_014792 | 3300059652 | Bacteria | 1008 |
| 905 | Ga0587107_019950 | 3300059652 | Bacteria | 925 |
| 906 | Ga0587110_012784 | 3300059654 | Bacteria | 870 |
| 907 | Ga0587114_109321 | 3300059655 | Bacteria | 548 |
| 908 | Ga0587119_025599 | 3300059658 | Bacteria | 779 |
| 909 | Ga0587120_007104 | 3300059659 | Bacteria | 894 |
| 910 | Ga0587124_000015 | 3300059660 | Bacteria | 5332 |
| 911 | Ga0587096_02006 | 3300060247 | Bacteria | 740 |
| 912 | Ga0587071_015645 | 3300060344 | Bacteria | 1333 |
| 913 | Ga0587071_027227 | 3300060344 | Bacteria | 1082 |
| 914 | Ga0587071_049865 | 3300060344 | Bacteria | 863 |
| 915 | Ga0587111_0003826 | 3300060346 | Bacteria | 2182 |
| 916 | Ga0587111_0031991 | 3300060346 | Bacteria | 1080 |
| 917 | Ga0501082_0795512 | 3300060353 | Bacteria | 827 |
| 918 | 2588107948 | 2585428157 | Bacteria | 3018951 |
| 919 | 2643732582 | 2643221542 | Bacteria | 3563959 |
| 920 | 2643753713 | 2643221546 | Bacteria | 2910897 |
| 921 | 2643786352 | 2643221553 | Bacteria | 3544260 |
| 922 | 2643847785 | 2643221566 | Bacteria | 3460379 |
| 923 | 2643994812 | 2643221597 | Bacteria | 3347721 |
| 924 | 2644171382 | 2643221630 | Bacteria | 3601215 |
| 925 | 2644197850 | 2643221635 | Bacteria | 2632343 |
| 926 | 2644681052 | 2643221724 | Bacteria | 3593515 |
| 927 | 2730230515 | 2728369380 | Bacteria | 3620317 |
| 928 | 2747952122 | 2747842429 | Bacteria | 3914386 |
| 929 | 2758224802 | 2757320536 | Bacteria | 3629334 |
| 930 | 2774378926 | 2773857758 | Bacteria | 3592392 |
| 931 | 2774382013 | 2773857759 | Bacteria | 2963774 |
| 932 | 2774400772 | 2773857763 | Bacteria | 4180068 |
| 933 | 2808628774 | 2808606306 | Bacteria | 3608896 |
| 934 | 2808884765 | 2808606368 | Bacteria | 3174172 |
| 935 | 2809226247 | 2808606447 | Bacteria | 3572005 |
| 936 | 2812322084 | 2811994872 | Bacteria | 4121241 |
| 937 | 2821268996 | 2821268502 | Bacteria | 3750023 |
| 938 | 2833709886 | 2833709550 | Bacteria | 4008291 |
| 939 | 2844854316 | 2844852863 | Bacteria | 3849151 |
| 940 | 2852632506 | 2852632344 | Bacteria | 3463163 |
| 941 | 2852647584 | 2852646457 | Bacteria | 3408613 |
| 942 | 2852678576 | 2852677369 | Bacteria | 3768884 |
| 943 | 2857722755 | 2857720070 | Bacteria | 3189373 |
| 944 | 2857725834 | 2857723135 | Bacteria | 4217853 |
| 945 | 2857730662 | 2857729791 | Bacteria | 4040535 |
| 946 | 2870622179 | 2870622029 | Bacteria | 3643329 |
| 947 | 2870629391 | 2870628048 | Bacteria | 3696012 |
| 948 | 2897564327 | 2897561785 | Bacteria | 3256946 |
| 949 | 2904510388 | 2904509784 | Bacteria | 3520416 |
| 950 | 2906801162 | 2906799679 | Bacteria | 4031749 |
| 951 | 2908678394 | 2908678064 | Bacteria | 3482747 |
| 952 | 2919070718 | 2919069694 | Bacteria | 3622919 |
| 953 | 2919397187 | 2919395869 | Bacteria | 3704152 |
| 954 | 2928093825 | 2928090899 | Bacteria | 3158267 |
| 955 | 2928121468 | 2928121344 | Bacteria | 3972376 |
| 956 | 2945968751 | 2945968032 | Bacteria | 4111363 |
| 957 | 2946036575 | 2946033335 | Bacteria | 3835514 |
| 958 | 2946045192 | 2946041624 | Bacteria | 4191385 |
| 959 | 2946084041 | 2946080515 | Bacteria | 4310960 |
| 960 | 2966926525 | 2966924647 | Bacteria | 3268643 |
| 961 | 2974294872 | 2974294766 | Bacteria | 3767688 |
| 962 | 2974325328 | 2974324384 | Bacteria | 3750535 |
| 963 | 2977230290 | 2977228692 | Bacteria | 3450105 |
| 964 | 2977239094 | 2977236895 | Bacteria | 3569373 |
| 965 | 2977265508 | 2977264416 | Bacteria | 3750737 |
| 966 | 2984543121 | 2984542743 | Bacteria | 3569378 |
| 967 | 2984582488 | 2984580707 | Bacteria | 3351387 |
| 968 | 8004184521 | 8004182704 | Bacteria | 3391155 |
| 969 | 8004213327 | 8004212874 | Bacteria | 2861420 |
| 970 | 8016255127 | 8016254467 | Bacteria | 3797036 |
| 971 | 8045832188 | 8045830549 | Bacteria | 4444727 |
| 972 | 8055035305 | 8055034563 | Bacteria | 3562128 |
| 973 | 8056039387 | 8056037122 | Bacteria | 3854319 |
| 974 | 8057347405 | 8057345674 | Bacteria | 4160394 |
| 975 | Ga0466970_0432150 | |||
| 976 | Ga0006779J45831_102222 | |||
| 977 | Ga0007427J51700_102557 | |||
| 978 | Ga0006781J51513_1004015 | |||
| 979 | Ga0006780_1005385 | |||
| 980 | Ga0055542_1013670 | |||
| 981 | Ga0065714_10085458 | |||
| 982 | Ga0070658_10009122 | |||
| 983 | Ga0070658_10037153 | |||
| 984 | Ga0070658_10233660 | |||
| 985 | Ga0070676_10260699 | |||
| 986 | Ga0070676_10664489 | |||
| 987 | Ga0070683_101690325 | |||
| 988 | Ga0070682_100104911 | |||
| 989 | Ga0070682_100319231 | |||
| 990 | Ga0070682_101277947 | |||
| 991 | Ga0068868_100083784 | |||
| 992 | Ga0070660_100092686 | |||
| 993 | Ga0070660_100319902 | |||
| 994 | Ga0070661_100175362 | |||
| 995 | Ga0070668_100021493 | |||
| 996 | Ga0070669_100662421 | |||
| 997 | Ga0070675_100169397 | |||
