F487225

General Info

Members Datasets Scaffolds Average Seq Length
975 403 1948 65

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_101025081|Ga0070716_1010250812
Length 73
Sequence MTRPTAKEIKAMADVAGVPVSTEVATRIANSIGPAFEGFAPVAGTLPLDLEPATFAVVQTAKTDTKTNKKGEK

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
222 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
247 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
248 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
249 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
250 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
251 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
252 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
253 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
256 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
257 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
258 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
265 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
336 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
364 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
367 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
368 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
369 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
372 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
385 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
391 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
392 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
393 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
394 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
395 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
396 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
397 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
398 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
399 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
400 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
401 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
402 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
403 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.21
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0.21
Rhizoplane 8.62
Rhizosphere 77.95
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_101025081 3300006173 Bacteria 654
2 Ga0065165_1028654 3300005262 Bacteria 1795
3 Ga0070676_10095558 3300005328 Bacteria 1827
4 Ga0070683_101510456 3300005329 Bacteria 646
5 Ga0070690_100139324 3300005330 Bacteria 1645
6 Ga0070690_100637158 3300005330 Bacteria 813
7 Ga0070670_100851596 3300005331 Bacteria 825
8 Ga0068869_100021516 3300005334 Bacteria 4438
9 Ga0068869_100060160 3300005334 Bacteria 2783
10 Ga0068869_101024677 3300005334 Bacteria 720
11 Ga0070666_10083835 3300005335 Bacteria 2181
12 Ga0070680_100012511 3300005336 Bacteria 6596
13 Ga0070682_100091969 3300005337 Bacteria 1986
14 Ga0070682_100223918 3300005337 Bacteria 1341
15 Ga0070682_100281468 3300005337 Bacteria 1212
16 Ga0070682_100630292 3300005337 Bacteria 851
17 Ga0070682_101075294 3300005337 Bacteria 672
18 Ga0068868_100034314 3300005338 Bacteria 3916
19 Ga0068868_100042187 3300005338 Bacteria 3559
20 Ga0068868_100543940 3300005338 Bacteria 1023
21 Ga0068868_100659331 3300005338 Bacteria 932
22 Ga0070660_101401290 3300005339 Bacteria 594
23 Ga0070660_101487341 3300005339 Bacteria 576
24 Ga0070689_101194371 3300005340 Bacteria 683
25 Ga0070661_100733913 3300005344 Bacteria 807
26 Ga0070661_100832721 3300005344 Bacteria 759
27 Ga0070661_101311303 3300005344 Bacteria 607
28 Ga0070692_10412295 3300005345 Bacteria 855
29 Ga0070668_100052513 3300005347 Bacteria 3141
30 Ga0070668_100912729 3300005347 Bacteria 786
31 Ga0070668_100992088 3300005347 Bacteria 754
32 Ga0070668_101961938 3300005347 Bacteria 540
33 Ga0070669_100051858 3300005353 Bacteria 2999
34 Ga0070669_100513050 3300005353 Bacteria 996
35 Ga0070669_101825220 3300005353 Bacteria 531
36 Ga0070671_100062733 3300005355 Bacteria 3094
37 Ga0070671_100228259 3300005355 Bacteria 1580
38 Ga0070671_100681823 3300005355 Bacteria 891
39 Ga0070671_101770858 3300005355 Bacteria 549
40 Ga0070674_100176507 3300005356 Bacteria 1633
41 Ga0070674_101922908 3300005356 Bacteria 538
42 Ga0070673_100292958 3300005364 Bacteria 1431
43 Ga0070673_101025368 3300005364 Bacteria 769
44 Ga0070673_101376178 3300005364 Bacteria 664
45 Ga0070688_100392233 3300005365 Bacteria 1026
46 Ga0070659_100134195 3300005366 Bacteria 2013
47 Ga0070659_100251416 3300005366 Bacteria 1465
48 Ga0070667_100570995 3300005367 Bacteria 1041
49 Ga0070709_10121361 3300005434 Bacteria 1772
50 Ga0070709_10777669 3300005434 Bacteria 750
51 Ga0070709_11400705 3300005434 Bacteria 566
52 Ga0070714_100075320 3300005435 Bacteria 2928
53 Ga0070714_100699541 3300005435 Bacteria 978
54 Ga0070713_100023479 3300005436 Bacteria 4786
55 Ga0070713_101218271 3300005436 Bacteria 729
56 Ga0070710_11172953 3300005437 Bacteria 567
57 Ga0070701_10904003 3300005438 Bacteria 609
58 Ga0070701_11376484 3300005438 Bacteria 507
59 Ga0070711_100009020 3300005439 Bacteria 6124
60 Ga0070711_100379406 3300005439 Bacteria 1143
61 Ga0070700_100489815 3300005441 Bacteria 943
62 Ga0070700_100676674 3300005441 Bacteria 818
63 Ga0070694_100806871 3300005444 Bacteria 770
64 Ga0070694_101143924 3300005444 Bacteria 650
65 Ga0070663_100007386 3300005455 Bacteria 6685
66 Ga0070663_100009181 3300005455 Bacteria 6115
67 Ga0070663_100563636 3300005455 Bacteria 954
68 Ga0070663_100882086 3300005455 Bacteria 772
69 Ga0070678_100384185 3300005456 Bacteria 1215
70 Ga0070678_100411120 3300005456 Bacteria 1177
71 Ga0070678_100789427 3300005456 Bacteria 861
72 Ga0070678_101058839 3300005456 Bacteria 747
73 Ga0070678_101408742 3300005456 Bacteria 651
74 Ga0070678_102354901 3300005456 Bacteria 506
75 Ga0070662_100147895 3300005457 Bacteria 1826
76 Ga0070662_100438528 3300005457 Bacteria 1082
77 Ga0070662_100551896 3300005457 Bacteria 965
78 Ga0070662_101084776 3300005457 Bacteria 687
79 Ga0070681_10915560 3300005458 Bacteria 795
80 Ga0070681_11655034 3300005458 Bacteria 566
81 Ga0070685_10174702 3300005466 Bacteria 1379
82 Ga0070685_10306024 3300005466 Bacteria 1073
83 Ga0070706_100380377 3300005467 Bacteria 1315
84 Ga0070706_102023414 3300005467 Bacteria 521
85 Ga0070699_100786662 3300005518 Bacteria 870
86 Ga0070679_100439546 3300005530 Bacteria 1249
87 Ga0070679_100551275 3300005530 Bacteria 1097
88 Ga0070679_100576481 3300005530 Bacteria 1069
89 Ga0070679_100643030 3300005530 Bacteria 1003
90 Ga0070684_100091808 3300005535 Bacteria 2701
91 Ga0070684_100246415 3300005535 Bacteria 1633
92 Ga0070684_100582271 3300005535 Bacteria 1040
93 Ga0070697_100131997 3300005536 Bacteria 2095
94 Ga0068853_100237050 3300005539 Bacteria 1671
95 Ga0068853_100274573 3300005539 Bacteria 1553
96 Ga0068853_101618741 3300005539 Bacteria 627
97 Ga0068853_101633310 3300005539 Bacteria 625
98 Ga0068853_102023689 3300005539 Bacteria 558
99 Ga0070672_100501844 3300005543 Bacteria 1050
100 Ga0070672_100600487 3300005543 Bacteria 958
101 Ga0070696_100405206 3300005546 Bacteria 1068
102 Ga0070696_100407547 3300005546 Bacteria 1065
103 Ga0070696_101782661 3300005546 Bacteria 532
104 Ga0070693_100482956 3300005547 Bacteria 876
105 Ga0070665_100006118 3300005548 Bacteria 12305
106 Ga0070665_100034010 3300005548 Bacteria 5126
107 Ga0070665_100130352 3300005548 Bacteria 2517
108 Ga0070665_100277326 3300005548 Bacteria 1678
109 Ga0070665_100501724 3300005548 Bacteria 1225
110 Ga0070665_100747992 3300005548 Bacteria 991
111 Ga0070665_101621115 3300005548 Bacteria 655
112 Ga0070704_101887851 3300005549 Bacteria 553
113 Ga0068855_100292750 3300005563 Bacteria 1805
114 Ga0068855_100882192 3300005563 Bacteria 946
115 Ga0070664_100046714 3300005564 Bacteria 3657
116 Ga0068857_100035532 3300005577 Bacteria 4413
117 Ga0068857_100966243 3300005577 Bacteria 819
118 Ga0068854_100169893 3300005578 Bacteria 1696
119 Ga0068854_100755541 3300005578 Bacteria 844
120 Ga0068854_101027370 3300005578 Bacteria 731
121 Ga0068854_101972624 3300005578 Bacteria 537
122 Ga0068856_100057634 3300005614 Bacteria 3835
123 Ga0068856_100370716 3300005614 Bacteria 1451
124 Ga0068856_100527621 3300005614 Bacteria 1202
125 Ga0070702_100241766 3300005615 Bacteria 1219
126 Ga0070702_100353580 3300005615 Bacteria 1036
127 Ga0070702_100925167 3300005615 Bacteria 684
128 Ga0068852_100538436 3300005616 Bacteria 1167
129 Ga0068852_100567210 3300005616 Bacteria 1137
130 Ga0068859_100150655 3300005617 Bacteria 2401
131 Ga0068864_100016160 3300005618 Bacteria 6211
132 Ga0068864_100038317 3300005618 Bacteria 4094
133 Ga0068864_100677940 3300005618 Bacteria 1005
134 Ga0068864_101317620 3300005618 Bacteria 723
135 Ga0068864_102249546 3300005618 Bacteria 552
136 Ga0068864_102715624 3300005618 Bacteria 501
137 Ga0068866_10076118 3300005718 Bacteria 1789
138 Ga0068866_10329030 3300005718 Bacteria 964
139 Ga0068861_100627997 3300005719 Bacteria 989
140 Ga0068861_100694847 3300005719 Bacteria 944
