F487228

General Info

Members Datasets Scaffolds Average Seq Length
975 308 972 326

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10210324|Ga0105239_102103242
Length 364
Sequence VPVRPPGGAFSKKGYDFLLVIGRRKDFFNKTKQDLKKAEKKITRIGVLTSGGDAPGMNAAIRAVVRTGVFNELEVYGIMRGYQGMIEDDITKMESRSVANIIQRGGTILKTARCKEFFDYSGRKKAYENLKKRGIDGLVIIGGDGSFRGAVKFHEEFGIPCIGLAGTIDKDIHGTDFTIGFDTAVNTAVEAIDKIRDTMDAHDRIFVIEVMGRDAGYIALHSGIATGAENILIPERKTDIDALVKGLKETNKRKKLVMLIVVAEGENFGGAGEVQKKILEEIPTAEIRVCILGHIQRGGSPSCLDRLLASRMGYHAVECLIEGRHNVFVGIMNNKMHYIPLEDAVKIKGKIGDEWLKIVKILAS

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
262 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
263 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
264 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
265 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
266 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
267 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
268 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
269 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
270 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
271 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
272 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
273 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
274 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
275 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
276 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
281 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
282 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
283 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
284 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
296 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
304 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 0
Rhizoplane 0.51
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009205 3300001979 Bacteria 3881
2 JGI24751J29686_10001328 3300002459 Bacteria 5203
3 JGI25406J46586_10000498 3300003203 Bacteria 18346
4 rootH1_10033438 3300003316 Bacteria 11872
5 rootH1_10051512 3300003316 Bacteria 14145
6 rootH1_10078088 3300003323 Bacteria 15401
7 rootH1_10103550 3300003323 Bacteria 4743
8 Ga0065714_10125089 3300005288 Unclassified 1304
9 Ga0065712_10070715 3300005290 Bacteria 5730
10 Ga0065712_10145434 3300005290 Bacteria 1413
11 Ga0065715_10127067 3300005293 Bacteria 2095
12 Ga0065715_10139861 3300005293 Bacteria 1860
13 Ga0065707_10010810 3300005295 Unclassified 3463
14 Ga0065707_10107553 3300005295 Bacteria 2549
15 Ga0070676_10001251 3300005328 Bacteria 12801
16 Ga0070676_10009728 3300005328 Bacteria 5200
17 Ga0070676_10028708 3300005328 Bacteria 3161
18 Ga0070676_10161613 3300005328 Bacteria 1442
19 Ga0070683_100010127 3300005329 Bacteria 8092
20 Ga0070683_100054784 3300005329 Bacteria 3698
21 Ga0070683_100076884 3300005329 Bacteria 3121
22 Ga0070683_100081383 3300005329 Bacteria 3032
23 Ga0070683_100299434 3300005329 Bacteria 1530
24 Ga0070690_100036931 3300005330 Bacteria 3075
25 Ga0070690_100066010 3300005330 Unclassified 2341
26 Ga0070690_100123210 3300005330 Bacteria 1742
27 Ga0070670_100012438 3300005331 Bacteria 7283
28 Ga0070670_100026443 3300005331 Bacteria 4993
29 Ga0070670_100037182 3300005331 Bacteria 4188
30 Ga0070670_100038260 3300005331 Bacteria 4125
31 Ga0070670_100052058 3300005331 Bacteria 3516
32 Ga0070670_100068287 3300005331 Bacteria 3051
33 Ga0070670_100129098 3300005331 Bacteria 2182
34 Ga0070670_100137765 3300005331 Bacteria 2110
35 Ga0070670_100245947 3300005331 Bacteria 1558
36 Ga0070670_100428721 3300005331 Bacteria 1170
37 Ga0070677_10003327 3300005333 Bacteria 5180
38 Ga0068869_100021417 3300005334 Bacteria 4447
39 Ga0068869_100047178 3300005334 Bacteria 3110
40 Ga0068869_100084375 3300005334 Bacteria 2377
41 Ga0068869_100102078 3300005334 Bacteria 2170
42 Ga0068869_100166170 3300005334 Bacteria 1721
43 Ga0070666_10000024 3300005335 Bacteria 161355
44 Ga0070666_10000913 3300005335 Bacteria 17912
45 Ga0070666_10021112 3300005335 Bacteria 4218
46 Ga0070666_10072432 3300005335 Bacteria 2346
47 Ga0070666_10094392 3300005335 Unclassified 2058
48 Ga0070666_10119228 3300005335 Unclassified 1829
49 Ga0070666_10221353 3300005335 Bacteria 1335
50 Ga0070680_100010215 3300005336 Bacteria 7238
51 Ga0070680_100070426 3300005336 Bacteria 2872
52 Ga0070682_100000054 3300005337 Bacteria 112635
53 Ga0070682_100000460 3300005337 Bacteria 25673
54 Ga0070682_100012658 3300005337 Bacteria 4840
55 Ga0068868_100002272 3300005338 Bacteria 13287
56 Ga0068868_100020428 3300005338 Bacteria 4976
57 Ga0068868_100034133 3300005338 Bacteria 3926
58 Ga0068868_100048811 3300005338 Bacteria 3321
59 Ga0068868_100088422 3300005338 Bacteria 2493
60 Ga0068868_100301234 3300005338 Bacteria 1362
61 Ga0070660_100015549 3300005339 Bacteria 5498
62 Ga0070660_100041686 3300005339 Bacteria 3499
63 Ga0070660_100211037 3300005339 Bacteria 1576
64 Ga0070689_100009290 3300005340 Bacteria 6968
65 Ga0070689_100035015 3300005340 Bacteria 3834
66 Ga0070689_100105916 3300005340 Bacteria 2230
67 Ga0070689_100111827 3300005340 Bacteria 2173
68 Ga0070691_10011617 3300005341 Bacteria 4023
69 Ga0070687_100211194 3300005343 Unclassified 1183
70 Ga0070661_100000277 3300005344 Bacteria 41446
71 Ga0070661_100008859 3300005344 Bacteria 6965
72 Ga0070661_100059221 3300005344 Bacteria 2807
73 Ga0070661_100070422 3300005344 Bacteria 2572
74 Ga0070692_10086390 3300005345 Bacteria 1698
75 Ga0070668_100000036 3300005347 Bacteria 81256
76 Ga0070668_100019902 3300005347 Bacteria 5057
77 Ga0070668_100044662 3300005347 Bacteria 3399
78 Ga0070668_100108012 3300005347 Bacteria 2212
79 Ga0070669_100014389 3300005353 Bacteria 5631
80 Ga0070669_100095488 3300005353 Bacteria 2236
81 Ga0070669_100114442 3300005353 Unclassified 2051
82 Ga0070669_100225592 3300005353 Bacteria 1483
83 Ga0070675_100002264 3300005354 Bacteria 14278
84 Ga0070675_100009802 3300005354 Bacteria 7463
85 Ga0070675_100018400 3300005354 Bacteria 5560
86 Ga0070675_100057499 3300005354 Bacteria 3207
87 Ga0070675_100084143 3300005354 Bacteria 2656
88 Ga0070675_100093349 3300005354 Unclassified 2524
89 Ga0070671_100006354 3300005355 Bacteria 9431
90 Ga0070671_100061563 3300005355 Unclassified 3126
91 Ga0070671_100066424 3300005355 Unclassified 3006
92 Ga0070671_100144767 3300005355 Bacteria 2006
93 Ga0070671_100288334 3300005355 Bacteria 1397
94 Ga0070671_100424691 3300005355 Bacteria 1139
95 Ga0070674_100034399 3300005356 Bacteria 3384
96 Ga0070674_100083656 3300005356 Unclassified 2286
97 Ga0070673_100000556 3300005364 Bacteria 20111
98 Ga0070673_100002842 3300005364 Bacteria 10659
99 Ga0070673_100016851 3300005364 Bacteria 5180
100 Ga0070673_100028728 3300005364 Bacteria 4139
101 Ga0070673_100040146 3300005364 Bacteria 3588
102 Ga0070673_100063512 3300005364 Bacteria 2938
103 Ga0070673_100090635 3300005364 Bacteria 2498
104 Ga0070673_100123716 3300005364 Bacteria 2162
105 Ga0070673_100198996 3300005364 Bacteria 1725
106 Ga0070688_100004500 3300005365 Bacteria 7266
107 Ga0070688_100009741 3300005365 Bacteria 5274
108 Ga0070688_100050604 3300005365 Bacteria 2589
109 Ga0070688_100119577 3300005365 Bacteria 1763
110 Ga0070688_100207598 3300005365 Bacteria 1374
111 Ga0070659_100004064 3300005366 Bacteria 10435
112 Ga0070659_100010005 3300005366 Bacteria 6978
113 Ga0070659_100151161 3300005366 Bacteria 1894
114 Ga0070667_100000151 3300005367 Bacteria 86629
115 Ga0070667_100032757 3300005367 Bacteria 4337
116 Ga0070667_100051778 3300005367 Unclassified 3462
117 Ga0070667_100069703 3300005367 Bacteria 2993
118 Ga0070667_100096463 3300005367 Bacteria 2550
119 Ga0070667_100112464 3300005367 Unclassified 2362
120 Ga0070667_100277595 3300005367 Bacteria 1504
121 Ga0070667_100339554 3300005367 Bacteria 1358
122 Ga0070663_100027279 3300005455 Bacteria 3877
123 Ga0070663_100085750 3300005455 Bacteria 2324
124 Ga0070678_100014996 3300005456 Bacteria 4908
125 Ga0070678_100066015 3300005456 Bacteria 2689
126 Ga0070678_100093372 3300005456 Bacteria 2314
127 Ga0070678_100101191 3300005456 Bacteria 2233
128 Ga0070662_100001152 3300005457 Bacteria 16211
129 Ga0070662_100004539 3300005457 Bacteria 8795
130 Ga0070662_100476107 3300005457 Bacteria 1039
131 Ga0070681_10040195 3300005458 Bacteria 4688
132 Ga0070681_10044426 3300005458 Unclassified 4448
133 Ga0070681_10064938 3300005458 Bacteria 3620
134 Ga0070681_10151863 3300005458 Bacteria 2242
135 Ga0070681_10366796 3300005458 Unclassified 1350
136 Ga0068867_100001821 3300005459 Bacteria 14856
137 Ga0068867_100009666 3300005459 Bacteria 6799
138 Ga0068867_100013422 3300005459 Bacteria 5804
139 Ga0068867_100092819 3300005459 Bacteria 2293
140 Ga0068867_100094717 3300005459 Bacteria 2271
141 Ga0068867_100199215 3300005459 Bacteria 1602
142 Ga0068867_100221391 3300005459 Bacteria 1525
143 Ga0070685_10024532 3300005466 Bacteria 3313
144 Ga0070685_10128415 3300005466 Bacteria 1582
145 Ga0070698_100000791 3300005471 Bacteria 34361
146 Ga0070698_100004354 3300005471 Bacteria 15565
147 Ga0070679_100001616 3300005530 Bacteria 20275
148 Ga0070679_100007747 3300005530 Bacteria 10058
149 Ga0070679_100021368 3300005530 Bacteria 6318
150 Ga0070679_100090552 3300005530 Bacteria 3047
151 Ga0070679_100121092 3300005530 Bacteria 2601
152 Ga0070679_100122840 3300005530 Bacteria 2580
153 Ga0070679_100198827 3300005530 Bacteria 1971
154 Ga0070684_100001505 3300005535 Bacteria 16829
155 Ga0070684_100002570 3300005535 Bacteria 13402
156 Ga0070684_100037366 3300005535 Bacteria 4165
157 Ga0068853_100014362 3300005539 Bacteria 6483
158 Ga0068853_100027817 3300005539 Bacteria 4754
159 Ga0068853_100050606 3300005539 Bacteria 3575
160 Ga0068853_100095600 3300005539 Bacteria 2620
161 Ga0068853_100101790 3300005539 Bacteria 2541
162 Ga0070672_100000471 3300005543 Bacteria 23416
163 Ga0070672_100008357 3300005543 Bacteria 7076
164 Ga0070672_100020254 3300005543 Bacteria 4848
165 Ga0070672_100260306 3300005543 Bacteria 1463
166 Ga0070672_100383415 3300005543 Bacteria 1202
167 Ga0070686_100103219 3300005544 Bacteria 1929
168 Ga0070693_100016506 3300005547 Bacteria 3824
169 Ga0070665_100000009 3300005548 Bacteria 562640
170 Ga0070665_100001215 3300005548 Bacteria 31387
171 Ga0070665_100078363 3300005548 Bacteria 3311
172 Ga0068855_100000351 3300005563 Bacteria 57089
173 Ga0068855_100025281 3300005563 Bacteria 7108
174 Ga0068855_100031346 3300005563 Bacteria 6349
175 Ga0068855_100057463 3300005563 Bacteria 4560
176 Ga0068855_100062948 3300005563 Bacteria 4330
177 Ga0068855_100121742 3300005563 Bacteria 2986
178 Ga0068855_100615828 3300005563 Bacteria 1169
179 Ga0070664_100015973 3300005564 Bacteria 6148
180 Ga0070664_100037086 3300005564 Bacteria 4096
181 Ga0070664_100060527 3300005564 Bacteria 3225
182 Ga0070664_100087930 3300005564 Bacteria 2687
183 Ga0068857_100014912 3300005577 Bacteria 6778
184 Ga0068857_100043833 3300005577 Bacteria 3968
185 Ga0068857_100085530 3300005577 Bacteria 2819
186 Ga0068857_100127787 3300005577 Bacteria 2291
187 Ga0068857_100344965 3300005577 Unclassified 1378
188 Ga0068857_100345480 3300005577 Bacteria 1377
189 Ga0068854_100029484 3300005578 Bacteria 3799
190 Ga0068854_100035369 3300005578 Bacteria 3495
191 Ga0068854_100054384 3300005578 Unclassified 2879
192 Ga0068854_100094159 3300005578 Unclassified 2234
193 Ga0068854_100101146 3300005578 Unclassified 2161
194 Ga0068854_100111978 3300005578 Bacteria 2060
195 Ga0068854_100120901 3300005578 Bacteria 1988
196 Ga0068856_100017543 3300005614 Bacteria 6937
197 Ga0068856_100021165 3300005614 Bacteria 6319
198 Ga0068856_100047298 3300005614 Bacteria 4238
199 Ga0068852_100006236 3300005616 Bacteria 8599
200 Ga0068852_100016758 3300005616 Bacteria 5725
201 Ga0068852_100018083 3300005616 Bacteria 5546
202 Ga0068852_100018176 3300005616 Bacteria 5534
203 Ga0068852_100023882 3300005616 Bacteria 4930
204 Ga0068852_100040366 3300005616 Bacteria 3936
205 Ga0068852_100050384 3300005616 Unclassified 3568
206 Ga0068852_100076301 3300005616 Bacteria 2959
207 Ga0068852_100149170 3300005616 Bacteria 2173
208 Ga0068852_100286069 3300005616 Bacteria 1591
209 Ga0068859_100000018 3300005617 Bacteria 248813
210 Ga0068859_100000727 3300005617 Bacteria 33122
211 Ga0068859_100050537 3300005617 Bacteria 4176
212 Ga0068859_100082282 3300005617 Bacteria 3262
213 Ga0068859_100094668 3300005617 Bacteria 3039
214 Ga0068859_100103911 3300005617 Bacteria 2899
215 Ga0068859_100171514 3300005617 Bacteria 2250
216 Ga0068859_100193607 3300005617 Bacteria 2118
217 Ga0068859_100285069 3300005617 Bacteria 1745
218 Ga0068859_100317606 3300005617 Bacteria 1651
219 Ga0068864_100001161 3300005618 Bacteria 21876
220 Ga0068864_100003796 3300005618 Bacteria 12453
221 Ga0068864_100009228 3300005618 Bacteria 8135
222 Ga0068864_100033921 3300005618 Bacteria 4340
223 Ga0068864_100096174 3300005618 Bacteria 2621
224 Ga0068864_100117879 3300005618 Bacteria 2370
225 Ga0068864_100154045 3300005618 Unclassified 2084
226 Ga0068864_100191887 3300005618 Bacteria 1873
227 Ga0068866_10011090 3300005718 Bacteria 3885
228 Ga0068861_100013192 3300005719 Bacteria 5780
229 Ga0068861_100028014 3300005719 Bacteria 4109
230 Ga0068861_100036108 3300005719 Bacteria 3666
231 Ga0068861_100183267 3300005719 Bacteria 1745
232 Ga0068861_100226540 3300005719 Bacteria 1583
233 Ga0068861_100324462 3300005719 Unclassified 1342
234 Ga0068851_10002501 3300005834 Bacteria 8078
235 Ga0068851_10022038 3300005834 Bacteria 3099
236 Ga0068851_10080575 3300005834 Bacteria 1699
237 Ga0068851_10260391 3300005834 Bacteria 986
238 Ga0068870_10010987 3300005840 Bacteria 4183
239 Ga0068863_100001435 3300005841 Bacteria 23620
240 Ga0068863_100027885 3300005841 Bacteria 5390