| 998 | Ga0070675_100543105 | |||
| 999 | Ga0070671_100053010 | |||
| 1000 | Ga0070674_100270580 | |||
| 1001 | Ga0070659_100003025 | |||
| 1002 | Ga0070659_100021971 | |||
| 1003 | Ga0070659_100398464 | |||
| 1004 | Ga0070667_100042795 | |||
| 1005 | Ga0070667_100964873 | |||
| 1006 | Ga0070710_10076760 | |||
| 1007 | Ga0070663_100016293 | |||
| 1008 | Ga0070663_100482593 | |||
| 1009 | Ga0070663_101607008 | |||
| 1010 | Ga0070678_100231593 | |||
| 1011 | Ga0068867_101541069 | |||
| 1012 | Ga0070685_10061812 | |||
| 1013 | Ga0068853_100213800 | |||
| 1014 | Ga0068853_100225354 | |||
| 1015 | Ga0068853_100923825 | |||
| 1016 | Ga0070672_100066968 | |||
| 1017 | Ga0070672_100705050 | |||
| 1018 | Ga0070672_101452822 | |||
| 1019 | Ga0070696_101062391 | |||
| 1020 | Ga0070693_100509741 | |||
| 1021 | Ga0070665_100077562 | |||
| 1022 | Ga0068855_100047986 | |||
| 1023 | Ga0068855_101352310 | |||
| 1024 | Ga0070664_100778979 | |||
| 1025 | Ga0068857_100258301 | |||
| 1026 | Ga0068857_100304925 | |||
| 1027 | Ga0068857_100375993 | |||
| 1028 | Ga0068854_100203793 | |||
| 1029 | Ga0068856_100096240 | |||
| 1030 | Ga0068856_100748277 | |||
| 1031 | Ga0068856_101258935 | |||
| 1032 | Ga0068852_101894449 | |||
| 1033 | Ga0068852_102108933 | |||
| 1034 | Ga0068859_100436457 | |||
| 1035 | Ga0068864_100500730 | |||
| 1036 | Ga0068861_100331014 | |||
| 1037 | Ga0068861_100901026 | |||
| 1038 | Ga0068851_10000022 | |||
| 1039 | Ga0068870_10016699 | |||
| 1040 | Ga0068870_10789556 | |||
| 1041 | Ga0068863_101020068 | |||
| 1042 | Ga0068863_101308821 | |||
| 1043 | Ga0068858_100199980 | |||
| 1044 | Ga0068862_100612731 | |||
| 1045 | Ga0075365_10012248 | |||
| 1046 | Ga0075365_10020292 | |||
| 1047 | Ga0075365_10227022 | |||
| 1048 | Ga0075365_10512919 | |||
| 1049 | Ga0075368_10014257 | |||
| 1050 | Ga0075363_100225976 | |||
| 1051 | Ga0075364_10130497 | |||
| 1052 | Ga0075364_10198269 | |||
| 1053 | Ga0075364_10212027 | |||
| 1054 | Ga0075364_10227910 | |||
| 1055 | Ga0075364_10432842 | |||
| 1056 | Ga0075364_10849750 | |||
| 1057 | Ga0075432_10221675 | |||
| 1058 | Ga0075367_10009009 | |||
| 1059 | Ga0075367_10167146 | |||
| 1060 | Ga0075367_10777194 | |||
| 1061 | Ga0075369_10017704 | |||
| 1062 | Ga0075369_10414775 | |||
| 1063 | Ga0075366_10091361 | |||
| 1064 | Ga0097621_100143128 | |||
| 1065 | Ga0097621_100613252 | |||
| 1066 | Ga0075370_10048588 | |||
| 1067 | Ga0075428_100682344 | |||
| 1068 | Ga0068865_100792830 | |||
| 1069 | Ga0097620_100436474 | |||
| 1070 | Ga0105244_10004765 | |||
| 1071 | Ga0105244_10034581 | |||
| 1072 | Ga0105244_10197391 | |||
| 1073 | Ga0105244_10208538 | |||
| 1074 | Ga0105240_10070946 | |||
| 1075 | Ga0105240_10557413 | |||
| 1076 | Ga0105245_10255698 | |||
| 1077 | Ga0105245_11476153 | |||
| 1078 | Ga0105247_10242894 | |||
| 1079 | Ga0105247_10316428 | |||
| 1080 | Ga0105247_10928869 | |||
| 1081 | Ga0105247_11271724 | |||
| 1082 | Ga0105243_10179204 | |||
| 1083 | Ga0105243_10253700 | |||
| 1084 | Ga0105243_10613788 | |||
| 1085 | Ga0105243_11234098 | |||
| 1086 | Ga0105243_11356396 | |||
| 1087 | Ga0105241_10028364 | |||
| 1088 | Ga0105248_10410272 | |||
| 1089 | Ga0105248_10463031 | |||
| 1090 | Ga0105248_11228235 | |||
| 1091 | Ga0105237_10031122 | |||
| 1092 | Ga0105237_10669691 | |||
| 1093 | Ga0105237_12131497 | |||
| 1094 | Ga0105238_10027288 | |||
| 1095 | Ga0105238_10438248 | |||
| 1096 | Ga0105238_12491186 | |||
| 1097 | Ga0105249_10086228 | |||
| 1098 | Ga0105249_12050801 | |||
| 1099 | Ga0105028_137232 | |||
| 1100 | Ga0105239_10267366 | |||
| 1101 | Ga0105239_11621087 | |||
| 1102 | Ga0105239_11851537 | |||
| 1103 | Ga0105246_11237319 | |||
| 1104 | Ga0105246_12463316 | |||
| 1105 | Ga0157373_10142177 | |||
| 1106 | Ga0157371_10013796 | |||
| 1107 | Ga0157371_10538714 | |||
| 1108 | Ga0157371_11401264 | |||
| 1109 | Ga0157370_10010513 | |||
| 1110 | Ga0157370_10259819 | |||
| 1111 | Ga0157370_10604984 | |||
| 1112 | Ga0157370_10764268 | |||
| 1113 | Ga0157370_11306663 | |||
| 1114 | Ga0157370_11361098 | |||
| 1115 | Ga0157369_10002930 | |||
| 1116 | Ga0157369_10059481 | |||
| 1117 | Ga0157369_10619795 | |||
| 1118 | Ga0157369_11086173 | |||
| 1119 | Ga0171462_1001 | |||
| 1120 | Ga0157374_11218046 | |||
| 1121 | Ga0163162_10286172 | |||
| 1122 | Ga0163162_10407681 | |||
| 1123 | Ga0163162_11148220 | |||
| 1124 | Ga0163162_11942760 | |||
| 1125 | Ga0157372_10200302 | |||
| 1126 | Ga0157372_10395974 | |||
| 1127 | Ga0157372_10548809 | |||
| 1128 | Ga0157372_10877162 | |||
| 1129 | Ga0157375_10832200 | |||
| 1130 | Ga0157375_11467728 | |||
| 1131 | Ga0163163_10056462 | |||
| 1132 | Ga0163163_10473800 | |||
| 1133 | Ga0157380_10596703 | |||
| 1134 | Ga0157380_10856607 | |||
| 1135 | Ga0157380_11821864 | |||