141 Ga0068861_102482985 3300005719 Bacteria 521
142 Ga0068851_10024840 3300005834 Bacteria 2935
143 Ga0068851_10232085 3300005834 Bacteria 1041
144 Ga0068863_100130928 3300005841 Bacteria 2395
145 Ga0068863_101304632 3300005841 Bacteria 733
146 Ga0068863_101764904 3300005841 Bacteria 628
147 Ga0068863_102429392 3300005841 Bacteria 533
148 Ga0068858_100569018 3300005842 Bacteria 1098
149 Ga0068858_100612645 3300005842 Bacteria 1057
150 Ga0068858_100810320 3300005842 Bacteria 914
151 Ga0068860_100223518 3300005843 Bacteria 1828
152 Ga0068860_100510904 3300005843 Bacteria 1200
153 Ga0068860_100791046 3300005843 Bacteria 962
154 Ga0068860_101006329 3300005843 Bacteria 851
155 Ga0068862_100606587 3300005844 Bacteria 1051
156 Ga0081455_10012598 3300005937 Bacteria 8428
157 Ga0081538_10077355 3300005981 Bacteria 1792
158 Ga0081540_1012305 3300005983 Bacteria 5647
159 Ga0081540_1020729 3300005983 Bacteria 3942
160 Ga0081540_1032288 3300005983 Bacteria 2862
161 Ga0081540_1055661 3300005983 Bacteria 1925
162 Ga0081540_1100944 3300005983 Bacteria 1243
163 Ga0081540_1282508 3300005983 Bacteria 572
164 Ga0081540_1300659 3300005983 Bacteria 552
165 Ga0081539_10158827 3300005985 Bacteria 1080
166 Ga0070717_10336181 3300006028 Bacteria 1348
167 Ga0075365_10084703 3300006038 Bacteria 2152
168 Ga0075365_10196791 3300006038 Bacteria 1411
169 Ga0075365_10349965 3300006038 Bacteria 1041
170 Ga0075365_10352986 3300006038 Bacteria 1037
171 Ga0075365_10656085 3300006038 Bacteria 741
172 Ga0075368_10046201 3300006042 Bacteria 1722
173 Ga0075368_10051084 3300006042 Bacteria 1643
174 Ga0075368_10108052 3300006042 Bacteria 1146
175 Ga0075368_10125544 3300006042 Bacteria 1065
176 Ga0075363_100003826 3300006048 Bacteria 6487
177 Ga0075363_100386891 3300006048 Bacteria 821
178 Ga0075364_10132637 3300006051 Bacteria 1672
179 Ga0075364_10253237 3300006051 Bacteria 1197
180 Ga0075432_10074492 3300006058 Bacteria 1223
181 Ga0070716_100240777 3300006173 Bacteria 1227
182 Ga0070712_100408574 3300006175 Bacteria 1123
183 Ga0070712_100572505 3300006175 Bacteria 953
184 Ga0070712_100698048 3300006175 Bacteria 865
185 Ga0075367_10013146 3300006178 Bacteria 4440
186 Ga0075367_10218052 3300006178 Bacteria 1194
187 Ga0075367_10561849 3300006178 Bacteria 725
188 Ga0075367_10579971 3300006178 Bacteria 712
189 Ga0075369_10040322 3300006186 Bacteria 1995
190 Ga0075366_10136676 3300006195 Bacteria 1480
191 Ga0075366_10474315 3300006195 Bacteria 773
192 Ga0075366_10946808 3300006195 Bacteria 537
193 Ga0097621_100078810 3300006237 Bacteria 2737
194 Ga0097621_101777034 3300006237 Bacteria 588
195 Ga0075370_10341589 3300006353 Bacteria 893
196 Ga0075370_10360120 3300006353 Bacteria 870
197 Ga0075370_10518933 3300006353 Bacteria 720
198 Ga0075370_10578391 3300006353 Bacteria 680
199 Ga0068871_100184390 3300006358 Bacteria 1795
200 Ga0068871_100435700 3300006358 Bacteria 1173
201 Ga0068871_100514253 3300006358 Bacteria 1080
202 Ga0075434_100131833 3300006871 Bacteria 2519
203 Ga0075434_101404132 3300006871 Bacteria 708
204 Ga0075434_101634337 3300006871 Bacteria 653
205 Ga0068865_100062209 3300006881 Bacteria 2620
206 Ga0068865_100358995 3300006881 Bacteria 1183
207 Ga0068865_100836199 3300006881 Bacteria 797
208 Ga0075436_100133028 3300006914 Bacteria 1745
209 Ga0097620_100150655 3300006931 Bacteria 2401
210 Ga0097620_102075299 3300006931 Bacteria 628
211 Ga0097620_102843996 3300006931 Bacteria 531
212 Ga0075435_100757374 3300007076 Bacteria 845
213 Ga0075435_101832513 3300007076 Bacteria 533
214 Ga0099794_10148910 3300007265 Bacteria 1188
215 Ga0099794_10490045 3300007265 Bacteria 646
216 Ga0099794_10621803 3300007265 Bacteria 572
217 Ga0099795_10116208 3300007788 Bacteria 1065
218 Ga0105250_10021947 3300009092 Bacteria 2575
219 Ga0105250_10373498 3300009092 Bacteria 628
220 Ga0105240_10023702 3300009093 Bacteria 8106
221 Ga0105240_10186253 3300009093 Bacteria 2445
222 Ga0105240_11962914 3300009093 Archaea 608
223 Ga0111539_10165360 3300009094 Bacteria 2587
224 Ga0111539_11061853 3300009094 Bacteria 941
225 Ga0105245_10134290 3300009098 Bacteria 2324
226 Ga0105245_11077376 3300009098 Bacteria 849
227 Ga0105245_11389366 3300009098 Bacteria 752
228 Ga0105247_10016286 3300009101 Bacteria 4454
229 Ga0105247_10110352 3300009101 Bacteria 1770
230 Ga0105247_10253059 3300009101 Bacteria 1205
231 Ga0105247_10852192 3300009101 Bacteria 700
232 Ga0105247_10996902 3300009101 Bacteria 654
233 Ga0105247_11072825 3300009101 Bacteria 634
234 Ga0105243_10290759 3300009148 Bacteria 1476
235 Ga0105243_12523225 3300009148 Bacteria 553
236 Ga0105241_10074299 3300009174 Bacteria 2647
237 Ga0105241_10142573 3300009174 Bacteria 1952
238 Ga0105241_10408216 3300009174 Bacteria 1193
239 Ga0105241_10866387 3300009174 Bacteria 836
240 Ga0105241_11173588 3300009174 Bacteria 726
241 Ga0105242_10487030 3300009176 Bacteria 1170
242 Ga0105242_10619230 3300009176 Bacteria 1048
243 Ga0105242_11087239 3300009176 Bacteria 813
244 Ga0105248_10102190 3300009177 Bacteria 3231
245 Ga0105248_10169254 3300009177 Bacteria 2463
246 Ga0105248_10235239 3300009177 Bacteria 2062
247 Ga0105248_10235569 3300009177 Bacteria 2061
248 Ga0105248_11085830 3300009177 Bacteria 904
249 Ga0105248_12269120 3300009177 Bacteria 618
250 Ga0105237_10027033 3300009545 Bacteria 5860
251 Ga0105237_10087836 3300009545 Bacteria 3098
252 Ga0105237_10308133 3300009545 Bacteria 1586
253 Ga0105237_11565926 3300009545 Bacteria 666
254 Ga0105238_10117323 3300009551 Bacteria 2642
255 Ga0105238_10256670 3300009551 Bacteria 1727
256 Ga0105238_10503517 3300009551 Bacteria 1212
257 Ga0105238_10565726 3300009551 Bacteria 1142
258 Ga0105238_10812824 3300009551 Bacteria 951
259 Ga0105238_12498280 3300009551 Bacteria 553
260 Ga0105249_10891118 3300009553 Bacteria 956
261 Ga0105249_10964045 3300009553 Bacteria 921
262 Ga0105249_12926266 3300009553 Bacteria 548
263 Ga0105249_13032338 3300009553 Bacteria 539
264 Ga0099796_10291662 3300010159 Bacteria 689
265 Ga0105239_10078922 3300010375 Bacteria 3623
266 Ga0105239_10108573 3300010375 Bacteria 3074
267 Ga0105239_10186334 3300010375 Bacteria 2322
268 Ga0105239_11697601 3300010375 Bacteria 731
269 Ga0105239_12168158 3300010375 Bacteria 646
270 Ga0105239_12306057 3300010375 Bacteria 626
271 Ga0105239_12344899 3300010375 Bacteria 621
272 Ga0105239_12432165 3300010375 Bacteria 610
273 Ga0105246_10515348 3300011119 Bacteria 1018
274 Ga0105246_10562125 3300011119 Bacteria 979
275 Ga0105246_10666668 3300011119 Bacteria 907
276 Ga0105246_11135439 3300011119 Bacteria 715
277 Ga0105246_11875282 3300011119 Bacteria 575
278 Ga0157313_1007605 3300012503 Bacteria 849
279 Ga0157370_10497203 3300013104 Bacteria 1120
280 Ga0157369_10324529 3300013105 Bacteria 1600
281 Ga0157369_10452713 3300013105 Bacteria 1329
282 Ga0157374_10053147 3300013296 Bacteria 3775
283 Ga0157374_10975629 3300013296 Bacteria 866
284 Ga0157374_11075651 3300013296 Bacteria 824
285 Ga0157374_11710598 3300013296 Bacteria 654
286 Ga0157378_11149826 3300013297 Bacteria 814
287 Ga0163162_10087204 3300013306 Bacteria 3199
288 Ga0163162_10203354 3300013306 Bacteria 2110
289 Ga0163162_10542465 3300013306 Bacteria 1291
290 Ga0163162_10817189 3300013306 Bacteria 1049
291 Ga0163162_10820089 3300013306 Bacteria 1047
292 Ga0163162_11847226 3300013306 Bacteria 691
293 Ga0163162_12468991 3300013306 Bacteria 598
294 Ga0157372_12237471 3300013307 Bacteria 628
295 Ga0157375_10067337 3300013308 Bacteria 3578
296 Ga0157375_10791628 3300013308 Bacteria 1097
297 Ga0157375_11472251 3300013308 Bacteria 803
298 Ga0157375_11733932 3300013308 Bacteria 740
299 Ga0163163_10275411 3300014325 Bacteria 1734
300 Ga0163163_10322102 3300014325 Bacteria 1599
301 Ga0163163_11158577 3300014325 Bacteria 836
302 Ga0163163_12437420 3300014325 Bacteria 581
303 Ga0157380_10234548 3300014326 Bacteria 1650
304 Ga0157380_11749032 3300014326 Bacteria 680
305 Ga0182008_10730648 3300014497 Bacteria 568
306 Ga0157377_10484729 3300014745 Bacteria 861
307 Ga0157377_10708251 3300014745 Bacteria 732
308 Ga0157379_10062470 3300014968 Bacteria 3331
309 Ga0157379_10255133 3300014968 Bacteria 1593
310 Ga0157379_11530448 3300014968 Bacteria 650
311 Ga0157379_12377549 3300014968 Bacteria 529
312 Ga0157376_10052020 3300014969 Bacteria 3404
313 Ga0157376_10724637 3300014969 Bacteria 1002
314 Ga0157376_12219526 3300014969 Bacteria 588
315 Ga0157376_12261544 3300014969 Bacteria 583
316 Ga0163161_10466484 3300017792 Bacteria 1023
317 Ga0163161_10532395 3300017792 Bacteria 961
318 Ga0163161_10564212 3300017792 Bacteria 934
319 Ga0163161_11833141 3300017792 Bacteria 540
320 Ga0197907_10857289 3300020069 Bacteria 782
321 Ga0206350_11330305 3300020080 Archaea 508
322 Ga0207666_1029968 3300025271 Bacteria 831
323 Ga0209564_1003277 3300025295 Bacteria 11286
324 Ga0209758_1005057 3300025297 Bacteria 10466
325 Ga0207426_1112117 3300025302 Bacteria 686
326 Ga0207697_10095714 3300025315 Bacteria 1262
327 Ga0207697_10404845 3300025315 Bacteria 606
328 Ga0207656_10316743 3300025321 Bacteria 774