241 Ga0068863_100028484 3300005841 Bacteria 5334
242 Ga0068863_100039684 3300005841 Bacteria 4478
243 Ga0068863_100046488 3300005841 Bacteria 4119
244 Ga0068863_100064593 3300005841 Unclassified 3461
245 Ga0068863_100433218 3300005841 Bacteria 1289
246 Ga0068858_100001071 3300005842 Bacteria 28302
247 Ga0068858_100010503 3300005842 Bacteria 8772
248 Ga0068858_100139680 3300005842 Bacteria 2274
249 Ga0068858_100216307 3300005842 Bacteria 1814
250 Ga0068860_100000078 3300005843 Bacteria 171062
251 Ga0068860_100000824 3300005843 Bacteria 34695
252 Ga0068860_100009310 3300005843 Bacteria 9757
253 Ga0068860_100025779 3300005843 Bacteria 5672
254 Ga0068860_100033819 3300005843 Bacteria 4905
255 Ga0068860_100036404 3300005843 Bacteria 4715
256 Ga0068860_100233903 3300005843 Bacteria 1786
257 Ga0068860_100249360 3300005843 Unclassified 1728
258 Ga0068860_100282073 3300005843 Bacteria 1624
259 Ga0068860_100371050 3300005843 Bacteria 1411
260 Ga0068860_100536505 3300005843 Bacteria 1171
261 Ga0068862_100023254 3300005844 Bacteria 5191
262 Ga0068862_100028062 3300005844 Bacteria 4740
263 Ga0068862_100085470 3300005844 Bacteria 2742
264 Ga0068862_100140557 3300005844 Bacteria 2142
265 Ga0081539_10000708 3300005985 Bacteria 66782
266 Ga0081539_10030635 3300005985 Bacteria 3334
267 Ga0075364_10172039 3300006051 Unclassified 1464
268 Ga0070716_100072149 3300006173 Unclassified 2032
269 Ga0075366_10163842 3300006195 Bacteria 1348
270 Ga0097621_100000489 3300006237 Bacteria 27739
271 Ga0097621_100001040 3300006237 Bacteria 19470
272 Ga0097621_100001758 3300006237 Bacteria 14859
273 Ga0097621_100004022 3300006237 Bacteria 10191
274 Ga0097621_100014475 3300006237 Bacteria 5903
275 Ga0097621_100033562 3300006237 Bacteria 4088
276 Ga0097621_100053932 3300006237 Bacteria 3277
277 Ga0097621_100067776 3300006237 Bacteria 2941
278 Ga0097621_100298441 3300006237 Bacteria 1422
279 Ga0097621_100401889 3300006237 Bacteria 1226
280 Ga0097621_100454887 3300006237 Bacteria 1154
281 Ga0068871_100000419 3300006358 Bacteria 29372
282 Ga0068871_100003690 3300006358 Bacteria 10521
283 Ga0068871_100009315 3300006358 Bacteria 7108
284 Ga0068871_100010582 3300006358 Bacteria 6740
285 Ga0068871_100018752 3300006358 Bacteria 5269
286 Ga0068871_100023999 3300006358 Unclassified 4725
287 Ga0068871_100046364 3300006358 Bacteria 3501
288 Ga0068871_100050409 3300006358 Bacteria 3367
289 Ga0068871_100270480 3300006358 Bacteria 1484
290 Ga0068871_100353245 3300006358 Bacteria 1301
291 Ga0075428_100027076 3300006844 Bacteria 6347
292 Ga0075428_100099952 3300006844 Bacteria 3163
293 Ga0075430_100018647 3300006846 Bacteria 5905
294 Ga0075434_100082728 3300006871 Bacteria 3208
295 Ga0075429_100012284 3300006880 Bacteria 7427
296 Ga0075429_100027936 3300006880 Bacteria 4897
297 Ga0075429_100306491 3300006880 Bacteria 1390
298 Ga0068865_100003069 3300006881 Bacteria 9987
299 Ga0068865_100006157 3300006881 Bacteria 7312
300 Ga0068865_100030779 3300006881 Bacteria 3572
301 Ga0068865_100074189 3300006881 Bacteria 2422
302 Ga0068865_100112625 3300006881 Bacteria 2010
303 Ga0097620_100000018 3300006931 Bacteria 248813
304 Ga0097620_100000727 3300006931 Bacteria 33122
305 Ga0097620_100050537 3300006931 Bacteria 4176
306 Ga0097620_100082273 3300006931 Bacteria 3262
307 Ga0097620_100094667 3300006931 Bacteria 3039
308 Ga0097620_100103924 3300006931 Bacteria 2899
309 Ga0097620_100171518 3300006931 Bacteria 2250
310 Ga0097620_100193601 3300006931 Bacteria 2118
311 Ga0097620_100285055 3300006931 Bacteria 1745
312 Ga0097620_100317619 3300006931 Bacteria 1651
313 Ga0105240_10001174 3300009093 Bacteria 45878
314 Ga0105240_10006711 3300009093 Bacteria 16862
315 Ga0105240_10007959 3300009093 Bacteria 15289
316 Ga0105240_10019358 3300009093 Bacteria 9097
317 Ga0105240_10026922 3300009093 Bacteria 7538
318 Ga0105240_10268206 3300009093 Bacteria 1967
319 Ga0105240_10403496 3300009093 Bacteria 1539
320 Ga0111539_10007214 3300009094 Bacteria 14247
321 Ga0111539_10046265 3300009094 Bacteria 5205
322 Ga0111539_10456846 3300009094 Bacteria 1487
323 Ga0105247_10003256 3300009101 Bacteria 10648
324 Ga0105247_10025102 3300009101 Bacteria 3596
325 Ga0105247_10293309 3300009101 Bacteria 1126
326 Ga0114129_10019090 3300009147 Bacteria 9766
327 Ga0114129_10890866 3300009147 Bacteria 1128
328 Ga0105243_10035212 3300009148 Unclassified 3880
329 Ga0105243_10055846 3300009148 Bacteria 3138
330 Ga0105241_10000113 3300009174 Bacteria 58135
331 Ga0105241_10008843 3300009174 Bacteria 7403
332 Ga0105241_10071809 3300009174 Bacteria 2688
333 Ga0105241_10164893 3300009174 Unclassified 1825
334 Ga0105241_10461240 3300009174 Unclassified 1126
335 Ga0105242_10020045 3300009176 Bacteria 5241
336 Ga0105242_10036590 3300009176 Bacteria 3939
337 Ga0105242_10122863 3300009176 Bacteria 2231
338 Ga0105242_10263542 3300009176 Bacteria 1558
339 Ga0105248_10191674 3300009177 Bacteria 2303
340 Ga0105248_10252470 3300009177 Unclassified 1985
341 Ga0105237_10002621 3300009545 Bacteria 22143
342 Ga0105237_10013947 3300009545 Bacteria 8410
343 Ga0105237_10026452 3300009545 Bacteria 5930
344 Ga0105237_10036714 3300009545 Bacteria 4958
345 Ga0105237_10249279 3300009545 Bacteria 1778
346 Ga0105238_10003534 3300009551 Bacteria 15582
347 Ga0105238_10092377 3300009551 Bacteria 3014
348 Ga0105238_10329127 3300009551 Bacteria 1514
349 Ga0105249_10004065 3300009553 Bacteria 12618
350 Ga0105249_10007291 3300009553 Bacteria 9642
351 Ga0105249_10008533 3300009553 Bacteria 8932
352 Ga0105249_10014840 3300009553 Bacteria 6889
353 Ga0105249_10022267 3300009553 Bacteria 5676
354 Ga0105249_10032858 3300009553 Bacteria 4696
355 Ga0105249_10035500 3300009553 Bacteria 4522
356 Ga0105249_10041571 3300009553 Bacteria 4179
357 Ga0105249_10082575 3300009553 Bacteria 2990
358 Ga0105249_10114077 3300009553 Bacteria 2558
359 Ga0105239_10030291 3300010375 Bacteria 5948
360 Ga0105239_10045032 3300010375 Bacteria 4836
361 Ga0105239_10051853 3300010375 Bacteria 4497
362 Ga0105239_10061607 3300010375 Bacteria 4118
363 Ga0105239_10093791 3300010375 Bacteria 3315
364 Ga0105239_10210324 3300010375 Unclassified 2180
365 Ga0105239_10497852 3300010375 Bacteria 1385
366 Ga0105246_10023678 3300011119 Bacteria 3976
367 Ga0105246_10153082 3300011119 Bacteria 1748
368 Ga0157373_10006436 3300013100 Bacteria 8773
369 Ga0157373_10016050 3300013100 Bacteria 5466
370 Ga0157373_10018871 3300013100 Bacteria 5019
371 Ga0157373_10075484 3300013100 Bacteria 2378
372 Ga0157371_10001020 3300013102 Bacteria 30696
373 Ga0157371_10002334 3300013102 Bacteria 18188
374 Ga0157371_10005815 3300013102 Bacteria 10320
375 Ga0157371_10006507 3300013102 Bacteria 9621
376 Ga0157371_10007605 3300013102 Bacteria 8741
377 Ga0157371_10012819 3300013102 Bacteria 6389
378 Ga0157371_10032312 3300013102 Bacteria 3767
379 Ga0157371_10131355 3300013102 Bacteria 1782
380 Ga0157370_10001463 3300013104 Bacteria 29196
381 Ga0157370_10001948 3300013104 Bacteria 25412
382 Ga0157370_10003125 3300013104 Bacteria 19611
383 Ga0157370_10010240 3300013104 Bacteria 9900
384 Ga0157370_10018009 3300013104 Bacteria 7109
385 Ga0157370_10027963 3300013104 Bacteria 5553
386 Ga0157370_10055569 3300013104 Bacteria 3770
387 Ga0157369_10043116 3300013105 Bacteria 4919
388 Ga0157369_10046180 3300013105 Unclassified 4734
389 Ga0157369_10056706 3300013105 Bacteria 4227
390 Ga0157369_10200311 3300013105 Bacteria 2096
391 Ga0157374_10000002 3300013296 Bacteria 1054226
392 Ga0157374_10000153 3300013296 Bacteria 63211
393 Ga0157374_10001371 3300013296 Bacteria 20705
394 Ga0157374_10010315 3300013296 Bacteria 8036
395 Ga0157374_10013148 3300013296 Bacteria 7219
396 Ga0157374_10034561 3300013296 Bacteria 4618
397 Ga0157374_10072440 3300013296 Unclassified 3250
398 Ga0157374_10077674 3300013296 Bacteria 3142
399 Ga0157374_10128472 3300013296 Bacteria 2451
400 Ga0157374_10318431 3300013296 Bacteria 1541
401 Ga0157378_10001024 3300013297 Bacteria 25548
402 Ga0157378_10010369 3300013297 Bacteria 8134
403 Ga0157378_10014239 3300013297 Bacteria 6962
404 Ga0157378_10020824 3300013297 Bacteria 5767
405 Ga0157378_10037481 3300013297 Bacteria 4294
406 Ga0157378_10041446 3300013297 Unclassified 4084
407 Ga0157378_10053851 3300013297 Bacteria 3583
408 Ga0157378_10054549 3300013297 Bacteria 3559
409 Ga0157378_10074360 3300013297 Bacteria 3057
410 Ga0157378_10290790 3300013297 Bacteria 1578
411 Ga0157378_10443283 3300013297 Bacteria 1287
412 Ga0163162_10000040 3300013306 Bacteria 133855
413 Ga0163162_10001017 3300013306 Bacteria 26052
414 Ga0163162_10002762 3300013306 Bacteria 16677
415 Ga0163162_10003821 3300013306 Bacteria 14434
416 Ga0163162_10004842 3300013306 Bacteria 12994
417 Ga0163162_10005595 3300013306 Bacteria 12157
418 Ga0163162_10012423 3300013306 Bacteria 8317
419 Ga0163162_10013858 3300013306 Bacteria 7875
420 Ga0163162_10022133 3300013306 Bacteria 6265
421 Ga0163162_10031458 3300013306 Bacteria 5264
422 Ga0163162_10069689 3300013306 Bacteria 3568
423 Ga0163162_10156466 3300013306 Bacteria 2399
424 Ga0163162_10411001 3300013306 Bacteria 1486
425 Ga0163162_10471123 3300013306 Bacteria 1387
426 Ga0163162_10505387 3300013306 Bacteria 1339
427 Ga0163162_10569159 3300013306 Bacteria 1260
428 Ga0157372_10012319 3300013307 Bacteria 9112
429 Ga0157372_10020346 3300013307 Bacteria 7158
430 Ga0157372_10022707 3300013307 Bacteria 6791
431 Ga0157372_10039725 3300013307 Bacteria 5194
432 Ga0157372_10045221 3300013307 Bacteria 4882
433 Ga0157372_10050213 3300013307 Bacteria 4640
434 Ga0157372_10076264 3300013307 Bacteria 3785
435 Ga0157372_10120605 3300013307 Bacteria 3011
436 Ga0157372_10127941 3300013307 Bacteria 2921
437 Ga0157372_10171244 3300013307 Bacteria 2512
438 Ga0157372_10198923 3300013307 Bacteria 2321
439 Ga0157372_10342281 3300013307 Unclassified 1742
440 Ga0157375_10000134 3300013308 Bacteria 73895
441 Ga0157375_10000407 3300013308 Bacteria 39103
442 Ga0157375_10008093 3300013308 Bacteria 9196
443 Ga0157375_10040651 3300013308 Unclassified 4484
444 Ga0157375_10070820 3300013308 Bacteria 3498
445 Ga0157375_10075732 3300013308 Unclassified 3390
446 Ga0157375_10144651 3300013308 Bacteria 2507
447 Ga0157375_10189337 3300013308 Bacteria 2212
448 Ga0157375_10201662 3300013308 Unclassified 2145
449 Ga0157375_10332425 3300013308 Bacteria 1684
450 Ga0157375_10515220 3300013308 Bacteria 1360
451 Ga0157375_10563744 3300013308 Bacteria 1300
452 Ga0163163_10000110 3300014325 Bacteria 87033
453 Ga0163163_10000348 3300014325 Bacteria 44508
454 Ga0163163_10133369 3300014325 Bacteria 2524
455 Ga0163163_10143490 3300014325 Unclassified 2431
456 Ga0163163_10213492 3300014325 Bacteria 1979
457 Ga0157380_10002726 3300014326 Bacteria 11984
458 Ga0157380_10150409 3300014326 Unclassified 2012
459 Ga0157380_10311836 3300014326 Unclassified 1454
460 Ga0157380_10331890 3300014326 Bacteria 1415
461 Ga0157380_10648820 3300014326 Bacteria 1052
462 Ga0157377_10000660 3300014745 Bacteria 14369
463 Ga0157377_10004324 3300014745 Bacteria 6523
464 Ga0157377_10011172 3300014745 Bacteria 4474
465 Ga0157377_10039277 3300014745 Unclassified 2617
466 Ga0157379_10000173 3300014968 Bacteria 48672
467 Ga0157379_10062987 3300014968 Bacteria 3316
468 Ga0157379_10077186 3300014968 Bacteria 2982
469 Ga0157379_10087882 3300014968 Bacteria 2787
470 Ga0157379_10093184 3300014968 Bacteria 2702
471 Ga0157379_10111555 3300014968 Bacteria 2457
472 Ga0157376_10000535 3300014969 Bacteria 24452
473 Ga0157376_10001080 3300014969 Bacteria 17869
474 Ga0157376_10006164 3300014969 Bacteria 8445
475 Ga0157376_10012851 3300014969 Bacteria 6228
476 Ga0157376_10084200 3300014969 Unclassified 2738
477 Ga0157376_10098191 3300014969 Bacteria 2553
478 Ga0157376_10115140 3300014969 Bacteria 2373
479 Ga0163161_10009332 3300017792 Bacteria 6788
480 Ga0163161_10118364 3300017792 Unclassified 1988
481 Ga0163161_10232229 3300017792 Bacteria 1432
482 Ga0213876_10003364 3300021384 Bacteria 9153
483 Ga0213876_10020918 3300021384 Bacteria 3459
484 Ga0213876_10099424 3300021384 Bacteria 1542
485 Ga0207426_1000009 3300025302 Bacteria 797229
486 Ga0207656_10009239 3300025321 Bacteria 3657
487 Ga0207682_10006983 3300025893 Bacteria 4525
488 Ga0207682_10089980 3300025893 Unclassified 1329
489 Ga0207642_10067256 3300025899 Bacteria 1690
490 Ga0207710_10002801 3300025900 Bacteria 7961
491 Ga0207710_10017415 3300025900 Bacteria 3047
492 Ga0207710_10040315 3300025900 Bacteria 2069
493 Ga0207688_10009307 3300025901 Bacteria 5355
494 Ga0207680_10000026 3300025903 Bacteria 79960
495 Ga0207680_10001727 3300025903 Bacteria 10295
496 Ga0207680_10022854 3300025903 Unclassified 3407
497 Ga0207680_10025926 3300025903 Bacteria 3240
498 Ga0207680_10135397 3300025903 Unclassified 1628
499 Ga0207680_10176991 3300025903 Unclassified 1440
500 Ga0207680_10235041 3300025903 Bacteria 1261
501 Ga0207647_10000587 3300025904 Bacteria 28282
502 Ga0207647_10025262 3300025904 Bacteria 3906
503 Ga0207645_10000572 3300025907 Bacteria 30492
504 Ga0207645_10005197 3300025907 Bacteria 9502
505 Ga0207645_10015652 3300025907 Bacteria 5032
506 Ga0207645_10021767 3300025907 Bacteria 4177
507 Ga0207645_10027872 3300025907 Bacteria 3647
508 Ga0207643_10023881 3300025908 Unclassified 3373
509 Ga0207643_10080915 3300025908 Bacteria 1882
510 Ga0207643_10096354 3300025908 Bacteria 1730
511 Ga0207705_10003028 3300025909 Bacteria 12813
512 Ga0207705_10099865 3300025909 Bacteria 2134
513 Ga0207705_10244474 3300025909 Unclassified 1367
514 Ga0207654_10007258 3300025911 Bacteria 5585
515 Ga0207707_10000189 3300025912 Bacteria 65118
516 Ga0207707_10090982 3300025912 Unclassified 2666
517 Ga0207707_10154907 3300025912 Bacteria 2004
518 Ga0207707_10348212 3300025912 Unclassified 1277