| 1136 | Ga0157377_10823293 | |||
| 1137 | Ga0157379_10079829 | |||
| 1138 | Ga0157376_10983722 | |||
| 1139 | Ga0157376_11573093 | |||
| 1140 | Ga0157376_12651451 | |||
| 1141 | Ga0163161_10180586 | |||
| 1142 | Ga0163161_10406459 | |||
| 1143 | Ga0163161_10669137 | |||
| 1144 | Ga0163161_11043176 | |||
| 1145 | Ga0197907_10274436 | |||
| 1146 | Ga0197907_10555491 | |||
| 1147 | Ga0206349_1158906 | |||
| 1148 | Ga0206349_1702118 | |||
| 1149 | Ga0206355_1137396 | |||
| 1150 | Ga0206355_1343386 | |||
| 1151 | Ga0206355_1409600 | |||
| 1152 | Ga0206355_1642509 | |||
| 1153 | Ga0206355_1689445 | |||
| 1154 | Ga0206351_10537763 | |||
| 1155 | Ga0206352_10962140 | |||
| 1156 | Ga0206350_11103668 | |||
| 1157 | Ga0206354_10603441 | |||
| 1158 | Ga0206353_11035842 | |||
| 1159 | Ga0206353_11100958 | |||
| 1160 | Ga0154015_1337298 | |||
| 1161 | Ga0224712_10195694 | |||
| 1162 | Ga0224712_10327531 | |||
| 1163 | Ga0224712_10631531 | |||
| 1164 | Ga0256744_120521 | |||
| 1165 | Ga0209646_1000013 | |||
| 1166 | Ga0209646_1000014 | |||
| 1167 | Ga0209148_1019038 | |||
| 1168 | Ga0209025_1103719 | |||
| 1169 | Ga0207656_10000005 | |||
| 1170 | Ga0207655_1000386 | |||
| 1171 | Ga0207655_1093316 | |||
| 1172 | Ga0207682_10106898 | |||
| 1173 | Ga0207692_10014203 | |||
| 1174 | Ga0207692_10293942 | |||
| 1175 | Ga0207710_10236693 | |||
| 1176 | Ga0207688_10069625 | |||
| 1177 | Ga0207688_10750778 | |||
| 1178 | Ga0207680_10278281 | |||
| 1179 | Ga0207647_10076267 | |||
| 1180 | Ga0207645_10296018 | |||
| 1181 | Ga0207643_10107470 | |||
| 1182 | Ga0207643_10267142 | |||
| 1183 | Ga0207705_10000001 | |||
| 1184 | Ga0207705_10067626 | |||
| 1185 | Ga0207654_10000001 | |||
| 1186 | Ga0207695_10100413 | |||
| 1187 | Ga0207695_10138337 | |||
| 1188 | Ga0207671_10000016 | |||
| 1189 | Ga0207671_10082507 | |||
| 1190 | Ga0207671_11121203 | |||
| 1191 | Ga0207663_10638057 | |||
| 1192 | Ga0207657_10005997 | |||
| 1193 | Ga0207657_10036712 | |||
| 1194 | Ga0207657_10904799 | |||
| 1195 | Ga0207649_11068311 | |||
| 1196 | Ga0207652_11109821 | |||
| 1197 | Ga0207652_11369443 | |||
| 1198 | Ga0207681_10766295 | |||
| 1199 | Ga0207694_10000057 | |||
| 1200 | Ga0207694_10602481 | |||
| 1201 | Ga0207650_10493042 | |||
| 1202 | Ga0207659_10208411 | |||
| 1203 | Ga0207659_10371726 | |||
| 1204 | Ga0207687_10903461 | |||
| 1205 | Ga0207644_10207643 | |||
| 1206 | Ga0207644_10848829 | |||
| 1207 | Ga0207690_10003803 | |||
| 1208 | Ga0207690_10095961 | |||
| 1209 | Ga0207690_10287694 | |||
| 1210 | Ga0207709_10037724 | |||
| 1211 | Ga0207709_10046229 | |||
| 1212 | Ga0207709_10236921 | |||
| 1213 | Ga0207709_11321513 | |||
| 1214 | Ga0207669_10366408 | |||
| 1215 | Ga0207691_10382609 | |||
| 1216 | Ga0207711_10022131 | |||
| 1217 | Ga0207711_10668680 | |||
| 1218 | Ga0207661_11246513 | |||
| 1219 | Ga0207667_10035600 | |||
| 1220 | Ga0207667_10069574 | |||
| 1221 | Ga0207667_10655227 | |||
| 1222 | Ga0207668_10867954 | |||
| 1223 | Ga0207668_11775902 | |||
| 1224 | Ga0207640_10260817 | |||
| 1225 | Ga0207658_10551283 | |||
| 1226 | Ga0207658_10605749 | |||
| 1227 | Ga0207677_10541056 | |||
| 1228 | Ga0207703_10001453 | |||
| 1229 | Ga0207703_12347938 | |||
| 1230 | Ga0207639_10056116 | |||
| 1231 | Ga0207639_10193937 | |||
| 1232 | Ga0207639_10195614 | |||
| 1233 | Ga0207678_10027691 | |||
| 1234 | Ga0207678_10349298 | |||
| 1235 | Ga0207678_10479024 | |||
| 1236 | Ga0207678_10999169 | |||
| 1237 | Ga0207678_11004479 | |||
| 1238 | Ga0207678_11158563 | |||
| 1239 | Ga0207702_10200036 | |||
| 1240 | Ga0207702_10818798 | |||
| 1241 | Ga0207702_11799327 | |||
| 1242 | Ga0207648_11209788 | |||
| 1243 | Ga0207676_10139684 | |||
| 1244 | Ga0207676_11241686 | |||
| 1245 | Ga0207674_10131056 | |||
| 1246 | Ga0207674_10257091 | |||
| 1247 | Ga0207675_100409019 | |||
| 1248 | Ga0207683_10092851 | |||
| 1249 | Ga0207683_10250969 | |||
| 1250 | Ga0207698_10084580 | |||
| 1251 | Ga0207698_11374576 | |||
| 1252 | Ga0209813_10023881 | |||
| 1253 | Ga0268265_10299071 | |||
| 1254 | Ga0307515_10448326 | |||
| 1255 | Ga0311001_1065528 | |||
| 1256 | Ga0311001_1074009 | |||
| 1257 | Ga0311001_1077971 | |||
| 1258 | Ga0316181_1207534 | |||
| 1259 | Ga0265769_102572 | |||
| 1260 | Ga0307408_100294688 | |||
| 1261 | Ga0307408_100875136 | |||
| 1262 | Ga0307514_10047781 | |||
| 1263 | Ga0307405_10197141 | |||
| 1264 | Ga0307405_10319573 | |||
| 1265 | Ga0307405_10394275 | |||
| 1266 | Ga0307405_10826035 | |||
| 1267 | Ga0307405_11858120 | |||
| 1268 | Ga0307413_10370817 | |||
| 1269 | Ga0307413_10558962 | |||
| 1270 | Ga0307413_11513760 | |||
| 1271 | Ga0307413_11721430 | |||
| 1272 | Ga0307413_12162400 | |||
| 1273 | Ga0307410_10008732 | |||
| 1274 | Ga0307410_10447093 | |||