329 Ga0207656_10364414 3300025321 Bacteria 723
330 Ga0207692_10032829 3300025898 Bacteria 2498
331 Ga0207642_10297431 3300025899 Bacteria 934
332 Ga0207642_10383502 3300025899 Bacteria 837
333 Ga0207710_10250659 3300025900 Bacteria 885
334 Ga0207710_10350684 3300025900 Bacteria 752
335 Ga0207710_10440375 3300025900 Bacteria 672
336 Ga0207688_10434961 3300025901 Bacteria 817
337 Ga0207688_10907838 3300025901 Bacteria 558
338 Ga0207680_10410337 3300025903 Bacteria 958
339 Ga0207680_10415017 3300025903 Bacteria 953
340 Ga0207680_10841242 3300025903 Bacteria 658
341 Ga0207647_10615303 3300025904 Bacteria 598
342 Ga0207685_10194088 3300025905 Bacteria 950
343 Ga0207685_10635013 3300025905 Bacteria 576
344 Ga0207645_10074983 3300025907 Bacteria 2166
345 Ga0207645_11108072 3300025907 Bacteria 534
346 Ga0207645_11184818 3300025907 Bacteria 513
347 Ga0207643_10034912 3300025908 Bacteria 2818
348 Ga0207705_10062266 3300025909 Bacteria 2695
349 Ga0207684_10364382 3300025910 Bacteria 1244
350 Ga0207654_10019788 3300025911 Bacteria 3559
351 Ga0207654_10325330 3300025911 Bacteria 1052
352 Ga0207654_10536226 3300025911 Bacteria 830
353 Ga0207654_11068369 3300025911 Bacteria 588
354 Ga0207707_10052748 3300025912 Bacteria 3539
355 Ga0207707_10064029 3300025912 Bacteria 3200
356 Ga0207707_11294238 3300025912 Bacteria 586
357 Ga0207695_10057666 3300025913 Bacteria 4034
358 Ga0207695_10269629 3300025913 Bacteria 1598
359 Ga0207695_10723346 3300025913 Bacteria 876
360 Ga0207671_10066485 3300025914 Bacteria 2683
361 Ga0207671_10149214 3300025914 Bacteria 1806
362 Ga0207671_10517969 3300025914 Bacteria 951
363 Ga0207693_10236790 3300025915 Bacteria 1433
364 Ga0207693_10420056 3300025915 Bacteria 1045
365 Ga0207663_10046410 3300025916 Bacteria 2676
366 Ga0207660_10021088 3300025917 Bacteria 4378
367 Ga0207660_10744682 3300025917 Bacteria 800
368 Ga0207662_10086259 3300025918 Bacteria 1924
369 Ga0207662_10329426 3300025918 Bacteria 1021
370 Ga0207657_10012461 3300025919 Bacteria 8392
371 Ga0207657_10165202 3300025919 Bacteria 1796
372 Ga0207649_10574406 3300025920 Bacteria 865
373 Ga0207652_10042831 3300025921 Bacteria 3855
374 Ga0207652_10556178 3300025921 Bacteria 1031
375 Ga0207652_10720117 3300025921 Bacteria 889
376 Ga0207681_10111222 3300025923 Bacteria 1993
377 Ga0207694_10240496 3300025924 Bacteria 1479
378 Ga0207694_10281173 3300025924 Bacteria 1367
379 Ga0207694_10418672 3300025924 Bacteria 1116
380 Ga0207694_10488430 3300025924 Bacteria 1030
381 Ga0207650_10646820 3300025925 Bacteria 891
382 Ga0207650_10809579 3300025925 Bacteria 794
383 Ga0207687_10063690 3300025927 Bacteria 2611
384 Ga0207687_10069486 3300025927 Bacteria 2512
385 Ga0207687_10875275 3300025927 Bacteria 768
386 Ga0207700_11028906 3300025928 Bacteria 737
387 Ga0207664_10038734 3300025929 Bacteria 3697
388 Ga0207664_10265243 3300025929 Bacteria 1503
389 Ga0207664_10714798 3300025929 Bacteria 901
390 Ga0207664_11593661 3300025929 Bacteria 575
391 Ga0207644_10086400 3300025931 Bacteria 2329
392 Ga0207644_10347373 3300025931 Bacteria 1204
393 Ga0207644_11152595 3300025931 Bacteria 652
394 Ga0207644_11315774 3300025931 Bacteria 607
395 Ga0207706_10097345 3300025933 Bacteria 2588
396 Ga0207706_10347639 3300025933 Bacteria 1289
397 Ga0207706_10752633 3300025933 Bacteria 830
398 Ga0207686_10315501 3300025934 Bacteria 1166
399 Ga0207686_10319557 3300025934 Bacteria 1159
400 Ga0207686_10671695 3300025934 Bacteria 821
401 Ga0207709_10134607 3300025935 Bacteria 1689
402 Ga0207709_10433349 3300025935 Bacteria 1012
403 Ga0207704_10057111 3300025938 Bacteria 2395
404 Ga0207704_11904676 3300025938 Bacteria 511
405 Ga0207665_10469022 3300025939 Bacteria 968
406 Ga0207665_10535903 3300025939 Bacteria 908
407 Ga0207665_10966010 3300025939 Bacteria 677
408 Ga0207691_10496654 3300025940 Bacteria 1036
409 Ga0207691_10553784 3300025940 Bacteria 975
410 Ga0207711_10025608 3300025941 Bacteria 4948
411 Ga0207711_10436629 3300025941 Bacteria 1218
412 Ga0207711_10488225 3300025941 Bacteria 1147
413 Ga0207711_11111027 3300025941 Bacteria 731
414 Ga0207689_10108961 3300025942 Bacteria 2276
415 Ga0207689_10208743 3300025942 Bacteria 1613
416 Ga0207661_10080746 3300025944 Bacteria 2684
417 Ga0207661_10323247 3300025944 Bacteria 1387
418 Ga0207661_10562430 3300025944 Bacteria 1045
419 Ga0207679_10108391 3300025945 Bacteria 2187
420 Ga0207679_10654574 3300025945 Bacteria 950
421 Ga0207679_11851295 3300025945 Bacteria 551
422 Ga0207667_10163053 3300025949 Bacteria 2292
423 Ga0207667_11646722 3300025949 Bacteria 609
424 Ga0207651_10830368 3300025960 Bacteria 820
425 Ga0207712_10063310 3300025961 Bacteria 2633
426 Ga0207712_11121398 3300025961 Bacteria 701
427 Ga0207668_10071147 3300025972 Bacteria 2483
428 Ga0207668_10327891 3300025972 Bacteria 1272
429 Ga0207668_10427029 3300025972 Bacteria 1126
430 Ga0207668_10604587 3300025972 Bacteria 955
431 Ga0207668_10994188 3300025972 Bacteria 749
432 Ga0207668_11505905 3300025972 Bacteria 607
433 Ga0207668_11528868 3300025972 Bacteria 602
434 Ga0207668_11736762 3300025972 Bacteria 563
435 Ga0207640_10324531 3300025981 Bacteria 1227
436 Ga0207640_10453736 3300025981 Bacteria 1057
437 Ga0207640_11937250 3300025981 Bacteria 533
438 Ga0207640_12091921 3300025981 Bacteria 513
439 Ga0207658_10119807 3300025986 Bacteria 2096
440 Ga0207658_11124560 3300025986 Bacteria 718
441 Ga0207677_10111875 3300026023 Bacteria 2035
442 Ga0207677_10167980 3300026023 Bacteria 1712
443 Ga0207677_10222459 3300026023 Bacteria 1515
444 Ga0207677_10966914 3300026023 Bacteria 771
445 Ga0207677_11366882 3300026023 Bacteria 652
446 Ga0207703_10032866 3300026035 Bacteria 4109
447 Ga0207703_10378699 3300026035 Bacteria 1308
448 Ga0207703_10449350 3300026035 Bacteria 1204
449 Ga0207703_10580157 3300026035 Bacteria 1059
450 Ga0207703_11360869 3300026035 Bacteria 683
451 Ga0207703_12216969 3300026035 Bacteria 525
452 Ga0207703_12418279 3300026035 Bacteria 501
453 Ga0207639_10330834 3300026041 Bacteria 1355
454 Ga0207639_10724454 3300026041 Bacteria 924
455 Ga0207639_10832069 3300026041 Bacteria 861
456 Ga0207639_10929568 3300026041 Bacteria 813
457 Ga0207639_11273633 3300026041 Bacteria 690
458 Ga0207639_11909851 3300026041 Bacteria 555
459 Ga0207678_10022769 3300026067 Bacteria 5486
460 Ga0207678_10050693 3300026067 Bacteria 3586
461 Ga0207678_10062792 3300026067 Bacteria 3192
462 Ga0207678_10414912 3300026067 Bacteria 1167
463 Ga0207678_10641983 3300026067 Bacteria 932
464 Ga0207678_11518913 3300026067 Bacteria 591
465 Ga0207708_10353297 3300026075 Bacteria 1206
466 Ga0207708_10481764 3300026075 Bacteria 1037
467 Ga0207702_10000101 3300026078 Bacteria 99845
468 Ga0207702_10294200 3300026078 Bacteria 1539
469 Ga0207702_10458630 3300026078 Bacteria 1238
470 Ga0207641_10193968 3300026088 Bacteria 1868
471 Ga0207641_10212661 3300026088 Bacteria 1789
472 Ga0207641_10445958 3300026088 Bacteria 1250
473 Ga0207641_11903760 3300026088 Bacteria 596
474 Ga0207648_11969562 3300026089 Bacteria 546
475 Ga0207676_10027587 3300026095 Bacteria 4231
476 Ga0207676_10166799 3300026095 Bacteria 1914
477 Ga0207676_10505888 3300026095 Bacteria 1148
478 Ga0207676_10882945 3300026095 Bacteria 876
479 Ga0207676_10961396 3300026095 Bacteria 840
480 Ga0207674_10006374 3300026116 Bacteria 13889
481 Ga0207674_10045376 3300026116 Bacteria 4521
482 Ga0207674_10881749 3300026116 Bacteria 862
483 Ga0207674_11372154 3300026116 Bacteria 676
484 Ga0207675_100304181 3300026118 Bacteria 1554
485 Ga0207675_100511708 3300026118 Bacteria 1196
486 Ga0207675_100892161 3300026118 Bacteria 905
487 Ga0207675_101410121 3300026118 Bacteria 717
488 Ga0207675_102484850 3300026118 Bacteria 529
489 Ga0207683_10120195 3300026121 Bacteria 2358
490 Ga0207683_10198786 3300026121 Bacteria 1822
491 Ga0207683_10618052 3300026121 Bacteria 1003
492 Ga0207683_11123724 3300026121 Bacteria 729
493 Ga0207698_10607430 3300026142 Bacteria 1079
494 Ga0207698_10839569 3300026142 Bacteria 923
495 Ga0207698_12504259 3300026142 Bacteria 526
496 Ga0209588_1081720 3300027671 Bacteria 1043
497 Ga0209813_10024637 3300027866 Bacteria 1723
498 Ga0209813_10057960 3300027866 Bacteria 1230
499 Ga0209813_10273986 3300027866 Bacteria 648
500 Ga0207428_10475001 3300027907 Bacteria 910
501 Ga0268266_10000936 3300028379 Bacteria 37196
502 Ga0268266_10011944 3300028379 Bacteria 7518
503 Ga0268266_10032435 3300028379 Bacteria 4438
504 Ga0268266_10955200 3300028379 Bacteria 829
505 Ga0268266_11168700 3300028379 Bacteria 744
506 Ga0268265_10828793 3300028380 Bacteria 903
507 Ga0268265_11048111 3300028380 Bacteria 807
508 Ga0268265_11366022 3300028380 Bacteria 710
509 Ga0268265_11830947 3300028380 Bacteria 613
510 Ga0268265_11837278 3300028380 Bacteria 612
511 Ga0268265_11857045 3300028380 Bacteria 609
512 Ga0268264_10218565 3300028381 Bacteria 1753
513 Ga0268264_10233302 3300028381 Bacteria 1700
514 Ga0268264_12308680 3300028381 Bacteria 545
515 Ga0307517_10000476 3300028786 Bacteria 68696
516 Ga0307515_10121156 3300028794 Bacteria 2961
517 Ga0307511_10046100 3300030521 Bacteria 3591