519 Ga0207695_10000585 3300025913 Bacteria 73614
520 Ga0207695_10005428 3300025913 Bacteria 16917
521 Ga0207695_10031168 3300025913 Bacteria 5854
522 Ga0207695_10091861 3300025913 Bacteria 3048
523 Ga0207695_10134827 3300025913 Bacteria 2423
524 Ga0207695_10174755 3300025913 Bacteria 2071
525 Ga0207695_10195644 3300025913 Bacteria 1938
526 Ga0207671_10000992 3300025914 Bacteria 34903
527 Ga0207671_10001520 3300025914 Bacteria 26605
528 Ga0207671_10001809 3300025914 Bacteria 23891
529 Ga0207671_10021058 3300025914 Bacteria 4953
530 Ga0207660_10001432 3300025917 Bacteria 16013
531 Ga0207660_10073469 3300025917 Bacteria 2493
532 Ga0207660_10149659 3300025917 Bacteria 1792
533 Ga0207662_10005444 3300025918 Bacteria 6791
534 Ga0207662_10063665 3300025918 Bacteria 2218
535 Ga0207657_10012535 3300025919 Bacteria 8361
536 Ga0207657_10037421 3300025919 Bacteria 4332
537 Ga0207657_10061002 3300025919 Bacteria 3236
538 Ga0207657_10112893 3300025919 Bacteria 2242
539 Ga0207649_10005596 3300025920 Bacteria 6793
540 Ga0207649_10054113 3300025920 Bacteria 2497
541 Ga0207649_10075155 3300025920 Bacteria 2170
542 Ga0207652_10000055 3300025921 Bacteria 115420
543 Ga0207652_10000488 3300025921 Bacteria 40566
544 Ga0207652_10003097 3300025921 Bacteria 13865
545 Ga0207652_10016240 3300025921 Bacteria 6074
546 Ga0207652_10037509 3300025921 Bacteria 4103
547 Ga0207652_10046663 3300025921 Bacteria 3697
548 Ga0207652_10293079 3300025921 Unclassified 1468
549 Ga0207681_10025072 3300025923 Bacteria 3833
550 Ga0207681_10085278 3300025923 Bacteria 2241
551 Ga0207681_10102423 3300025923 Bacteria 2067
552 Ga0207694_10008276 3300025924 Bacteria 7863
553 Ga0207694_10119132 3300025924 Bacteria 2106
554 Ga0207650_10006072 3300025925 Bacteria 8240
555 Ga0207650_10060159 3300025925 Bacteria 2834
556 Ga0207650_10082891 3300025925 Bacteria 2435
557 Ga0207650_10105680 3300025925 Bacteria 2174
558 Ga0207650_10116575 3300025925 Bacteria 2074
559 Ga0207650_10161218 3300025925 Bacteria 1777
560 Ga0207650_10296982 3300025925 Unclassified 1318
561 Ga0207650_10365991 3300025925 Bacteria 1188
562 Ga0207659_10046878 3300025926 Bacteria 3055
563 Ga0207659_10048335 3300025926 Bacteria 3013
564 Ga0207659_10080766 3300025926 Bacteria 2403
565 Ga0207659_10124792 3300025926 Unclassified 1978
566 Ga0207687_10223876 3300025927 Bacteria 1483
567 Ga0207644_10004058 3300025931 Bacteria 9499
568 Ga0207644_10044879 3300025931 Unclassified 3142
569 Ga0207644_10053396 3300025931 Unclassified 2907
570 Ga0207644_10054700 3300025931 Unclassified 2875
571 Ga0207644_10292459 3300025931 Bacteria 1310
572 Ga0207690_10007149 3300025932 Bacteria 6630
573 Ga0207690_10017444 3300025932 Bacteria 4382
574 Ga0207690_10125103 3300025932 Bacteria 1873
575 Ga0207690_10168805 3300025932 Bacteria 1637
576 Ga0207690_10382478 3300025932 Bacteria 1119
577 Ga0207706_10002485 3300025933 Bacteria 17975
578 Ga0207706_10005175 3300025933 Bacteria 12175
579 Ga0207706_10024766 3300025933 Bacteria 5378
580 Ga0207706_10074429 3300025933 Bacteria 2987
581 Ga0207706_10090741 3300025933 Unclassified 2686
582 Ga0207686_10030443 3300025934 Bacteria 3195
583 Ga0207686_10034541 3300025934 Bacteria 3027
584 Ga0207686_10095714 3300025934 Bacteria 1971
585 Ga0207686_10141565 3300025934 Bacteria 1663
586 Ga0207686_10365701 3300025934 Bacteria 1090
587 Ga0207670_10048036 3300025936 Bacteria 2845
588 Ga0207670_10049393 3300025936 Bacteria 2814
589 Ga0207670_10109958 3300025936 Bacteria 1984
590 Ga0207670_10134537 3300025936 Unclassified 1816
591 Ga0207670_10158458 3300025936 Unclassified 1687
592 Ga0207669_10029323 3300025937 Bacteria 3042
593 Ga0207669_10278024 3300025937 Bacteria 1261
594 Ga0207704_10001601 3300025938 Bacteria 10176
595 Ga0207704_10077829 3300025938 Bacteria 2131
596 Ga0207704_10174349 3300025938 Unclassified 1546
597 Ga0207704_10322697 3300025938 Unclassified 1192
598 Ga0207691_10000504 3300025940 Bacteria 38867
599 Ga0207691_10003556 3300025940 Bacteria 15157
600 Ga0207691_10023719 3300025940 Bacteria 5775
601 Ga0207691_10050317 3300025940 Bacteria 3815
602 Ga0207691_10070087 3300025940 Bacteria 3166
603 Ga0207691_10076260 3300025940 Bacteria 3022
604 Ga0207691_10089022 3300025940 Unclassified 2768
605 Ga0207691_10111096 3300025940 Archaea 2437
606 Ga0207711_10120925 3300025941 Bacteria 2337
607 Ga0207711_10394646 3300025941 Unclassified 1285
608 Ga0207689_10001176 3300025942 Bacteria 25213
609 Ga0207689_10009612 3300025942 Bacteria 8338
610 Ga0207689_10013229 3300025942 Bacteria 7040
611 Ga0207689_10014847 3300025942 Bacteria 6612
612 Ga0207689_10019979 3300025942 Bacteria 5641
613 Ga0207689_10020131 3300025942 Bacteria 5619
614 Ga0207689_10029042 3300025942 Bacteria 4622
615 Ga0207689_10033265 3300025942 Bacteria 4284
616 Ga0207689_10038375 3300025942 Unclassified 3968
617 Ga0207689_10072098 3300025942 Bacteria 2837
618 Ga0207689_10174932 3300025942 Bacteria 1770
619 Ga0207661_10000840 3300025944 Bacteria 20127
620 Ga0207661_10010476 3300025944 Bacteria 6672
621 Ga0207661_10018872 3300025944 Bacteria 5132
622 Ga0207661_10096723 3300025944 Bacteria 2471
623 Ga0207679_10008617 3300025945 Bacteria 6502
624 Ga0207679_10008706 3300025945 Bacteria 6471
625 Ga0207679_10020849 3300025945 Bacteria 4432
626 Ga0207679_10021105 3300025945 Bacteria 4407
627 Ga0207679_10078429 3300025945 Bacteria 2516
628 Ga0207667_10000275 3300025949 Bacteria 71281
629 Ga0207667_10000721 3300025949 Bacteria 42931
630 Ga0207667_10011490 3300025949 Bacteria 10284
631 Ga0207667_10074372 3300025949 Bacteria 3530
632 Ga0207667_10075991 3300025949 Bacteria 3486
633 Ga0207667_10095656 3300025949 Bacteria 3066
634 Ga0207667_10107057 3300025949 Bacteria 2884
635 Ga0207651_10000164 3300025960 Bacteria 28660
636 Ga0207651_10015652 3300025960 Bacteria 4416
637 Ga0207651_10038783 3300025960 Bacteria 3134
638 Ga0207651_10042532 3300025960 Bacteria 3025
639 Ga0207712_10002266 3300025961 Bacteria 12484
640 Ga0207712_10003837 3300025961 Bacteria 9494
641 Ga0207712_10009791 3300025961 Bacteria 6074
642 Ga0207712_10011308 3300025961 Bacteria 5683
643 Ga0207712_10138273 3300025961 Unclassified 1866
644 Ga0207712_10170095 3300025961 Bacteria 1702
645 Ga0207668_10000568 3300025972 Bacteria 23189
646 Ga0207668_10005433 3300025972 Bacteria 7500
647 Ga0207668_10262122 3300025972 Bacteria 1409
648 Ga0207640_10008552 3300025981 Bacteria 5684
649 Ga0207640_10010668 3300025981 Bacteria 5182
650 Ga0207640_10027730 3300025981 Bacteria 3454
651 Ga0207640_10115742 3300025981 Unclassified 1910
652 Ga0207658_10000225 3300025986 Bacteria 59285
653 Ga0207658_10018882 3300025986 Bacteria 4768
654 Ga0207658_10102971 3300025986 Bacteria 2240
655 Ga0207658_10114310 3300025986 Bacteria 2140
656 Ga0207658_10433626 3300025986 Bacteria 1161
657 Ga0207677_10004033 3300026023 Bacteria 7839
658 Ga0207677_10020431 3300026023 Bacteria 4021
659 Ga0207677_10068565 3300026023 Unclassified 2490
660 Ga0207677_10243069 3300026023 Bacteria 1457
661 Ga0207677_10325428 3300026023 Bacteria 1279
662 Ga0207703_10001012 3300026035 Bacteria 27015
663 Ga0207703_10004551 3300026035 Bacteria 11366
664 Ga0207703_10078745 3300026035 Bacteria 2739
665 Ga0207639_10011129 3300026041 Bacteria 6240
666 Ga0207639_10016999 3300026041 Bacteria 5155
667 Ga0207639_10019305 3300026041 Bacteria 4860
668 Ga0207639_10030049 3300026041 Bacteria 3983
669 Ga0207639_10035531 3300026041 Bacteria 3688
670 Ga0207639_10401623 3300026041 Unclassified 1235
671 Ga0207678_10048748 3300026067 Bacteria 3661
672 Ga0207678_10073535 3300026067 Bacteria 2929
673 Ga0207678_10077023 3300026067 Bacteria 2856
674 Ga0207678_10093966 3300026067 Bacteria 2562
675 Ga0207678_10171365 3300026067 Bacteria 1853
676 Ga0207708_10062482 3300026075 Unclassified 2845
677 Ga0207702_10014859 3300026078 Bacteria 6459
678 Ga0207702_10048289 3300026078 Bacteria 3589
679 Ga0207702_10097371 3300026078 Bacteria 2589
680 Ga0207641_10000167 3300026088 Bacteria 92790
681 Ga0207641_10006442 3300026088 Bacteria 9897
682 Ga0207641_10025224 3300026088 Unclassified 4903
683 Ga0207641_10215578 3300026088 Bacteria 1777
684 Ga0207641_10223475 3300026088 Unclassified 1747
685 Ga0207641_10515453 3300026088 Bacteria 1163
686 Ga0207648_10000560 3300026089 Bacteria 41654
687 Ga0207648_10001895 3300026089 Bacteria 22861
688 Ga0207648_10013539 3300026089 Bacteria 7583
689 Ga0207648_10025240 3300026089 Bacteria 5295
690 Ga0207648_10084464 3300026089 Unclassified 2769
691 Ga0207648_10109922 3300026089 Bacteria 2420
692 Ga0207648_10135085 3300026089 Bacteria 2172
693 Ga0207648_10153901 3300026089 Bacteria 2029
694 Ga0207676_10000992 3300026095 Bacteria 21875
695 Ga0207676_10025764 3300026095 Bacteria 4366
696 Ga0207676_10105191 3300026095 Bacteria 2349
697 Ga0207676_10108328 3300026095 Unclassified 2319
698 Ga0207676_10334902 3300026095 Bacteria 1394
699 Ga0207676_10517281 3300026095 Bacteria 1136
700 Ga0207674_10023234 3300026116 Bacteria 6642
701 Ga0207674_10024690 3300026116 Bacteria 6417
702 Ga0207674_10057085 3300026116 Bacteria 3959
703 Ga0207674_10091138 3300026116 Bacteria 3039
704 Ga0207674_10127552 3300026116 Unclassified 2509
705 Ga0207674_10144646 3300026116 Bacteria 2336
706 Ga0207674_10150557 3300026116 Bacteria 2284
707 Ga0207674_10153912 3300026116 Bacteria 2255
708 Ga0207675_100001069 3300026118 Bacteria 27199
709 Ga0207675_100053199 3300026118 Bacteria 3778
710 Ga0207675_100074576 3300026118 Bacteria 3175
711 Ga0207675_100096566 3300026118 Bacteria 2782
712 Ga0207675_100134723 3300026118 Bacteria 2343
713 Ga0207675_100194001 3300026118 Bacteria 1949
714 Ga0207683_10001675 3300026121 Bacteria 19850
715 Ga0207683_10042151 3300026121 Bacteria 3986
716 Ga0207683_10043729 3300026121 Bacteria 3915
717 Ga0207683_10182867 3300026121 Unclassified 1901
718 Ga0207683_10211932 3300026121 Unclassified 1763
719 Ga0207683_10340472 3300026121 Bacteria 1375
720 Ga0207698_10001738 3300026142 Bacteria 12693
721 Ga0207698_10011377 3300026142 Bacteria 5768
722 Ga0207698_10039833 3300026142 Bacteria 3484
723 Ga0207698_10064058 3300026142 Bacteria 2880
724 Ga0207698_10192049 3300026142 Bacteria 1820
725 Ga0207698_10282447 3300026142 Bacteria 1536
726 Ga0207428_10128535 3300027907 Bacteria 1940
727 Ga0268266_10000014 3300028379 Bacteria 644033
728 Ga0268266_10001023 3300028379 Bacteria 35230
729 Ga0268266_10127702 3300028379 Unclassified 2271
730 Ga0268266_10300343 3300028379 Bacteria 1498
731 Ga0268265_10108869 3300028380 Bacteria 2257
732 Ga0268265_10316489 3300028380 Bacteria 1411
733 Ga0268264_10000105 3300028381 Bacteria 212531
734 Ga0268264_10001646 3300028381 Bacteria 20632
735 Ga0268264_10020393 3300028381 Bacteria 5417
736 Ga0268264_10024621 3300028381 Bacteria 4915
737 Ga0268264_10032257 3300028381 Bacteria 4297
738 Ga0307517_10016657 3300028786 Bacteria 9642
739 Ga0307515_10001274 3300028794 Bacteria 57313
740 Ga0265338_10000408 3300028800 Bacteria 77235
741 Ga0307511_10000579 3300030521 Bacteria 39193
742 Ga0265327_10000107 3300031251 Bacteria 183770
743 Ga0265327_10050815 3300031251 Bacteria 2167
744 Ga0265316_10001346 3300031344 Bacteria 26432
745 Ga0307513_10012204 3300031456 Bacteria 10622
746 Ga0307513_10141289 3300031456 Bacteria 2334
747 Ga0307509_10045786 3300031507 Bacteria 4714
748 Ga0307509_10174833 3300031507 Bacteria 2021
749 Ga0307509_10292170 3300031507 Bacteria 1384
750 Ga0307508_10002565 3300031616 Bacteria 19118
751 Ga0316579_10041913 3300031691 Unclassified 2125
752 Ga0307516_10004180 3300031730 Bacteria 17982
753 Ga0307410_10020334 3300031852 Bacteria 4058
754 Ga0307407_10199329 3300031903 Bacteria 1340
755 Ga0307409_100009385 3300031995 Bacteria 6008
756 Ga0307416_100069838 3300032002 Bacteria 2909
757 Ga0307414_10422156 3300032004 Bacteria 1163
758 Ga0307415_100001047 3300032126 Bacteria 12840
759 Ga0373941_0009668 3300035115 Bacteria 2434
760 Ga0373943_0140224 3300035170 Bacteria 1302
761 Ga0373927_0049219 3300035695 Bacteria 2726
762 Ga0373933_0051362 3300035724 Unclassified 2464
763 Ga0373937_0004801 3300036401 Bacteria 11481
764 Ga0373937_0169918 3300036401 Bacteria 2046
765 Ga0316582_0338069 3300036647 Bacteria 1035
766 Ga0373925_0455590 3300037068 Bacteria 1048
767 Ga0395900_0008236 3300037418 Bacteria 10734
768 Ga0395898_0053541 3300037466 Bacteria 3941
769 Ga0395905_0000040 3300037471 Bacteria 251247
770 Ga0395905_0053611 3300037471 Bacteria 3774
771 Ga0395905_0067168 3300037471 Bacteria 3358
772 Ga0395905_0082304 3300037471 Bacteria 3017
773 Ga0395905_0176205 3300037471 Bacteria 2008
774 Ga0316581_0001785 3300037588 Unclassified 4978
775 Ga0316581_0106146 3300037588 Bacteria 865
776 Ga0395901_0042335 3300038443 Bacteria 4721
777 Ga0395901_0072744 3300038443 Bacteria 3584
778 Ga0436365_0419801 3300039437 Bacteria 5292
779 Ga0436365_0735035 3300039437 Bacteria 3782
780 Ga0436365_1019786 3300039437 Bacteria 3225
781 Ga0436365_1658325 3300039437 Bacteria 5163
782 Ga0439436_0010189 3300041404 Bacteria 2870
783 Ga0439439_0006295 3300041406 Bacteria 2743
784 Ga0439439_0009348 3300041406 Bacteria 2331
785 Ga0439449_0006238 3300042007 Bacteria 4556
786 Ga0439449_0016056 3300042007 Bacteria 2816
787 Ga0439457_000399 3300042014 Bacteria 12335
788 Ga0439457_006263 3300042014 Bacteria 2925
789 Ga0439462_0010507 3300042015 Bacteria 2345
790 Ga0439462_0082326 3300042015 Bacteria 879
791 Ga0439434_0020825 3300042435 Bacteria 1970
792 Ga0439434_0047558 3300042435 Bacteria 1325
793 Ga0451577_0009739 3300042876 Bacteria 9212
794 Ga0451577_0117342 3300042876 Bacteria 2384
795 Ga0451577_0172493 3300042876 Unclassified 1949
796 Ga0466969_0000293 3300044656 Bacteria 27315
797 Ga0466972_0000014 3300044658 Bacteria 216776
798 Ga0466972_0000250 3300044658 Bacteria 36169