| 1275 | Ga0307410_10675328 | |||
| 1276 | Ga0307406_10000938 | |||
| 1277 | Ga0307406_10216849 | |||
| 1278 | Ga0307406_10401571 | |||
| 1279 | Ga0307406_10427104 | |||
| 1280 | Ga0307406_10459435 | |||
| 1281 | Ga0307406_10479838 | |||
| 1282 | Ga0307407_10117652 | |||
| 1283 | Ga0307407_10301390 | |||
| 1284 | Ga0307412_10198673 | |||
| 1285 | Ga0307412_10278485 | |||
| 1286 | Ga0307412_10387768 | |||
| 1287 | Ga0307412_10897432 | |||
| 1288 | Ga0307409_100004394 | |||
| 1289 | Ga0307409_100989842 | |||
| 1290 | Ga0307409_101939674 | |||
| 1291 | Ga0307409_102024175 | |||
| 1292 | Ga0307416_100005285 | |||
| 1293 | Ga0307416_100744123 | |||
| 1294 | Ga0307416_101469148 | |||
| 1295 | Ga0307414_10269756 | |||
| 1296 | Ga0307414_10309586 | |||
| 1297 | Ga0307414_10520607 | |||
| 1298 | Ga0307411_12059527 | |||
| 1299 | Ga0307415_100008614 | |||
| 1300 | Ga0307415_100201386 | |||
| 1301 | Ga0307415_100607553 | |||
| 1302 | Ga0307415_100960089 | |||
| 1303 | Ga0307415_101084235 | |||
| 1304 | Ga0395899_0162658 | |||
| 1305 | Ga0395900_0006982 | |||
| 1306 | Ga0395900_0263054 | |||
| 1307 | Ga0395900_0438975 | |||
| 1308 | Ga0395900_0451389 | |||
| 1309 | Ga0395898_0019914 | |||
| 1310 | Ga0395898_0852468 | |||
| 1311 | Ga0395901_0085857 | |||
| 1312 | Ga0237816_11011 | |||
| 1313 | Ga0439436_0041933 | |||
| 1314 | Ga0439439_0059326 | |||
| 1315 | Ga0439461_0053344 | |||
| 1316 | Ga0439461_0111934 | |||
| 1317 | Ga0439466_0121782 | |||
| 1318 | Ga0439465_0022200 | |||
| 1319 | Ga0439465_0072314 | |||
| 1320 | Ga0439465_0081676 | |||
| 1321 | Ga0451787_246423 | |||
| 1322 | Ga0451790_16668 | |||
| 1323 | Ga0451794_51954 | |||
| 1324 | Ga0451791_0252410 | |||
| 1325 | Ga0451791_0522425 | |||
| 1326 | Ga0451791_0885182 | |||
| 1327 | Ga0451791_0946463 | |||
| 1328 | Ga0451791_1667512 | |||
| 1329 | Ga0451793_0114708 | |||
| 1330 | Ga0451793_0364734 | |||
| 1331 | Ga0451797_0447299 | |||
| 1332 | Ga0451797_0573731 | |||
| 1333 | Ga0451797_1305345 | |||
| 1334 | Ga0451795_0457218 | |||
| 1335 | Ga0451795_0898513 | |||
| 1336 | Ga0451795_1334679 | |||
| 1337 | Ga0451800_0760376 | |||
| 1338 | Ga0451802_0834053 | |||
| 1339 | Ga0451802_1970844 | |||
| 1340 | Ga0451805_062275 | |||
| 1341 | Ga0451805_105826 | |||
| 1342 | Ga0451804_0489240 | |||
| 1343 | Ga0451807_2527770 | |||
| 1344 | Ga0451807_2680378 | |||
| 1345 | Ga0451833_1022863 | |||
| 1346 | Ga0451837_0158494 | |||
| 1347 | Ga0451841_0676603 | |||
| 1348 | Ga0451845_0769710 | |||
| 1349 | Ga0451847_0326429 | |||
| 1350 | Ga0451855_0157124 | |||
| 1351 | Ga0451855_1282023 | |||
| 1352 | Ga0451855_1919360 | |||
| 1353 | Ga0451853_0210551 | |||
| 1354 | Ga0451853_0362195 | |||
| 1355 | Ga0451853_1287593 | |||
| 1356 | Ga0451853_3699793 | |||
| 1357 | Ga0439431_0023873 | |||
| 1358 | Ga0439431_0058250 | |||
| 1359 | Ga0439442_040323 | |||
| 1360 | Ga0439449_0386704 | |||
| 1361 | Ga0439457_082023 | |||
| 1362 | Ga0439463_024047 | |||
| 1363 | Ga0450920_023388 | |||
| 1364 | Ga0450923_019939 | |||
| 1365 | Ga0450902_017328 | |||
| 1366 | Ga0450905_019201 | |||
| 1367 | Ga0450905_024562 | |||
| 1368 | Ga0450906_071078 | |||
| 1369 | Ga0450910_074924 | |||
| 1370 | Ga0439446_0171586 | |||
| 1371 | Ga0450909_036270 | |||
| 1372 | Ga0439459_0055691 | |||
| 1373 | Ga0439459_0105076 | |||
| 1374 | Ga0439464_0203545 | |||
| 1375 | Ga0450918_002834 | |||
| 1376 | Ga0450918_020516 | |||
| 1377 | Ga0466972_0106471 | |||
| 1378 | Ga0466972_0412879 | |||
| 1379 | Ga0466965_0000003 | |||
| 1380 | Ga0466965_0023372 | |||
| 1381 | Ga0466965_0279776 | |||
| 1382 | Ga0466968_0162456 | |||
| 1383 | Ga0466970_0000027 | |||
| 1384 | Ga0466957_0481872 | |||
| 1385 | Ga0466958_0181544 | |||
| 1386 | Ga0466958_0842770 | |||
| 1387 | Ga0466967_0086122 | |||
| 1388 | Ga0495627_001687 | |||
| 1389 | Ga0495590_0327161 | |||
| 1390 | Ga0495638_0063229 | |||
| 1391 | Ga0495638_0115266 | |||
| 1392 | Ga0495650_0002639 | |||
| 1393 | Ga0495650_0093875 | |||
| 1394 | Ga0495650_0109089 | |||
| 1395 | Ga0495639_0351832 | |||
| 1396 | Ga0495620_0160846 | |||
| 1397 | Ga0495620_0343423 | |||
| 1398 | Ga0495631_0197683 | |||
| 1399 | Ga0495632_0104569 | |||
| 1400 | Ga0495643_0095066 | |||
| 1401 | Ga0495643_0370741 | |||
| 1402 | Ga0495663_0203307 | |||
| 1403 | Ga0495654_0029667 | |||
| 1404 | Ga0495587_0586571 | |||
| 1405 | Ga0495598_0021497 | |||
| 1406 | Ga0495645_0050080 | |||
| 1407 | Ga0495645_0323490 | |||
| 1408 | Ga0495645_0478378 | |||
| 1409 | Ga0495633_0473560 | |||
| 1410 | Ga0495656_0023242 | |||
| 1411 | Ga0495625_0678898 | |||
| 1412 | Ga0495658_0375610 | |||
| 1413 | Ga0495624_0891625 | |||
| 1414 | Ga0495671_0122328 | |||
| 1415 | Ga0495649_0160447 | |||
| 1416 | Ga0495600_0274860 | |||