518 Ga0307511_10098612 3300030521 Bacteria 1933
519 Ga0307512_10181996 3300030522 Bacteria 1179
520 Ga0265330_10017291 3300031235 Bacteria 3322
521 Ga0265330_10055412 3300031235 Bacteria 1731
522 Ga0265330_10058842 3300031235 Bacteria 1674
523 Ga0265332_10016586 3300031238 Bacteria 3250
524 Ga0265332_10223911 3300031238 Bacteria 780
525 Ga0265328_10083552 3300031239 Bacteria 1178
526 Ga0265328_10328471 3300031239 Bacteria 593
527 Ga0265325_10164669 3300031241 Bacteria 1041
528 Ga0265329_10213671 3300031242 Bacteria 637
529 Ga0265340_10046406 3300031247 Bacteria 2119
530 Ga0265340_10089087 3300031247 Bacteria 1445
531 Ga0265331_10177436 3300031250 Bacteria 963
532 Ga0265331_10294024 3300031250 Bacteria 728
533 Ga0265316_10146387 3300031344 Bacteria 1771
534 Ga0265316_10187081 3300031344 Bacteria 1540
535 Ga0265316_10400459 3300031344 Bacteria 989
536 Ga0265316_10698552 3300031344 Bacteria 715
537 Ga0307513_10288476 3300031456 Bacteria 1414
538 Ga0307513_10640822 3300031456 Bacteria 770
539 Ga0307509_10054161 3300031507 Bacteria 4272
540 Ga0307509_10106278 3300031507 Bacteria 2826
541 Ga0307509_10693506 3300031507 Bacteria 685
542 Ga0307509_10786269 3300031507 Bacteria 616
543 Ga0307408_102270659 3300031548 Bacteria 525
544 Ga0265313_10233531 3300031595 Bacteria 755
545 Ga0307508_10784193 3300031616 Bacteria 569
546 Ga0265314_10124022 3300031711 Bacteria 1621
547 Ga0265314_10320184 3300031711 Bacteria 863
548 Ga0265342_10047735 3300031712 Bacteria 2569
549 Ga0265342_10712015 3300031712 Bacteria 501
550 Ga0307516_10261486 3300031730 Bacteria 1421
551 Ga0307405_10176309 3300031731 Bacteria 1530
552 Ga0307405_10502238 3300031731 Bacteria 972
553 Ga0307413_10719128 3300031824 Bacteria 831
554 Ga0307413_11661199 3300031824 Bacteria 569
555 Ga0307410_10342480 3300031852 Bacteria 1192
556 Ga0307410_11373156 3300031852 Bacteria 620
557 Ga0307406_10572184 3300031901 Bacteria 927
558 Ga0307412_10308837 3300031911 Bacteria 1253
559 Ga0307409_100430672 3300031995 Bacteria 1268
560 Ga0307409_100901980 3300031995 Bacteria 897
561 Ga0307409_101531951 3300031995 Bacteria 694
562 Ga0307416_100512564 3300032002 Bacteria 1266
563 Ga0307416_101233979 3300032002 Bacteria 853
564 Ga0307416_102436579 3300032002 Bacteria 622
565 Ga0307414_11684690 3300032004 Bacteria 591
566 Ga0307411_10041450 3300032005 Bacteria 2929
567 Ga0307411_10744454 3300032005 Bacteria 858
568 Ga0307411_10774403 3300032005 Bacteria 843
569 Ga0307415_100123857 3300032126 Bacteria 1944
570 Ga0307415_100289602 3300032126 Bacteria 1351
571 Ga0307415_100440401 3300032126 Bacteria 1124
572 Ga0307415_100479421 3300032126 Bacteria 1083
573 Ga0307510_10055610 3300033180 Bacteria 4132
574 Ga0307510_10260763 3300033180 Bacteria 1215
575 Ga0307510_10285102 3300033180 Bacteria 1120
576 Ga0373958_0105523 3300034819 Bacteria 666
577 Ga0373958_0132556 3300034819 Bacteria 611
578 Ga0373928_0111198 3300035084 Bacteria 725
579 Ga0373934_0204576 3300035086 Bacteria 813
580 Ga0373944_0002516 3300035089 Bacteria 4657
581 Ga0373944_0097939 3300035089 Bacteria 988
582 Ga0373949_0129504 3300035090 Bacteria 715
583 Ga0373923_0488660 3300035111 Bacteria 600
584 Ga0373936_0023395 3300035113 Bacteria 2408
585 Ga0373945_0140923 3300035116 Bacteria 972
586 Ga0373953_0054773 3300035117 Bacteria 1618
587 Ga0373953_0519694 3300035117 Bacteria 528
588 Ga0373956_0023157 3300035119 Bacteria 2663
589 Ga0373956_0195252 3300035119 Bacteria 959
590 Ga0373957_0052425 3300035120 Bacteria 1563
591 Ga0373960_0107078 3300035121 Bacteria 913
592 Ga0373960_0449411 3300035121 Bacteria 505
593 Ga0373943_0001393 3300035170 Bacteria 10893
594 Ga0373946_0052787 3300035171 Bacteria 1706
595 Ga0373955_0007967 3300035172 Bacteria 4896
596 Ga0373955_0255732 3300035172 Bacteria 1051
597 Ga0373955_0408424 3300035172 Bacteria 825
598 Ga0373955_0770459 3300035172 Bacteria 591
599 Ga0373942_0061052 3300035207 Bacteria 1081
600 Ga0373924_0008559 3300035410 Bacteria 3723
601 Ga0373924_0333149 3300035410 Bacteria 676
602 Ga0373931_0005817 3300035691 Bacteria 5737
603 Ga0373931_0217723 3300035691 Bacteria 1148
604 Ga0373935_0004338 3300035692 Bacteria 8319
605 Ga0373935_0250811 3300035692 Bacteria 1238
606 Ga0373935_1368676 3300035692 Bacteria 529
607 Ga0373927_0006494 3300035695 Bacteria 7966
608 Ga0373927_0011722 3300035695 Bacteria 5836
609 Ga0373927_0088352 3300035695 Bacteria 2012
610 Ga0373927_0468319 3300035695 Bacteria 832
611 Ga0373933_0875101 3300035724 Bacteria 591
612 Ga0373947_0005689 3300035725 Bacteria 7269
613 Ga0373947_0567590 3300035725 Bacteria 773
614 Ga0373937_0400972 3300036401 Bacteria 1301
615 Ga0373937_0536641 3300036401 Bacteria 1111
616 Ga0373937_0622254 3300036401 Bacteria 1024
617 Ga0373937_2011591 3300036401 Bacteria 524
618 Ga0373925_0002440 3300037068 Bacteria 14906
619 Ga0373925_0009266 3300037068 Bacteria 7165
620 Ga0373925_0048246 3300037068 Bacteria 3173
621 Ga0373925_0209915 3300037068 Bacteria 1551
622 Ga0373925_0245062 3300037068 Bacteria 1436
623 Ga0373925_0441217 3300037068 Bacteria 1065
624 Ga0395905_0540183 3300037471 Bacteria 1067
625 Ga0439461_0051143 3300041410 Bacteria 917
626 Ga0451789_0696212 3300041443 Bacteria 546
627 Ga0451791_1594185 3300041451 Bacteria 569
628 Ga0451797_0611394 3300041453 Bacteria 777
629 Ga0451795_0896708 3300041456 Bacteria 832
630 Ga0451795_1341839 3300041456 Bacteria 770
631 Ga0451798_0872829 3300041458 Bacteria 673
632 Ga0451800_0569557 3300041459 Bacteria 581
633 Ga0451804_0266971 3300041463 Bacteria 644
634 Ga0451807_1493626 3300041486 Bacteria 526
635 Ga0451807_1578213 3300041486 Bacteria 557
636 Ga0451807_2434911 3300041486 Bacteria 877
637 Ga0451837_1490810 3300041494 Bacteria 755
638 Ga0451839_0057745 3300041496 Bacteria 567
639 Ga0451841_0590766 3300041498 Bacteria 690
640 Ga0451841_1003147 3300041498 Bacteria 737
641 Ga0451845_0550473 3300041501 Bacteria 517
642 Ga0451851_1168112 3300041507 Bacteria 880
643 Ga0451853_3462357 3300041512 Bacteria 520
644 Ga0451853_3705113 3300041512 Bacteria 1634
645 Ga0495627_200868 3300046453 Bacteria 549
646 Ga0495592_0019284 3300046454 Bacteria 5188
647 Ga0495603_0000029 3300046455 Bacteria 60872
648 Ga0495603_0133864 3300046455 Bacteria 1443
649 Ga0495603_0419777 3300046455 Bacteria 766
650 Ga0495603_0592680 3300046455 Bacteria 634
651 Ga0495603_0835679 3300046455 Bacteria 524
652 Ga0495590_0134423 3300046457 Bacteria 890
653 Ga0495591_156774 3300046458 Bacteria 546
654 Ga0495629_0000029 3300046459 Bacteria 127000
655 Ga0495629_0099667 3300046459 Bacteria 2027
656 Ga0495629_0254693 3300046459 Bacteria 1207
657 Ga0495629_0526974 3300046459 Bacteria 795
658 Ga0495638_0493496 3300046460 Bacteria 618
659 Ga0495638_0500861 3300046460 Bacteria 612
660 Ga0495641_0005506 3300046461 Bacteria 8521
661 Ga0495651_0090735 3300046462 Bacteria 2292
662 Ga0495651_0223276 3300046462 Bacteria 1302
663 Ga0495651_0387996 3300046462 Bacteria 914
664 Ga0495651_0718747 3300046462 Bacteria 621
665 Ga0495653_0062313 3300046463 Bacteria 2818
666 Ga0495653_0422484 3300046463 Bacteria 843
667 Ga0495580_0005561 3300046472 Bacteria 10391
668 Ga0495580_0343720 3300046472 Bacteria 1012
669 Ga0495582_0000068 3300046473 Bacteria 53389
670 Ga0495605_0137700 3300046474 Bacteria 1097
671 Ga0495639_0000006 3300046475 Bacteria 100361
672 Ga0495662_0003219 3300046476 Bacteria 8248
673 Ga0495662_0132665 3300046476 Bacteria 1225
674 Ga0495662_0474443 3300046476 Bacteria 614
675 Ga0495662_0575228 3300046476 Bacteria 551
676 Ga0495664_0039694 3300046477 Bacteria 2782
677 Ga0495664_0060095 3300046477 Bacteria 2263
678 Ga0495664_0101448 3300046477 Bacteria 1734
679 Ga0495664_0168512 3300046477 Bacteria 1329
680 Ga0495664_0924072 3300046477 Bacteria 510
681 Ga0495584_0084725 3300046491 Bacteria 1596
682 Ga0495584_0562103 3300046491 Bacteria 581
683 Ga0495585_0409261 3300046492 Bacteria 652
684 Ga0495585_0522909 3300046492 Bacteria 562
685 Ga0495594_0000750 3300046499 Bacteria 16637
686 Ga0495596_0038323 3300046500 Bacteria 1895
687 Ga0495596_0317148 3300046500 Bacteria 606
688 Ga0495607_0229204 3300046501 Bacteria 904
689 Ga0495607_0419310 3300046501 Bacteria 606
690 Ga0495606_0244961 3300046507 Bacteria 997
691 Ga0495606_0645738 3300046507 Bacteria 513
692 Ga0495616_0321354 3300046513 Bacteria 650
693 Ga0495618_0326629 3300046514 Bacteria 949
694 Ga0495618_0408951 3300046514 Bacteria 829
695 Ga0495620_0048200 3300046515 Bacteria 1830
696 Ga0495620_0239562 3300046515 Bacteria 692
697 Ga0495628_0090359 3300046516 Bacteria 2371
698 Ga0495628_0601263 3300046516 Bacteria 785
699 Ga0495630_0005874 3300046517 Bacteria 8682
700 Ga0495630_0203161 3300046517 Bacteria 1512
701 Ga0495631_0092712 3300046518 Bacteria 1300
702 Ga0495631_0185355 3300046518 Bacteria 891
703 Ga0495631_0208888 3300046518 Bacteria 834
704 Ga0495631_0279330 3300046518 Bacteria 711
705 Ga0495632_0444389 3300046519 Bacteria 563
706 Ga0495637_0350364 3300046520 Bacteria 518
707 Ga0495643_0366170 3300046522 Bacteria 642
708 Ga0495648_0217415 3300046524 Bacteria 945