799 Ga0466972_0000477 3300044658 Bacteria 20281
800 Ga0466966_0000028 3300044684 Bacteria 105667
801 Ga0453684_0000108 3300044712 Bacteria 361085
802 Ga0453684_0001771 3300044712 Bacteria 57646
803 Ga0453684_0191394 3300044712 Bacteria 2393
804 Ga0453684_0205116 3300044712 Bacteria 2295
805 Ga0453684_0214306 3300044712 Bacteria 2236
806 Ga0466968_0008930 3300044735 Bacteria 3848
807 Ga0466968_0023147 3300044735 Bacteria 2529
808 Ga0466970_0001468 3300044765 Bacteria 11384
809 Ga0466957_0000123 3300044842 Bacteria 32543
810 Ga0466959_0000039 3300045049 Bacteria 101186
811 Ga0466959_0035662 3300045049 Bacteria 3677
812 Ga0451576_0016411 3300045051 Bacteria 8175
813 Ga0466967_0076668 3300045976 Bacteria 3008
814 Ga0466967_0395490 3300045976 Bacteria 1344
815 Ga0495651_0123422 3300046462 Bacteria 1900
816 Ga0495664_0061219 3300046477 Unclassified 2242
817 Ga0495606_0005219 3300046507 Bacteria 12536
818 Ga0495630_0150442 3300046517 Unclassified 1771
819 Ga0495630_0180336 3300046517 Bacteria 1610
820 Ga0495643_0032341 3300046522 Bacteria 2905
821 Ga0495648_0008977 3300046524 Bacteria 7808
822 Ga0495586_0133191 3300046535 Unclassified 1392
823 Ga0495645_0228718 3300046543 Bacteria 1247
824 Ga0495656_0000004 3300046615 Bacteria 242784
825 Ga0495668_0001408 3300046616 Bacteria 23422
826 Ga0495668_0001611 3300046616 Bacteria 21126
827 Ga0495634_0012523 3300046642 Bacteria 6137
828 Ga0495625_0094619 3300046660 Bacteria 2061
829 Ga0495659_0000580 3300046664 Bacteria 13484
830 Ga0495657_0068433 3300046675 Bacteria 2327
831 Ga0495623_0092939 3300046679 Bacteria 1848
832 Ga0495670_0125775 3300046691 Bacteria 1334
833 Ga0495604_0087987 3300047317 Unclassified 2312
834 Ga0495674_0236940 3300047319 Bacteria 1505
835 Ga0495672_0026023 3300047320 Bacteria 3738
836 Ga0495672_0065375 3300047320 Unclassified 2079
837 Ga0495672_0081734 3300047320 Bacteria 1798
838 Ga0495687_000056 3300047443 Bacteria 188227
839 Ga0495684_0249530 3300047471 Bacteria 1292
840 Ga0495686_0130542 3300047472 Bacteria 1490
841 Ga0496101_0054484 3300048904 Bacteria 2888
842 Ga0496102_0317033 3300048905 Bacteria 1469
843 Ga0496108_0211119 3300048911 Bacteria 1685
844 Ga0496114_0117615 3300048917 Bacteria 2283
845 Ga0496115_0292143 3300048918 Unclassified 1337
846 Ga0496124_0044005 3300048927 Bacteria 3834
847 Ga0501031_0073046 3300049568 Bacteria 2233
848 Ga0501032_0000105 3300049569 Bacteria 71525
849 Ga0501032_0057079 3300049569 Bacteria 2623
850 Ga0501034_0000363 3300049571 Bacteria 77256
851 Ga0501034_0020326 3300049571 Bacteria 6778
852 Ga0501034_0023760 3300049571 Bacteria 6243
853 Ga0501034_0058351 3300049571 Bacteria 3879
854 Ga0501034_0327662 3300049571 Bacteria 1463
855 Ga0501034_0400905 3300049571 Bacteria 1294
856 Ga0501034_0414027 3300049571 Unclassified 1270
857 Ga0501034_0500007 3300049571 Bacteria 1129
858 Ga0501034_0566480 3300049571 Bacteria 1044
859 Ga0501036_0008626 3300049572 Bacteria 8365
860 Ga0501036_0015178 3300049572 Bacteria 6433
861 Ga0501036_0089161 3300049572 Bacteria 2606
862 Ga0501037_0036199 3300049573 Bacteria 3638
863 Ga0501037_0128887 3300049573 Bacteria 1815
864 Ga0501037_0129521 3300049573 Bacteria 1810
865 Ga0501037_0222459 3300049573 Bacteria 1328
866 Ga0501037_0321285 3300049573 Unclassified 1072
867 Ga0501038_0036362 3300049574 Bacteria 4322
868 Ga0501038_0072889 3300049574 Bacteria 2909
869 Ga0501038_0086995 3300049574 Bacteria 2625
870 Ga0501038_0191304 3300049574 Bacteria 1646
871 Ga0501039_0019257 3300049575 Bacteria 5234
872 Ga0501039_0144315 3300049575 Bacteria 1870
873 Ga0501039_0490293 3300049575 Bacteria 965
874 Ga0501043_0025312 3300049579 Bacteria 4655
875 Ga0501043_0033904 3300049579 Bacteria 4017
876 Ga0501043_0128951 3300049579 Bacteria 1982
877 Ga0501043_0145079 3300049579 Bacteria 1859
878 Ga0501043_0161440 3300049579 Bacteria 1751
879 Ga0501043_0211997 3300049579 Bacteria 1501
880 Ga0501046_0007138 3300049580 Bacteria 9826
881 Ga0501046_0109050 3300049580 Bacteria 2117
882 Ga0501047_0008441 3300049581 Bacteria 9723
883 Ga0501047_0023465 3300049581 Bacteria 5921
884 Ga0501047_0118369 3300049581 Bacteria 2531
885 Ga0501047_0170001 3300049581 Bacteria 2049
886 Ga0501047_0270173 3300049581 Bacteria 1547
887 Ga0501047_0322644 3300049581 Unclassified 1384
888 Ga0501048_0053337 3300049582 Bacteria 2876
889 Ga0501067_0031941 3300049583 Bacteria 2921
890 Ga0501068_0050600 3300049584 Bacteria 2512
891 Ga0501068_0282282 3300049584 Bacteria 1061
892 Ga0501069_0060217 3300049585 Bacteria 2119
893 Ga0501070_0162072 3300049586 Bacteria 1843
894 Ga0501073_0205126 3300049589 Bacteria 1362
895 Ga0501074_0034682 3300049590 Bacteria 3658
896 Ga0501074_0160719 3300049590 Bacteria 1604
897 Ga0501202_000556 3300049652 Bacteria 5413
898 Ga0501207_018216 3300049654 Unclassified 1102
899 Ga0501217_007182 3300049661 Bacteria 2383
900 Ga0501223_003405 3300049663 Bacteria 3471
901 Ga0501224_000662 3300049664 Bacteria 4281
902 Ga0501227_014783 3300049665 Bacteria 1737
903 Ga0501242_002083 3300049674 Bacteria 2086
904 Ga0501243_000597 3300049675 Bacteria 4875
905 Ga0501252_003669 3300049682 Unclassified 1597
906 Ga0501253_026702 3300049683 Bacteria 1067
907 Ga0501257_001076 3300049686 Bacteria 5535
908 Ga0501257_026261 3300049686 Bacteria 1389
909 Ga0501259_000155 3300049688 Bacteria 10299
910 Ga0501259_000915 3300049688 Bacteria 4868
911 Ga0501221_006730 3300049704 Unclassified 1950
912 Ga0501225_0002223 3300049705 Bacteria 5999
913 Ga0501225_0031215 3300049705 Bacteria 1466
914 Ga0501234_000444 3300049707 Bacteria 6230
915 Ga0501245_000325 3300049708 Bacteria 5660
916 Ga0501079_0079388 3300049741 Bacteria 2538
917 Ga0501080_0116817 3300049742 Bacteria 2473
918 Ga0501080_0265447 3300049742 Bacteria 1563
919 Ga0501080_0437825 3300049742 Bacteria 1173
920 Ga0501083_0022448 3300049744 Bacteria 4380
921 Ga0501083_0073596 3300049744 Bacteria 2271
922 Ga0501241_017865 3300049758 Unclassified 1297
923 Ga0501268_005545 3300049765 Bacteria 1819
924 Ga0501273_010746 3300049770 Bacteria 1130
925 Ga0501280_015129 3300049776 Bacteria 1103
926 Ga0501283_015883 3300049779 Bacteria 1162
927 Ga0501035_0084081 3300049822 Unclassified 2807
928 Ga0501035_0105981 3300049822 Bacteria 2465
929 Ga0501035_0145956 3300049822 Bacteria 2055
930 Ga0501035_0417977 3300049822 Bacteria 1113
931 Ga0501044_0002352 3300049823 Bacteria 21578
932 Ga0501044_0011986 3300049823 Bacteria 9392
933 Ga0501044_0025772 3300049823 Bacteria 6234
934 Ga0501044_0050958 3300049823 Bacteria 4270
935 Ga0501044_0107114 3300049823 Bacteria 2807
936 Ga0501044_0167070 3300049823 Unclassified 2174
937 Ga0501044_0176022 3300049823 Bacteria 2109
938 Ga0501044_0195803 3300049823 Bacteria 1981
939 Ga0501284_00011 3300050005 Bacteria 131008
940 nmdc:mga00v17_68331_c1 3300050491 Unclassified 2196
941 nmdc:mga0k408_139188_c1 3300050493 Bacteria 1443
942 nmdc:mga0k408_5876_c1 3300050493 Bacteria 6540
943 nmdc:mga0k408_87688_c1 3300050493 Bacteria 1828
944 nmdc:mga05p37_504936_c1 3300050507 Bacteria 1387
945 nmdc:mga05p37_5549_c1 3300050507 Bacteria 14824
946 nmdc:mga09592_12657_c1 3300050508 Bacteria 6877
947 nmdc:mga09592_2970_c1 3300050508 Bacteria 13746
948 nmdc:mga09592_37657_c1 3300050508 Bacteria 4058
949 nmdc:mga0qj67_21010_c1 3300050509 Bacteria 5005
950 nmdc:mga06r32_62752_c1 3300050510 Bacteria 3580
951 Ga0500578_0000027 3300053086 Bacteria 144362
952 Ga0500646_0000241 3300053090 Bacteria 16732
953 Ga0500646_0026088 3300053090 Bacteria 1582
954 Ga0500583_0000042 3300053092 Bacteria 82406
955 Ga0500583_0000651 3300053092 Bacteria 10276
956 Ga0500583_0003160 3300053092 Bacteria 5116
957 Ga0500562_000004 3300053108 Bacteria 270087
958 Ga0500572_006582 3300053111 Bacteria 2666
959 Ga0500594_0015123 3300053118 Bacteria 1858
960 Ga0500642_0056099 3300053130 Unclassified 1754
961 Ga0500568_0000407 3300053139 Bacteria 32843
962 Ga0500568_0039687 3300053139 Unclassified 1899
963 Ga0500616_0036566 3300053153 Bacteria 2665
964 Ga0500616_0097578 3300053153 Bacteria 1442
965 Ga0500622_0002745 3300053156 Bacteria 12426
966 Ga0500622_0004729 3300053156 Bacteria 8410
967 Ga0500639_079843 3300053163 Bacteria 1650
968 Ga0500636_0071028 3300053177 Bacteria 2019
969 Ga0500611_000007 3300053727 Bacteria 210964
970 Ga0500611_009690 3300053727 Bacteria 1535
971 Ga0500645_008755 3300053730 Bacteria 3432
972 Ga0501082_0235193 3300060353 Bacteria 1594

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042015 Ga0439462_0082326 Ga0439462_0082326_23_838 268
2 3300036647 Ga0316582_0338069 Ga0316582_0338069_16_840 271
3 3300037588 Ga0316581_0106146 Ga0316581_0106146_22_846 271
4 3300049573 Ga0501037_0222459 Ga0501037_0222459_101_979 289
5 3300049823 Ga0501044_0050958 Ga0501044_0050958_2802_3680 289
6 3300005335 Ga0070666_10221353 Ga0070666_102213531 293
7 3300005355 Ga0070671_100006354 Ga0070671_1000063543 293
8 3300005459 Ga0068867_100094717 Ga0068867_1000947172 293
9 3300005841 Ga0068863_100028484 Ga0068863_1000284844 293
10 3300005842 Ga0068858_100216307 Ga0068858_1002163072 293
11 3300005843 Ga0068860_100536505 Ga0068860_1005365051 293
12 3300006237 Ga0097621_100000489 Ga0097621_10000048913 293
13 3300006358 Ga0068871_100000419 Ga0068871_1000004199 293
14 3300013297 Ga0157378_10020824 Ga0157378_100208242 293
15 3300013306 Ga0163162_10001017 Ga0163162_100010175 293
16 3300013308 Ga0157375_10000134 Ga0157375_1000013443 293
17 3300014969 Ga0157376_10001080 Ga0157376_100010801 293
18 3300017792 Ga0163161_10009332 Ga0163161_100093325 293
19 3300025903 Ga0207680_10235041 Ga0207680_102350412 293
20 3300025931 Ga0207644_10004058 Ga0207644_100040584 293
21 3300026089 Ga0207648_10135085 Ga0207648_101350852 293
22 3300026121 Ga0207683_10340472 Ga0207683_103404722 293
23 3300048905 Ga0496102_0317033 Ga0496102_0317033_468_1457 293
24 3300048917 Ga0496114_0117615 Ga0496114_0117615_58_1047 293
25 3300042435 Ga0439434_0047558 Ga0439434_0047558_31_1014 295
26 3300049575 Ga0501039_0490293 Ga0501039_0490293_15_917 297
27 3300013296 Ga0157374_10034561 Ga0157374_100345614 298
28 3300013308 Ga0157375_10189337 Ga0157375_101893373 298
29 3300014968 Ga0157379_10062987 Ga0157379_100629873 298
30 3300025893 Ga0207682_10006983 Ga0207682_100069832 298
31 3300025940 Ga0207691_10023719 Ga0207691_100237194 298
32 3300025960 Ga0207651_10042532 Ga0207651_100425322 298
33 3300005331 Ga0070670_100245947 Ga0070670_1002459471 299
34 3300005334 Ga0068869_100166170 Ga0068869_1001661702 299
35 3300005456 Ga0070678_100093372 Ga0070678_1000933722 299
36 3300005459 Ga0068867_100199215 Ga0068867_1001992152 299
37 3300005618 Ga0068864_100096174 Ga0068864_1000961742 299
38 3300006881 Ga0068865_100074189 Ga0068865_1000741892 299
39 3300013306 Ga0163162_10069689 Ga0163162_100696891 299
40 3300013308 Ga0157375_10563744 Ga0157375_105637442 299
41 3300017792 Ga0163161_10232229 Ga0163161_102322291 299
42 3300025925 Ga0207650_10161218 Ga0207650_101612182 299
43 3300025942 Ga0207689_10174932 Ga0207689_101749321 299
44 3300026121 Ga0207683_10043729 Ga0207683_100437293 299
45 3300044712 Ga0453684_0214306 Ga0453684_0214306_951_1874 304
46 3300005617 Ga0068859_100193607 Ga0068859_1001936072 305
47 3300005834 Ga0068851_10260391 Ga0068851_102603911 305
48 3300005843 Ga0068860_100249360 Ga0068860_1002493602 305
49 3300006931 Ga0097620_100193601 Ga0097620_1001936012 305
50 3300021384 Ga0213876_10003364 Ga0213876_100033647 305
51 3300025904 Ga0207647_10025262 Ga0207647_100252623 305
52 3300025920 Ga0207649_10075155 Ga0207649_100751552 305
53 3300025942 Ga0207689_10013229 Ga0207689_100132291 305
54 3300025945 Ga0207679_10021105 Ga0207679_100211054 305
55 3300026067 Ga0207678_10171365 Ga0207678_101713652 305
56 3300026088 Ga0207641_10515453 Ga0207641_105154532 305
57 3300026095 Ga0207676_10025764 Ga0207676_100257642 305
58 3300031903 Ga0307407_10199329 Ga0307407_101993291 305
59 3300037471 Ga0395905_0067168 Ga0395905_0067168_2381_3307 305
60 3300039437 Ga0436365_1658325 Ga0436365_1658325_3419_4345 305
61 3300042876 Ga0451577_0117342 Ga0451577_0117342_1445_2371 305
62 3300049575 Ga0501039_0019257 Ga0501039_0019257_4270_5196 305
63 3300053153 Ga0500616_0097578 Ga0500616_0097578_469_1395 305
64 3300003316 rootH1_10033438 rootH1_100334383 306
65 3300049571 Ga0501034_0566480 Ga0501034_0566480_44_991 308
66 3300049742 Ga0501080_0437825 Ga0501080_0437825_199_1146 308
67 3300006358 Ga0068871_100270480 Ga0068871_1002704801 311
68 3300009553 Ga0105249_10022267 Ga0105249_100222672 312
69 3300013306 Ga0163162_10012423 Ga0163162_100124233 312
70 3300013308 Ga0157375_10070820 Ga0157375_100708202 312
71 3300025961 Ga0207712_10138273 Ga0207712_101382731 312
72 3300006881 Ga0068865_100030779 Ga0068865_1000307794 315
73 3300026023 Ga0207677_10068565 Ga0207677_100685651 315
74 3300026118 Ga0207675_100096566 Ga0207675_1000965662 315
75 3300046535 Ga0495586_0133191 Ga0495586_0133191_18_974 315
76 3300005333 Ga0070677_10003327 Ga0070677_100033273 317
77 3300005354 Ga0070675_100018400 Ga0070675_1000184005 317
78 3300005364 Ga0070673_100063512 Ga0070673_1000635122 317
79 3300006237 Ga0097621_100033562 Ga0097621_1000335624 317
80 3300014326 Ga0157380_10150409 Ga0157380_101504092 317
81 3300025908 Ga0207643_10096354 Ga0207643_100963542 317
82 3300042876 Ga0451577_0172493 Ga0451577_0172493_316_1281 318
83 3300044712 Ga0453684_0000108 Ga0453684_0000108_327025_327990 318
84 3300044712 Ga0453684_0001771 Ga0453684_0001771_9818_10783 318
85 3300045051 Ga0451576_0016411 Ga0451576_0016411_5742_6707 318
86 3300031691 Ga0316579_10041913 Ga0316579_100419132 319
87 3300037588 Ga0316581_0001785 Ga0316581_0001785_1653_2621 319
88 3300025900 Ga0207710_10002801 Ga0207710_100028012 320
89 iso_pu_bacteria 2738541278 2738727650 320
90 iso_pu_bacteria 2818991444 2819590605 320