| 1417 | Ga0495672_0011493 | |||
| 1418 | Ga0495686_0067922 | |||
| 1419 | Ga0495686_0227840 | |||
| 1420 | Ga0495686_0246858 | |||
| 1421 | Ga0495602_0601624 | |||
| 1422 | Ga0495615_0301450 | |||
| 1423 | Ga0496100_0011682 | |||
| 1424 | Ga0496100_0025779 | |||
| 1425 | Ga0496100_0410090 | |||
| 1426 | Ga0496101_0002898 | |||
| 1427 | Ga0496101_0123527 | |||
| 1428 | Ga0496102_0089571 | |||
| 1429 | Ga0496102_0188751 | |||
| 1430 | Ga0496103_0010181 | |||
| 1431 | Ga0496103_0024216 | |||
| 1432 | Ga0496104_0015491 | |||
| 1433 | Ga0496104_0171501 | |||
| 1434 | Ga0496104_0579457 | |||
| 1435 | Ga0496104_1294508 | |||
| 1436 | Ga0496104_1381368 | |||
| 1437 | Ga0496105_0009192 | |||
| 1438 | Ga0496105_0045124 | |||
| 1439 | Ga0496105_0145356 | |||
| 1440 | Ga0496105_0278400 | |||
| 1441 | Ga0496105_0350452 | |||
| 1442 | Ga0496105_0939262 | |||
| 1443 | Ga0496106_0117833 | |||
| 1444 | Ga0496107_0001328 | |||
| 1445 | Ga0496107_0227663 | |||
| 1446 | Ga0496108_0047565 | |||
| 1447 | Ga0496108_0378828 | |||
| 1448 | Ga0496108_1577978 | |||
| 1449 | Ga0496109_0016841 | |||
| 1450 | Ga0496109_0042506 | |||
| 1451 | Ga0496109_0219854 | |||
| 1452 | Ga0496109_1907855 | |||
| 1453 | Ga0496110_0036804 | |||
| 1454 | Ga0496110_0567031 | |||
| 1455 | Ga0496111_0012648 | |||
| 1456 | Ga0496111_0138419 | |||
| 1457 | Ga0496111_0236721 | |||
| 1458 | Ga0496111_0282014 | |||
| 1459 | Ga0496111_0968826 | |||
| 1460 | Ga0496112_0020079 | |||
| 1461 | Ga0496113_0005620 | |||
| 1462 | Ga0496113_0258695 | |||
| 1463 | Ga0496113_1150051 | |||
| 1464 | Ga0496114_0002463 | |||
| 1465 | Ga0496114_0194217 | |||
| 1466 | Ga0496114_0265025 | |||
| 1467 | Ga0496114_0297517 | |||
| 1468 | Ga0496114_0487680 | |||
| 1469 | Ga0496114_0518177 | |||
| 1470 | Ga0496115_0002702 | |||
| 1471 | Ga0496115_0045726 | |||
| 1472 | Ga0496115_0092488 | |||
| 1473 | Ga0496115_0216657 | |||
| 1474 | Ga0496115_0327444 | |||
| 1475 | Ga0496116_0021611 | |||
| 1476 | Ga0496116_0267126 | |||
| 1477 | Ga0496117_0000362 | |||
| 1478 | Ga0496117_0003610 | |||
| 1479 | Ga0496117_0004032 | |||
| 1480 | Ga0496117_0006530 | |||
| 1481 | Ga0496117_0009885 | |||
| 1482 | Ga0496117_0059887 | |||
| 1483 | Ga0496117_0108984 | |||
| 1484 | Ga0496117_0546609 | |||
| 1485 | Ga0496118_0002856 | |||
| 1486 | Ga0496118_0043816 | |||
| 1487 | Ga0496119_0000720 | |||
| 1488 | Ga0496119_0006250 | |||
| 1489 | Ga0496119_0025618 | |||
| 1490 | Ga0496119_0046717 | |||
| 1491 | Ga0496119_0049436 | |||
| 1492 | Ga0496119_0190207 | |||
| 1493 | Ga0496119_0192228 | |||
| 1494 | Ga0496119_0251481 | |||
| 1495 | Ga0496119_0275352 | |||
| 1496 | Ga0496119_0316247 | |||
| 1497 | Ga0496119_0336832 | |||
| 1498 | Ga0496119_0453570 | |||
| 1499 | Ga0496120_0007276 | |||
| 1500 | Ga0496120_0013513 | |||
| 1501 | Ga0496120_0022013 | |||
| 1502 | Ga0496120_0038694 | |||
| 1503 | Ga0496120_0109839 | |||
| 1504 | Ga0496120_0221924 | |||
| 1505 | Ga0496121_0000497 | |||
| 1506 | Ga0496121_0026877 | |||
| 1507 | Ga0496122_0000022 | |||
| 1508 | Ga0496122_0000799 | |||
| 1509 | Ga0496122_0005147 | |||
| 1510 | Ga0496122_0010341 | |||
| 1511 | Ga0496122_0026775 | |||
| 1512 | Ga0496122_0119930 | |||
| 1513 | Ga0496122_0435742 | |||
| 1514 | Ga0496122_0523403 | |||
| 1515 | Ga0496123_0000009 | |||
| 1516 | Ga0496123_0000016 | |||
| 1517 | Ga0496123_0002420 | |||
| 1518 | Ga0496123_0020865 | |||
| 1519 | Ga0496123_0083824 | |||
| 1520 | Ga0496123_0182963 | |||
| 1521 | Ga0496123_0237916 | |||
| 1522 | Ga0496124_0002766 | |||
| 1523 | Ga0496124_0006965 | |||
| 1524 | Ga0496124_0046380 | |||
| 1525 | Ga0496125_0001491 | |||
| 1526 | Ga0496125_0002578 | |||
| 1527 | Ga0496125_0016052 | |||
| 1528 | Ga0496125_0029529 | |||
| 1529 | Ga0496125_0123889 | |||
| 1530 | Ga0496126_0002077 | |||
| 1531 | Ga0496126_0002563 | |||
| 1532 | Ga0496126_0015145 | |||
| 1533 | Ga0496126_0020288 | |||
| 1534 | Ga0496126_0029883 | |||
| 1535 | Ga0496126_0089792 | |||
| 1536 | Ga0496126_0141466 | |||
| 1537 | Ga0496126_0263130 | |||
| 1538 | Ga0496126_0392660 | |||
| 1539 | Ga0501306_000074 | |||
| 1540 | Ga0501306_000560 | |||
| 1541 | Ga0501306_009610 | |||
| 1542 | Ga0501306_044904 | |||
| 1543 | Ga0501306_091381 | |||
| 1544 | Ga0501308_002157 | |||
| 1545 | Ga0501308_004467 | |||
| 1546 | Ga0501309_000615 | |||
| 1547 | Ga0501309_003216 | |||
| 1548 | Ga0501309_021404 | |||
| 1549 | Ga0501309_056572 | |||
| 1550 | Ga0501310_002153 | |||
| 1551 | Ga0501310_006171 | |||
| 1552 | Ga0501310_007007 | |||
| 1553 | Ga0501310_007679 | |||
| 1554 | Ga0501310_020196 | |||
| 1555 | Ga0501341_01921 | |||
| 1556 | Ga0501341_03734 | |||
| 1557 | Ga0501341_04190 | |||
| 1558 | Ga0501304_001479 | |||
| 1559 | Ga0501304_025540 | |||