709 Ga0495648_0329493 3300046524 Bacteria 705
710 Ga0495663_0038869 3300046525 Bacteria 1440
711 Ga0495663_0121627 3300046525 Bacteria 874
712 Ga0495666_0024498 3300046526 Bacteria 2981
713 Ga0495666_0223991 3300046526 Bacteria 861
714 Ga0495652_0066072 3300046529 Bacteria 3037
715 Ga0495652_0382537 3300046529 Bacteria 1001
716 Ga0495652_0784885 3300046529 Bacteria 635
717 Ga0495665_0000237 3300046531 Bacteria 27649
718 Ga0495665_0424006 3300046531 Bacteria 674
719 Ga0495640_0007919 3300046533 Bacteria 8356
720 Ga0495640_0240454 3300046533 Bacteria 1136
721 Ga0495640_0733201 3300046533 Bacteria 592
722 Ga0495586_0245592 3300046535 Bacteria 1021
723 Ga0495587_0261777 3300046536 Bacteria 971
724 Ga0495598_0011365 3300046537 Bacteria 2157
725 Ga0495598_0084314 3300046537 Bacteria 1025
726 Ga0495609_0088185 3300046538 Bacteria 1351
727 Ga0495609_0159041 3300046538 Bacteria 958
728 Ga0495621_0026472 3300046539 Bacteria 1957
729 Ga0495621_0083686 3300046539 Bacteria 1193
730 Ga0495645_0321313 3300046543 Bacteria 1005
731 Ga0495622_0009979 3300046557 Bacteria 4392
732 Ga0495622_0217950 3300046557 Bacteria 846
733 Ga0495622_0517092 3300046557 Bacteria 510
734 Ga0495633_0133579 3300046558 Bacteria 1148
735 Ga0495667_0016586 3300046559 Bacteria 4973
736 Ga0495667_0107146 3300046559 Bacteria 1806
737 Ga0495656_0040356 3300046615 Bacteria 1944
738 Ga0495656_0113966 3300046615 Bacteria 1268
739 Ga0495668_0065969 3300046616 Bacteria 1992
740 Ga0495668_0757956 3300046616 Bacteria 537
741 Ga0495634_0001307 3300046642 Bacteria 22759
742 Ga0495611_0069196 3300046648 Bacteria 1612
743 Ga0495611_0588853 3300046648 Bacteria 503
744 Ga0495625_0174547 3300046660 Bacteria 1433
745 Ga0495625_0311340 3300046660 Bacteria 1005
746 Ga0495635_0239830 3300046663 Bacteria 1223
747 Ga0495635_0758294 3300046663 Bacteria 627
748 Ga0495659_0023671 3300046664 Bacteria 2088
749 Ga0495659_0467066 3300046664 Bacteria 550
750 Ga0495661_0224423 3300046665 Bacteria 972
751 Ga0495661_0430190 3300046665 Bacteria 638
752 Ga0495588_0032772 3300046674 Bacteria 2620
753 Ga0495588_0074867 3300046674 Bacteria 1763
754 Ga0495657_0464742 3300046675 Bacteria 740
755 Ga0495657_0562170 3300046675 Bacteria 662
756 Ga0495657_0703860 3300046675 Bacteria 580
757 Ga0495646_0084097 3300046680 Bacteria 1848
758 Ga0495646_0316575 3300046680 Bacteria 822
759 Ga0495647_0003788 3300046681 Bacteria 4865
760 Ga0495658_0002427 3300046683 Bacteria 9388
761 Ga0495658_0271699 3300046683 Bacteria 1069
762 Ga0495669_0072986 3300046684 Bacteria 1566
763 Ga0495669_0116487 3300046684 Bacteria 1250
764 Ga0495669_0260297 3300046684 Bacteria 833
765 Ga0495669_0274613 3300046684 Bacteria 810
766 Ga0495669_0341240 3300046684 Bacteria 724
767 Ga0495669_0650893 3300046684 Bacteria 512
768 Ga0495613_0000582 3300046689 Bacteria 29501
769 Ga0495613_0762368 3300046689 Bacteria 633
770 Ga0495624_0032108 3300046690 Bacteria 3406
771 Ga0495624_0495405 3300046690 Bacteria 731
772 Ga0495670_0104520 3300046691 Bacteria 1461
773 Ga0495670_0460394 3300046691 Bacteria 689
774 Ga0495589_0113587 3300046794 Bacteria 1306
775 Ga0495589_0404279 3300046794 Bacteria 627
776 Ga0495600_0038562 3300046809 Bacteria 3109
777 Ga0495581_0000048 3300047315 Bacteria 45311
778 Ga0495604_0268426 3300047317 Bacteria 1157
779 Ga0495604_0749883 3300047317 Bacteria 617
780 Ga0495636_0147912 3300047318 Bacteria 1052
781 Ga0495636_0494070 3300047318 Bacteria 591
782 Ga0495674_0009200 3300047319 Bacteria 9387
783 Ga0495674_0173317 3300047319 Bacteria 1799
784 Ga0495674_0203279 3300047319 Bacteria 1643
785 Ga0495674_0426500 3300047319 Bacteria 1068
786 Ga0495674_1304545 3300047319 Unclassified 545
787 Ga0495672_0007852 3300047320 Bacteria 7968
788 Ga0495676_0075575 3300047321 Bacteria 2576
789 Ga0495676_0087804 3300047321 Bacteria 2335
790 Ga0495680_0422953 3300047322 Bacteria 916
791 Ga0495680_0974198 3300047322 Bacteria 543
792 Ga0495683_0127492 3300047323 Bacteria 1203
793 Ga0495683_0482135 3300047323 Bacteria 505
794 Ga0495675_0331510 3300047444 Bacteria 898
795 Ga0495677_0121998 3300047445 Bacteria 994
796 Ga0495685_017516 3300047447 Bacteria 2454
797 Ga0495673_0059165 3300047469 Bacteria 1648
798 Ga0495673_0064273 3300047469 Bacteria 1562
799 Ga0495681_0180177 3300047470 Bacteria 869
800 Ga0495681_0365921 3300047470 Bacteria 545
801 Ga0495684_0063799 3300047471 Bacteria 2800
802 Ga0495686_0655887 3300047472 Bacteria 539
803 Ga0495593_0000556 3300047673 Bacteria 21184
804 Ga0495602_0402067 3300048088 Bacteria 976
805 Ga0495602_0455559 3300048088 Bacteria 902
806 Ga0495602_0796608 3300048088 Bacteria 635
807 Ga0495602_0819533 3300048088 Bacteria 624
808 Ga0495614_0250795 3300048089 Bacteria 809
809 Ga0496100_0000928 3300048903 Bacteria 13991
810 Ga0496100_0172861 3300048903 Bacteria 1557
811 Ga0496100_0179857 3300048903 Bacteria 1529
812 Ga0496100_1138705 3300048903 Bacteria 615
813 Ga0496101_0020506 3300048904 Bacteria 4527
814 Ga0496101_0661175 3300048904 Bacteria 825
815 Ga0496101_1082452 3300048904 Bacteria 630
816 Ga0496101_1277719 3300048904 Bacteria 574
817 Ga0496102_0009365 3300048905 Bacteria 8413
818 Ga0496102_0029530 3300048905 Bacteria 4906
819 Ga0496102_0597788 3300048905 Bacteria 1026
820 Ga0496102_0598940 3300048905 Bacteria 1025
821 Ga0496102_0915656 3300048905 Bacteria 798
822 Ga0496102_0973480 3300048905 Bacteria 769
823 Ga0496102_1656804 3300048905 Bacteria 558
824 Ga0496103_0039337 3300048906 Bacteria 2906
825 Ga0496103_0085757 3300048906 Bacteria 1984
826 Ga0496103_0247404 3300048906 Bacteria 1147
827 Ga0496104_0062825 3300048907 Bacteria 3521
828 Ga0496104_0070509 3300048907 Bacteria 3322
829 Ga0496104_0184972 3300048907 Bacteria 1994
830 Ga0496104_0516173 3300048907 Bacteria 1106
831 Ga0496105_0010801 3300048908 Bacteria 7191
832 Ga0496105_0032337 3300048908 Bacteria 4292
833 Ga0496105_0290950 3300048908 Bacteria 1315
834 Ga0496106_0004140 3300048909 Bacteria 10810
835 Ga0496106_0005511 3300048909 Bacteria 9361
836 Ga0496106_0101452 3300048909 Bacteria 2232
837 Ga0496106_0273268 3300048909 Bacteria 1353
838 Ga0496106_0698754 3300048909 Bacteria 808
839 Ga0496106_1258475 3300048909 Bacteria 575
840 Ga0496106_1413064 3300048909 Bacteria 537
841 Ga0496107_0076056 3300048910 Bacteria 2444
842 Ga0496107_0136247 3300048910 Bacteria 1814
843 Ga0496107_0162851 3300048910 Bacteria 1653
844 Ga0496107_0267313 3300048910 Bacteria 1273
845 Ga0496107_0338245 3300048910 Bacteria 1120
846 Ga0496107_0362886 3300048910 Bacteria 1078
847 Ga0496107_0485153 3300048910 Bacteria 917
848 Ga0496108_0021363 3300048911 Bacteria 5319
849 Ga0496108_1242794 3300048911 Bacteria 628
850 Ga0496108_1273341 3300048911 Bacteria 619
851 Ga0496108_1403393 3300048911 Bacteria 584
852 Ga0496109_0049422 3300048912 Bacteria 3828
853 Ga0496109_0095609 3300048912 Bacteria 2751
854 Ga0496109_0331856 3300048912 Bacteria 1436
855 Ga0496109_1415890 3300048912 Bacteria 630
856 Ga0496110_0024944 3300048913 Bacteria 5103
857 Ga0496110_0030548 3300048913 Bacteria 4645
858 Ga0496110_0281533 3300048913 Bacteria 1514
859 Ga0496110_1036264 3300048913 Bacteria 728
860 Ga0496110_1040784 3300048913 Bacteria 726
861 Ga0496110_1435526 3300048913 Bacteria 600
862 Ga0496110_1678439 3300048913 Bacteria 545
863 Ga0496111_0109768 3300048914 Bacteria 2031
864 Ga0496111_0337508 3300048914 Bacteria 1116
865 Ga0496111_0435027 3300048914 Bacteria 969
866 Ga0496111_0906415 3300048914 Bacteria 635
867 Ga0496112_0011528 3300048915 Bacteria 8077
868 Ga0496112_0062276 3300048915 Bacteria 3679
869 Ga0496112_0108428 3300048915 Bacteria 2747
870 Ga0496112_0598930 3300048915 Bacteria 1034
871 Ga0496113_0036587 3300048916 Bacteria 3597
872 Ga0496113_0098926 3300048916 Bacteria 2258
873 Ga0496113_0530078 3300048916 Bacteria 945
874 Ga0496114_0018487 3300048917 Bacteria 5636
875 Ga0496114_0282024 3300048917 Bacteria 1465
876 Ga0496114_1713656 3300048917 Bacteria 516
877 Ga0496115_0000889 3300048918 Bacteria 21680
878 Ga0496115_0042563 3300048918 Bacteria 3618
879 Ga0496115_0130878 3300048918 Bacteria 2068
880 Ga0496115_0321098 3300048918 Bacteria 1266
881 Ga0496115_1024527 3300048918 Bacteria 630
882 Ga0496116_0057216 3300048919 Bacteria 2551
883 Ga0496116_0297667 3300048919 Bacteria 770
884 Ga0496117_0030017 3300048920 Bacteria 4179
885 Ga0496117_0167282 3300048920 Bacteria 1281
886 Ga0496118_0032367 3300048921 Bacteria 4308
887 Ga0496118_0322898 3300048921 Bacteria 837
888 Ga0496119_0175345 3300048922 Bacteria 1129
889 Ga0496119_0194575 3300048922 Bacteria 1054
890 Ga0496120_0165898 3300048923 Bacteria 1097
891 Ga0496120_0396481 3300048923 Bacteria 610
892 Ga0496121_0000218 3300048924 Bacteria 126175
893 Ga0496121_0083541 3300048924 Bacteria 2521
894 Ga0496121_0122408 3300048924 Bacteria 1962
895 Ga0496121_0154316 3300048924 Bacteria 1686
896 Ga0496121_0397037 3300048924 Bacteria 904
897 Ga0496121_0503886 3300048924 Bacteria 768
898 Ga0496121_0563455 3300048924 Bacteria 710
899 Ga0496121_0637501 3300048924 Bacteria 651
900 Ga0496122_0020536 3300048925 Bacteria 5960