91 iso_pu_bacteria 2929154850 2929156010 320
92 3300031344 Ga0265316_10001346 Ga0265316_1000134613 321
93 3300037418 Ga0395900_0008236 Ga0395900_0008236_1299_2279 321
94 3300037471 Ga0395905_0082304 Ga0395905_0082304_1394_2374 321
95 3300048904 Ga0496101_0054484 Ga0496101_0054484_1350_2327 321
96 3300003316 rootH1_10051512 rootH1_1005151213 322
97 3300005295 Ga0065707_10107553 Ga0065707_101075532 322
98 3300005330 Ga0070690_100066010 Ga0070690_1000660102 322
99 3300005354 Ga0070675_100002264 Ga0070675_10000226410 322
100 3300005365 Ga0070688_100004500 Ga0070688_1000045006 322
101 3300005543 Ga0070672_100020254 Ga0070672_1000202541 322
102 3300005578 Ga0068854_100101146 Ga0068854_1001011462 322
103 3300005719 Ga0068861_100013192 Ga0068861_1000131925 322
104 3300005840 Ga0068870_10010987 Ga0068870_100109875 322
105 3300005844 Ga0068862_100028062 Ga0068862_1000280625 322
106 3300009094 Ga0111539_10007214 Ga0111539_1000721411 322
107 3300009148 Ga0105243_10055846 Ga0105243_100558462 322
108 3300009553 Ga0105249_10082575 Ga0105249_100825752 322
109 3300014745 Ga0157377_10000660 Ga0157377_100006603 322
110 3300025908 Ga0207643_10080915 Ga0207643_100809152 322
111 3300025936 Ga0207670_10049393 Ga0207670_100493932 322
112 3300026118 Ga0207675_100001069 Ga0207675_1000010694 322
113 3300035115 Ga0373941_0009668 Ga0373941_0009668_478_1458 322
114 3300045976 Ga0466967_0076668 Ga0466967_0076668_719_1702 322
115 3300045976 Ga0466967_0395490 Ga0466967_0395490_32_1015 322
116 3300046615 Ga0495656_0000004 Ga0495656_0000004_25790_26773 322
117 3300046664 Ga0495659_0000580 Ga0495659_0000580_8204_9187 322
118 3300005329 Ga0070683_100081383 Ga0070683_1000813832 323
119 3300005335 Ga0070666_10094392 Ga0070666_100943922 323
120 3300005336 Ga0070680_100010215 Ga0070680_1000102155 323
121 3300005336 Ga0070680_100070426 Ga0070680_1000704262 323
122 3300005338 Ga0068868_100034133 Ga0068868_1000341332 323
123 3300005339 Ga0070660_100041686 Ga0070660_1000416864 323
124 3300005340 Ga0070689_100035015 Ga0070689_1000350152 323
125 3300005345 Ga0070692_10086390 Ga0070692_100863902 323
126 3300005354 Ga0070675_100057499 Ga0070675_1000574992 323
127 3300005355 Ga0070671_100061563 Ga0070671_1000615632 323
128 3300005356 Ga0070674_100083656 Ga0070674_1000836562 323
129 3300005367 Ga0070667_100051778 Ga0070667_1000517782 323
130 3300005367 Ga0070667_100112464 Ga0070667_1001124642 323
131 3300005455 Ga0070663_100085750 Ga0070663_1000857502 323
132 3300005458 Ga0070681_10040195 Ga0070681_100401952 323
133 3300005458 Ga0070681_10064938 Ga0070681_100649383 323
134 3300005458 Ga0070681_10366796 Ga0070681_103667961 323
135 3300005459 Ga0068867_100009666 Ga0068867_1000096664 323
136 3300005530 Ga0070679_100001616 Ga0070679_10000161614 323
137 3300005530 Ga0070679_100021368 Ga0070679_1000213682 323
138 3300005530 Ga0070679_100121092 Ga0070679_1001210922 323
139 3300005530 Ga0070679_100122840 Ga0070679_1001228402 323
140 3300005543 Ga0070672_100260306 Ga0070672_1002603062 323
141 3300005563 Ga0068855_100000351 Ga0068855_10000035146 323
142 3300005563 Ga0068855_100025281 Ga0068855_1000252814 323
143 3300005563 Ga0068855_100062948 Ga0068855_1000629482 323
144 3300005563 Ga0068855_100615828 Ga0068855_1006158281 323
145 3300005578 Ga0068854_100094159 Ga0068854_1000941592 323
146 3300005616 Ga0068852_100018176 Ga0068852_1000181765 323
147 3300005616 Ga0068852_100286069 Ga0068852_1002860692 323
148 3300005617 Ga0068859_100050537 Ga0068859_1000505374 323
149 3300005843 Ga0068860_100036404 Ga0068860_1000364042 323
150 3300005844 Ga0068862_100023254 Ga0068862_1000232543 323
151 3300006051 Ga0075364_10172039 Ga0075364_101720392 323
152 3300006880 Ga0075429_100306491 Ga0075429_1003064911 323
153 3300006931 Ga0097620_100050537 Ga0097620_1000505372 323
154 3300013100 Ga0157373_10006436 Ga0157373_100064364 323
155 3300013100 Ga0157373_10018871 Ga0157373_100188713 323
156 3300013102 Ga0157371_10002334 Ga0157371_100023347 323
157 3300013102 Ga0157371_10006507 Ga0157371_100065074 323
158 3300013102 Ga0157371_10007605 Ga0157371_100076057 323
159 3300013102 Ga0157371_10032312 Ga0157371_100323122 323
160 3300013104 Ga0157370_10001463 Ga0157370_1000146320 323
161 3300013104 Ga0157370_10001948 Ga0157370_1000194820 323
162 3300013104 Ga0157370_10003125 Ga0157370_1000312510 323
163 3300013105 Ga0157369_10043116 Ga0157369_100431163 323
164 3300013105 Ga0157369_10046180 Ga0157369_100461804 323
165 3300013296 Ga0157374_10000002 Ga0157374_10000002138 323
166 3300013297 Ga0157378_10001024 Ga0157378_1000102413 323
167 3300013306 Ga0163162_10411001 Ga0163162_104110012 323
168 3300013307 Ga0157372_10039725 Ga0157372_100397253 323
169 3300013307 Ga0157372_10050213 Ga0157372_100502132 323
170 3300013307 Ga0157372_10076264 Ga0157372_100762643 323
171 3300013307 Ga0157372_10171244 Ga0157372_101712442 323
172 3300013307 Ga0157372_10342281 Ga0157372_103422812 323
173 3300014326 Ga0157380_10648820 Ga0157380_106488201 323
174 3300014745 Ga0157377_10004324 Ga0157377_100043242 323
175 3300014969 Ga0157376_10006164 Ga0157376_100061643 323
176 3300025907 Ga0207645_10027872 Ga0207645_100278722 323
177 3300025909 Ga0207705_10099865 Ga0207705_100998652 323
178 3300025909 Ga0207705_10244474 Ga0207705_102444741 323
179 3300025912 Ga0207707_10090982 Ga0207707_100909822 323
180 3300025912 Ga0207707_10154907 Ga0207707_101549073 323
181 3300025912 Ga0207707_10348212 Ga0207707_103482121 323
182 3300025917 Ga0207660_10073469 Ga0207660_100734692 323
183 3300025917 Ga0207660_10149659 Ga0207660_101496592 323
184 3300025918 Ga0207662_10005444 Ga0207662_100054442 323
185 3300025919 Ga0207657_10012535 Ga0207657_100125353 323
186 3300025919 Ga0207657_10037421 Ga0207657_100374213 323
187 3300025919 Ga0207657_10061002 Ga0207657_100610022 323
188 3300025921 Ga0207652_10000055 Ga0207652_1000005564 323
189 3300025921 Ga0207652_10003097 Ga0207652_1000309711 323
190 3300025921 Ga0207652_10016240 Ga0207652_100162404 323
191 3300025921 Ga0207652_10046663 Ga0207652_100466632 323
192 3300025921 Ga0207652_10293079 Ga0207652_102930791 323
193 3300025923 Ga0207681_10025072 Ga0207681_100250722 323
194 3300025925 Ga0207650_10296982 Ga0207650_102969822 323
195 3300025926 Ga0207659_10080766 Ga0207659_100807662 323
196 3300025931 Ga0207644_10044879 Ga0207644_100448792 323
197 3300025932 Ga0207690_10007149 Ga0207690_100071495 323
198 3300025932 Ga0207690_10017444 Ga0207690_100174441 323
199 3300025934 Ga0207686_10365701 Ga0207686_103657011 323
200 3300025936 Ga0207670_10134537 Ga0207670_101345372 323
201 3300025940 Ga0207691_10050317 Ga0207691_100503171 323
202 3300025942 Ga0207689_10038375 Ga0207689_100383752 323
203 3300025945 Ga0207679_10020849 Ga0207679_100208492 323
204 3300025949 Ga0207667_10000721 Ga0207667_1000072133 323
205 3300025949 Ga0207667_10011490 Ga0207667_100114905 323
206 3300025949 Ga0207667_10075991 Ga0207667_100759912 323
207 3300025960 Ga0207651_10038783 Ga0207651_100387832 323
208 3300025981 Ga0207640_10115742 Ga0207640_101157422 323
209 3300026023 Ga0207677_10325428 Ga0207677_103254282 323
210 3300026041 Ga0207639_10401623 Ga0207639_104016231 323
211 3300026067 Ga0207678_10048748 Ga0207678_100487481 323
212 3300026067 Ga0207678_10093966 Ga0207678_100939661 323
213 3300026075 Ga0207708_10062482 Ga0207708_100624823 323
214 3300026078 Ga0207702_10014859 Ga0207702_100148595 323
215 3300026116 Ga0207674_10023234 Ga0207674_100232342 323
216 3300026116 Ga0207674_10153912 Ga0207674_101539122 323
217 3300026121 Ga0207683_10182867 Ga0207683_101828672 323
218 3300026142 Ga0207698_10001738 Ga0207698_1000173811 323
219 3300026142 Ga0207698_10282447 Ga0207698_102824472 323
220 3300028381 Ga0268264_10020393 Ga0268264_100203934 323
221 3300028800 Ga0265338_10000408 Ga0265338_100004089 323
222 3300037466 Ga0395898_0053541 Ga0395898_0053541_1198_2178 323
223 3300037471 Ga0395905_0000040 Ga0395905_0000040_82066_83082 323
224 3300037471 Ga0395905_0176205 Ga0395905_0176205_309_1289 323
225 3300038443 Ga0395901_0042335 Ga0395901_0042335_1325_2305 323
226 3300038443 Ga0395901_0072744 Ga0395901_0072744_612_1592 323
227 3300042007 Ga0439449_0006238 Ga0439449_0006238_202_1182 323
228 3300046507 Ga0495606_0005219 Ga0495606_0005219_3622_4599 323
229 3300049569 Ga0501032_0000105 Ga0501032_0000105_28405_29388 323
230 3300049571 Ga0501034_0000363 Ga0501034_0000363_17294_18289 323
231 3300049572 Ga0501036_0015178 Ga0501036_0015178_1444_2439 323
232 3300049574 Ga0501038_0086995 Ga0501038_0086995_280_1275 323
233 3300049654 Ga0501207_018216 Ga0501207_018216_61_1041 323
234 3300049663 Ga0501223_003405 Ga0501223_003405_2304_3284 323
235 3300049664 Ga0501224_000662 Ga0501224_000662_1757_2737 323
236 3300049675 Ga0501243_000597 Ga0501243_000597_507_1487 323
237 3300049682 Ga0501252_003669 Ga0501252_003669_49_1029 323
238 3300049686 Ga0501257_026261 Ga0501257_026261_352_1332 323
239 3300049688 Ga0501259_000155 Ga0501259_000155_9151_10131 323
240 3300049704 Ga0501221_006730 Ga0501221_006730_619_1599 323
241 3300049707 Ga0501234_000444 Ga0501234_000444_4420_5400 323
242 3300049708 Ga0501245_000325 Ga0501245_000325_2525_3505 323
243 3300049758 Ga0501241_017865 Ga0501241_017865_75_1055 323
244 3300049770 Ga0501273_010746 Ga0501273_010746_79_1059 323
245 3300049822 Ga0501035_0084081 Ga0501035_0084081_1592_2572 323
246 3300049823 Ga0501044_0107114 Ga0501044_0107114_153_1133 323
247 3300050491 nmdc:mga00v17_68331_c1 nmdc:mga00v17_68331_c1_842_1837 323
248 3300002459 JGI24751J29686_10001328 JGI24751J29686_100013284 324
249 3300003323 rootH1_10078088 rootH1_100780886 324
250 3300003323 rootH1_10103550 rootH1_101035504 324
251 3300005288 Ga0065714_10125089 Ga0065714_101250891 324
252 3300005290 Ga0065712_10070715 Ga0065712_100707153 324
253 3300005293 Ga0065715_10127067 Ga0065715_101270672 324
254 3300005293 Ga0065715_10139861 Ga0065715_101398612 324
255 3300005295 Ga0065707_10010810 Ga0065707_100108102 324
256 3300005328 Ga0070676_10001251 Ga0070676_100012515 324
257 3300005328 Ga0070676_10009728 Ga0070676_100097286 324
258 3300005328 Ga0070676_10028708 Ga0070676_100287082 324
259 3300005328 Ga0070676_10161613 Ga0070676_101616131 324
260 3300005329 Ga0070683_100010127 Ga0070683_1000101273 324
261 3300005329 Ga0070683_100054784 Ga0070683_1000547841 324
262 3300005329 Ga0070683_100076884 Ga0070683_1000768845 324
263 3300005329 Ga0070683_100299434 Ga0070683_1002994342 324
264 3300005330 Ga0070690_100123210 Ga0070690_1001232102 324
265 3300005331 Ga0070670_100012438 Ga0070670_1000124382 324
266 3300005331 Ga0070670_100037182 Ga0070670_1000371823 324
267 3300005331 Ga0070670_100038260 Ga0070670_1000382601 324
268 3300005331 Ga0070670_100052058 Ga0070670_1000520583 324
269 3300005331 Ga0070670_100068287 Ga0070670_1000682872 324
270 3300005331 Ga0070670_100129098 Ga0070670_1001290982 324
271 3300005331 Ga0070670_100137765 Ga0070670_1001377652 324
272 3300005331 Ga0070670_100428721 Ga0070670_1004287211 324
273 3300005334 Ga0068869_100021417 Ga0068869_1000214174 324
274 3300005334 Ga0068869_100047178 Ga0068869_1000471783 324
275 3300005334 Ga0068869_100084375 Ga0068869_1000843752 324
276 3300005334 Ga0068869_100102078 Ga0068869_1001020781 324
277 3300005335 Ga0070666_10000024 Ga0070666_1000002471 324
278 3300005335 Ga0070666_10000913 Ga0070666_100009137 324
279 3300005335 Ga0070666_10021112 Ga0070666_100211122 324
280 3300005335 Ga0070666_10072432 Ga0070666_100724322 324
281 3300005335 Ga0070666_10119228 Ga0070666_101192282 324
282 3300005337 Ga0070682_100000054 Ga0070682_10000005458 324
283 3300005337 Ga0070682_100000460 Ga0070682_10000046016 324
284 3300005338 Ga0068868_100002272 Ga0068868_1000022723 324
285 3300005338 Ga0068868_100020428 Ga0068868_1000204282 324
286 3300005338 Ga0068868_100048811 Ga0068868_1000488112 324
287 3300005338 Ga0068868_100088422 Ga0068868_1000884222 324
288 3300005338 Ga0068868_100301234 Ga0068868_1003012341 324
289 3300005339 Ga0070660_100211037 Ga0070660_1002110373 324
290 3300005340 Ga0070689_100009290 Ga0070689_1000092901 324
291 3300005340 Ga0070689_100105916 Ga0070689_1001059161 324
292 3300005341 Ga0070691_10011617 Ga0070691_100116173 324
293 3300005343 Ga0070687_100211194 Ga0070687_1002111941 324
294 3300005344 Ga0070661_100000277 Ga0070661_10000027718 324
295 3300005344 Ga0070661_100008859 Ga0070661_1000088594 324
296 3300005344 Ga0070661_100070422 Ga0070661_1000704222 324
297 3300005347 Ga0070668_100000036 Ga0070668_10000003626 324
298 3300005347 Ga0070668_100019902 Ga0070668_1000199022 324
299 3300005347 Ga0070668_100044662 Ga0070668_1000446622 324
300 3300005347 Ga0070668_100108012 Ga0070668_1001080122 324
301 3300005353 Ga0070669_100014389 Ga0070669_1000143893 324
302 3300005353 Ga0070669_100095488 Ga0070669_1000954882 324
303 3300005353 Ga0070669_100225592 Ga0070669_1002255923 324
304 3300005354 Ga0070675_100009802 Ga0070675_1000098027 324
305 3300005354 Ga0070675_100084143 Ga0070675_1000841432 324
306 3300005354 Ga0070675_100093349 Ga0070675_1000933493 324
307 3300005355 Ga0070671_100066424 Ga0070671_1000664242 324
308 3300005355 Ga0070671_100288334 Ga0070671_1002883342 324
309 3300005355 Ga0070671_100424691 Ga0070671_1004246911 324
310 3300005356 Ga0070674_100034399 Ga0070674_1000343992 324
311 3300005364 Ga0070673_100000556 Ga0070673_10000055611 324
312 3300005364 Ga0070673_100016851 Ga0070673_1000168512 324
313 3300005364 Ga0070673_100028728 Ga0070673_1000287282 324
314 3300005364 Ga0070673_100040146 Ga0070673_1000401464 324
315 3300005364 Ga0070673_100090635 Ga0070673_1000906352 324
316 3300005364 Ga0070673_100123716 Ga0070673_1001237161 324
317 3300005364 Ga0070673_100198996 Ga0070673_1001989962 324
318 3300005365 Ga0070688_100009741 Ga0070688_1000097412 324
319 3300005365 Ga0070688_100050604 Ga0070688_1000506044 324
320 3300005365 Ga0070688_100119577 Ga0070688_1001195771 324
321 3300005365 Ga0070688_100207598 Ga0070688_1002075981 324
322 3300005366 Ga0070659_100004064 Ga0070659_1000040645 324
323 3300005366 Ga0070659_100151161 Ga0070659_1001511612 324
324 3300005367 Ga0070667_100000151 Ga0070667_10000015110 324
325 3300005367 Ga0070667_100032757 Ga0070667_1000327572 324
326 3300005367 Ga0070667_100069703 Ga0070667_1000697033 324
327 3300005367 Ga0070667_100096463 Ga0070667_1000964632 324
328 3300005367 Ga0070667_100277595 Ga0070667_1002775952 324
329 3300005367 Ga0070667_100339554 Ga0070667_1003395542 324
330 3300005455 Ga0070663_100027279 Ga0070663_1000272792 324
331 3300005456 Ga0070678_100014996 Ga0070678_1000149962 324
332 3300005456 Ga0070678_100066015 Ga0070678_1000660152 324
333 3300005457 Ga0070662_100001152 Ga0070662_1000011527 324
334 3300005457 Ga0070662_100004539 Ga0070662_1000045398 324
335 3300005457 Ga0070662_100476107 Ga0070662_1004761071 324
336 3300005458 Ga0070681_10151863 Ga0070681_101518632 324
337 3300005459 Ga0068867_100001821 Ga0068867_1000018213 324
338 3300005459 Ga0068867_100013422 Ga0068867_1000134222 324
339 3300005459 Ga0068867_100221391 Ga0068867_1002213912 324
340 3300005466 Ga0070685_10024532 Ga0070685_100245321 324
341 3300005466 Ga0070685_10128415 Ga0070685_101284151 324
342 3300005471 Ga0070698_100000791 Ga0070698_10000079113 324
343 3300005471 Ga0070698_100004354 Ga0070698_1000043548 324
344 3300005530 Ga0070679_100007747 Ga0070679_1000077477 324
345 3300005535 Ga0070684_100001505 Ga0070684_1000015057 324
346 3300005535 Ga0070684_100002570 Ga0070684_10000257010 324
347 3300005539 Ga0068853_100027817 Ga0068853_1000278173 324
348 3300005539 Ga0068853_100050606 Ga0068853_1000506062 324
349 3300005539 Ga0068853_100095600 Ga0068853_1000956002 324
350 3300005539 Ga0068853_100101790 Ga0068853_1001017903 324
351 3300005543 Ga0070672_100000471 Ga0070672_10000047110 324
352 3300005543 Ga0070672_100008357 Ga0070672_1000083576 324
353 3300005543 Ga0070672_100383415 Ga0070672_1003834152 324
354 3300005544 Ga0070686_100103219 Ga0070686_1001032192 324
355 3300005547 Ga0070693_100016506 Ga0070693_1000165062 324
356 3300005548 Ga0070665_100000009 Ga0070665_100000009437 324
357 3300005548 Ga0070665_100001215 Ga0070665_10000121521 324
358 3300005548 Ga0070665_100078363 Ga0070665_1000783632 324
359 3300005563 Ga0068855_100031346 Ga0068855_1000313464 324
360 3300005563 Ga0068855_100121742 Ga0068855_1001217422 324
361 3300005564 Ga0070664_100015973 Ga0070664_1000159732 324
362 3300005564 Ga0070664_100060527 Ga0070664_1000605272 324
363 3300005564 Ga0070664_100087930 Ga0070664_1000879303 324
364 3300005577 Ga0068857_100014912 Ga0068857_1000149123 324
365 3300005577 Ga0068857_100043833 Ga0068857_1000438333 324
366 3300005577 Ga0068857_100085530 Ga0068857_1000855304 324
367 3300005577 Ga0068857_100345480 Ga0068857_1003454802 324
368 3300005578 Ga0068854_100035369 Ga0068854_1000353694 324
369 3300005578 Ga0068854_100054384 Ga0068854_1000543842 324
370 3300005578 Ga0068854_100120901 Ga0068854_1001209012 324
371 3300005614 Ga0068856_100017543 Ga0068856_1000175435 324
372 3300005614 Ga0068856_100021165 Ga0068856_1000211652 324
373 3300005616 Ga0068852_100006236 Ga0068852_1000062362 324
374 3300005616 Ga0068852_100016758 Ga0068852_1000167582 324
375 3300005616 Ga0068852_100018083 Ga0068852_1000180832 324
376 3300005616 Ga0068852_100040366 Ga0068852_1000403663 324
377 3300005616 Ga0068852_100050384 Ga0068852_1000503842 324
378 3300005616 Ga0068852_100076301 Ga0068852_1000763012 324
379 3300005616 Ga0068852_100149170 Ga0068852_1001491702 324
380 3300005617 Ga0068859_100000018 Ga0068859_100000018206 324
381 3300005617 Ga0068859_100000727 Ga0068859_1000007278 324
382 3300005617 Ga0068859_100082282 Ga0068859_1000822822 324
383 3300005617 Ga0068859_100094668 Ga0068859_1000946682 324
384 3300005617 Ga0068859_100103911 Ga0068859_1001039112 324
385 3300005617 Ga0068859_100171514 Ga0068859_1001715142 324
386 3300005617 Ga0068859_100285069 Ga0068859_1002850691 324
387 3300005618 Ga0068864_100001161 Ga0068864_1000011616 324
388 3300005618 Ga0068864_100003796 Ga0068864_1000037962 324
389 3300005618 Ga0068864_100009228 Ga0068864_1000092286 324
390 3300005618 Ga0068864_100033921 Ga0068864_1000339213 324
391 3300005618 Ga0068864_100117879 Ga0068864_1001178791 324
392 3300005618 Ga0068864_100154045 Ga0068864_1001540452 324
393 3300005718 Ga0068866_10011090 Ga0068866_100110903 324
394 3300005719 Ga0068861_100028014 Ga0068861_1000280143 324
395 3300005719 Ga0068861_100036108 Ga0068861_1000361084 324
396 3300005719 Ga0068861_100183267 Ga0068861_1001832672 324
397 3300005719 Ga0068861_100226540 Ga0068861_1002265402 324
398 3300005719 Ga0068861_100324462 Ga0068861_1003244622 324
399 3300005834 Ga0068851_10002501 Ga0068851_100025013 324
400 3300005834 Ga0068851_10022038 Ga0068851_100220382 324
401 3300005834 Ga0068851_10080575 Ga0068851_100805752 324
402 3300005841 Ga0068863_100001435 Ga0068863_10000143512 324
403 3300005841 Ga0068863_100027885 Ga0068863_1000278853 324
404 3300005841 Ga0068863_100039684 Ga0068863_1000396844 324
405 3300005841 Ga0068863_100046488 Ga0068863_1000464882 324
406 3300005841 Ga0068863_100064593 Ga0068863_1000645933 324
407 3300005841 Ga0068863_100433218 Ga0068863_1004332181 324
408 3300005842 Ga0068858_100001071 Ga0068858_10000107110 324
409 3300005842 Ga0068858_100010503 Ga0068858_1000105036 324
410 3300005842 Ga0068858_100139680 Ga0068858_1001396802 324
411 3300005843 Ga0068860_100000078 Ga0068860_100000078126 324
412 3300005843 Ga0068860_100000824 Ga0068860_10000082427 324
413 3300005843 Ga0068860_100009310 Ga0068860_1000093105 324
414 3300005843 Ga0068860_100025779 Ga0068860_1000257792 324
415 3300005843 Ga0068860_100033819 Ga0068860_1000338194 324
416 3300005843 Ga0068860_100233903 Ga0068860_1002339032 324
417 3300005843 Ga0068860_100282073 Ga0068860_1002820732 324
418 3300005843 Ga0068860_100371050 Ga0068860_1003710502 324
419 3300005844 Ga0068862_100085470 Ga0068862_1000854702 324
420 3300005844 Ga0068862_100140557 Ga0068862_1001405573 324
421 3300005985 Ga0081539_10030635 Ga0081539_100306352 324
422 3300006173 Ga0070716_100072149 Ga0070716_1000721492 324
423 3300006195 Ga0075366_10163842 Ga0075366_101638422 324
424 3300006237 Ga0097621_100001040 Ga0097621_1000010404 324
425 3300006237 Ga0097621_100001758 Ga0097621_1000017582 324
426 3300006237 Ga0097621_100004022 Ga0097621_1000040229 324
427 3300006237 Ga0097621_100014475 Ga0097621_1000144754 324
428 3300006237 Ga0097621_100053932 Ga0097621_1000539322 324
429 3300006237 Ga0097621_100067776 Ga0097621_1000677762 324
430 3300006237 Ga0097621_100298441 Ga0097621_1002984412 324
431 3300006237 Ga0097621_100401889 Ga0097621_1004018891 324
432 3300006237 Ga0097621_100454887 Ga0097621_1004548871 324
433 3300006358 Ga0068871_100003690 Ga0068871_1000036905 324
434 3300006358 Ga0068871_100009315 Ga0068871_1000093153 324
435 3300006358 Ga0068871_100010582 Ga0068871_1000105822 324
436 3300006358 Ga0068871_100023999 Ga0068871_1000239994 324
437 3300006358 Ga0068871_100046364 Ga0068871_1000463644 324
438 3300006358 Ga0068871_100050409 Ga0068871_1000504092 324
439 3300006358 Ga0068871_100353245 Ga0068871_1003532452 324
440 3300006844 Ga0075428_100027076 Ga0075428_1000270766 324
441 3300006844 Ga0075428_100099952 Ga0075428_1000999522 324
442 3300006846 Ga0075430_100018647 Ga0075430_1000186473 324
443 3300006871 Ga0075434_100082728 Ga0075434_1000827283 324
444 3300006880 Ga0075429_100012284 Ga0075429_1000122845 324
445 3300006880 Ga0075429_100027936 Ga0075429_1000279362 324
446 3300006881 Ga0068865_100003069 Ga0068865_1000030694 324
447 3300006881 Ga0068865_100006157 Ga0068865_1000061572 324
448 3300006881 Ga0068865_100112625 Ga0068865_1001126253 324
449 3300006931 Ga0097620_100000018 Ga0097620_100000018206 324
450 3300006931 Ga0097620_100000727 Ga0097620_1000007278 324
451 3300006931 Ga0097620_100082273 Ga0097620_1000822732 324
452 3300006931 Ga0097620_100094667 Ga0097620_1000946672 324
453 3300006931 Ga0097620_100103924 Ga0097620_1001039242 324
454 3300006931 Ga0097620_100171518 Ga0097620_1001715182 324
455 3300006931 Ga0097620_100285055 Ga0097620_1002850551 324
456 3300009093 Ga0105240_10001174 Ga0105240_1000117411 324
457 3300009093 Ga0105240_10006711 Ga0105240_100067112 324
458 3300009093 Ga0105240_10007959 Ga0105240_1000795912 324
459 3300009093 Ga0105240_10019358 Ga0105240_100193586 324
460 3300009093 Ga0105240_10026922 Ga0105240_100269222 324
461 3300009093 Ga0105240_10268206 Ga0105240_102682062 324
462 3300009093 Ga0105240_10403496 Ga0105240_104034962 324
463 3300009094 Ga0111539_10046265 Ga0111539_100462652 324
464 3300009094 Ga0111539_10456846 Ga0111539_104568462 324
465 3300009101 Ga0105247_10003256 Ga0105247_100032568 324
466 3300009101 Ga0105247_10025102 Ga0105247_100251022 324
467 3300009101 Ga0105247_10293309 Ga0105247_102933091 324
468 3300009147 Ga0114129_10019090 Ga0114129_100190904 324
469 3300009147 Ga0114129_10890866 Ga0114129_108908662 324
470 3300009148 Ga0105243_10035212 Ga0105243_100352122 324
471 3300009174 Ga0105241_10000113 Ga0105241_100001136 324
472 3300009174 Ga0105241_10008843 Ga0105241_100088434 324
473 3300009174 Ga0105241_10164893 Ga0105241_101648932 324
474 3300009174 Ga0105241_10461240 Ga0105241_104612401 324
475 3300009176 Ga0105242_10020045 Ga0105242_100200456 324
476 3300009176 Ga0105242_10036590 Ga0105242_100365903 324
477 3300009176 Ga0105242_10122863 Ga0105242_101228632 324
478 3300009176 Ga0105242_10263542 Ga0105242_102635422 324
479 3300009177 Ga0105248_10191674 Ga0105248_101916742 324
480 3300009177 Ga0105248_10252470 Ga0105248_102524701 324
481 3300009545 Ga0105237_10002621 Ga0105237_100026212 324
482 3300009545 Ga0105237_10013947 Ga0105237_100139475 324
483 3300009545 Ga0105237_10026452 Ga0105237_100264522 324
484 3300009545 Ga0105237_10249279 Ga0105237_102492791 324
485 3300009551 Ga0105238_10003534 Ga0105238_1000353413 324
486 3300009551 Ga0105238_10092377 Ga0105238_100923772 324
487 3300009551 Ga0105238_10329127 Ga0105238_103291271 324
488 3300009553 Ga0105249_10004065 Ga0105249_1000406510 324
489 3300009553 Ga0105249_10007291 Ga0105249_100072913 324
490 3300009553 Ga0105249_10008533 Ga0105249_100085337 324
491 3300009553 Ga0105249_10014840 Ga0105249_100148405 324
492 3300009553 Ga0105249_10032858 Ga0105249_100328584 324
493 3300009553 Ga0105249_10035500 Ga0105249_100355004 324
494 3300009553 Ga0105249_10041571 Ga0105249_100415714 324
495 3300009553 Ga0105249_10114077 Ga0105249_101140771 324
496 3300010375 Ga0105239_10045032 Ga0105239_100450322 324
497 3300010375 Ga0105239_10051853 Ga0105239_100518534 324
498 3300010375 Ga0105239_10061607 Ga0105239_100616073 324
499 3300010375 Ga0105239_10093791 Ga0105239_100937913 324
500 3300010375 Ga0105239_10210324 Ga0105239_102103242 324
501 3300010375 Ga0105239_10497852 Ga0105239_104978521 324
502 3300011119 Ga0105246_10023678 Ga0105246_100236783 324
503 3300011119 Ga0105246_10153082 Ga0105246_101530821 324
504 3300013100 Ga0157373_10016050 Ga0157373_100160504 324
505 3300013100 Ga0157373_10075484 Ga0157373_100754842 324
506 3300013102 Ga0157371_10001020 Ga0157371_1000102018 324
507 3300013102 Ga0157371_10005815 Ga0157371_100058156 324
508 3300013102 Ga0157371_10131355 Ga0157371_101313552 324
509 3300013104 Ga0157370_10010240 Ga0157370_100102407 324
510 3300013104 Ga0157370_10018009 Ga0157370_100180095 324
511 3300013104 Ga0157370_10055569 Ga0157370_100555692 324
512 3300013105 Ga0157369_10200311 Ga0157369_102003112 324
513 3300013296 Ga0157374_10000153 Ga0157374_1000015310 324
514 3300013296 Ga0157374_10001371 Ga0157374_1000137118 324
515 3300013296 Ga0157374_10013148 Ga0157374_100131486 324
516 3300013296 Ga0157374_10072440 Ga0157374_100724402 324
517 3300013296 Ga0157374_10077674 Ga0157374_100776743 324
518 3300013296 Ga0157374_10128472 Ga0157374_101284723 324
519 3300013297 Ga0157378_10010369 Ga0157378_100103694 324
520 3300013297 Ga0157378_10037481 Ga0157378_100374811 324
521 3300013297 Ga0157378_10041446 Ga0157378_100414462 324
522 3300013297 Ga0157378_10053851 Ga0157378_100538512 324
523 3300013297 Ga0157378_10054549 Ga0157378_100545494 324
524 3300013297 Ga0157378_10290790 Ga0157378_102907902 324
525 3300013297 Ga0157378_10443283 Ga0157378_104432832 324
526 3300013306 Ga0163162_10000040 Ga0163162_1000004082 324
527 3300013306 Ga0163162_10002762 Ga0163162_1000276213 324
528 3300013306 Ga0163162_10003821 Ga0163162_100038212 324
529 3300013306 Ga0163162_10004842 Ga0163162_100048422 324
530 3300013306 Ga0163162_10005595 Ga0163162_100055956 324
531 3300013306 Ga0163162_10013858 Ga0163162_100138586 324
532 3300013306 Ga0163162_10022133 Ga0163162_100221332 324
533 3300013306 Ga0163162_10031458 Ga0163162_100314583 324
534 3300013306 Ga0163162_10156466 Ga0163162_101564661 324
535 3300013306 Ga0163162_10471123 Ga0163162_104711231 324
536 3300013306 Ga0163162_10569159 Ga0163162_105691591 324
537 3300013307 Ga0157372_10012319 Ga0157372_100123199 324
538 3300013307 Ga0157372_10022707 Ga0157372_100227072 324
539 3300013307 Ga0157372_10198923 Ga0157372_101989232 324
540 3300013308 Ga0157375_10000407 Ga0157375_1000040730 324
541 3300013308 Ga0157375_10008093 Ga0157375_100080932 324
542 3300013308 Ga0157375_10040651 Ga0157375_100406513 324
543 3300013308 Ga0157375_10075732 Ga0157375_100757322 324
544 3300013308 Ga0157375_10144651 Ga0157375_101446511 324
545 3300013308 Ga0157375_10201662 Ga0157375_102016622 324
546 3300013308 Ga0157375_10332425 Ga0157375_103324253 324
547 3300014325 Ga0163163_10000110 Ga0163163_1000011061 324
548 3300014325 Ga0163163_10000348 Ga0163163_1000034839 324
549 3300014325 Ga0163163_10133369 Ga0163163_101333692 324
550 3300014325 Ga0163163_10143490 Ga0163163_101434902 324
551 3300014325 Ga0163163_10213492 Ga0163163_102134921 324
552 3300014326 Ga0157380_10002726 Ga0157380_100027265 324
553 3300014326 Ga0157380_10311836 Ga0157380_103118361 324
554 3300014745 Ga0157377_10039277 Ga0157377_100392772 324
555 3300014968 Ga0157379_10000173 Ga0157379_1000017321 324
556 3300014968 Ga0157379_10077186 Ga0157379_100771862 324
557 3300014968 Ga0157379_10087882 Ga0157379_100878825 324
558 3300014968 Ga0157379_10093184 Ga0157379_100931842 324
559 3300014968 Ga0157379_10111555 Ga0157379_101115553 324
560 3300014969 Ga0157376_10000535 Ga0157376_1000053513 324
561 3300014969 Ga0157376_10012851 Ga0157376_100128516 324
562 3300014969 Ga0157376_10084200 Ga0157376_100842002 324
563 3300014969 Ga0157376_10098191 Ga0157376_100981913 324
564 3300014969 Ga0157376_10115140 Ga0157376_101151402 324
565 3300017792 Ga0163161_10118364 Ga0163161_101183641 324
566 3300025321 Ga0207656_10009239 Ga0207656_100092392 324
567 3300025893 Ga0207682_10089980 Ga0207682_100899801 324
568 3300025899 Ga0207642_10067256 Ga0207642_100672562 324
569 3300025900 Ga0207710_10017415 Ga0207710_100174152 324
570 3300025900 Ga0207710_10040315 Ga0207710_100403152 324
571 3300025901 Ga0207688_10009307 Ga0207688_100093073 324
572 3300025903 Ga0207680_10000026 Ga0207680_1000002649 324
573 3300025903 Ga0207680_10001727 Ga0207680_100017275 324
574 3300025903 Ga0207680_10022854 Ga0207680_100228541 324
575 3300025903 Ga0207680_10025926 Ga0207680_100259262 324
576 3300025903 Ga0207680_10135397 Ga0207680_101353971 324
577 3300025903 Ga0207680_10176991 Ga0207680_101769912 324
578 3300025904 Ga0207647_10000587 Ga0207647_1000058714 324
579 3300025907 Ga0207645_10000572 Ga0207645_1000057216 324
580 3300025907 Ga0207645_10005197 Ga0207645_100051977 324
581 3300025907 Ga0207645_10015652 Ga0207645_100156525 324
582 3300025907 Ga0207645_10021767 Ga0207645_100217673 324
583 3300025908 Ga0207643_10023881 Ga0207643_100238812 324
584 3300025909 Ga0207705_10003028 Ga0207705_100030284 324
585 3300025911 Ga0207654_10007258 Ga0207654_100072584 324
586 3300025912 Ga0207707_10000189 Ga0207707_1000018960 324
587 3300025913 Ga0207695_10000585 Ga0207695_1000058548 324
588 3300025913 Ga0207695_10005428 Ga0207695_1000542811 324
589 3300025913 Ga0207695_10031168 Ga0207695_100311685 324
590 3300025913 Ga0207695_10091861 Ga0207695_100918613 324
591 3300025913 Ga0207695_10134827 Ga0207695_101348272 324
592 3300025913 Ga0207695_10174755 Ga0207695_101747552 324
593 3300025913 Ga0207695_10195644 Ga0207695_101956442 324
594 3300025914 Ga0207671_10000992 Ga0207671_100009928 324
595 3300025914 Ga0207671_10001520 Ga0207671_1000152029 324
596 3300025914 Ga0207671_10001809 Ga0207671_1000180911 324
597 3300025914 Ga0207671_10021058 Ga0207671_100210582 324
598 3300025917 Ga0207660_10001432 Ga0207660_100014322 324
599 3300025918 Ga0207662_10063665 Ga0207662_100636651 324
600 3300025919 Ga0207657_10112893 Ga0207657_101128932 324
601 3300025920 Ga0207649_10005596 Ga0207649_100055963 324
602 3300025920 Ga0207649_10054113 Ga0207649_100541133 324
603 3300025921 Ga0207652_10000488 Ga0207652_100004882 324
604 3300025923 Ga0207681_10085278 Ga0207681_100852782 324
605 3300025923 Ga0207681_10102423 Ga0207681_101024232 324
606 3300025924 Ga0207694_10008276 Ga0207694_100082765 324
607 3300025924 Ga0207694_10119132 Ga0207694_101191322 324
608 3300025925 Ga0207650_10006072 Ga0207650_100060727 324
609 3300025925 Ga0207650_10060159 Ga0207650_100601592 324
610 3300025925 Ga0207650_10105680 Ga0207650_101056802 324
611 3300025925 Ga0207650_10116575 Ga0207650_101165752 324
612 3300025926 Ga0207659_10046878 Ga0207659_100468782 324
613 3300025926 Ga0207659_10048335 Ga0207659_100483352 324
614 3300025926 Ga0207659_10124792 Ga0207659_101247921 324
615 3300025927 Ga0207687_10223876 Ga0207687_102238762 324
616 3300025931 Ga0207644_10053396 Ga0207644_100533962 324
617 3300025931 Ga0207644_10054700 Ga0207644_100547003 324
618 3300025931 Ga0207644_10292459 Ga0207644_102924592 324
619 3300025932 Ga0207690_10125103 Ga0207690_101251031 324
620 3300025932 Ga0207690_10382478 Ga0207690_103824781 324
621 3300025933 Ga0207706_10002485 Ga0207706_1000248511 324
622 3300025933 Ga0207706_10024766 Ga0207706_100247662 324
623 3300025933 Ga0207706_10074429 Ga0207706_100744292 324
624 3300025933 Ga0207706_10090741 Ga0207706_100907412 324
625 3300025934 Ga0207686_10030443 Ga0207686_100304432 324
626 3300025934 Ga0207686_10034541 Ga0207686_100345413 324
627 3300025934 Ga0207686_10095714 Ga0207686_100957142 324
628 3300025934 Ga0207686_10141565 Ga0207686_101415651 324
629 3300025936 Ga0207670_10048036 Ga0207670_100480362 324
630 3300025936 Ga0207670_10109958 Ga0207670_101099581 324
631 3300025936 Ga0207670_10158458 Ga0207670_101584583 324
632 3300025937 Ga0207669_10029323 Ga0207669_100293233 324
633 3300025937 Ga0207669_10278024 Ga0207669_102780241 324
634 3300025938 Ga0207704_10001601 Ga0207704_100016016 324
635 3300025938 Ga0207704_10077829 Ga0207704_100778292 324
636 3300025938 Ga0207704_10174349 Ga0207704_101743492 324
637 3300025938 Ga0207704_10322697 Ga0207704_103226972 324
638 3300025940 Ga0207691_10000504 Ga0207691_1000050415 324
639 3300025940 Ga0207691_10003556 Ga0207691_1000355613 324
640 3300025940 Ga0207691_10076260 Ga0207691_100762601 324
641 3300025940 Ga0207691_10089022 Ga0207691_100890222 324
642 3300025940 Ga0207691_10111096 Ga0207691_101110962 324
643 3300025941 Ga0207711_10120925 Ga0207711_101209252 324
644 3300025941 Ga0207711_10394646 Ga0207711_103946461 324
645 3300025942 Ga0207689_10001176 Ga0207689_100011768 324
646 3300025942 Ga0207689_10009612 Ga0207689_100096128 324
647 3300025942 Ga0207689_10014847 Ga0207689_100148474 324
648 3300025942 Ga0207689_10019979 Ga0207689_100199793 324
649 3300025942 Ga0207689_10020131 Ga0207689_100201312 324
650 3300025942 Ga0207689_10029042 Ga0207689_100290422 324
651 3300025942 Ga0207689_10033265 Ga0207689_100332653 324
652 3300025942 Ga0207689_10072098 Ga0207689_100720982 324
653 3300025944 Ga0207661_10000840 Ga0207661_1000084014 324
654 3300025944 Ga0207661_10010476 Ga0207661_100104766 324
655 3300025944 Ga0207661_10018872 Ga0207661_100188723 324
656 3300025945 Ga0207679_10008617 Ga0207679_100086174 324
657 3300025945 Ga0207679_10008706 Ga0207679_100087066 324
658 3300025945 Ga0207679_10078429 Ga0207679_100784292 324
659 3300025949 Ga0207667_10000275 Ga0207667_1000027555 324
660 3300025949 Ga0207667_10074372 Ga0207667_100743724 324
661 3300025949 Ga0207667_10107057 Ga0207667_101070572 324
662 3300025960 Ga0207651_10000164 Ga0207651_1000016421 324
663 3300025961 Ga0207712_10002266 Ga0207712_100022668 324
664 3300025961 Ga0207712_10003837 Ga0207712_100038372 324
665 3300025961 Ga0207712_10009791 Ga0207712_100097916 324
666 3300025961 Ga0207712_10011308 Ga0207712_100113082 324
667 3300025961 Ga0207712_10170095 Ga0207712_101700952 324
668 3300025972 Ga0207668_10000568 Ga0207668_1000056810 324
669 3300025972 Ga0207668_10005433 Ga0207668_100054335 324
670 3300025972 Ga0207668_10262122 Ga0207668_102621222 324
671 3300025981 Ga0207640_10008552 Ga0207640_100085523 324
672 3300025981 Ga0207640_10027730 Ga0207640_100277304 324
673 3300025986 Ga0207658_10000225 Ga0207658_1000022549 324
674 3300025986 Ga0207658_10018882 Ga0207658_100188823 324
675 3300025986 Ga0207658_10102971 Ga0207658_101029712 324
676 3300025986 Ga0207658_10114310 Ga0207658_101143102 324
677 3300025986 Ga0207658_10433626 Ga0207658_104336262 324
678 3300026023 Ga0207677_10004033 Ga0207677_100040334 324
679 3300026023 Ga0207677_10020431 Ga0207677_100204314 324
680 3300026035 Ga0207703_10001012 Ga0207703_1000101218 324
681 3300026035 Ga0207703_10004551 Ga0207703_1000455110 324
682 3300026035 Ga0207703_10078745 Ga0207703_100787451 324
683 3300026041 Ga0207639_10011129 Ga0207639_100111292 324
684 3300026041 Ga0207639_10016999 Ga0207639_100169992 324
685 3300026041 Ga0207639_10019305 Ga0207639_100193053 324
686 3300026041 Ga0207639_10030049 Ga0207639_100300492 324
687 3300026041 Ga0207639_10035531 Ga0207639_100355311 324
688 3300026067 Ga0207678_10073535 Ga0207678_100735352 324
689 3300026078 Ga0207702_10048289 Ga0207702_100482893 324
690 3300026088 Ga0207641_10000167 Ga0207641_1000016758 324
691 3300026088 Ga0207641_10006442 Ga0207641_100064425 324
692 3300026088 Ga0207641_10025224 Ga0207641_100252241 324
693 3300026088 Ga0207641_10215578 Ga0207641_102155782 324
694 3300026088 Ga0207641_10223475 Ga0207641_102234752 324
695 3300026089 Ga0207648_10000560 Ga0207648_100005602 324
696 3300026089 Ga0207648_10001895 Ga0207648_100018953 324
697 3300026089 Ga0207648_10013539 Ga0207648_100135394 324
698 3300026089 Ga0207648_10025240 Ga0207648_100252403 324
699 3300026089 Ga0207648_10084464 Ga0207648_100844643 324
700 3300026089 Ga0207648_10153901 Ga0207648_101539012 324
701 3300026095 Ga0207676_10000992 Ga0207676_1000099213 324
702 3300026095 Ga0207676_10105191 Ga0207676_101051911 324
703 3300026095 Ga0207676_10108328 Ga0207676_101083282 324
704 3300026095 Ga0207676_10517281 Ga0207676_105172811 324
705 3300026116 Ga0207674_10024690 Ga0207674_100246908 324
706 3300026116 Ga0207674_10127552 Ga0207674_101275522 324
707 3300026116 Ga0207674_10144646 Ga0207674_101446462 324
708 3300026116 Ga0207674_10150557 Ga0207674_101505573 324
709 3300026118 Ga0207675_100053199 Ga0207675_1000531992 324
710 3300026118 Ga0207675_100074576 Ga0207675_1000745763 324
711 3300026118 Ga0207675_100134723 Ga0207675_1001347232 324
712 3300026118 Ga0207675_100194001 Ga0207675_1001940011 324
713 3300026121 Ga0207683_10001675 Ga0207683_100016759 324
714 3300026121 Ga0207683_10042151 Ga0207683_100421513 324
715 3300026121 Ga0207683_10211932 Ga0207683_102119322 324
716 3300026142 Ga0207698_10011377 Ga0207698_100113774 324
717 3300026142 Ga0207698_10039833 Ga0207698_100398332 324
718 3300026142 Ga0207698_10064058 Ga0207698_100640583 324
719 3300026142 Ga0207698_10192049 Ga0207698_101920491 324
720 3300028379 Ga0268266_10000014 Ga0268266_10000014235 324
721 3300028379 Ga0268266_10001023 Ga0268266_1000102324 324
722 3300028379 Ga0268266_10127702 Ga0268266_101277022 324
723 3300028380 Ga0268265_10108869 Ga0268265_101088692 324
724 3300028380 Ga0268265_10316489 Ga0268265_103164892 324
725 3300028381 Ga0268264_10000105 Ga0268264_1000010557 324
726 3300028381 Ga0268264_10001646 Ga0268264_1000164610 324
727 3300028381 Ga0268264_10024621 Ga0268264_100246214 324
728 3300028381 Ga0268264_10032257 Ga0268264_100322572 324
729 3300028786 Ga0307517_10016657 Ga0307517_100166575 324
730 3300028794 Ga0307515_10001274 Ga0307515_1000127450 324
731 3300030521 Ga0307511_10000579 Ga0307511_1000057911 324
732 3300031456 Ga0307513_10012204 Ga0307513_100122043 324
733 3300031456 Ga0307513_10141289 Ga0307513_101412892 324
734 3300031507 Ga0307509_10045786 Ga0307509_100457862 324
735 3300031507 Ga0307509_10174833 Ga0307509_101748331 324
736 3300031507 Ga0307509_10292170 Ga0307509_102921702 324
737 3300031616 Ga0307508_10002565 Ga0307508_100025657 324
738 3300031730 Ga0307516_10004180 Ga0307516_100041808 324
739 3300031852 Ga0307410_10020334 Ga0307410_100203341 324
740 3300031995 Ga0307409_100009385 Ga0307409_1000093852 324
741 3300032002 Ga0307416_100069838 Ga0307416_1000698382 324
742 3300032126 Ga0307415_100001047 Ga0307415_1000010474 324
743 3300035170 Ga0373943_0140224 Ga0373943_0140224_173_1156 324
744 3300035695 Ga0373927_0049219 Ga0373927_0049219_1208_2191 324
745 3300035724 Ga0373933_0051362 Ga0373933_0051362_1452_2444 324
746 3300036401 Ga0373937_0004801 Ga0373937_0004801_290_1282 324
747 3300036401 Ga0373937_0169918 Ga0373937_0169918_964_1947 324
748 3300037068 Ga0373925_0455590 Ga0373925_0455590_30_1022 324
749 3300037471 Ga0395905_0053611 Ga0395905_0053611_2288_3271 324
750 3300039437 Ga0436365_1019786 Ga0436365_1019786_995_1981 324
751 3300041404 Ga0439436_0010189 Ga0439436_0010189_1129_2112 324
752 3300041406 Ga0439439_0009348 Ga0439439_0009348_944_1927 324
753 3300042014 Ga0439457_000399 Ga0439457_000399_10660_11643 324
754 3300042015 Ga0439462_0010507 Ga0439462_0010507_802_1785 324
755 3300042876 Ga0451577_0009739 Ga0451577_0009739_128_1114 324
756 3300044656 Ga0466969_0000293 Ga0466969_0000293_3981_4964 324
757 3300044658 Ga0466972_0000014 Ga0466972_0000014_47026_48009 324
758 3300044658 Ga0466972_0000250 Ga0466972_0000250_17951_18934 324
759 3300044658 Ga0466972_0000477 Ga0466972_0000477_12527_13510 324
760 3300044684 Ga0466966_0000028 Ga0466966_0000028_10866_11849 324
761 3300044712 Ga0453684_0191394 Ga0453684_0191394_937_1929 324
762 3300044712 Ga0453684_0205116 Ga0453684_0205116_456_1439 324
763 3300044735 Ga0466968_0008930 Ga0466968_0008930_76_1059 324
764 3300044735 Ga0466968_0023147 Ga0466968_0023147_966_1949 324
765 3300044765 Ga0466970_0001468 Ga0466970_0001468_5556_6539 324
766 3300044842 Ga0466957_0000123 Ga0466957_0000123_15834_16817 324
767 3300045049 Ga0466959_0000039 Ga0466959_0000039_21163_22146 324
768 3300045049 Ga0466959_0035662 Ga0466959_0035662_1985_2968 324
769 3300046462 Ga0495651_0123422 Ga0495651_0123422_448_1431 324
770 3300046477 Ga0495664_0061219 Ga0495664_0061219_954_1946 324
771 3300046517 Ga0495630_0150442 Ga0495630_0150442_41_1024 324
772 3300046517 Ga0495630_0180336 Ga0495630_0180336_15_998 324
773 3300046524 Ga0495648_0008977 Ga0495648_0008977_6359_7342 324
774 3300046543 Ga0495645_0228718 Ga0495645_0228718_252_1235 324
775 3300046616 Ga0495668_0001408 Ga0495668_0001408_20757_21740 324
776 3300046616 Ga0495668_0001611 Ga0495668_0001611_19438_20421 324
777 3300046642 Ga0495634_0012523 Ga0495634_0012523_4163_5155 324
778 3300046660 Ga0495625_0094619 Ga0495625_0094619_494_1483 324
779 3300046675 Ga0495657_0068433 Ga0495657_0068433_902_1885 324
780 3300046679 Ga0495623_0092939 Ga0495623_0092939_570_1553 324
781 3300046691 Ga0495670_0125775 Ga0495670_0125775_190_1173 324
782 3300047317 Ga0495604_0087987 Ga0495604_0087987_701_1693 324
783 3300047320 Ga0495672_0026023 Ga0495672_0026023_2306_3289 324
784 3300047320 Ga0495672_0065375 Ga0495672_0065375_380_1363 324
785 3300047320 Ga0495672_0081734 Ga0495672_0081734_794_1777 324
786 3300047443 Ga0495687_000056 Ga0495687_000056_39128_40111 324
787 3300047471 Ga0495684_0249530 Ga0495684_0249530_70_1062 324
788 3300047472 Ga0495686_0130542 Ga0495686_0130542_144_1127 324
789 3300048911 Ga0496108_0211119 Ga0496108_0211119_303_1286 324
790 3300048918 Ga0496115_0292143 Ga0496115_0292143_284_1267 324
791 3300048927 Ga0496124_0044005 Ga0496124_0044005_2419_3402 324
792 3300049568 Ga0501031_0073046 Ga0501031_0073046_754_1737 324
793 3300049569 Ga0501032_0057079 Ga0501032_0057079_630_1613 324
794 3300049571 Ga0501034_0020326 Ga0501034_0020326_4637_5623 324
795 3300049571 Ga0501034_0023760 Ga0501034_0023760_1984_2967 324
796 3300049571 Ga0501034_0058351 Ga0501034_0058351_418_1404 324
797 3300049571 Ga0501034_0327662 Ga0501034_0327662_38_1024 324
798 3300049571 Ga0501034_0400905 Ga0501034_0400905_96_1079 324
799 3300049571 Ga0501034_0414027 Ga0501034_0414027_28_1014 324
800 3300049571 Ga0501034_0500007 Ga0501034_0500007_36_1019 324
801 3300049572 Ga0501036_0008626 Ga0501036_0008626_849_1832 324
802 3300049572 Ga0501036_0089161 Ga0501036_0089161_1126_2109 324
803 3300049573 Ga0501037_0036199 Ga0501037_0036199_494_1477 324
804 3300049573 Ga0501037_0128887 Ga0501037_0128887_754_1737 324
805 3300049573 Ga0501037_0129521 Ga0501037_0129521_472_1455 324
806 3300049573 Ga0501037_0321285 Ga0501037_0321285_37_1023 324
807 3300049574 Ga0501038_0036362 Ga0501038_0036362_2025_3008 324
808 3300049574 Ga0501038_0072889 Ga0501038_0072889_1703_2686 324
809 3300049574 Ga0501038_0191304 Ga0501038_0191304_386_1369 324
810 3300049575 Ga0501039_0144315 Ga0501039_0144315_308_1291 324
811 3300049579 Ga0501043_0025312 Ga0501043_0025312_2566_3549 324
812 3300049579 Ga0501043_0033904 Ga0501043_0033904_2296_3279 324
813 3300049579 Ga0501043_0128951 Ga0501043_0128951_10_993 324
814 3300049579 Ga0501043_0145079 Ga0501043_0145079_704_1690 324
815 3300049579 Ga0501043_0161440 Ga0501043_0161440_33_1016 324
816 3300049579 Ga0501043_0211997 Ga0501043_0211997_339_1322 324
817 3300049580 Ga0501046_0007138 Ga0501046_0007138_7749_8732 324
818 3300049580 Ga0501046_0109050 Ga0501046_0109050_153_1136 324
819 3300049581 Ga0501047_0008441 Ga0501047_0008441_2190_3173 324
820 3300049581 Ga0501047_0023465 Ga0501047_0023465_1265_2248 324
821 3300049581 Ga0501047_0118369 Ga0501047_0118369_481_1464 324
822 3300049581 Ga0501047_0170001 Ga0501047_0170001_291_1274 324
823 3300049581 Ga0501047_0270173 Ga0501047_0270173_247_1233 324
824 3300049581 Ga0501047_0322644 Ga0501047_0322644_337_1320 324
825 3300049582 Ga0501048_0053337 Ga0501048_0053337_1396_2379 324
826 3300049583 Ga0501067_0031941 Ga0501067_0031941_280_1263 324
827 3300049584 Ga0501068_0050600 Ga0501068_0050600_278_1261 324
828 3300049584 Ga0501068_0282282 Ga0501068_0282282_18_1001 324
829 3300049585 Ga0501069_0060217 Ga0501069_0060217_154_1137 324
830 3300049586 Ga0501070_0162072 Ga0501070_0162072_563_1546 324
831 3300049589 Ga0501073_0205126 Ga0501073_0205126_138_1121 324
832 3300049590 Ga0501074_0034682 Ga0501074_0034682_1402_2385 324
833 3300049590 Ga0501074_0160719 Ga0501074_0160719_484_1467 324
834 3300049652 Ga0501202_000556 Ga0501202_000556_4157_5140 324
835 3300049661 Ga0501217_007182 Ga0501217_007182_1049_2032 324
836 3300049665 Ga0501227_014783 Ga0501227_014783_381_1364 324
837 3300049674 Ga0501242_002083 Ga0501242_002083_1073_2056 324
838 3300049683 Ga0501253_026702 Ga0501253_026702_62_1045 324
839 3300049686 Ga0501257_001076 Ga0501257_001076_1286_2269 324
840 3300049688 Ga0501259_000915 Ga0501259_000915_1620_2603 324
841 3300049705 Ga0501225_0002223 Ga0501225_0002223_446_1429 324
842 3300049705 Ga0501225_0031215 Ga0501225_0031215_34_1017 324
843 3300049741 Ga0501079_0079388 Ga0501079_0079388_638_1621 324
844 3300049742 Ga0501080_0116817 Ga0501080_0116817_184_1167 324
845 3300049742 Ga0501080_0265447 Ga0501080_0265447_311_1294 324
846 3300049744 Ga0501083_0022448 Ga0501083_0022448_2599_3582 324
847 3300049744 Ga0501083_0073596 Ga0501083_0073596_981_1964 324
848 3300049765 Ga0501268_005545 Ga0501268_005545_797_1780 324
849 3300049776 Ga0501280_015129 Ga0501280_015129_55_1038 324
850 3300049779 Ga0501283_015883 Ga0501283_015883_115_1098 324
851 3300049822 Ga0501035_0105981 Ga0501035_0105981_763_1746 324
852 3300049822 Ga0501035_0145956 Ga0501035_0145956_211_1194 324
853 3300049822 Ga0501035_0417977 Ga0501035_0417977_80_1066 324
854 3300049823 Ga0501044_0002352 Ga0501044_0002352_11291_12274 324
855 3300049823 Ga0501044_0011986 Ga0501044_0011986_2212_3198 324
856 3300049823 Ga0501044_0025772 Ga0501044_0025772_2130_3113 324
857 3300049823 Ga0501044_0167070 Ga0501044_0167070_900_1883 324
858 3300049823 Ga0501044_0176022 Ga0501044_0176022_925_1911 324
859 3300049823 Ga0501044_0195803 Ga0501044_0195803_335_1318 324
860 3300050005 Ga0501284_00011 Ga0501284_00011_52991_53974 324
861 3300050493 nmdc:mga0k408_139188_c1 nmdc:mga0k408_139188_c1_89_1072 324
862 3300050493 nmdc:mga0k408_5876_c1 nmdc:mga0k408_5876_c1_3567_4550 324
863 3300050493 nmdc:mga0k408_87688_c1 nmdc:mga0k408_87688_c1_307_1290 324
864 3300050507 nmdc:mga05p37_504936_c1 nmdc:mga05p37_504936_c1_358_1341 324
865 3300050507 nmdc:mga05p37_5549_c1 nmdc:mga05p37_5549_c1_6956_7939 324
866 3300050508 nmdc:mga09592_12657_c1 nmdc:mga09592_12657_c1_3847_4830 324
867 3300050508 nmdc:mga09592_2970_c1 nmdc:mga09592_2970_c1_1194_2177 324
868 3300050508 nmdc:mga09592_37657_c1 nmdc:mga09592_37657_c1_1025_2008 324
869 3300050509 nmdc:mga0qj67_21010_c1 nmdc:mga0qj67_21010_c1_1749_2732 324
870 3300050510 nmdc:mga06r32_62752_c1 nmdc:mga06r32_62752_c1_1347_2330 324
871 3300053086 Ga0500578_0000027 Ga0500578_0000027_44248_45231 324
872 3300053090 Ga0500646_0000241 Ga0500646_0000241_8061_9047 324
873 3300053090 Ga0500646_0026088 Ga0500646_0026088_268_1251 324
874 3300053092 Ga0500583_0000042 Ga0500583_0000042_58929_59912 324
875 3300053092 Ga0500583_0000651 Ga0500583_0000651_4933_5916 324
876 3300053092 Ga0500583_0003160 Ga0500583_0003160_1779_2762 324
877 3300053108 Ga0500562_000004 Ga0500562_000004_262729_263712 324
878 3300053111 Ga0500572_006582 Ga0500572_006582_1358_2341 324
879 3300053118 Ga0500594_0015123 Ga0500594_0015123_400_1389 324
880 3300053130 Ga0500642_0056099 Ga0500642_0056099_489_1472 324
881 3300053139 Ga0500568_0000407 Ga0500568_0000407_25103_26086 324
882 3300053139 Ga0500568_0039687 Ga0500568_0039687_551_1534 324
883 3300053153 Ga0500616_0036566 Ga0500616_0036566_1287_2270 324
884 3300053156 Ga0500622_0002745 Ga0500622_0002745_10783_11766 324
885 3300053156 Ga0500622_0004729 Ga0500622_0004729_441_1424 324
886 3300053163 Ga0500639_079843 Ga0500639_079843_188_1171 324
887 3300053177 Ga0500636_0071028 Ga0500636_0071028_30_1013 324
888 3300053727 Ga0500611_000007 Ga0500611_000007_62338_63321 324
889 3300053727 Ga0500611_009690 Ga0500611_009690_389_1372 324
890 3300053730 Ga0500645_008755 Ga0500645_008755_445_1428 324
891 3300060353 Ga0501082_0235193 Ga0501082_0235193_372_1355 324
892 3300005290 Ga0065712_10145434 Ga0065712_101454341 325
893 3300005331 Ga0070670_100026443 Ga0070670_1000264433 325
894 3300005340 Ga0070689_100111827 Ga0070689_1001118272 325
895 3300005364 Ga0070673_100002842 Ga0070673_1000028426 325
896 3300005459 Ga0068867_100092819 Ga0068867_1000928191 325
897 3300005617 Ga0068859_100317606 Ga0068859_1003176062 325
898 3300006931 Ga0097620_100317619 Ga0097620_1003176192 325
899 3300014326 Ga0157380_10331890 Ga0157380_103318902 325
900 3300025940 Ga0207691_10070087 Ga0207691_100700871 325
901 3300025960 Ga0207651_10015652 Ga0207651_100156521 325
902 3300026089 Ga0207648_10109922 Ga0207648_101099222 325
903 3300027907 Ga0207428_10128535 Ga0207428_101285352 325
904 3300032004 Ga0307414_10422156 Ga0307414_104221561 325
905 3300041406 Ga0439439_0006295 Ga0439439_0006295_83_1069 325
906 3300042007 Ga0439449_0016056 Ga0439449_0016056_1522_2508 325
907 3300042014 Ga0439457_006263 Ga0439457_006263_409_1395 325
908 3300042435 Ga0439434_0020825 Ga0439434_0020825_580_1566 325
909 3300046522 Ga0495643_0032341 Ga0495643_0032341_1318_2304 325
910 3300001979 JGI24740J21852_10009205 JGI24740J21852_100092052 327
911 3300003203 JGI25406J46586_10000498 JGI25406J46586_1000049818 327
912 3300005330 Ga0070690_100036931 Ga0070690_1000369313 327
913 3300005337 Ga0070682_100012658 Ga0070682_1000126583 327
914 3300005339 Ga0070660_100015549 Ga0070660_1000155492 327
915 3300005344 Ga0070661_100059221 Ga0070661_1000592212 327
916 3300005353 Ga0070669_100114442 Ga0070669_1001144422 327
917 3300005355 Ga0070671_100144767 Ga0070671_1001447673 327
918 3300005366 Ga0070659_100010005 Ga0070659_1000100053 327
919 3300005456 Ga0070678_100101191 Ga0070678_1001011911 327
920 3300005458 Ga0070681_10044426 Ga0070681_100444263 327
921 3300005530 Ga0070679_100090552 Ga0070679_1000905521 327
922 3300005530 Ga0070679_100198827 Ga0070679_1001988271 327
923 3300005535 Ga0070684_100037366 Ga0070684_1000373662 327
924 3300005539 Ga0068853_100014362 Ga0068853_1000143624 327
925 3300005563 Ga0068855_100057463 Ga0068855_1000574633 327
926 3300005564 Ga0070664_100037086 Ga0070664_1000370864 327
927 3300005577 Ga0068857_100127787 Ga0068857_1001277872 327
928 3300005577 Ga0068857_100344965 Ga0068857_1003449651 327
929 3300005578 Ga0068854_100029484 Ga0068854_1000294842 327
930 3300005578 Ga0068854_100111978 Ga0068854_1001119782 327
931 3300005614 Ga0068856_100047298 Ga0068856_1000472983 327
932 3300005616 Ga0068852_100023882 Ga0068852_1000238823 327
933 3300005618 Ga0068864_100191887 Ga0068864_1001918872 327
934 3300005985 Ga0081539_10000708 Ga0081539_1000070855 327
935 3300006358 Ga0068871_100018752 Ga0068871_1000187524 327
936 3300009174 Ga0105241_10071809 Ga0105241_100718093 327
937 3300009545 Ga0105237_10036714 Ga0105237_100367144 327
938 3300010375 Ga0105239_10030291 Ga0105239_100302912 327
939 3300013102 Ga0157371_10012819 Ga0157371_100128193 327
940 3300013104 Ga0157370_10027963 Ga0157370_100279632 327
941 3300013105 Ga0157369_10056706 Ga0157369_100567062 327
942 3300013296 Ga0157374_10010315 Ga0157374_100103153 327
943 3300013296 Ga0157374_10318431 Ga0157374_103184312 327
944 3300013297 Ga0157378_10014239 Ga0157378_100142393 327
945 3300013297 Ga0157378_10074360 Ga0157378_100743602 327
946 3300013306 Ga0163162_10505387 Ga0163162_105053872 327
947 3300013307 Ga0157372_10020346 Ga0157372_100203463 327
948 3300013307 Ga0157372_10045221 Ga0157372_100452214 327
949 3300013307 Ga0157372_10120605 Ga0157372_101206052 327
950 3300013307 Ga0157372_10127941 Ga0157372_101279412 327
951 3300013308 Ga0157375_10515220 Ga0157375_105152201 327
952 3300014745 Ga0157377_10011172 Ga0157377_100111721 327
953 3300021384 Ga0213876_10020918 Ga0213876_100209182 327
954 3300021384 Ga0213876_10099424 Ga0213876_100994241 327
955 3300025302 Ga0207426_1000009 Ga0207426_1000009332 327
956 3300025921 Ga0207652_10037509 Ga0207652_100375093 327
957 3300025925 Ga0207650_10082891 Ga0207650_100828912 327
958 3300025925 Ga0207650_10365991 Ga0207650_103659911 327
959 3300025932 Ga0207690_10168805 Ga0207690_101688052 327
960 3300025933 Ga0207706_10005175 Ga0207706_100051753 327
961 3300025944 Ga0207661_10096723 Ga0207661_100967232 327
962 3300025949 Ga0207667_10095656 Ga0207667_100956562 327
963 3300025981 Ga0207640_10010668 Ga0207640_100106683 327
964 3300026023 Ga0207677_10243069 Ga0207677_102430691 327
965 3300026067 Ga0207678_10077023 Ga0207678_100770232 327
966 3300026078 Ga0207702_10097371 Ga0207702_100973712 327
967 3300026095 Ga0207676_10334902 Ga0207676_103349021 327
968 3300026116 Ga0207674_10057085 Ga0207674_100570852 327
969 3300026116 Ga0207674_10091138 Ga0207674_100911383 327
970 3300028379 Ga0268266_10300343 Ga0268266_103003431 327
971 3300031251 Ga0265327_10000107 Ga0265327_10000107108 327
972 3300031251 Ga0265327_10050815 Ga0265327_100508152 327
973 3300039437 Ga0436365_0419801 Ga0436365_0419801_1661_2665 327
974 3300039437 Ga0436365_0735035 Ga0436365_0735035_49_1053 327
975 3300047319 Ga0495674_0236940 Ga0495674_0236940_78_1082 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00365

PFK

Phosphofructokinase

44

320

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mto-assembly2.cif.gz_E crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate 0.9798 6 327
3pfk-assembly1.cif.gz_A phosphofructokinase. structure and control 0.977 6 325
4a3s-assembly1.cif.gz_A crystal structure of pfk from bacillus subtilis 0.9757 6 327
3u39-assembly1.cif.gz_A crystal structure of the apo bacillus stearothermophilus phosphofructokinase 0.9757 6 327
1mto-assembly2.cif.gz_E crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate 0.9738 6 327
ID Description Score Start End Superfamily
af_Q27483_12_171_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9839 8 143 3.40.50.450
af_Q2FXM8_1_303_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.976 6 307 3.40.50.450
3u39A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9739 6 308 3.40.50.450
af_Q2FXM8_1_303_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9634 6 307 3.40.50.450
3u39A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9536 6 308 3.40.50.450

Feature Viewer

pLDDT pTM Quality
88.8 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map