| 1560 | Ga0501304_029583 | |||
| 1561 | Ga0501304_030253 | |||
| 1562 | Ga0501305_003699 | |||
| 1563 | Ga0501305_090353 | |||
| 1564 | Ga0501307_000930 | |||
| 1565 | Ga0501307_007279 | |||
| 1566 | Ga0501307_013113 | |||
| 1567 | Ga0501307_013962 | |||
| 1568 | Ga0501307_018450 | |||
| 1569 | Ga0501307_030182 | |||
| 1570 | Ga0501307_039061 | |||
| 1571 | Ga0501311_000216 | |||
| 1572 | Ga0501311_003504 | |||
| 1573 | Ga0501311_006499 | |||
| 1574 | Ga0501311_024279 | |||
| 1575 | Ga0501311_064511 | |||
| 1576 | Ga0501312_011327 | |||
| 1577 | Ga0501312_016522 | |||
| 1578 | Ga0501312_037408 | |||
| 1579 | Ga0501312_040937 | |||
| 1580 | Ga0501313_005880 | |||
| 1581 | Ga0501313_071242 | |||
| 1582 | Ga0501314_002632 | |||
| 1583 | Ga0501314_021280 | |||
| 1584 | Ga0501315_002877 | |||
| 1585 | Ga0501315_020592 | |||
| 1586 | Ga0501315_047156 | |||
| 1587 | Ga0501316_000435 | |||
| 1588 | Ga0501316_009910 | |||
| 1589 | Ga0501316_013098 | |||
| 1590 | Ga0501316_013217 | |||
| 1591 | Ga0501316_023780 | |||
| 1592 | Ga0501317_001951 | |||
| 1593 | Ga0501317_011943 | |||
| 1594 | Ga0501317_014096 | |||
| 1595 | Ga0501317_026782 | |||
| 1596 | Ga0501317_076255 | |||
| 1597 | Ga0501318_000070 | |||
| 1598 | Ga0501318_013616 | |||
| 1599 | Ga0501318_050164 | |||
| 1600 | Ga0501318_061498 | |||
| 1601 | Ga0501319_000088 | |||
| 1602 | Ga0501319_004101 | |||
| 1603 | Ga0501319_006052 | |||
| 1604 | Ga0501320_002053 | |||
| 1605 | Ga0501320_013226 | |||
| 1606 | Ga0501321_000212 | |||
| 1607 | Ga0501321_007064 | |||
| 1608 | Ga0501321_010938 | |||
| 1609 | Ga0501323_005116 | |||
| 1610 | Ga0501323_006917 | |||
| 1611 | Ga0501323_007033 | |||
| 1612 | Ga0501324_001941 | |||
| 1613 | Ga0501324_008804 | |||
| 1614 | Ga0501325_001231 | |||
| 1615 | Ga0501325_003351 | |||
| 1616 | Ga0501325_012426 | |||
| 1617 | Ga0501326_08559 | |||
| 1618 | Ga0501327_10274 | |||
| 1619 | Ga0501330_006252 | |||
| 1620 | Ga0501330_008606 | |||
| 1621 | Ga0501330_010575 | |||
| 1622 | Ga0501330_015283 | |||
| 1623 | Ga0501331_07226 | |||
| 1624 | Ga0501332_02792 | |||
| 1625 | Ga0501332_07209 | |||
| 1626 | Ga0501334_13800 | |||
| 1627 | Ga0501335_012651 | |||
| 1628 | Ga0501336_004708 | |||
| 1629 | Ga0501337_005088 | |||
| 1630 | Ga0501338_11695 | |||
| 1631 | Ga0501340_002551 | |||
| 1632 | Ga0501340_011976 | |||
| 1633 | Ga0501340_012709 | |||
| 1634 | Ga0501031_0053231 | |||
| 1635 | Ga0501031_0154726 | |||
| 1636 | Ga0501031_0185874 | |||
| 1637 | Ga0501031_0233826 | |||
| 1638 | Ga0501032_0003386 | |||
| 1639 | Ga0501032_0011095 | |||
| 1640 | Ga0501032_0017365 | |||
| 1641 | Ga0501033_0002214 | |||
| 1642 | Ga0501033_0004032 | |||
| 1643 | Ga0501033_0004858 | |||
| 1644 | Ga0501033_0147016 | |||
| 1645 | Ga0501033_0357914 | |||
| 1646 | Ga0501034_0002490 | |||
| 1647 | Ga0501034_0008687 | |||
| 1648 | Ga0501034_0022444 | |||
| 1649 | Ga0501034_0032413 | |||
| 1650 | Ga0501034_0057847 | |||
| 1651 | Ga0501034_0078054 | |||
| 1652 | Ga0501034_0208027 | |||
| 1653 | Ga0501034_0213629 | |||
| 1654 | Ga0501034_0240972 | |||
| 1655 | Ga0501034_0290985 | |||
| 1656 | Ga0501034_0557893 | |||
| 1657 | Ga0501034_1091062 | |||
| 1658 | Ga0501034_1264223 | |||
| 1659 | Ga0501034_1574227 | |||
| 1660 | Ga0501036_0039389 | |||
| 1661 | Ga0501036_0240730 | |||
| 1662 | Ga0501036_0544297 | |||
| 1663 | Ga0501036_0656143 | |||
| 1664 | Ga0501036_0670647 | |||
| 1665 | Ga0501036_0943498 | |||
| 1666 | Ga0501037_0001422 | |||
| 1667 | Ga0501037_0084416 | |||
| 1668 | Ga0501037_0160205 | |||
| 1669 | Ga0501037_0232969 | |||
| 1670 | Ga0501037_0309292 | |||
| 1671 | Ga0501037_0901739 | |||
| 1672 | Ga0501038_0003511 | |||
| 1673 | Ga0501038_0021820 | |||
| 1674 | Ga0501038_0126029 | |||
| 1675 | Ga0501038_0344075 | |||
| 1676 | Ga0501038_0370455 | |||
| 1677 | Ga0501038_0573279 | |||
| 1678 | Ga0501039_0008941 | |||
| 1679 | Ga0501039_0114351 | |||
| 1680 | Ga0501039_0388898 | |||
| 1681 | Ga0501039_0565281 | |||
| 1682 | Ga0501039_0828073 | |||
| 1683 | Ga0501039_0886832 | |||
| 1684 | Ga0501039_0967576 | |||
| 1685 | Ga0501040_0348686 | |||
| 1686 | Ga0501040_0705388 | |||
| 1687 | Ga0501042_0009674 | |||
| 1688 | Ga0501042_0098304 | |||
| 1689 | Ga0501042_0292483 | |||
| 1690 | Ga0501042_0998805 | |||
| 1691 | Ga0501043_0016944 | |||
| 1692 | Ga0501043_0048230 | |||
| 1693 | Ga0501043_0065288 | |||
| 1694 | Ga0501043_0100265 | |||
| 1695 | Ga0501043_0784689 | |||
| 1696 | Ga0501046_0013742 | |||
| 1697 | Ga0501046_0023204 | |||
| 1698 | Ga0501047_0001782 | |||
| 1699 | Ga0501047_0006944 | |||
| 1700 | Ga0501047_0034189 | |||
| 1701 | Ga0501048_0013228 | |||
| 1702 | Ga0501048_0016304 | |||
| 1703 | Ga0501048_0022961 | |||
| 1704 | Ga0501048_0291761 | |||
| 1705 | Ga0501048_0411271 | |||