901 Ga0496123_0050879 3300048926 Bacteria 2764
902 Ga0496124_0025392 3300048927 Bacteria 5366
903 Ga0496124_0068902 3300048927 Bacteria 2939
904 Ga0496124_0130505 3300048927 Bacteria 1997
905 Ga0496124_0294433 3300048927 Bacteria 1176
906 Ga0496125_0410406 3300048928 Bacteria 788
907 Ga0496126_0007078 3300048929 Bacteria 12354
908 Ga0496126_0030798 3300048929 Bacteria 5079
909 Ga0496126_0138436 3300048929 Bacteria 2097
910 Ga0496126_0143331 3300048929 Bacteria 2054
911 Ga0496126_0474303 3300048929 Bacteria 1004
912 Ga0496126_0516206 3300048929 Bacteria 953
913 Ga0496126_0552299 3300048929 Bacteria 914
914 Ga0496126_0860949 3300048929 Bacteria 690
915 Ga0496126_1038365 3300048929 Bacteria 613
916 Ga0501067_0688623 3300049583 Bacteria 574
917 Ga0501076_1471927 3300049592 Bacteria 559
918 nmdc:mga03683_338804_c1 3300050489 Bacteria 710
919 nmdc:mga03n38_155590_c1 3300050490 Bacteria 1153
920 nmdc:mga03n38_267989_c1 3300050490 Bacteria 907
921 nmdc:mga03n38_276269_c1 3300050490 Bacteria 895
922 nmdc:mga03n38_351_c1 3300050490 Bacteria 11225
923 nmdc:mga03n38_881307_c1 3300050490 Bacteria 525
924 nmdc:mga00v17_852017_c1 3300050491 Bacteria 579
925 nmdc:mga0yw44_1142947_c1 3300050492 Bacteria 526
926 nmdc:mga0yw44_1187448_c1 3300050492 Bacteria 515
927 nmdc:mga0yw44_168420_c1 3300050492 Bacteria 1437
928 nmdc:mga0yw44_929613_c1 3300050492 Bacteria 589
929 nmdc:mga0yw44_95478_c1 3300050492 Bacteria 1886
930 nmdc:mga0k408_190644_c1 3300050493 Bacteria 1223
931 nmdc:mga0k408_31663_c1 3300050493 Bacteria 3021
932 nmdc:mga06z11_40480_c1 3300050494 Bacteria 2326
933 nmdc:mga04h51_259885_c1 3300050495 Bacteria 698
934 nmdc:mga04h51_28926_c1 3300050495 Bacteria 1732
935 nmdc:mga04h51_90771_c1 3300050495 Bacteria 1099
936 nmdc:mga07m45_213178_c1 3300050496 Bacteria 1123
937 nmdc:mga07m45_68249_c1 3300050496 Bacteria 2021
938 nmdc:mga07m45_69152_c1 3300050496 Bacteria 2007
939 nmdc:mga07m45_735501_c1 3300050496 Bacteria 567
940 nmdc:mga08y16_1198552_c1 3300050511 Bacteria 730
941 nmdc:mga08y16_264122_c1 3300050511 Bacteria 1777
942 nmdc:mga0n895_127425_c1 3300050512 Bacteria 2569
943 nmdc:mga0n895_159692_c1 3300050512 Bacteria 2285
944 nmdc:mga0rr50_153295_c1 3300050513 Bacteria 1864
945 nmdc:mga0a205_690792_c1 3300050515 Bacteria 870
946 nmdc:mga0sz30_181073_c1 3300050516 Bacteria 935
947 Ga0495601_0071233 3300053077 Bacteria 2220
948 Ga0495601_0399583 3300053077 Bacteria 891
949 Ga0495655_0079527 3300053083 Bacteria 934
950 Ga0495655_0189459 3300053083 Bacteria 667
951 Ga0495655_0301801 3300053083 Bacteria 550
952 Ga0495595_0028106 3300053084 Bacteria 2510
953 Ga0495595_0503589 3300053084 Bacteria 617
954 Ga0495619_0065596 3300053085 Bacteria 2422
955 Ga0495619_0105930 3300053085 Bacteria 1917
956 Ga0495619_0529333 3300053085 Bacteria 809
957 Ga0495619_0660721 3300053085 Bacteria 712
958 Ga0500583_0429599 3300053092 Bacteria 630
959 Ga0500641_0038251 3300053096 Bacteria 1927
960 Ga0500592_087990 3300053116 Bacteria 520
961 Ga0500594_0055064 3300053118 Bacteria 1131
962 Ga0500594_0279499 3300053118 Bacteria 558
963 Ga0500628_200737 3300053129 Bacteria 575
964 Ga0500577_0000162 3300053142 Bacteria 16748
965 Ga0500577_0019734 3300053142 Bacteria 2191
966 Ga0500589_149384 3300053147 Bacteria 953
967 Ga0500604_0268862 3300053151 Bacteria 591
968 Ga0500604_0294872 3300053151 Bacteria 563
969 Ga0500636_0306294 3300053177 Bacteria 779
970 Ga0500611_112709 3300053727 Bacteria 717
971 Ga0500645_002736 3300053730 Bacteria 7648
972 2513715465 2513237104 Bacteria 10034502
973 2876809239 2876808645 Bacteria 8824342
974 2879112485 2879110137 Bacteria 8907982
975 Ga0070716_101025081
976 Ga0065165_1028654
977 Ga0070676_10095558
978 Ga0070683_101510456
979 Ga0070690_100139324
980 Ga0070690_100637158
981 Ga0070670_100851596
982 Ga0068869_100021516
983 Ga0068869_100060160
984 Ga0068869_101024677
985 Ga0070666_10083835
986 Ga0070680_100012511
987 Ga0070682_100091969
988 Ga0070682_100223918
989 Ga0070682_100281468
990 Ga0070682_100630292
991 Ga0070682_101075294
992 Ga0068868_100034314
993 Ga0068868_100042187
994 Ga0068868_100543940
995 Ga0068868_100659331
996 Ga0070660_101401290
997 Ga0070660_101487341
998 Ga0070689_101194371
999 Ga0070661_100733913
1000 Ga0070661_100832721
1001 Ga0070661_101311303
1002 Ga0070692_10412295
1003 Ga0070668_100052513
1004 Ga0070668_100912729
1005 Ga0070668_100992088
1006 Ga0070668_101961938
1007 Ga0070669_100051858
1008 Ga0070669_100513050
1009 Ga0070669_101825220
1010 Ga0070671_100062733
1011 Ga0070671_100228259
1012 Ga0070671_100681823
1013 Ga0070671_101770858
1014 Ga0070674_100176507
1015 Ga0070674_101922908
1016 Ga0070673_100292958
1017 Ga0070673_101025368
1018 Ga0070673_101376178
1019 Ga0070688_100392233
1020 Ga0070659_100134195
1021 Ga0070659_100251416
1022 Ga0070667_100570995
1023 Ga0070709_10121361
1024 Ga0070709_10777669
1025 Ga0070709_11400705
1026 Ga0070714_100075320
1027 Ga0070714_100699541
1028 Ga0070713_100023479
1029 Ga0070713_101218271
1030 Ga0070710_11172953
1031 Ga0070701_10904003
1032 Ga0070701_11376484
1033 Ga0070711_100009020
1034 Ga0070711_100379406
1035 Ga0070700_100489815
1036 Ga0070700_100676674
1037 Ga0070694_100806871
1038 Ga0070694_101143924
1039 Ga0070663_100007386
1040 Ga0070663_100009181
1041 Ga0070663_100563636
1042 Ga0070663_100882086
1043 Ga0070678_100384185
1044 Ga0070678_100411120
1045 Ga0070678_100789427
1046 Ga0070678_101058839
1047 Ga0070678_101408742
1048 Ga0070678_102354901
1049 Ga0070662_100147895
1050 Ga0070662_100438528
1051 Ga0070662_100551896
1052 Ga0070662_101084776
1053 Ga0070681_10915560
1054 Ga0070681_11655034
1055 Ga0070685_10174702
1056 Ga0070685_10306024
1057 Ga0070706_100380377
1058 Ga0070706_102023414
1059 Ga0070699_100786662
1060 Ga0070679_100439546
1061 Ga0070679_100551275
1062 Ga0070679_100576481
1063 Ga0070679_100643030
1064 Ga0070684_100091808
1065 Ga0070684_100246415
1066 Ga0070684_100582271
1067 Ga0070697_100131997
1068 Ga0068853_100237050
1069 Ga0068853_100274573
1070 Ga0068853_101618741
1071 Ga0068853_101633310
1072 Ga0068853_102023689
1073 Ga0070672_100501844
1074 Ga0070672_100600487
1075 Ga0070696_100405206
1076 Ga0070696_100407547
1077 Ga0070696_101782661
1078 Ga0070693_100482956
1079 Ga0070665_100006118
1080 Ga0070665_100034010
1081 Ga0070665_100130352
1082 Ga0070665_100277326
1083 Ga0070665_100501724
1084 Ga0070665_100747992
1085 Ga0070665_101621115
1086 Ga0070704_101887851
1087 Ga0068855_100292750
1088 Ga0068855_100882192
1089 Ga0070664_100046714
1090 Ga0068857_100035532
1091 Ga0068857_100966243
1092 Ga0068854_100169893
1093 Ga0068854_100755541
1094 Ga0068854_101027370
1095 Ga0068854_101972624
1096 Ga0068856_100057634
1097 Ga0068856_100370716
1098 Ga0068856_100527621
1099 Ga0070702_100241766
1100 Ga0070702_100353580
1101 Ga0070702_100925167
1102 Ga0068852_100538436
1103 Ga0068852_100567210
1104 Ga0068859_100150655
1105 Ga0068864_100016160
1106 Ga0068864_100038317
1107 Ga0068864_100677940
1108 Ga0068864_101317620
1109 Ga0068864_102249546
1110 Ga0068864_102715624
1111 Ga0068866_10076118
1112 Ga0068866_10329030
1113 Ga0068861_100627997
1114 Ga0068861_100694847
1115 Ga0068861_102482985
1116 Ga0068851_10024840
1117 Ga0068851_10232085
1118 Ga0068863_100130928
1119 Ga0068863_101304632
1120 Ga0068863_101764904
1121 Ga0068863_102429392
1122 Ga0068858_100569018
1123 Ga0068858_100612645
1124 Ga0068858_100810320
1125 Ga0068860_100223518
1126 Ga0068860_100510904
1127 Ga0068860_100791046
1128 Ga0068860_101006329
1129 Ga0068862_100606587
1130 Ga0081455_10012598
1131 Ga0081538_10077355
1132 Ga0081540_1012305
1133 Ga0081540_1020729
1134 Ga0081540_1032288
1135 Ga0081540_1055661
1136 Ga0081540_1100944
1137 Ga0081540_1282508
1138 Ga0081540_1300659
1139 Ga0081539_10158827
1140 Ga0070717_10336181
1141 Ga0075365_10084703
1142 Ga0075365_10196791
1143 Ga0075365_10349965
1144 Ga0075365_10352986
1145 Ga0075365_10656085
1146 Ga0075368_10046201
1147 Ga0075368_10051084
1148 Ga0075368_10108052
1149 Ga0075368_10125544
1150 Ga0075363_100003826
1151 Ga0075363_100386891
1152 Ga0075364_10132637
1153 Ga0075364_10253237
1154 Ga0075432_10074492
1155 Ga0070716_100240777
1156 Ga0070712_100408574
1157 Ga0070712_100572505
1158 Ga0070712_100698048
1159 Ga0075367_10013146
1160 Ga0075367_10218052
1161 Ga0075367_10561849
1162 Ga0075367_10579971
1163 Ga0075369_10040322
1164 Ga0075366_10136676
1165 Ga0075366_10474315
1166 Ga0075366_10946808
1167 Ga0097621_100078810
1168 Ga0097621_101777034
1169 Ga0075370_10341589
1170 Ga0075370_10360120
1171 Ga0075370_10518933
1172 Ga0075370_10578391
1173 Ga0068871_100184390
1174 Ga0068871_100435700
1175 Ga0068871_100514253
1176 Ga0075434_100131833
1177 Ga0075434_101404132
1178 Ga0075434_101634337
1179 Ga0068865_100062209
1180 Ga0068865_100358995
1181 Ga0068865_100836199
1182 Ga0075436_100133028
1183 Ga0097620_100150655
1184 Ga0097620_102075299
1185 Ga0097620_102843996
1186 Ga0075435_100757374
1187 Ga0075435_101832513
1188 Ga0099794_10148910
1189 Ga0099794_10490045
1190 Ga0099794_10621803
1191 Ga0099795_10116208
1192 Ga0105250_10021947
1193 Ga0105250_10373498
1194 Ga0105240_10023702
1195 Ga0105240_10186253
1196 Ga0105240_11962914
1197 Ga0111539_10165360
1198 Ga0111539_11061853
1199 Ga0105245_10134290
1200 Ga0105245_11077376
1201 Ga0105245_11389366
1202 Ga0105247_10016286
1203 Ga0105247_10110352
1204 Ga0105247_10253059
1205 Ga0105247_10852192
1206 Ga0105247_10996902
1207 Ga0105247_11072825
1208 Ga0105243_10290759
1209 Ga0105243_12523225
1210 Ga0105241_10074299
1211 Ga0105241_10142573
1212 Ga0105241_10408216
1213 Ga0105241_10866387
1214 Ga0105241_11173588
1215 Ga0105242_10487030
1216 Ga0105242_10619230
1217 Ga0105242_11087239
1218 Ga0105248_10102190
1219 Ga0105248_10169254
1220 Ga0105248_10235239
1221 Ga0105248_10235569
1222 Ga0105248_11085830
1223 Ga0105248_12269120
1224 Ga0105237_10027033
1225 Ga0105237_10087836
1226 Ga0105237_10308133
1227 Ga0105237_11565926
1228 Ga0105238_10117323
1229 Ga0105238_10256670
1230 Ga0105238_10503517
1231 Ga0105238_10565726
1232 Ga0105238_10812824
1233 Ga0105238_12498280
1234 Ga0105249_10891118
1235 Ga0105249_10964045
1236 Ga0105249_12926266
1237 Ga0105249_13032338
1238 Ga0099796_10291662
1239 Ga0105239_10078922
1240 Ga0105239_10108573
1241 Ga0105239_10186334
1242 Ga0105239_11697601
1243 Ga0105239_12168158
1244 Ga0105239_12306057
1245 Ga0105239_12344899
1246 Ga0105239_12432165
1247 Ga0105246_10515348
1248 Ga0105246_10562125
1249 Ga0105246_10666668
1250 Ga0105246_11135439
1251 Ga0105246_11875282
1252 Ga0157313_1007605
1253 Ga0157370_10497203
1254 Ga0157369_10324529
1255 Ga0157369_10452713
1256 Ga0157374_10053147
1257 Ga0157374_10975629
1258 Ga0157374_11075651
1259 Ga0157374_11710598
1260 Ga0157378_11149826
1261 Ga0163162_10087204
1262 Ga0163162_10203354
1263 Ga0163162_10542465
1264 Ga0163162_10817189
1265 Ga0163162_10820089
1266 Ga0163162_11847226
1267 Ga0163162_12468991
1268 Ga0157372_12237471
1269 Ga0157375_10067337
1270 Ga0157375_10791628
1271 Ga0157375_11472251
1272 Ga0157375_11733932
1273 Ga0163163_10275411
1274 Ga0163163_10322102
1275 Ga0163163_11158577
1276 Ga0163163_12437420
1277 Ga0157380_10234548
1278 Ga0157380_11749032
1279 Ga0182008_10730648
1280 Ga0157377_10484729
1281 Ga0157377_10708251
1282 Ga0157379_10062470
1283 Ga0157379_10255133
1284 Ga0157379_11530448
1285 Ga0157379_12377549
1286 Ga0157376_10052020
1287 Ga0157376_10724637
1288 Ga0157376_12219526
1289 Ga0157376_12261544
1290 Ga0163161_10466484
1291 Ga0163161_10532395
1292 Ga0163161_10564212
1293 Ga0163161_11833141
1294 Ga0197907_10857289
1295 Ga0206350_11330305
1296 Ga0207666_1029968
1297 Ga0209564_1003277
1298 Ga0209758_1005057
1299 Ga0207426_1112117
1300 Ga0207697_10095714
1301 Ga0207697_10404845
1302 Ga0207656_10316743
1303 Ga0207656_10364414
1304 Ga0207692_10032829
1305 Ga0207642_10297431
1306 Ga0207642_10383502
1307 Ga0207710_10250659
1308 Ga0207710_10350684
1309 Ga0207710_10440375
1310 Ga0207688_10434961
1311 Ga0207688_10907838
1312 Ga0207680_10410337
1313 Ga0207680_10415017
1314 Ga0207680_10841242
1315 Ga0207647_10615303
1316 Ga0207685_10194088
1317 Ga0207685_10635013
1318 Ga0207645_10074983
1319 Ga0207645_11108072
1320 Ga0207645_11184818
1321 Ga0207643_10034912
1322 Ga0207705_10062266
1323 Ga0207684_10364382
1324 Ga0207654_10019788
1325 Ga0207654_10325330
1326 Ga0207654_10536226
1327 Ga0207654_11068369
1328 Ga0207707_10052748
1329 Ga0207707_10064029
1330 Ga0207707_11294238
1331 Ga0207695_10057666
1332 Ga0207695_10269629
1333 Ga0207695_10723346
1334 Ga0207671_10066485
1335 Ga0207671_10149214
1336 Ga0207671_10517969
1337 Ga0207693_10236790
1338 Ga0207693_10420056
1339 Ga0207663_10046410
1340 Ga0207660_10021088
1341 Ga0207660_10744682
1342 Ga0207662_10086259
1343 Ga0207662_10329426
1344 Ga0207657_10012461
1345 Ga0207657_10165202
1346 Ga0207649_10574406
1347 Ga0207652_10042831
1348 Ga0207652_10556178
1349 Ga0207652_10720117
1350 Ga0207681_10111222
1351 Ga0207694_10240496
1352 Ga0207694_10281173
1353 Ga0207694_10418672
1354 Ga0207694_10488430
1355 Ga0207650_10646820
1356 Ga0207650_10809579
1357 Ga0207687_10063690
1358 Ga0207687_10069486
1359 Ga0207687_10875275
1360 Ga0207700_11028906
1361 Ga0207664_10038734
1362 Ga0207664_10265243
1363 Ga0207664_10714798
1364 Ga0207664_11593661
1365 Ga0207644_10086400
1366 Ga0207644_10347373
1367 Ga0207644_11152595
1368 Ga0207644_11315774
1369 Ga0207706_10097345
1370 Ga0207706_10347639
1371 Ga0207706_10752633
1372 Ga0207686_10315501
1373 Ga0207686_10319557
1374 Ga0207686_10671695
1375 Ga0207709_10134607
1376 Ga0207709_10433349
1377 Ga0207704_10057111
1378 Ga0207704_11904676
1379 Ga0207665_10469022
1380 Ga0207665_10535903
1381 Ga0207665_10966010
1382 Ga0207691_10496654
1383 Ga0207691_10553784
1384 Ga0207711_10025608
1385 Ga0207711_10436629
1386 Ga0207711_10488225
1387 Ga0207711_11111027
1388 Ga0207689_10108961
1389 Ga0207689_10208743
1390 Ga0207661_10080746
1391 Ga0207661_10323247
1392 Ga0207661_10562430
1393 Ga0207679_10108391
1394 Ga0207679_10654574
1395 Ga0207679_11851295
1396 Ga0207667_10163053
1397 Ga0207667_11646722
1398 Ga0207651_10830368
1399 Ga0207712_10063310
1400 Ga0207712_11121398
1401 Ga0207668_10071147
1402 Ga0207668_10327891
1403 Ga0207668_10427029
1404 Ga0207668_10604587
1405 Ga0207668_10994188
1406 Ga0207668_11505905
1407 Ga0207668_11528868
1408 Ga0207668_11736762
1409 Ga0207640_10324531
1410 Ga0207640_10453736
1411 Ga0207640_11937250
1412 Ga0207640_12091921
1413 Ga0207658_10119807
1414 Ga0207658_11124560
1415 Ga0207677_10111875
1416 Ga0207677_10167980
1417 Ga0207677_10222459
1418 Ga0207677_10966914
1419 Ga0207677_11366882
1420 Ga0207703_10032866
1421 Ga0207703_10378699
1422 Ga0207703_10449350
1423 Ga0207703_10580157
1424 Ga0207703_11360869
1425 Ga0207703_12216969
1426 Ga0207703_12418279
1427 Ga0207639_10330834
1428 Ga0207639_10724454
1429 Ga0207639_10832069
1430 Ga0207639_10929568
1431 Ga0207639_11273633
1432 Ga0207639_11909851
1433 Ga0207678_10022769
1434 Ga0207678_10050693
1435 Ga0207678_10062792
1436 Ga0207678_10414912
1437 Ga0207678_10641983
1438 Ga0207678_11518913
1439 Ga0207708_10353297
1440 Ga0207708_10481764
1441 Ga0207702_10000101
1442 Ga0207702_10294200
1443 Ga0207702_10458630
1444 Ga0207641_10193968
1445 Ga0207641_10212661
1446 Ga0207641_10445958
1447 Ga0207641_11903760
1448 Ga0207648_11969562
1449 Ga0207676_10027587
1450 Ga0207676_10166799
1451 Ga0207676_10505888
1452 Ga0207676_10882945
1453 Ga0207676_10961396
1454 Ga0207674_10006374
1455 Ga0207674_10045376
1456 Ga0207674_10881749
1457 Ga0207674_11372154
1458 Ga0207675_100304181
1459 Ga0207675_100511708
1460 Ga0207675_100892161
1461 Ga0207675_101410121
1462 Ga0207675_102484850
1463 Ga0207683_10120195
1464 Ga0207683_10198786
1465 Ga0207683_10618052
1466 Ga0207683_11123724
1467 Ga0207698_10607430
1468 Ga0207698_10839569
1469 Ga0207698_12504259
1470 Ga0209588_1081720
1471 Ga0209813_10024637
1472 Ga0209813_10057960
1473 Ga0209813_10273986
1474 Ga0207428_10475001
1475 Ga0268266_10000936
1476 Ga0268266_10011944
1477 Ga0268266_10032435
1478 Ga0268266_10955200
1479 Ga0268266_11168700
1480 Ga0268265_10828793
1481 Ga0268265_11048111
1482 Ga0268265_11366022
1483 Ga0268265_11830947
1484 Ga0268265_11837278
1485 Ga0268265_11857045
1486 Ga0268264_10218565
1487 Ga0268264_10233302
1488 Ga0268264_12308680
1489 Ga0307517_10000476
1490 Ga0307515_10121156
1491 Ga0307511_10046100
1492 Ga0307511_10098612
1493 Ga0307512_10181996
1494 Ga0265330_10017291
1495 Ga0265330_10055412
1496 Ga0265330_10058842
1497 Ga0265332_10016586
1498 Ga0265332_10223911
1499 Ga0265328_10083552
1500 Ga0265328_10328471
1501 Ga0265325_10164669
1502 Ga0265329_10213671
1503 Ga0265340_10046406
1504 Ga0265340_10089087
1505 Ga0265331_10177436
1506 Ga0265331_10294024
1507 Ga0265316_10146387
1508 Ga0265316_10187081
1509 Ga0265316_10400459
1510 Ga0265316_10698552
1511 Ga0307513_10288476
1512 Ga0307513_10640822
1513 Ga0307509_10054161
1514 Ga0307509_10106278
1515 Ga0307509_10693506
1516 Ga0307509_10786269
1517 Ga0307408_102270659
1518 Ga0265313_10233531
1519 Ga0307508_10784193
1520 Ga0265314_10124022
1521 Ga0265314_10320184
1522 Ga0265342_10047735
1523 Ga0265342_10712015
1524 Ga0307516_10261486
1525 Ga0307405_10176309
1526 Ga0307405_10502238
1527 Ga0307413_10719128
1528 Ga0307413_11661199
1529 Ga0307410_10342480
1530 Ga0307410_11373156
1531 Ga0307406_10572184
1532 Ga0307412_10308837
1533 Ga0307409_100430672
1534 Ga0307409_100901980
1535 Ga0307409_101531951
1536 Ga0307416_100512564
1537 Ga0307416_101233979
1538 Ga0307416_102436579
1539 Ga0307414_11684690
1540 Ga0307411_10041450
1541 Ga0307411_10744454
1542 Ga0307411_10774403
1543 Ga0307415_100123857
1544 Ga0307415_100289602
1545 Ga0307415_100440401
1546 Ga0307415_100479421
1547 Ga0307510_10055610
1548 Ga0307510_10260763
1549 Ga0307510_10285102
1550 Ga0373958_0105523
1551 Ga0373958_0132556
1552 Ga0373928_0111198
1553 Ga0373934_0204576
1554 Ga0373944_0002516
1555 Ga0373944_0097939
1556 Ga0373949_0129504
1557 Ga0373923_0488660
1558 Ga0373936_0023395
1559 Ga0373945_0140923
1560 Ga0373953_0054773
1561 Ga0373953_0519694
1562 Ga0373956_0023157
1563 Ga0373956_0195252
1564 Ga0373957_0052425
1565 Ga0373960_0107078
1566 Ga0373960_0449411