| 1706 | Ga0501067_0023885 | |||
| 1707 | Ga0501067_0400834 | |||
| 1708 | Ga0501068_0045634 | |||
| 1709 | Ga0501068_0087080 | |||
| 1710 | Ga0501068_0666368 | |||
| 1711 | Ga0501069_0035485 | |||
| 1712 | Ga0501069_0037626 | |||
| 1713 | Ga0501069_0106583 | |||
| 1714 | Ga0501069_0429571 | |||
| 1715 | Ga0501069_0735944 | |||
| 1716 | Ga0501070_0000874 | |||
| 1717 | Ga0501070_0014598 | |||
| 1718 | Ga0501070_0015639 | |||
| 1719 | Ga0501070_0048708 | |||
| 1720 | Ga0501070_0170892 | |||
| 1721 | Ga0501070_0183881 | |||
| 1722 | Ga0501070_0236614 | |||
| 1723 | Ga0501071_0000119 | |||
| 1724 | Ga0501071_0175141 | |||
| 1725 | Ga0501071_0432562 | |||
| 1726 | Ga0501072_0160959 | |||
| 1727 | Ga0501072_0570567 | |||
| 1728 | Ga0501073_0000030 | |||
| 1729 | Ga0501073_0041926 | |||
| 1730 | Ga0501073_0124032 | |||
| 1731 | Ga0501073_0143186 | |||
| 1732 | Ga0501073_0510672 | |||
| 1733 | Ga0501073_0611871 | |||
| 1734 | Ga0501074_0028983 | |||
| 1735 | Ga0501074_0109265 | |||
| 1736 | Ga0501074_0257172 | |||
| 1737 | Ga0501074_0499410 | |||
| 1738 | Ga0501075_0709706 | |||
| 1739 | Ga0501076_0378201 | |||
| 1740 | Ga0501076_1528786 | |||
| 1741 | Ga0501077_0914008 | |||
| 1742 | Ga0501214_034494 | |||
| 1743 | Ga0501080_0000208 | |||
| 1744 | Ga0501080_0079834 | |||
| 1745 | Ga0501080_0119382 | |||
| 1746 | Ga0501080_1194266 | |||
| 1747 | Ga0501080_1661248 | |||
| 1748 | Ga0501081_0628195 | |||
| 1749 | Ga0501083_0015538 | |||
| 1750 | Ga0501083_0039761 | |||
| 1751 | Ga0501083_0142584 | |||
| 1752 | Ga0501083_0227432 | |||
| 1753 | Ga0501035_0013885 | |||
| 1754 | Ga0501035_0023629 | |||
| 1755 | Ga0501035_0360044 | |||
| 1756 | Ga0501035_0478328 | |||
| 1757 | Ga0501044_0001222 | |||
| 1758 | Ga0501044_0001531 | |||
| 1759 | Ga0501044_0021477 | |||
| 1760 | Ga0501044_0180571 | |||
| 1761 | Ga0501044_0705061 | |||
| 1762 | Ga0501044_0743427 | |||
| 1763 | Ga0501045_0114911 | |||
| 1764 | nmdc:mga03n38_210369_c1 | |||
| 1765 | nmdc:mga00v17_100204_c1 | |||
| 1766 | nmdc:mga00v17_113028_c1 | |||
| 1767 | nmdc:mga00v17_138040_c1 | |||
| 1768 | nmdc:mga00v17_165640_c1 | |||
| 1769 | nmdc:mga00v17_197603_c1 | |||
| 1770 | nmdc:mga00v17_231678_c1 | |||
| 1771 | nmdc:mga00v17_441872_c1 | |||
| 1772 | nmdc:mga00v17_473228_c1 | |||
| 1773 | nmdc:mga00v17_534563_c1 | |||
| 1774 | nmdc:mga00v17_6859_c1 | |||
| 1775 | nmdc:mga00v17_702801_c1 | |||
| 1776 | nmdc:mga0yw44_134716_c1 | |||
| 1777 | nmdc:mga0yw44_19106_c1 | |||
| 1778 | nmdc:mga0yw44_277_c1 | |||
| 1779 | nmdc:mga0yw44_593875_c1 | |||
| 1780 | nmdc:mga0k408_226215_c1 | |||
| 1781 | nmdc:mga06z11_203705_c1 | |||
| 1782 | nmdc:mga06z11_23458_c1 | |||
| 1783 | nmdc:mga06z11_261886_c1 | |||
| 1784 | nmdc:mga04h51_226028_c1 | |||
| 1785 | nmdc:mga04h51_27870_c1 | |||
| 1786 | nmdc:mga07m45_290131_c1 | |||
| 1787 | nmdc:mga07m45_8187_c1 | |||
| 1788 | nmdc:mga08y16_357908_c1 | |||
| 1789 | nmdc:mga08y16_462766_c1 | |||
| 1790 | nmdc:mga0sz30_216985_c1 | |||
| 1791 | nmdc:mga0sz30_308280_c1 | |||
| 1792 | Ga0500635_0003539 | |||
| 1793 | Ga0500651_0004271 | |||
| 1794 | Ga0500650_0021930 | |||
| 1795 | Ga0500654_209616 | |||
| 1796 | Ga0500556_0000020 | |||
| 1797 | Ga0500608_074519 | |||
| 1798 | Ga0500652_077661 | |||
| 1799 | Ga0500655_001124 | |||
| 1800 | Ga0500559_0070462 | |||
| 1801 | Ga0500559_0456316 | |||
| 1802 | Ga0500568_0000038 | |||
| 1803 | Ga0500568_0002756 | |||
| 1804 | Ga0500573_0193781 | |||
| 1805 | Ga0500573_0241740 | |||
| 1806 | Ga0500573_0293371 | |||
| 1807 | Ga0500573_0349543 | |||
| 1808 | Ga0500573_0443580 | |||
| 1809 | Ga0500573_0540548 | |||
| 1810 | Ga0500573_0555269 | |||
| 1811 | Ga0500577_0122216 | |||
| 1812 | Ga0500577_0303883 | |||
| 1813 | Ga0500606_169749 | |||
| 1814 | Ga0500616_0000027 | |||
| 1815 | Ga0500616_0026699 | |||
| 1816 | Ga0500636_0249477 | |||
| 1817 | Ga0500645_081041 | |||
| 1818 | Ga0501084_0133108 | |||
| 1819 | Ga0501084_1524162 | |||
| 1820 | Ga0587084_000004 | |||
| 1821 | Ga0587084_097638 | |||
| 1822 | Ga0587093_051773 | |||
| 1823 | Ga0587070_007986 | |||
| 1824 | Ga0587070_061502 | |||
| 1825 | Ga0587073_0026582 | |||
| 1826 | Ga0587077_025220 | |||
| 1827 | Ga0587077_096467 | |||
| 1828 | Ga0587080_108714 | |||
| 1829 | Ga0587082_055807 | |||
| 1830 | Ga0587082_065931 | |||
| 1831 | Ga0587083_0124197 | |||
| 1832 | Ga0587086_028379 | |||
| 1833 | Ga0587086_051210 | |||
| 1834 | Ga0587088_018103 | |||
| 1835 | Ga0587088_062998 | |||
| 1836 | Ga0587089_017250 | |||
| 1837 | Ga0587090_000311 | |||
| 1838 | Ga0587090_051852 | |||
| 1839 | Ga0587092_005842 | |||
| 1840 | Ga0587094_001057 | |||
| 1841 | Ga0587095_002206 | |||
| 1842 | Ga0587095_004022 | |||
| 1843 | Ga0587098_000186 | |||