1567 Ga0373943_0001393
1568 Ga0373946_0052787
1569 Ga0373955_0007967
1570 Ga0373955_0255732
1571 Ga0373955_0408424
1572 Ga0373955_0770459
1573 Ga0373942_0061052
1574 Ga0373924_0008559
1575 Ga0373924_0333149
1576 Ga0373931_0005817
1577 Ga0373931_0217723
1578 Ga0373935_0004338
1579 Ga0373935_0250811
1580 Ga0373935_1368676
1581 Ga0373927_0006494
1582 Ga0373927_0011722
1583 Ga0373927_0088352
1584 Ga0373927_0468319
1585 Ga0373933_0875101
1586 Ga0373947_0005689
1587 Ga0373947_0567590
1588 Ga0373937_0400972
1589 Ga0373937_0536641
1590 Ga0373937_0622254
1591 Ga0373937_2011591
1592 Ga0373925_0002440
1593 Ga0373925_0009266
1594 Ga0373925_0048246
1595 Ga0373925_0209915
1596 Ga0373925_0245062
1597 Ga0373925_0441217
1598 Ga0395905_0540183
1599 Ga0439461_0051143
1600 Ga0451789_0696212
1601 Ga0451791_1594185
1602 Ga0451797_0611394
1603 Ga0451795_0896708
1604 Ga0451795_1341839
1605 Ga0451798_0872829
1606 Ga0451800_0569557
1607 Ga0451804_0266971
1608 Ga0451807_1493626
1609 Ga0451807_1578213
1610 Ga0451807_2434911
1611 Ga0451837_1490810
1612 Ga0451839_0057745
1613 Ga0451841_0590766
1614 Ga0451841_1003147
1615 Ga0451845_0550473
1616 Ga0451851_1168112
1617 Ga0451853_3462357
1618 Ga0451853_3705113
1619 Ga0495627_200868
1620 Ga0495592_0019284
1621 Ga0495603_0000029
1622 Ga0495603_0133864
1623 Ga0495603_0419777
1624 Ga0495603_0592680
1625 Ga0495603_0835679
1626 Ga0495590_0134423
1627 Ga0495591_156774
1628 Ga0495629_0000029
1629 Ga0495629_0099667
1630 Ga0495629_0254693
1631 Ga0495629_0526974
1632 Ga0495638_0493496
1633 Ga0495638_0500861
1634 Ga0495641_0005506
1635 Ga0495651_0090735
1636 Ga0495651_0223276
1637 Ga0495651_0387996
1638 Ga0495651_0718747
1639 Ga0495653_0062313
1640 Ga0495653_0422484
1641 Ga0495580_0005561
1642 Ga0495580_0343720
1643 Ga0495582_0000068
1644 Ga0495605_0137700
1645 Ga0495639_0000006
1646 Ga0495662_0003219
1647 Ga0495662_0132665
1648 Ga0495662_0474443
1649 Ga0495662_0575228
1650 Ga0495664_0039694
1651 Ga0495664_0060095
1652 Ga0495664_0101448
1653 Ga0495664_0168512
1654 Ga0495664_0924072
1655 Ga0495584_0084725
1656 Ga0495584_0562103
1657 Ga0495585_0409261
1658 Ga0495585_0522909
1659 Ga0495594_0000750
1660 Ga0495596_0038323
1661 Ga0495596_0317148
1662 Ga0495607_0229204
1663 Ga0495607_0419310
1664 Ga0495606_0244961
1665 Ga0495606_0645738
1666 Ga0495616_0321354
1667 Ga0495618_0326629
1668 Ga0495618_0408951
1669 Ga0495620_0048200
1670 Ga0495620_0239562
1671 Ga0495628_0090359
1672 Ga0495628_0601263
1673 Ga0495630_0005874
1674 Ga0495630_0203161
1675 Ga0495631_0092712
1676 Ga0495631_0185355
1677 Ga0495631_0208888
1678 Ga0495631_0279330
1679 Ga0495632_0444389
1680 Ga0495637_0350364
1681 Ga0495643_0366170
1682 Ga0495648_0217415
1683 Ga0495648_0329493
1684 Ga0495663_0038869
1685 Ga0495663_0121627
1686 Ga0495666_0024498
1687 Ga0495666_0223991
1688 Ga0495652_0066072
1689 Ga0495652_0382537
1690 Ga0495652_0784885
1691 Ga0495665_0000237
1692 Ga0495665_0424006
1693 Ga0495640_0007919
1694 Ga0495640_0240454
1695 Ga0495640_0733201
1696 Ga0495586_0245592
1697 Ga0495587_0261777
1698 Ga0495598_0011365
1699 Ga0495598_0084314
1700 Ga0495609_0088185
1701 Ga0495609_0159041
1702 Ga0495621_0026472
1703 Ga0495621_0083686
1704 Ga0495645_0321313
1705 Ga0495622_0009979
1706 Ga0495622_0217950
1707 Ga0495622_0517092
1708 Ga0495633_0133579
1709 Ga0495667_0016586
1710 Ga0495667_0107146
1711 Ga0495656_0040356
1712 Ga0495656_0113966
1713 Ga0495668_0065969
1714 Ga0495668_0757956
1715 Ga0495634_0001307
1716 Ga0495611_0069196
1717 Ga0495611_0588853
1718 Ga0495625_0174547
1719 Ga0495625_0311340
1720 Ga0495635_0239830
1721 Ga0495635_0758294
1722 Ga0495659_0023671
1723 Ga0495659_0467066
1724 Ga0495661_0224423
1725 Ga0495661_0430190
1726 Ga0495588_0032772
1727 Ga0495588_0074867
1728 Ga0495657_0464742
1729 Ga0495657_0562170
1730 Ga0495657_0703860
1731 Ga0495646_0084097
1732 Ga0495646_0316575
1733 Ga0495647_0003788
1734 Ga0495658_0002427
1735 Ga0495658_0271699
1736 Ga0495669_0072986
1737 Ga0495669_0116487
1738 Ga0495669_0260297
1739 Ga0495669_0274613
1740 Ga0495669_0341240
1741 Ga0495669_0650893
1742 Ga0495613_0000582
1743 Ga0495613_0762368
1744 Ga0495624_0032108
1745 Ga0495624_0495405
1746 Ga0495670_0104520
1747 Ga0495670_0460394
1748 Ga0495589_0113587
1749 Ga0495589_0404279
1750 Ga0495600_0038562
1751 Ga0495581_0000048
1752 Ga0495604_0268426
1753 Ga0495604_0749883
1754 Ga0495636_0147912
1755 Ga0495636_0494070
1756 Ga0495674_0009200
1757 Ga0495674_0173317
1758 Ga0495674_0203279
1759 Ga0495674_0426500
1760 Ga0495674_1304545
1761 Ga0495672_0007852
1762 Ga0495676_0075575
1763 Ga0495676_0087804
1764 Ga0495680_0422953
1765 Ga0495680_0974198
1766 Ga0495683_0127492
1767 Ga0495683_0482135
1768 Ga0495675_0331510
1769 Ga0495677_0121998
1770 Ga0495685_017516
1771 Ga0495673_0059165
1772 Ga0495673_0064273
1773 Ga0495681_0180177
1774 Ga0495681_0365921
1775 Ga0495684_0063799
1776 Ga0495686_0655887
1777 Ga0495593_0000556
1778 Ga0495602_0402067
1779 Ga0495602_0455559
1780 Ga0495602_0796608
1781 Ga0495602_0819533
1782 Ga0495614_0250795
1783 Ga0496100_0000928
1784 Ga0496100_0172861
1785 Ga0496100_0179857
1786 Ga0496100_1138705
1787 Ga0496101_0020506
1788 Ga0496101_0661175
1789 Ga0496101_1082452
1790 Ga0496101_1277719
1791 Ga0496102_0009365
1792 Ga0496102_0029530
1793 Ga0496102_0597788
1794 Ga0496102_0598940
1795 Ga0496102_0915656
1796 Ga0496102_0973480
1797 Ga0496102_1656804
1798 Ga0496103_0039337
1799 Ga0496103_0085757
1800 Ga0496103_0247404
1801 Ga0496104_0062825
1802 Ga0496104_0070509
1803 Ga0496104_0184972
1804 Ga0496104_0516173
1805 Ga0496105_0010801
1806 Ga0496105_0032337
1807 Ga0496105_0290950
1808 Ga0496106_0004140
1809 Ga0496106_0005511
1810 Ga0496106_0101452
1811 Ga0496106_0273268
1812 Ga0496106_0698754
1813 Ga0496106_1258475
1814 Ga0496106_1413064
1815 Ga0496107_0076056
1816 Ga0496107_0136247
1817 Ga0496107_0162851
1818 Ga0496107_0267313
1819 Ga0496107_0338245
1820 Ga0496107_0362886
1821 Ga0496107_0485153
1822 Ga0496108_0021363
1823 Ga0496108_1242794
1824 Ga0496108_1273341
1825 Ga0496108_1403393
1826 Ga0496109_0049422
1827 Ga0496109_0095609
1828 Ga0496109_0331856
1829 Ga0496109_1415890
1830 Ga0496110_0024944
1831 Ga0496110_0030548
1832 Ga0496110_0281533
1833 Ga0496110_1036264
1834 Ga0496110_1040784
1835 Ga0496110_1435526
1836 Ga0496110_1678439
1837 Ga0496111_0109768
1838 Ga0496111_0337508
1839 Ga0496111_0435027
1840 Ga0496111_0906415
1841 Ga0496112_0011528
1842 Ga0496112_0062276
1843 Ga0496112_0108428
1844 Ga0496112_0598930
1845 Ga0496113_0036587
1846 Ga0496113_0098926
1847 Ga0496113_0530078
1848 Ga0496114_0018487
1849 Ga0496114_0282024
1850 Ga0496114_1713656
1851 Ga0496115_0000889
1852 Ga0496115_0042563
1853 Ga0496115_0130878
1854 Ga0496115_0321098
1855 Ga0496115_1024527
1856 Ga0496116_0057216
1857 Ga0496116_0297667
1858 Ga0496117_0030017
1859 Ga0496117_0167282
1860 Ga0496118_0032367
1861 Ga0496118_0322898
1862 Ga0496119_0175345
1863 Ga0496119_0194575
1864 Ga0496120_0165898
1865 Ga0496120_0396481
1866 Ga0496121_0000218
1867 Ga0496121_0083541
1868 Ga0496121_0122408
1869 Ga0496121_0154316
1870 Ga0496121_0397037
1871 Ga0496121_0503886
1872 Ga0496121_0563455
1873 Ga0496121_0637501
1874 Ga0496122_0020536
1875 Ga0496123_0050879
1876 Ga0496124_0025392
1877 Ga0496124_0068902
1878 Ga0496124_0130505
1879 Ga0496124_0294433
1880 Ga0496125_0410406
1881 Ga0496126_0007078
1882 Ga0496126_0030798
1883 Ga0496126_0138436
1884 Ga0496126_0143331
1885 Ga0496126_0474303
1886 Ga0496126_0516206
1887 Ga0496126_0552299
1888 Ga0496126_0860949
1889 Ga0496126_1038365
1890 Ga0501067_0688623
1891 Ga0501076_1471927
1892 nmdc:mga03683_338804_c1
1893 nmdc:mga03n38_155590_c1
1894 nmdc:mga03n38_267989_c1
1895 nmdc:mga03n38_276269_c1
1896 nmdc:mga03n38_351_c1
1897 nmdc:mga03n38_881307_c1
1898 nmdc:mga00v17_852017_c1
1899 nmdc:mga0yw44_1142947_c1
1900 nmdc:mga0yw44_1187448_c1
1901 nmdc:mga0yw44_168420_c1
1902 nmdc:mga0yw44_929613_c1
1903 nmdc:mga0yw44_95478_c1
1904 nmdc:mga0k408_190644_c1
1905 nmdc:mga0k408_31663_c1
1906 nmdc:mga06z11_40480_c1
1907 nmdc:mga04h51_259885_c1
1908 nmdc:mga04h51_28926_c1
1909 nmdc:mga04h51_90771_c1
1910 nmdc:mga07m45_213178_c1
1911 nmdc:mga07m45_68249_c1
1912 nmdc:mga07m45_69152_c1
1913 nmdc:mga07m45_735501_c1
1914 nmdc:mga08y16_1198552_c1
1915 nmdc:mga08y16_264122_c1
1916 nmdc:mga0n895_127425_c1
1917 nmdc:mga0n895_159692_c1
1918 nmdc:mga0rr50_153295_c1
1919 nmdc:mga0a205_690792_c1
1920 nmdc:mga0sz30_181073_c1
1921 Ga0495601_0071233
1922 Ga0495601_0399583
1923 Ga0495655_0079527
1924 Ga0495655_0189459
1925 Ga0495655_0301801
1926 Ga0495595_0028106
1927 Ga0495595_0503589
1928 Ga0495619_0065596
1929 Ga0495619_0105930
1930 Ga0495619_0529333
1931 Ga0495619_0660721
1932 Ga0500583_0429599
1933 Ga0500641_0038251
1934 Ga0500592_087990
1935 Ga0500594_0055064
1936 Ga0500594_0279499
1937 Ga0500628_200737
1938 Ga0500577_0000162
1939 Ga0500577_0019734
1940 Ga0500589_149384
1941 Ga0500604_0268862
1942 Ga0500604_0294872
1943 Ga0500636_0306294
1944 Ga0500611_112709
1945 Ga0500645_002736
1946 2513715465
1947 2876809239
1948 2879112485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map