| 1844 | Ga0587106_013695 | |||
| 1845 | Ga0587106_016615 | |||
| 1846 | Ga0587106_154271 | |||
| 1847 | Ga0587125_000024 | |||
| 1848 | Ga0587129_005457 | |||
| 1849 | Ga0587099_005271 | |||
| 1850 | Ga0587101_000011 | |||
| 1851 | Ga0587101_007043 | |||
| 1852 | Ga0587101_064909 | |||
| 1853 | Ga0587113_011663 | |||
| 1854 | Ga0587115_000112 | |||
| 1855 | Ga0587117_012574 | |||
| 1856 | Ga0587122_054708 | |||
| 1857 | Ga0587127_015589 | |||
| 1858 | Ga0587128_000332 | |||
| 1859 | Ga0587128_053974 | |||
| 1860 | Ga0587068_028950 | |||
| 1861 | Ga0587068_069517 | |||
| 1862 | Ga0587069_009037 | |||
| 1863 | Ga0587069_012760 | |||
| 1864 | Ga0587072_014536 | |||
| 1865 | Ga0587072_055636 | |||
| 1866 | Ga0587075_046591 | |||
| 1867 | Ga0587076_026022 | |||
| 1868 | Ga0587076_044515 | |||
| 1869 | Ga0587076_045923 | |||
| 1870 | Ga0587078_083251 | |||
| 1871 | Ga0587079_013651 | |||
| 1872 | Ga0587079_080182 | |||
| 1873 | Ga0587102_012056 | |||
| 1874 | Ga0587102_028304 | |||
| 1875 | Ga0587104_005156 | |||
| 1876 | Ga0587105_017585 | |||
| 1877 | Ga0587107_000354 | |||
| 1878 | Ga0587107_014792 | |||
| 1879 | Ga0587107_019950 | |||
| 1880 | Ga0587110_012784 | |||
| 1881 | Ga0587114_109321 | |||
| 1882 | Ga0587119_025599 | |||
| 1883 | Ga0587120_007104 | |||
| 1884 | Ga0587124_000015 | |||
| 1885 | Ga0587096_02006 | |||
| 1886 | Ga0587071_015645 | |||
| 1887 | Ga0587071_027227 | |||
| 1888 | Ga0587071_049865 | |||
| 1889 | Ga0587111_0003826 | |||
| 1890 | Ga0587111_0031991 | |||
| 1891 | Ga0501082_0795512 | |||
| 1892 | 2588107948 | |||
| 1893 | 2643732582 | |||
| 1894 | 2643753713 | |||
| 1895 | 2643786352 | |||
| 1896 | 2643847785 | |||
| 1897 | 2643994812 | |||
| 1898 | 2644171382 | |||
| 1899 | 2644197850 | |||
| 1900 | 2644681052 | |||
| 1901 | 2730230515 | |||
| 1902 | 2747952122 | |||
| 1903 | 2758224802 | |||
| 1904 | 2774378926 | |||
| 1905 | 2774382013 | |||
| 1906 | 2774400772 | |||
| 1907 | 2808628774 | |||
| 1908 | 2808884765 | |||
| 1909 | 2809226247 | |||
| 1910 | 2812322084 | |||
| 1911 | 2821268996 | |||
| 1912 | 2833709886 | |||
| 1913 | 2844854316 | |||
| 1914 | 2852632506 | |||
| 1915 | 2852647584 | |||
| 1916 | 2852678576 | |||
| 1917 | 2857722755 | |||
| 1918 | 2857725834 | |||
| 1919 | 2857730662 | |||
| 1920 | 2870622179 | |||
| 1921 | 2870629391 | |||
| 1922 | 2897564327 | |||
| 1923 | 2904510388 | |||
| 1924 | 2906801162 | |||
| 1925 | 2908678394 | |||
| 1926 | 2919070718 | |||
| 1927 | 2919397187 | |||
| 1928 | 2928093825 | |||
| 1929 | 2928121468 | |||
| 1930 | 2945968751 | |||
| 1931 | 2946036575 | |||
| 1932 | 2946045192 | |||
| 1933 | 2946084041 | |||
| 1934 | 2966926525 | |||
| 1935 | 2974294872 | |||
| 1936 | 2974325328 | |||
| 1937 | 2977230290 | |||
| 1938 | 2977239094 | |||
| 1939 | 2977265508 | |||
| 1940 | 2984543121 | |||
| 1941 | 2984582488 | |||
| 1942 | 8004184521 | |||
| 1943 | 8004213327 | |||
| 1944 | 8016255127 | |||
| 1945 | 8045832188 | |||
| 1946 | 8055035305 | |||
| 1947 | 8056039387 | |||
| 1948 | 8057347405 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c94-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9197 | 3 | 114 |
| 6czr-assembly2.cif.gz_2W | the structure of amicetin bound to the 70s ribosome | 0.9113 | 3 | 115 |
| 8c97-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9107 | 3 | 114 |
| 7nhn-assembly1.cif.gz_V | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9098 | 3 | 116 |
| 6pvk-assembly1.cif.gz_S | bacterial 45srbga ribosomal particle class a | 0.9076 | 4 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0YAA5_35_146_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.904 | 3 | 117 | 3.90.470.10 |
| af_P56795_7_145_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8956 | 2 | 115 | 3.90.470.10 |
| af_P9WHC1_2_148_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.889 | 3 | 118 | 3.90.470.10 |
| 5jvgP00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.883 | 5 | 115 | 3.90.470.10 |
| 4g5uS00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8809 | 3 | 115 | 3.90.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P7AE44-F1-model_v4 | deleted | 0.9349 | 1 | 118 |
|
| AF-A0A6L9XSY5-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9338 | 1 | 116 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-C5CC57-F1-model_v4 | Large ribosomal subunit protein uL22 (50S ribosomal protein L22) | 0.9327 | 3 | 115 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A7Y4X9P2-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9315 | 3 | 114 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-B7GND5-F1-model_v4 | Large ribosomal subunit protein uL22 (50S ribosomal protein L22) | 0.9305 | 3 | 115 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |