F487228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 975 | 308 | 972 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10210324|Ga0105239_102103242 |
| Length | 364 |
| Sequence | VPVRPPGGAFSKKGYDFLLVIGRRKDFFNKTKQDLKKAEKKITRIGVLTSGGDAPGMNAAIRAVVRTGVFNELEVYGIMRGYQGMIEDDITKMESRSVANIIQRGGTILKTARCKEFFDYSGRKKAYENLKKRGIDGLVIIGGDGSFRGAVKFHEEFGIPCIGLAGTIDKDIHGTDFTIGFDTAVNTAVEAIDKIRDTMDAHDRIFVIEVMGRDAGYIALHSGIATGAENILIPERKTDIDALVKGLKETNKRKKLVMLIVVAEGENFGGAGEVQKKILEEIPTAEIRVCILGHIQRGGSPSCLDRLLASRMGYHAVECLIEGRHNVFVGIMNNKMHYIPLEDAVKIKGKIGDEWLKIVKILAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 200 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 201 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 202 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 203 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 204 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 262 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 263 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 264 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 269 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 270 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 271 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 272 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 274 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 281 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 282 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 283 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 284 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 290 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 296 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 297 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 298 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 300 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 301 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 304 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 305 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 307 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.87 |
| Nodule | 0 |
| Rhizoplane | 0.51 |
| Rhizosphere | 94.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009205 | 3300001979 | Bacteria | 3881 |
| 2 | JGI24751J29686_10001328 | 3300002459 | Bacteria | 5203 |
| 3 | JGI25406J46586_10000498 | 3300003203 | Bacteria | 18346 |
| 4 | rootH1_10033438 | 3300003316 | Bacteria | 11872 |
| 5 | rootH1_10051512 | 3300003316 | Bacteria | 14145 |
| 6 | rootH1_10078088 | 3300003323 | Bacteria | 15401 |
| 7 | rootH1_10103550 | 3300003323 | Bacteria | 4743 |
| 8 | Ga0065714_10125089 | 3300005288 | Unclassified | 1304 |
| 9 | Ga0065712_10070715 | 3300005290 | Bacteria | 5730 |
| 10 | Ga0065712_10145434 | 3300005290 | Bacteria | 1413 |
| 11 | Ga0065715_10127067 | 3300005293 | Bacteria | 2095 |
| 12 | Ga0065715_10139861 | 3300005293 | Bacteria | 1860 |
| 13 | Ga0065707_10010810 | 3300005295 | Unclassified | 3463 |
| 14 | Ga0065707_10107553 | 3300005295 | Bacteria | 2549 |
| 15 | Ga0070676_10001251 | 3300005328 | Bacteria | 12801 |
| 16 | Ga0070676_10009728 | 3300005328 | Bacteria | 5200 |
| 17 | Ga0070676_10028708 | 3300005328 | Bacteria | 3161 |
| 18 | Ga0070676_10161613 | 3300005328 | Bacteria | 1442 |
| 19 | Ga0070683_100010127 | 3300005329 | Bacteria | 8092 |
| 20 | Ga0070683_100054784 | 3300005329 | Bacteria | 3698 |
| 21 | Ga0070683_100076884 | 3300005329 | Bacteria | 3121 |
| 22 | Ga0070683_100081383 | 3300005329 | Bacteria | 3032 |
| 23 | Ga0070683_100299434 | 3300005329 | Bacteria | 1530 |
| 24 | Ga0070690_100036931 | 3300005330 | Bacteria | 3075 |
| 25 | Ga0070690_100066010 | 3300005330 | Unclassified | 2341 |
| 26 | Ga0070690_100123210 | 3300005330 | Bacteria | 1742 |
| 27 | Ga0070670_100012438 | 3300005331 | Bacteria | 7283 |
| 28 | Ga0070670_100026443 | 3300005331 | Bacteria | 4993 |
| 29 | Ga0070670_100037182 | 3300005331 | Bacteria | 4188 |
| 30 | Ga0070670_100038260 | 3300005331 | Bacteria | 4125 |
| 31 | Ga0070670_100052058 | 3300005331 | Bacteria | 3516 |
| 32 | Ga0070670_100068287 | 3300005331 | Bacteria | 3051 |
| 33 | Ga0070670_100129098 | 3300005331 | Bacteria | 2182 |
| 34 | Ga0070670_100137765 | 3300005331 | Bacteria | 2110 |
| 35 | Ga0070670_100245947 | 3300005331 | Bacteria | 1558 |
| 36 | Ga0070670_100428721 | 3300005331 | Bacteria | 1170 |
| 37 | Ga0070677_10003327 | 3300005333 | Bacteria | 5180 |
| 38 | Ga0068869_100021417 | 3300005334 | Bacteria | 4447 |
| 39 | Ga0068869_100047178 | 3300005334 | Bacteria | 3110 |
| 40 | Ga0068869_100084375 | 3300005334 | Bacteria | 2377 |
| 41 | Ga0068869_100102078 | 3300005334 | Bacteria | 2170 |
| 42 | Ga0068869_100166170 | 3300005334 | Bacteria | 1721 |
| 43 | Ga0070666_10000024 | 3300005335 | Bacteria | 161355 |
| 44 | Ga0070666_10000913 | 3300005335 | Bacteria | 17912 |
| 45 | Ga0070666_10021112 | 3300005335 | Bacteria | 4218 |
| 46 | Ga0070666_10072432 | 3300005335 | Bacteria | 2346 |
| 47 | Ga0070666_10094392 | 3300005335 | Unclassified | 2058 |
| 48 | Ga0070666_10119228 | 3300005335 | Unclassified | 1829 |
| 49 | Ga0070666_10221353 | 3300005335 | Bacteria | 1335 |
| 50 | Ga0070680_100010215 | 3300005336 | Bacteria | 7238 |
| 51 | Ga0070680_100070426 | 3300005336 | Bacteria | 2872 |
| 52 | Ga0070682_100000054 | 3300005337 | Bacteria | 112635 |
| 53 | Ga0070682_100000460 | 3300005337 | Bacteria | 25673 |
| 54 | Ga0070682_100012658 | 3300005337 | Bacteria | 4840 |
| 55 | Ga0068868_100002272 | 3300005338 | Bacteria | 13287 |
| 56 | Ga0068868_100020428 | 3300005338 | Bacteria | 4976 |
| 57 | Ga0068868_100034133 | 3300005338 | Bacteria | 3926 |
| 58 | Ga0068868_100048811 | 3300005338 | Bacteria | 3321 |
| 59 | Ga0068868_100088422 | 3300005338 | Bacteria | 2493 |
| 60 | Ga0068868_100301234 | 3300005338 | Bacteria | 1362 |
| 61 | Ga0070660_100015549 | 3300005339 | Bacteria | 5498 |
| 62 | Ga0070660_100041686 | 3300005339 | Bacteria | 3499 |
| 63 | Ga0070660_100211037 | 3300005339 | Bacteria | 1576 |
| 64 | Ga0070689_100009290 | 3300005340 | Bacteria | 6968 |
| 65 | Ga0070689_100035015 | 3300005340 | Bacteria | 3834 |
| 66 | Ga0070689_100105916 | 3300005340 | Bacteria | 2230 |
| 67 | Ga0070689_100111827 | 3300005340 | Bacteria | 2173 |
| 68 | Ga0070691_10011617 | 3300005341 | Bacteria | 4023 |
| 69 | Ga0070687_100211194 | 3300005343 | Unclassified | 1183 |
| 70 | Ga0070661_100000277 | 3300005344 | Bacteria | 41446 |
| 71 | Ga0070661_100008859 | 3300005344 | Bacteria | 6965 |
| 72 | Ga0070661_100059221 | 3300005344 | Bacteria | 2807 |
| 73 | Ga0070661_100070422 | 3300005344 | Bacteria | 2572 |
| 74 | Ga0070692_10086390 | 3300005345 | Bacteria | 1698 |
| 75 | Ga0070668_100000036 | 3300005347 | Bacteria | 81256 |
| 76 | Ga0070668_100019902 | 3300005347 | Bacteria | 5057 |
| 77 | Ga0070668_100044662 | 3300005347 | Bacteria | 3399 |
| 78 | Ga0070668_100108012 | 3300005347 | Bacteria | 2212 |
| 79 | Ga0070669_100014389 | 3300005353 | Bacteria | 5631 |
| 80 | Ga0070669_100095488 | 3300005353 | Bacteria | 2236 |
| 81 | Ga0070669_100114442 | 3300005353 | Unclassified | 2051 |
| 82 | Ga0070669_100225592 | 3300005353 | Bacteria | 1483 |
| 83 | Ga0070675_100002264 | 3300005354 | Bacteria | 14278 |
| 84 | Ga0070675_100009802 | 3300005354 | Bacteria | 7463 |
| 85 | Ga0070675_100018400 | 3300005354 | Bacteria | 5560 |
| 86 | Ga0070675_100057499 | 3300005354 | Bacteria | 3207 |
| 87 | Ga0070675_100084143 | 3300005354 | Bacteria | 2656 |
| 88 | Ga0070675_100093349 | 3300005354 | Unclassified | 2524 |
| 89 | Ga0070671_100006354 | 3300005355 | Bacteria | 9431 |
| 90 | Ga0070671_100061563 | 3300005355 | Unclassified | 3126 |
| 91 | Ga0070671_100066424 | 3300005355 | Unclassified | 3006 |
| 92 | Ga0070671_100144767 | 3300005355 | Bacteria | 2006 |
| 93 | Ga0070671_100288334 | 3300005355 | Bacteria | 1397 |
| 94 | Ga0070671_100424691 | 3300005355 | Bacteria | 1139 |
| 95 | Ga0070674_100034399 | 3300005356 | Bacteria | 3384 |
| 96 | Ga0070674_100083656 | 3300005356 | Unclassified | 2286 |
| 97 | Ga0070673_100000556 | 3300005364 | Bacteria | 20111 |
| 98 | Ga0070673_100002842 | 3300005364 | Bacteria | 10659 |
| 99 | Ga0070673_100016851 | 3300005364 | Bacteria | 5180 |
| 100 | Ga0070673_100028728 | 3300005364 | Bacteria | 4139 |
| 101 | Ga0070673_100040146 | 3300005364 | Bacteria | 3588 |
| 102 | Ga0070673_100063512 | 3300005364 | Bacteria | 2938 |
| 103 | Ga0070673_100090635 | 3300005364 | Bacteria | 2498 |
| 104 | Ga0070673_100123716 | 3300005364 | Bacteria | 2162 |
| 105 | Ga0070673_100198996 | 3300005364 | Bacteria | 1725 |
| 106 | Ga0070688_100004500 | 3300005365 | Bacteria | 7266 |
| 107 | Ga0070688_100009741 | 3300005365 | Bacteria | 5274 |
| 108 | Ga0070688_100050604 | 3300005365 | Bacteria | 2589 |
| 109 | Ga0070688_100119577 | 3300005365 | Bacteria | 1763 |
| 110 | Ga0070688_100207598 | 3300005365 | Bacteria | 1374 |
| 111 | Ga0070659_100004064 | 3300005366 | Bacteria | 10435 |
| 112 | Ga0070659_100010005 | 3300005366 | Bacteria | 6978 |
| 113 | Ga0070659_100151161 | 3300005366 | Bacteria | 1894 |
| 114 | Ga0070667_100000151 | 3300005367 | Bacteria | 86629 |
| 115 | Ga0070667_100032757 | 3300005367 | Bacteria | 4337 |
| 116 | Ga0070667_100051778 | 3300005367 | Unclassified | 3462 |
| 117 | Ga0070667_100069703 | 3300005367 | Bacteria | 2993 |
| 118 | Ga0070667_100096463 | 3300005367 | Bacteria | 2550 |
| 119 | Ga0070667_100112464 | 3300005367 | Unclassified | 2362 |
| 120 | Ga0070667_100277595 | 3300005367 | Bacteria | 1504 |
| 121 | Ga0070667_100339554 | 3300005367 | Bacteria | 1358 |
| 122 | Ga0070663_100027279 | 3300005455 | Bacteria | 3877 |
| 123 | Ga0070663_100085750 | 3300005455 | Bacteria | 2324 |
| 124 | Ga0070678_100014996 | 3300005456 | Bacteria | 4908 |
| 125 | Ga0070678_100066015 | 3300005456 | Bacteria | 2689 |
| 126 | Ga0070678_100093372 | 3300005456 | Bacteria | 2314 |
| 127 | Ga0070678_100101191 | 3300005456 | Bacteria | 2233 |
| 128 | Ga0070662_100001152 | 3300005457 | Bacteria | 16211 |
| 129 | Ga0070662_100004539 | 3300005457 | Bacteria | 8795 |
| 130 | Ga0070662_100476107 | 3300005457 | Bacteria | 1039 |
| 131 | Ga0070681_10040195 | 3300005458 | Bacteria | 4688 |
| 132 | Ga0070681_10044426 | 3300005458 | Unclassified | 4448 |
| 133 | Ga0070681_10064938 | 3300005458 | Bacteria | 3620 |
| 134 | Ga0070681_10151863 | 3300005458 | Bacteria | 2242 |
| 135 | Ga0070681_10366796 | 3300005458 | Unclassified | 1350 |
| 136 | Ga0068867_100001821 | 3300005459 | Bacteria | 14856 |
| 137 | Ga0068867_100009666 | 3300005459 | Bacteria | 6799 |
| 138 | Ga0068867_100013422 | 3300005459 | Bacteria | 5804 |
| 139 | Ga0068867_100092819 | 3300005459 | Bacteria | 2293 |
| 140 | Ga0068867_100094717 | 3300005459 | Bacteria | 2271 |
| 141 | Ga0068867_100199215 | 3300005459 | Bacteria | 1602 |
| 142 | Ga0068867_100221391 | 3300005459 | Bacteria | 1525 |
| 143 | Ga0070685_10024532 | 3300005466 | Bacteria | 3313 |
| 144 | Ga0070685_10128415 | 3300005466 | Bacteria | 1582 |
| 145 | Ga0070698_100000791 | 3300005471 | Bacteria | 34361 |
| 146 | Ga0070698_100004354 | 3300005471 | Bacteria | 15565 |
| 147 | Ga0070679_100001616 | 3300005530 | Bacteria | 20275 |
| 148 | Ga0070679_100007747 | 3300005530 | Bacteria | 10058 |
| 149 | Ga0070679_100021368 | 3300005530 | Bacteria | 6318 |
| 150 | Ga0070679_100090552 | 3300005530 | Bacteria | 3047 |
| 151 | Ga0070679_100121092 | 3300005530 | Bacteria | 2601 |
| 152 | Ga0070679_100122840 | 3300005530 | Bacteria | 2580 |
| 153 | Ga0070679_100198827 | 3300005530 | Bacteria | 1971 |
| 154 | Ga0070684_100001505 | 3300005535 | Bacteria | 16829 |
| 155 | Ga0070684_100002570 | 3300005535 | Bacteria | 13402 |
| 156 | Ga0070684_100037366 | 3300005535 | Bacteria | 4165 |
| 157 | Ga0068853_100014362 | 3300005539 | Bacteria | 6483 |
| 158 | Ga0068853_100027817 | 3300005539 | Bacteria | 4754 |
| 159 | Ga0068853_100050606 | 3300005539 | Bacteria | 3575 |
| 160 | Ga0068853_100095600 | 3300005539 | Bacteria | 2620 |
| 161 | Ga0068853_100101790 | 3300005539 | Bacteria | 2541 |
| 162 | Ga0070672_100000471 | 3300005543 | Bacteria | 23416 |
| 163 | Ga0070672_100008357 | 3300005543 | Bacteria | 7076 |
| 164 | Ga0070672_100020254 | 3300005543 | Bacteria | 4848 |
| 165 | Ga0070672_100260306 | 3300005543 | Bacteria | 1463 |
| 166 | Ga0070672_100383415 | 3300005543 | Bacteria | 1202 |
| 167 | Ga0070686_100103219 | 3300005544 | Bacteria | 1929 |
| 168 | Ga0070693_100016506 | 3300005547 | Bacteria | 3824 |
| 169 | Ga0070665_100000009 | 3300005548 | Bacteria | 562640 |
| 170 | Ga0070665_100001215 | 3300005548 | Bacteria | 31387 |
| 171 | Ga0070665_100078363 | 3300005548 | Bacteria | 3311 |
| 172 | Ga0068855_100000351 | 3300005563 | Bacteria | 57089 |
| 173 | Ga0068855_100025281 | 3300005563 | Bacteria | 7108 |
| 174 | Ga0068855_100031346 | 3300005563 | Bacteria | 6349 |
| 175 | Ga0068855_100057463 | 3300005563 | Bacteria | 4560 |
| 176 | Ga0068855_100062948 | 3300005563 | Bacteria | 4330 |
| 177 | Ga0068855_100121742 | 3300005563 | Bacteria | 2986 |
| 178 | Ga0068855_100615828 | 3300005563 | Bacteria | 1169 |
| 179 | Ga0070664_100015973 | 3300005564 | Bacteria | 6148 |
| 180 | Ga0070664_100037086 | 3300005564 | Bacteria | 4096 |
| 181 | Ga0070664_100060527 | 3300005564 | Bacteria | 3225 |
| 182 | Ga0070664_100087930 | 3300005564 | Bacteria | 2687 |
| 183 | Ga0068857_100014912 | 3300005577 | Bacteria | 6778 |
| 184 | Ga0068857_100043833 | 3300005577 | Bacteria | 3968 |
| 185 | Ga0068857_100085530 | 3300005577 | Bacteria | 2819 |
| 186 | Ga0068857_100127787 | 3300005577 | Bacteria | 2291 |
| 187 | Ga0068857_100344965 | 3300005577 | Unclassified | 1378 |
| 188 | Ga0068857_100345480 | 3300005577 | Bacteria | 1377 |
| 189 | Ga0068854_100029484 | 3300005578 | Bacteria | 3799 |
| 190 | Ga0068854_100035369 | 3300005578 | Bacteria | 3495 |
| 191 | Ga0068854_100054384 | 3300005578 | Unclassified | 2879 |
| 192 | Ga0068854_100094159 | 3300005578 | Unclassified | 2234 |
| 193 | Ga0068854_100101146 | 3300005578 | Unclassified | 2161 |
| 194 | Ga0068854_100111978 | 3300005578 | Bacteria | 2060 |
| 195 | Ga0068854_100120901 | 3300005578 | Bacteria | 1988 |
| 196 | Ga0068856_100017543 | 3300005614 | Bacteria | 6937 |
| 197 | Ga0068856_100021165 | 3300005614 | Bacteria | 6319 |
| 198 | Ga0068856_100047298 | 3300005614 | Bacteria | 4238 |
| 199 | Ga0068852_100006236 | 3300005616 | Bacteria | 8599 |
| 200 | Ga0068852_100016758 | 3300005616 | Bacteria | 5725 |
| 201 | Ga0068852_100018083 | 3300005616 | Bacteria | 5546 |
| 202 | Ga0068852_100018176 | 3300005616 | Bacteria | 5534 |
| 203 | Ga0068852_100023882 | 3300005616 | Bacteria | 4930 |
| 204 | Ga0068852_100040366 | 3300005616 | Bacteria | 3936 |
| 205 | Ga0068852_100050384 | 3300005616 | Unclassified | 3568 |
| 206 | Ga0068852_100076301 | 3300005616 | Bacteria | 2959 |
| 207 | Ga0068852_100149170 | 3300005616 | Bacteria | 2173 |
| 208 | Ga0068852_100286069 | 3300005616 | Bacteria | 1591 |
| 209 | Ga0068859_100000018 | 3300005617 | Bacteria | 248813 |
| 210 | Ga0068859_100000727 | 3300005617 | Bacteria | 33122 |
| 211 | Ga0068859_100050537 | 3300005617 | Bacteria | 4176 |
| 212 | Ga0068859_100082282 | 3300005617 | Bacteria | 3262 |
| 213 | Ga0068859_100094668 | 3300005617 | Bacteria | 3039 |
| 214 | Ga0068859_100103911 | 3300005617 | Bacteria | 2899 |
| 215 | Ga0068859_100171514 | 3300005617 | Bacteria | 2250 |
| 216 | Ga0068859_100193607 | 3300005617 | Bacteria | 2118 |
| 217 | Ga0068859_100285069 | 3300005617 | Bacteria | 1745 |
| 218 | Ga0068859_100317606 | 3300005617 | Bacteria | 1651 |
| 219 | Ga0068864_100001161 | 3300005618 | Bacteria | 21876 |
| 220 | Ga0068864_100003796 | 3300005618 | Bacteria | 12453 |
| 221 | Ga0068864_100009228 | 3300005618 | Bacteria | 8135 |
| 222 | Ga0068864_100033921 | 3300005618 | Bacteria | 4340 |
| 223 | Ga0068864_100096174 | 3300005618 | Bacteria | 2621 |
| 224 | Ga0068864_100117879 | 3300005618 | Bacteria | 2370 |
| 225 | Ga0068864_100154045 | 3300005618 | Unclassified | 2084 |
| 226 | Ga0068864_100191887 | 3300005618 | Bacteria | 1873 |
| 227 | Ga0068866_10011090 | 3300005718 | Bacteria | 3885 |
| 228 | Ga0068861_100013192 | 3300005719 | Bacteria | 5780 |
| 229 | Ga0068861_100028014 | 3300005719 | Bacteria | 4109 |
| 230 | Ga0068861_100036108 | 3300005719 | Bacteria | 3666 |
| 231 | Ga0068861_100183267 | 3300005719 | Bacteria | 1745 |
| 232 | Ga0068861_100226540 | 3300005719 | Bacteria | 1583 |
| 233 | Ga0068861_100324462 | 3300005719 | Unclassified | 1342 |
| 234 | Ga0068851_10002501 | 3300005834 | Bacteria | 8078 |
| 235 | Ga0068851_10022038 | 3300005834 | Bacteria | 3099 |
| 236 | Ga0068851_10080575 | 3300005834 | Bacteria | 1699 |
| 237 | Ga0068851_10260391 | 3300005834 | Bacteria | 986 |
| 238 | Ga0068870_10010987 | 3300005840 | Bacteria | 4183 |
| 239 | Ga0068863_100001435 | 3300005841 | Bacteria | 23620 |
| 240 | Ga0068863_100027885 | 3300005841 | Bacteria | 5390 |
| 241 | Ga0068863_100028484 | 3300005841 | Bacteria | 5334 |
| 242 | Ga0068863_100039684 | 3300005841 | Bacteria | 4478 |
| 243 | Ga0068863_100046488 | 3300005841 | Bacteria | 4119 |
| 244 | Ga0068863_100064593 | 3300005841 | Unclassified | 3461 |
| 245 | Ga0068863_100433218 | 3300005841 | Bacteria | 1289 |
| 246 | Ga0068858_100001071 | 3300005842 | Bacteria | 28302 |
| 247 | Ga0068858_100010503 | 3300005842 | Bacteria | 8772 |
| 248 | Ga0068858_100139680 | 3300005842 | Bacteria | 2274 |
| 249 | Ga0068858_100216307 | 3300005842 | Bacteria | 1814 |
| 250 | Ga0068860_100000078 | 3300005843 | Bacteria | 171062 |
| 251 | Ga0068860_100000824 | 3300005843 | Bacteria | 34695 |
| 252 | Ga0068860_100009310 | 3300005843 | Bacteria | 9757 |
| 253 | Ga0068860_100025779 | 3300005843 | Bacteria | 5672 |
| 254 | Ga0068860_100033819 | 3300005843 | Bacteria | 4905 |
| 255 | Ga0068860_100036404 | 3300005843 | Bacteria | 4715 |
| 256 | Ga0068860_100233903 | 3300005843 | Bacteria | 1786 |
| 257 | Ga0068860_100249360 | 3300005843 | Unclassified | 1728 |
| 258 | Ga0068860_100282073 | 3300005843 | Bacteria | 1624 |
| 259 | Ga0068860_100371050 | 3300005843 | Bacteria | 1411 |
| 260 | Ga0068860_100536505 | 3300005843 | Bacteria | 1171 |
| 261 | Ga0068862_100023254 | 3300005844 | Bacteria | 5191 |
| 262 | Ga0068862_100028062 | 3300005844 | Bacteria | 4740 |
| 263 | Ga0068862_100085470 | 3300005844 | Bacteria | 2742 |
| 264 | Ga0068862_100140557 | 3300005844 | Bacteria | 2142 |
| 265 | Ga0081539_10000708 | 3300005985 | Bacteria | 66782 |
| 266 | Ga0081539_10030635 | 3300005985 | Bacteria | 3334 |
| 267 | Ga0075364_10172039 | 3300006051 | Unclassified | 1464 |
| 268 | Ga0070716_100072149 | 3300006173 | Unclassified | 2032 |
| 269 | Ga0075366_10163842 | 3300006195 | Bacteria | 1348 |
| 270 | Ga0097621_100000489 | 3300006237 | Bacteria | 27739 |
| 271 | Ga0097621_100001040 | 3300006237 | Bacteria | 19470 |
| 272 | Ga0097621_100001758 | 3300006237 | Bacteria | 14859 |
| 273 | Ga0097621_100004022 | 3300006237 | Bacteria | 10191 |
| 274 | Ga0097621_100014475 | 3300006237 | Bacteria | 5903 |
| 275 | Ga0097621_100033562 | 3300006237 | Bacteria | 4088 |
| 276 | Ga0097621_100053932 | 3300006237 | Bacteria | 3277 |
| 277 | Ga0097621_100067776 | 3300006237 | Bacteria | 2941 |
| 278 | Ga0097621_100298441 | 3300006237 | Bacteria | 1422 |
| 279 | Ga0097621_100401889 | 3300006237 | Bacteria | 1226 |
| 280 | Ga0097621_100454887 | 3300006237 | Bacteria | 1154 |
| 281 | Ga0068871_100000419 | 3300006358 | Bacteria | 29372 |
| 282 | Ga0068871_100003690 | 3300006358 | Bacteria | 10521 |
| 283 | Ga0068871_100009315 | 3300006358 | Bacteria | 7108 |
| 284 | Ga0068871_100010582 | 3300006358 | Bacteria | 6740 |
| 285 | Ga0068871_100018752 | 3300006358 | Bacteria | 5269 |
| 286 | Ga0068871_100023999 | 3300006358 | Unclassified | 4725 |
| 287 | Ga0068871_100046364 | 3300006358 | Bacteria | 3501 |
| 288 | Ga0068871_100050409 | 3300006358 | Bacteria | 3367 |
| 289 | Ga0068871_100270480 | 3300006358 | Bacteria | 1484 |
| 290 | Ga0068871_100353245 | 3300006358 | Bacteria | 1301 |
| 291 | Ga0075428_100027076 | 3300006844 | Bacteria | 6347 |
| 292 | Ga0075428_100099952 | 3300006844 | Bacteria | 3163 |
| 293 | Ga0075430_100018647 | 3300006846 | Bacteria | 5905 |
| 294 | Ga0075434_100082728 | 3300006871 | Bacteria | 3208 |
| 295 | Ga0075429_100012284 | 3300006880 | Bacteria | 7427 |
| 296 | Ga0075429_100027936 | 3300006880 | Bacteria | 4897 |
| 297 | Ga0075429_100306491 | 3300006880 | Bacteria | 1390 |
| 298 | Ga0068865_100003069 | 3300006881 | Bacteria | 9987 |
| 299 | Ga0068865_100006157 | 3300006881 | Bacteria | 7312 |
| 300 | Ga0068865_100030779 | 3300006881 | Bacteria | 3572 |
| 301 | Ga0068865_100074189 | 3300006881 | Bacteria | 2422 |
| 302 | Ga0068865_100112625 | 3300006881 | Bacteria | 2010 |
| 303 | Ga0097620_100000018 | 3300006931 | Bacteria | 248813 |
| 304 | Ga0097620_100000727 | 3300006931 | Bacteria | 33122 |
| 305 | Ga0097620_100050537 | 3300006931 | Bacteria | 4176 |
| 306 | Ga0097620_100082273 | 3300006931 | Bacteria | 3262 |
| 307 | Ga0097620_100094667 | 3300006931 | Bacteria | 3039 |
| 308 | Ga0097620_100103924 | 3300006931 | Bacteria | 2899 |
| 309 | Ga0097620_100171518 | 3300006931 | Bacteria | 2250 |
| 310 | Ga0097620_100193601 | 3300006931 | Bacteria | 2118 |
| 311 | Ga0097620_100285055 | 3300006931 | Bacteria | 1745 |
| 312 | Ga0097620_100317619 | 3300006931 | Bacteria | 1651 |
| 313 | Ga0105240_10001174 | 3300009093 | Bacteria | 45878 |
| 314 | Ga0105240_10006711 | 3300009093 | Bacteria | 16862 |
| 315 | Ga0105240_10007959 | 3300009093 | Bacteria | 15289 |
| 316 | Ga0105240_10019358 | 3300009093 | Bacteria | 9097 |
| 317 | Ga0105240_10026922 | 3300009093 | Bacteria | 7538 |
| 318 | Ga0105240_10268206 | 3300009093 | Bacteria | 1967 |
| 319 | Ga0105240_10403496 | 3300009093 | Bacteria | 1539 |
| 320 | Ga0111539_10007214 | 3300009094 | Bacteria | 14247 |
| 321 | Ga0111539_10046265 | 3300009094 | Bacteria | 5205 |
| 322 | Ga0111539_10456846 | 3300009094 | Bacteria | 1487 |
| 323 | Ga0105247_10003256 | 3300009101 | Bacteria | 10648 |
| 324 | Ga0105247_10025102 | 3300009101 | Bacteria | 3596 |
| 325 | Ga0105247_10293309 | 3300009101 | Bacteria | 1126 |
| 326 | Ga0114129_10019090 | 3300009147 | Bacteria | 9766 |
| 327 | Ga0114129_10890866 | 3300009147 | Bacteria | 1128 |
| 328 | Ga0105243_10035212 | 3300009148 | Unclassified | 3880 |
| 329 | Ga0105243_10055846 | 3300009148 | Bacteria | 3138 |
| 330 | Ga0105241_10000113 | 3300009174 | Bacteria | 58135 |
| 331 | Ga0105241_10008843 | 3300009174 | Bacteria | 7403 |
| 332 | Ga0105241_10071809 | 3300009174 | Bacteria | 2688 |
| 333 | Ga0105241_10164893 | 3300009174 | Unclassified | 1825 |
| 334 | Ga0105241_10461240 | 3300009174 | Unclassified | 1126 |
| 335 | Ga0105242_10020045 | 3300009176 | Bacteria | 5241 |
| 336 | Ga0105242_10036590 | 3300009176 | Bacteria | 3939 |
| 337 | Ga0105242_10122863 | 3300009176 | Bacteria | 2231 |
| 338 | Ga0105242_10263542 | 3300009176 | Bacteria | 1558 |
| 339 | Ga0105248_10191674 | 3300009177 | Bacteria | 2303 |
| 340 | Ga0105248_10252470 | 3300009177 | Unclassified | 1985 |
| 341 | Ga0105237_10002621 | 3300009545 | Bacteria | 22143 |
| 342 | Ga0105237_10013947 | 3300009545 | Bacteria | 8410 |
| 343 | Ga0105237_10026452 | 3300009545 | Bacteria | 5930 |
| 344 | Ga0105237_10036714 | 3300009545 | Bacteria | 4958 |
| 345 | Ga0105237_10249279 | 3300009545 | Bacteria | 1778 |
| 346 | Ga0105238_10003534 | 3300009551 | Bacteria | 15582 |
| 347 | Ga0105238_10092377 | 3300009551 | Bacteria | 3014 |
| 348 | Ga0105238_10329127 | 3300009551 | Bacteria | 1514 |
| 349 | Ga0105249_10004065 | 3300009553 | Bacteria | 12618 |
| 350 | Ga0105249_10007291 | 3300009553 | Bacteria | 9642 |
| 351 | Ga0105249_10008533 | 3300009553 | Bacteria | 8932 |
| 352 | Ga0105249_10014840 | 3300009553 | Bacteria | 6889 |
| 353 | Ga0105249_10022267 | 3300009553 | Bacteria | 5676 |
| 354 | Ga0105249_10032858 | 3300009553 | Bacteria | 4696 |
| 355 | Ga0105249_10035500 | 3300009553 | Bacteria | 4522 |
| 356 | Ga0105249_10041571 | 3300009553 | Bacteria | 4179 |
| 357 | Ga0105249_10082575 | 3300009553 | Bacteria | 2990 |
| 358 | Ga0105249_10114077 | 3300009553 | Bacteria | 2558 |
| 359 | Ga0105239_10030291 | 3300010375 | Bacteria | 5948 |
| 360 | Ga0105239_10045032 | 3300010375 | Bacteria | 4836 |
| 361 | Ga0105239_10051853 | 3300010375 | Bacteria | 4497 |
| 362 | Ga0105239_10061607 | 3300010375 | Bacteria | 4118 |
| 363 | Ga0105239_10093791 | 3300010375 | Bacteria | 3315 |
| 364 | Ga0105239_10210324 | 3300010375 | Unclassified | 2180 |
| 365 | Ga0105239_10497852 | 3300010375 | Bacteria | 1385 |
| 366 | Ga0105246_10023678 | 3300011119 | Bacteria | 3976 |
| 367 | Ga0105246_10153082 | 3300011119 | Bacteria | 1748 |
| 368 | Ga0157373_10006436 | 3300013100 | Bacteria | 8773 |
| 369 | Ga0157373_10016050 | 3300013100 | Bacteria | 5466 |
| 370 | Ga0157373_10018871 | 3300013100 | Bacteria | 5019 |
| 371 | Ga0157373_10075484 | 3300013100 | Bacteria | 2378 |
| 372 | Ga0157371_10001020 | 3300013102 | Bacteria | 30696 |
| 373 | Ga0157371_10002334 | 3300013102 | Bacteria | 18188 |
| 374 | Ga0157371_10005815 | 3300013102 | Bacteria | 10320 |
| 375 | Ga0157371_10006507 | 3300013102 | Bacteria | 9621 |
| 376 | Ga0157371_10007605 | 3300013102 | Bacteria | 8741 |
| 377 | Ga0157371_10012819 | 3300013102 | Bacteria | 6389 |
| 378 | Ga0157371_10032312 | 3300013102 | Bacteria | 3767 |
| 379 | Ga0157371_10131355 | 3300013102 | Bacteria | 1782 |
| 380 | Ga0157370_10001463 | 3300013104 | Bacteria | 29196 |
| 381 | Ga0157370_10001948 | 3300013104 | Bacteria | 25412 |
| 382 | Ga0157370_10003125 | 3300013104 | Bacteria | 19611 |
| 383 | Ga0157370_10010240 | 3300013104 | Bacteria | 9900 |
| 384 | Ga0157370_10018009 | 3300013104 | Bacteria | 7109 |
| 385 | Ga0157370_10027963 | 3300013104 | Bacteria | 5553 |
| 386 | Ga0157370_10055569 | 3300013104 | Bacteria | 3770 |
| 387 | Ga0157369_10043116 | 3300013105 | Bacteria | 4919 |
| 388 | Ga0157369_10046180 | 3300013105 | Unclassified | 4734 |
| 389 | Ga0157369_10056706 | 3300013105 | Bacteria | 4227 |
| 390 | Ga0157369_10200311 | 3300013105 | Bacteria | 2096 |
| 391 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 392 | Ga0157374_10000153 | 3300013296 | Bacteria | 63211 |
| 393 | Ga0157374_10001371 | 3300013296 | Bacteria | 20705 |
| 394 | Ga0157374_10010315 | 3300013296 | Bacteria | 8036 |
| 395 | Ga0157374_10013148 | 3300013296 | Bacteria | 7219 |
| 396 | Ga0157374_10034561 | 3300013296 | Bacteria | 4618 |
| 397 | Ga0157374_10072440 | 3300013296 | Unclassified | 3250 |
| 398 | Ga0157374_10077674 | 3300013296 | Bacteria | 3142 |
| 399 | Ga0157374_10128472 | 3300013296 | Bacteria | 2451 |
| 400 | Ga0157374_10318431 | 3300013296 | Bacteria | 1541 |
| 401 | Ga0157378_10001024 | 3300013297 | Bacteria | 25548 |
| 402 | Ga0157378_10010369 | 3300013297 | Bacteria | 8134 |
| 403 | Ga0157378_10014239 | 3300013297 | Bacteria | 6962 |
| 404 | Ga0157378_10020824 | 3300013297 | Bacteria | 5767 |
| 405 | Ga0157378_10037481 | 3300013297 | Bacteria | 4294 |
| 406 | Ga0157378_10041446 | 3300013297 | Unclassified | 4084 |
| 407 | Ga0157378_10053851 | 3300013297 | Bacteria | 3583 |
| 408 | Ga0157378_10054549 | 3300013297 | Bacteria | 3559 |
| 409 | Ga0157378_10074360 | 3300013297 | Bacteria | 3057 |
| 410 | Ga0157378_10290790 | 3300013297 | Bacteria | 1578 |
| 411 | Ga0157378_10443283 | 3300013297 | Bacteria | 1287 |
| 412 | Ga0163162_10000040 | 3300013306 | Bacteria | 133855 |
| 413 | Ga0163162_10001017 | 3300013306 | Bacteria | 26052 |
| 414 | Ga0163162_10002762 | 3300013306 | Bacteria | 16677 |
| 415 | Ga0163162_10003821 | 3300013306 | Bacteria | 14434 |
| 416 | Ga0163162_10004842 | 3300013306 | Bacteria | 12994 |
| 417 | Ga0163162_10005595 | 3300013306 | Bacteria | 12157 |
| 418 | Ga0163162_10012423 | 3300013306 | Bacteria | 8317 |
| 419 | Ga0163162_10013858 | 3300013306 | Bacteria | 7875 |
| 420 | Ga0163162_10022133 | 3300013306 | Bacteria | 6265 |
| 421 | Ga0163162_10031458 | 3300013306 | Bacteria | 5264 |
| 422 | Ga0163162_10069689 | 3300013306 | Bacteria | 3568 |
| 423 | Ga0163162_10156466 | 3300013306 | Bacteria | 2399 |
| 424 | Ga0163162_10411001 | 3300013306 | Bacteria | 1486 |
| 425 | Ga0163162_10471123 | 3300013306 | Bacteria | 1387 |
| 426 | Ga0163162_10505387 | 3300013306 | Bacteria | 1339 |
| 427 | Ga0163162_10569159 | 3300013306 | Bacteria | 1260 |
| 428 | Ga0157372_10012319 | 3300013307 | Bacteria | 9112 |
| 429 | Ga0157372_10020346 | 3300013307 | Bacteria | 7158 |
| 430 | Ga0157372_10022707 | 3300013307 | Bacteria | 6791 |
| 431 | Ga0157372_10039725 | 3300013307 | Bacteria | 5194 |
| 432 | Ga0157372_10045221 | 3300013307 | Bacteria | 4882 |
| 433 | Ga0157372_10050213 | 3300013307 | Bacteria | 4640 |
| 434 | Ga0157372_10076264 | 3300013307 | Bacteria | 3785 |
| 435 | Ga0157372_10120605 | 3300013307 | Bacteria | 3011 |
| 436 | Ga0157372_10127941 | 3300013307 | Bacteria | 2921 |
| 437 | Ga0157372_10171244 | 3300013307 | Bacteria | 2512 |
| 438 | Ga0157372_10198923 | 3300013307 | Bacteria | 2321 |
| 439 | Ga0157372_10342281 | 3300013307 | Unclassified | 1742 |
| 440 | Ga0157375_10000134 | 3300013308 | Bacteria | 73895 |
| 441 | Ga0157375_10000407 | 3300013308 | Bacteria | 39103 |
| 442 | Ga0157375_10008093 | 3300013308 | Bacteria | 9196 |
| 443 | Ga0157375_10040651 | 3300013308 | Unclassified | 4484 |
| 444 | Ga0157375_10070820 | 3300013308 | Bacteria | 3498 |
| 445 | Ga0157375_10075732 | 3300013308 | Unclassified | 3390 |
| 446 | Ga0157375_10144651 | 3300013308 | Bacteria | 2507 |
| 447 | Ga0157375_10189337 | 3300013308 | Bacteria | 2212 |
| 448 | Ga0157375_10201662 | 3300013308 | Unclassified | 2145 |
| 449 | Ga0157375_10332425 | 3300013308 | Bacteria | 1684 |
| 450 | Ga0157375_10515220 | 3300013308 | Bacteria | 1360 |
| 451 | Ga0157375_10563744 | 3300013308 | Bacteria | 1300 |
| 452 | Ga0163163_10000110 | 3300014325 | Bacteria | 87033 |
| 453 | Ga0163163_10000348 | 3300014325 | Bacteria | 44508 |
| 454 | Ga0163163_10133369 | 3300014325 | Bacteria | 2524 |
| 455 | Ga0163163_10143490 | 3300014325 | Unclassified | 2431 |
| 456 | Ga0163163_10213492 | 3300014325 | Bacteria | 1979 |
| 457 | Ga0157380_10002726 | 3300014326 | Bacteria | 11984 |
| 458 | Ga0157380_10150409 | 3300014326 | Unclassified | 2012 |
| 459 | Ga0157380_10311836 | 3300014326 | Unclassified | 1454 |
| 460 | Ga0157380_10331890 | 3300014326 | Bacteria | 1415 |
| 461 | Ga0157380_10648820 | 3300014326 | Bacteria | 1052 |
| 462 | Ga0157377_10000660 | 3300014745 | Bacteria | 14369 |
| 463 | Ga0157377_10004324 | 3300014745 | Bacteria | 6523 |
| 464 | Ga0157377_10011172 | 3300014745 | Bacteria | 4474 |
| 465 | Ga0157377_10039277 | 3300014745 | Unclassified | 2617 |
| 466 | Ga0157379_10000173 | 3300014968 | Bacteria | 48672 |
| 467 | Ga0157379_10062987 | 3300014968 | Bacteria | 3316 |
| 468 | Ga0157379_10077186 | 3300014968 | Bacteria | 2982 |
| 469 | Ga0157379_10087882 | 3300014968 | Bacteria | 2787 |
| 470 | Ga0157379_10093184 | 3300014968 | Bacteria | 2702 |
| 471 | Ga0157379_10111555 | 3300014968 | Bacteria | 2457 |
| 472 | Ga0157376_10000535 | 3300014969 | Bacteria | 24452 |
| 473 | Ga0157376_10001080 | 3300014969 | Bacteria | 17869 |
| 474 | Ga0157376_10006164 | 3300014969 | Bacteria | 8445 |
| 475 | Ga0157376_10012851 | 3300014969 | Bacteria | 6228 |
| 476 | Ga0157376_10084200 | 3300014969 | Unclassified | 2738 |
| 477 | Ga0157376_10098191 | 3300014969 | Bacteria | 2553 |
| 478 | Ga0157376_10115140 | 3300014969 | Bacteria | 2373 |
| 479 | Ga0163161_10009332 | 3300017792 | Bacteria | 6788 |
| 480 | Ga0163161_10118364 | 3300017792 | Unclassified | 1988 |
| 481 | Ga0163161_10232229 | 3300017792 | Bacteria | 1432 |
| 482 | Ga0213876_10003364 | 3300021384 | Bacteria | 9153 |
| 483 | Ga0213876_10020918 | 3300021384 | Bacteria | 3459 |
| 484 | Ga0213876_10099424 | 3300021384 | Bacteria | 1542 |
| 485 | Ga0207426_1000009 | 3300025302 | Bacteria | 797229 |
| 486 | Ga0207656_10009239 | 3300025321 | Bacteria | 3657 |
| 487 | Ga0207682_10006983 | 3300025893 | Bacteria | 4525 |
| 488 | Ga0207682_10089980 | 3300025893 | Unclassified | 1329 |
| 489 | Ga0207642_10067256 | 3300025899 | Bacteria | 1690 |
| 490 | Ga0207710_10002801 | 3300025900 | Bacteria | 7961 |
| 491 | Ga0207710_10017415 | 3300025900 | Bacteria | 3047 |
| 492 | Ga0207710_10040315 | 3300025900 | Bacteria | 2069 |
| 493 | Ga0207688_10009307 | 3300025901 | Bacteria | 5355 |
| 494 | Ga0207680_10000026 | 3300025903 | Bacteria | 79960 |
| 495 | Ga0207680_10001727 | 3300025903 | Bacteria | 10295 |
| 496 | Ga0207680_10022854 | 3300025903 | Unclassified | 3407 |
| 497 | Ga0207680_10025926 | 3300025903 | Bacteria | 3240 |
| 498 | Ga0207680_10135397 | 3300025903 | Unclassified | 1628 |
| 499 | Ga0207680_10176991 | 3300025903 | Unclassified | 1440 |
| 500 | Ga0207680_10235041 | 3300025903 | Bacteria | 1261 |
| 501 | Ga0207647_10000587 | 3300025904 | Bacteria | 28282 |
| 502 | Ga0207647_10025262 | 3300025904 | Bacteria | 3906 |
| 503 | Ga0207645_10000572 | 3300025907 | Bacteria | 30492 |
| 504 | Ga0207645_10005197 | 3300025907 | Bacteria | 9502 |
| 505 | Ga0207645_10015652 | 3300025907 | Bacteria | 5032 |
| 506 | Ga0207645_10021767 | 3300025907 | Bacteria | 4177 |
| 507 | Ga0207645_10027872 | 3300025907 | Bacteria | 3647 |
| 508 | Ga0207643_10023881 | 3300025908 | Unclassified | 3373 |
| 509 | Ga0207643_10080915 | 3300025908 | Bacteria | 1882 |
| 510 | Ga0207643_10096354 | 3300025908 | Bacteria | 1730 |
| 511 | Ga0207705_10003028 | 3300025909 | Bacteria | 12813 |
| 512 | Ga0207705_10099865 | 3300025909 | Bacteria | 2134 |
| 513 | Ga0207705_10244474 | 3300025909 | Unclassified | 1367 |
| 514 | Ga0207654_10007258 | 3300025911 | Bacteria | 5585 |
| 515 | Ga0207707_10000189 | 3300025912 | Bacteria | 65118 |
| 516 | Ga0207707_10090982 | 3300025912 | Unclassified | 2666 |
| 517 | Ga0207707_10154907 | 3300025912 | Bacteria | 2004 |
| 518 | Ga0207707_10348212 | 3300025912 | Unclassified | 1277 |
| 519 | Ga0207695_10000585 | 3300025913 | Bacteria | 73614 |
| 520 | Ga0207695_10005428 | 3300025913 | Bacteria | 16917 |
| 521 | Ga0207695_10031168 | 3300025913 | Bacteria | 5854 |
| 522 | Ga0207695_10091861 | 3300025913 | Bacteria | 3048 |
| 523 | Ga0207695_10134827 | 3300025913 | Bacteria | 2423 |
| 524 | Ga0207695_10174755 | 3300025913 | Bacteria | 2071 |
| 525 | Ga0207695_10195644 | 3300025913 | Bacteria | 1938 |
| 526 | Ga0207671_10000992 | 3300025914 | Bacteria | 34903 |
| 527 | Ga0207671_10001520 | 3300025914 | Bacteria | 26605 |
| 528 | Ga0207671_10001809 | 3300025914 | Bacteria | 23891 |
| 529 | Ga0207671_10021058 | 3300025914 | Bacteria | 4953 |
| 530 | Ga0207660_10001432 | 3300025917 | Bacteria | 16013 |
| 531 | Ga0207660_10073469 | 3300025917 | Bacteria | 2493 |
| 532 | Ga0207660_10149659 | 3300025917 | Bacteria | 1792 |
| 533 | Ga0207662_10005444 | 3300025918 | Bacteria | 6791 |
| 534 | Ga0207662_10063665 | 3300025918 | Bacteria | 2218 |
| 535 | Ga0207657_10012535 | 3300025919 | Bacteria | 8361 |
| 536 | Ga0207657_10037421 | 3300025919 | Bacteria | 4332 |
| 537 | Ga0207657_10061002 | 3300025919 | Bacteria | 3236 |
| 538 | Ga0207657_10112893 | 3300025919 | Bacteria | 2242 |
| 539 | Ga0207649_10005596 | 3300025920 | Bacteria | 6793 |
| 540 | Ga0207649_10054113 | 3300025920 | Bacteria | 2497 |
| 541 | Ga0207649_10075155 | 3300025920 | Bacteria | 2170 |
| 542 | Ga0207652_10000055 | 3300025921 | Bacteria | 115420 |
| 543 | Ga0207652_10000488 | 3300025921 | Bacteria | 40566 |
| 544 | Ga0207652_10003097 | 3300025921 | Bacteria | 13865 |
| 545 | Ga0207652_10016240 | 3300025921 | Bacteria | 6074 |
| 546 | Ga0207652_10037509 | 3300025921 | Bacteria | 4103 |
| 547 | Ga0207652_10046663 | 3300025921 | Bacteria | 3697 |
| 548 | Ga0207652_10293079 | 3300025921 | Unclassified | 1468 |
| 549 | Ga0207681_10025072 | 3300025923 | Bacteria | 3833 |
| 550 | Ga0207681_10085278 | 3300025923 | Bacteria | 2241 |
| 551 | Ga0207681_10102423 | 3300025923 | Bacteria | 2067 |
| 552 | Ga0207694_10008276 | 3300025924 | Bacteria | 7863 |
| 553 | Ga0207694_10119132 | 3300025924 | Bacteria | 2106 |
| 554 | Ga0207650_10006072 | 3300025925 | Bacteria | 8240 |
| 555 | Ga0207650_10060159 | 3300025925 | Bacteria | 2834 |
| 556 | Ga0207650_10082891 | 3300025925 | Bacteria | 2435 |
| 557 | Ga0207650_10105680 | 3300025925 | Bacteria | 2174 |
| 558 | Ga0207650_10116575 | 3300025925 | Bacteria | 2074 |
| 559 | Ga0207650_10161218 | 3300025925 | Bacteria | 1777 |
| 560 | Ga0207650_10296982 | 3300025925 | Unclassified | 1318 |
| 561 | Ga0207650_10365991 | 3300025925 | Bacteria | 1188 |
| 562 | Ga0207659_10046878 | 3300025926 | Bacteria | 3055 |
| 563 | Ga0207659_10048335 | 3300025926 | Bacteria | 3013 |
| 564 | Ga0207659_10080766 | 3300025926 | Bacteria | 2403 |
| 565 | Ga0207659_10124792 | 3300025926 | Unclassified | 1978 |
| 566 | Ga0207687_10223876 | 3300025927 | Bacteria | 1483 |
| 567 | Ga0207644_10004058 | 3300025931 | Bacteria | 9499 |
| 568 | Ga0207644_10044879 | 3300025931 | Unclassified | 3142 |
| 569 | Ga0207644_10053396 | 3300025931 | Unclassified | 2907 |
| 570 | Ga0207644_10054700 | 3300025931 | Unclassified | 2875 |
| 571 | Ga0207644_10292459 | 3300025931 | Bacteria | 1310 |
| 572 | Ga0207690_10007149 | 3300025932 | Bacteria | 6630 |
| 573 | Ga0207690_10017444 | 3300025932 | Bacteria | 4382 |
| 574 | Ga0207690_10125103 | 3300025932 | Bacteria | 1873 |
| 575 | Ga0207690_10168805 | 3300025932 | Bacteria | 1637 |
| 576 | Ga0207690_10382478 | 3300025932 | Bacteria | 1119 |
| 577 | Ga0207706_10002485 | 3300025933 | Bacteria | 17975 |
| 578 | Ga0207706_10005175 | 3300025933 | Bacteria | 12175 |
| 579 | Ga0207706_10024766 | 3300025933 | Bacteria | 5378 |
| 580 | Ga0207706_10074429 | 3300025933 | Bacteria | 2987 |
| 581 | Ga0207706_10090741 | 3300025933 | Unclassified | 2686 |
| 582 | Ga0207686_10030443 | 3300025934 | Bacteria | 3195 |
| 583 | Ga0207686_10034541 | 3300025934 | Bacteria | 3027 |
| 584 | Ga0207686_10095714 | 3300025934 | Bacteria | 1971 |
| 585 | Ga0207686_10141565 | 3300025934 | Bacteria | 1663 |
| 586 | Ga0207686_10365701 | 3300025934 | Bacteria | 1090 |
| 587 | Ga0207670_10048036 | 3300025936 | Bacteria | 2845 |
| 588 | Ga0207670_10049393 | 3300025936 | Bacteria | 2814 |
| 589 | Ga0207670_10109958 | 3300025936 | Bacteria | 1984 |
| 590 | Ga0207670_10134537 | 3300025936 | Unclassified | 1816 |
| 591 | Ga0207670_10158458 | 3300025936 | Unclassified | 1687 |
| 592 | Ga0207669_10029323 | 3300025937 | Bacteria | 3042 |
| 593 | Ga0207669_10278024 | 3300025937 | Bacteria | 1261 |
| 594 | Ga0207704_10001601 | 3300025938 | Bacteria | 10176 |
| 595 | Ga0207704_10077829 | 3300025938 | Bacteria | 2131 |
| 596 | Ga0207704_10174349 | 3300025938 | Unclassified | 1546 |
| 597 | Ga0207704_10322697 | 3300025938 | Unclassified | 1192 |
| 598 | Ga0207691_10000504 | 3300025940 | Bacteria | 38867 |
| 599 | Ga0207691_10003556 | 3300025940 | Bacteria | 15157 |
| 600 | Ga0207691_10023719 | 3300025940 | Bacteria | 5775 |
| 601 | Ga0207691_10050317 | 3300025940 | Bacteria | 3815 |
| 602 | Ga0207691_10070087 | 3300025940 | Bacteria | 3166 |
| 603 | Ga0207691_10076260 | 3300025940 | Bacteria | 3022 |
| 604 | Ga0207691_10089022 | 3300025940 | Unclassified | 2768 |
| 605 | Ga0207691_10111096 | 3300025940 | Archaea | 2437 |
| 606 | Ga0207711_10120925 | 3300025941 | Bacteria | 2337 |
| 607 | Ga0207711_10394646 | 3300025941 | Unclassified | 1285 |
| 608 | Ga0207689_10001176 | 3300025942 | Bacteria | 25213 |
| 609 | Ga0207689_10009612 | 3300025942 | Bacteria | 8338 |
| 610 | Ga0207689_10013229 | 3300025942 | Bacteria | 7040 |
| 611 | Ga0207689_10014847 | 3300025942 | Bacteria | 6612 |
| 612 | Ga0207689_10019979 | 3300025942 | Bacteria | 5641 |
| 613 | Ga0207689_10020131 | 3300025942 | Bacteria | 5619 |
| 614 | Ga0207689_10029042 | 3300025942 | Bacteria | 4622 |
| 615 | Ga0207689_10033265 | 3300025942 | Bacteria | 4284 |
| 616 | Ga0207689_10038375 | 3300025942 | Unclassified | 3968 |
| 617 | Ga0207689_10072098 | 3300025942 | Bacteria | 2837 |
| 618 | Ga0207689_10174932 | 3300025942 | Bacteria | 1770 |
| 619 | Ga0207661_10000840 | 3300025944 | Bacteria | 20127 |
| 620 | Ga0207661_10010476 | 3300025944 | Bacteria | 6672 |
| 621 | Ga0207661_10018872 | 3300025944 | Bacteria | 5132 |
| 622 | Ga0207661_10096723 | 3300025944 | Bacteria | 2471 |
| 623 | Ga0207679_10008617 | 3300025945 | Bacteria | 6502 |
| 624 | Ga0207679_10008706 | 3300025945 | Bacteria | 6471 |
| 625 | Ga0207679_10020849 | 3300025945 | Bacteria | 4432 |
| 626 | Ga0207679_10021105 | 3300025945 | Bacteria | 4407 |
| 627 | Ga0207679_10078429 | 3300025945 | Bacteria | 2516 |
| 628 | Ga0207667_10000275 | 3300025949 | Bacteria | 71281 |
| 629 | Ga0207667_10000721 | 3300025949 | Bacteria | 42931 |
| 630 | Ga0207667_10011490 | 3300025949 | Bacteria | 10284 |
| 631 | Ga0207667_10074372 | 3300025949 | Bacteria | 3530 |
| 632 | Ga0207667_10075991 | 3300025949 | Bacteria | 3486 |
| 633 | Ga0207667_10095656 | 3300025949 | Bacteria | 3066 |
| 634 | Ga0207667_10107057 | 3300025949 | Bacteria | 2884 |
| 635 | Ga0207651_10000164 | 3300025960 | Bacteria | 28660 |
| 636 | Ga0207651_10015652 | 3300025960 | Bacteria | 4416 |
| 637 | Ga0207651_10038783 | 3300025960 | Bacteria | 3134 |
| 638 | Ga0207651_10042532 | 3300025960 | Bacteria | 3025 |
| 639 | Ga0207712_10002266 | 3300025961 | Bacteria | 12484 |
| 640 | Ga0207712_10003837 | 3300025961 | Bacteria | 9494 |
| 641 | Ga0207712_10009791 | 3300025961 | Bacteria | 6074 |
| 642 | Ga0207712_10011308 | 3300025961 | Bacteria | 5683 |
| 643 | Ga0207712_10138273 | 3300025961 | Unclassified | 1866 |
| 644 | Ga0207712_10170095 | 3300025961 | Bacteria | 1702 |
| 645 | Ga0207668_10000568 | 3300025972 | Bacteria | 23189 |
| 646 | Ga0207668_10005433 | 3300025972 | Bacteria | 7500 |
| 647 | Ga0207668_10262122 | 3300025972 | Bacteria | 1409 |
| 648 | Ga0207640_10008552 | 3300025981 | Bacteria | 5684 |
| 649 | Ga0207640_10010668 | 3300025981 | Bacteria | 5182 |
| 650 | Ga0207640_10027730 | 3300025981 | Bacteria | 3454 |
| 651 | Ga0207640_10115742 | 3300025981 | Unclassified | 1910 |
| 652 | Ga0207658_10000225 | 3300025986 | Bacteria | 59285 |
| 653 | Ga0207658_10018882 | 3300025986 | Bacteria | 4768 |
| 654 | Ga0207658_10102971 | 3300025986 | Bacteria | 2240 |
| 655 | Ga0207658_10114310 | 3300025986 | Bacteria | 2140 |
| 656 | Ga0207658_10433626 | 3300025986 | Bacteria | 1161 |
| 657 | Ga0207677_10004033 | 3300026023 | Bacteria | 7839 |
| 658 | Ga0207677_10020431 | 3300026023 | Bacteria | 4021 |
| 659 | Ga0207677_10068565 | 3300026023 | Unclassified | 2490 |
| 660 | Ga0207677_10243069 | 3300026023 | Bacteria | 1457 |
| 661 | Ga0207677_10325428 | 3300026023 | Bacteria | 1279 |
| 662 | Ga0207703_10001012 | 3300026035 | Bacteria | 27015 |
| 663 | Ga0207703_10004551 | 3300026035 | Bacteria | 11366 |
| 664 | Ga0207703_10078745 | 3300026035 | Bacteria | 2739 |
| 665 | Ga0207639_10011129 | 3300026041 | Bacteria | 6240 |
| 666 | Ga0207639_10016999 | 3300026041 | Bacteria | 5155 |
| 667 | Ga0207639_10019305 | 3300026041 | Bacteria | 4860 |
| 668 | Ga0207639_10030049 | 3300026041 | Bacteria | 3983 |
| 669 | Ga0207639_10035531 | 3300026041 | Bacteria | 3688 |
| 670 | Ga0207639_10401623 | 3300026041 | Unclassified | 1235 |
| 671 | Ga0207678_10048748 | 3300026067 | Bacteria | 3661 |
| 672 | Ga0207678_10073535 | 3300026067 | Bacteria | 2929 |
| 673 | Ga0207678_10077023 | 3300026067 | Bacteria | 2856 |
| 674 | Ga0207678_10093966 | 3300026067 | Bacteria | 2562 |
| 675 | Ga0207678_10171365 | 3300026067 | Bacteria | 1853 |
| 676 | Ga0207708_10062482 | 3300026075 | Unclassified | 2845 |
| 677 | Ga0207702_10014859 | 3300026078 | Bacteria | 6459 |
| 678 | Ga0207702_10048289 | 3300026078 | Bacteria | 3589 |
| 679 | Ga0207702_10097371 | 3300026078 | Bacteria | 2589 |
| 680 | Ga0207641_10000167 | 3300026088 | Bacteria | 92790 |
| 681 | Ga0207641_10006442 | 3300026088 | Bacteria | 9897 |
| 682 | Ga0207641_10025224 | 3300026088 | Unclassified | 4903 |
| 683 | Ga0207641_10215578 | 3300026088 | Bacteria | 1777 |
| 684 | Ga0207641_10223475 | 3300026088 | Unclassified | 1747 |
| 685 | Ga0207641_10515453 | 3300026088 | Bacteria | 1163 |
| 686 | Ga0207648_10000560 | 3300026089 | Bacteria | 41654 |
| 687 | Ga0207648_10001895 | 3300026089 | Bacteria | 22861 |
| 688 | Ga0207648_10013539 | 3300026089 | Bacteria | 7583 |
| 689 | Ga0207648_10025240 | 3300026089 | Bacteria | 5295 |
| 690 | Ga0207648_10084464 | 3300026089 | Unclassified | 2769 |
| 691 | Ga0207648_10109922 | 3300026089 | Bacteria | 2420 |
| 692 | Ga0207648_10135085 | 3300026089 | Bacteria | 2172 |
| 693 | Ga0207648_10153901 | 3300026089 | Bacteria | 2029 |
| 694 | Ga0207676_10000992 | 3300026095 | Bacteria | 21875 |
| 695 | Ga0207676_10025764 | 3300026095 | Bacteria | 4366 |
| 696 | Ga0207676_10105191 | 3300026095 | Bacteria | 2349 |
| 697 | Ga0207676_10108328 | 3300026095 | Unclassified | 2319 |
| 698 | Ga0207676_10334902 | 3300026095 | Bacteria | 1394 |
| 699 | Ga0207676_10517281 | 3300026095 | Bacteria | 1136 |
| 700 | Ga0207674_10023234 | 3300026116 | Bacteria | 6642 |
| 701 | Ga0207674_10024690 | 3300026116 | Bacteria | 6417 |
| 702 | Ga0207674_10057085 | 3300026116 | Bacteria | 3959 |
| 703 | Ga0207674_10091138 | 3300026116 | Bacteria | 3039 |
| 704 | Ga0207674_10127552 | 3300026116 | Unclassified | 2509 |
| 705 | Ga0207674_10144646 | 3300026116 | Bacteria | 2336 |
| 706 | Ga0207674_10150557 | 3300026116 | Bacteria | 2284 |
| 707 | Ga0207674_10153912 | 3300026116 | Bacteria | 2255 |
| 708 | Ga0207675_100001069 | 3300026118 | Bacteria | 27199 |
| 709 | Ga0207675_100053199 | 3300026118 | Bacteria | 3778 |
| 710 | Ga0207675_100074576 | 3300026118 | Bacteria | 3175 |
| 711 | Ga0207675_100096566 | 3300026118 | Bacteria | 2782 |
| 712 | Ga0207675_100134723 | 3300026118 | Bacteria | 2343 |
| 713 | Ga0207675_100194001 | 3300026118 | Bacteria | 1949 |
| 714 | Ga0207683_10001675 | 3300026121 | Bacteria | 19850 |
| 715 | Ga0207683_10042151 | 3300026121 | Bacteria | 3986 |
| 716 | Ga0207683_10043729 | 3300026121 | Bacteria | 3915 |
| 717 | Ga0207683_10182867 | 3300026121 | Unclassified | 1901 |
| 718 | Ga0207683_10211932 | 3300026121 | Unclassified | 1763 |
| 719 | Ga0207683_10340472 | 3300026121 | Bacteria | 1375 |
| 720 | Ga0207698_10001738 | 3300026142 | Bacteria | 12693 |
| 721 | Ga0207698_10011377 | 3300026142 | Bacteria | 5768 |
| 722 | Ga0207698_10039833 | 3300026142 | Bacteria | 3484 |
| 723 | Ga0207698_10064058 | 3300026142 | Bacteria | 2880 |
| 724 | Ga0207698_10192049 | 3300026142 | Bacteria | 1820 |
| 725 | Ga0207698_10282447 | 3300026142 | Bacteria | 1536 |
| 726 | Ga0207428_10128535 | 3300027907 | Bacteria | 1940 |
| 727 | Ga0268266_10000014 | 3300028379 | Bacteria | 644033 |
| 728 | Ga0268266_10001023 | 3300028379 | Bacteria | 35230 |
| 729 | Ga0268266_10127702 | 3300028379 | Unclassified | 2271 |
| 730 | Ga0268266_10300343 | 3300028379 | Bacteria | 1498 |
| 731 | Ga0268265_10108869 | 3300028380 | Bacteria | 2257 |
| 732 | Ga0268265_10316489 | 3300028380 | Bacteria | 1411 |
| 733 | Ga0268264_10000105 | 3300028381 | Bacteria | 212531 |
| 734 | Ga0268264_10001646 | 3300028381 | Bacteria | 20632 |
| 735 | Ga0268264_10020393 | 3300028381 | Bacteria | 5417 |
| 736 | Ga0268264_10024621 | 3300028381 | Bacteria | 4915 |
| 737 | Ga0268264_10032257 | 3300028381 | Bacteria | 4297 |
| 738 | Ga0307517_10016657 | 3300028786 | Bacteria | 9642 |
| 739 | Ga0307515_10001274 | 3300028794 | Bacteria | 57313 |
| 740 | Ga0265338_10000408 | 3300028800 | Bacteria | 77235 |
| 741 | Ga0307511_10000579 | 3300030521 | Bacteria | 39193 |
| 742 | Ga0265327_10000107 | 3300031251 | Bacteria | 183770 |
| 743 | Ga0265327_10050815 | 3300031251 | Bacteria | 2167 |
| 744 | Ga0265316_10001346 | 3300031344 | Bacteria | 26432 |
| 745 | Ga0307513_10012204 | 3300031456 | Bacteria | 10622 |
| 746 | Ga0307513_10141289 | 3300031456 | Bacteria | 2334 |
| 747 | Ga0307509_10045786 | 3300031507 | Bacteria | 4714 |
| 748 | Ga0307509_10174833 | 3300031507 | Bacteria | 2021 |
| 749 | Ga0307509_10292170 | 3300031507 | Bacteria | 1384 |
| 750 | Ga0307508_10002565 | 3300031616 | Bacteria | 19118 |
| 751 | Ga0316579_10041913 | 3300031691 | Unclassified | 2125 |
| 752 | Ga0307516_10004180 | 3300031730 | Bacteria | 17982 |
| 753 | Ga0307410_10020334 | 3300031852 | Bacteria | 4058 |
| 754 | Ga0307407_10199329 | 3300031903 | Bacteria | 1340 |
| 755 | Ga0307409_100009385 | 3300031995 | Bacteria | 6008 |
| 756 | Ga0307416_100069838 | 3300032002 | Bacteria | 2909 |
| 757 | Ga0307414_10422156 | 3300032004 | Bacteria | 1163 |
| 758 | Ga0307415_100001047 | 3300032126 | Bacteria | 12840 |
| 759 | Ga0373941_0009668 | 3300035115 | Bacteria | 2434 |
| 760 | Ga0373943_0140224 | 3300035170 | Bacteria | 1302 |
| 761 | Ga0373927_0049219 | 3300035695 | Bacteria | 2726 |
| 762 | Ga0373933_0051362 | 3300035724 | Unclassified | 2464 |
| 763 | Ga0373937_0004801 | 3300036401 | Bacteria | 11481 |
| 764 | Ga0373937_0169918 | 3300036401 | Bacteria | 2046 |
| 765 | Ga0316582_0338069 | 3300036647 | Bacteria | 1035 |
| 766 | Ga0373925_0455590 | 3300037068 | Bacteria | 1048 |
| 767 | Ga0395900_0008236 | 3300037418 | Bacteria | 10734 |
| 768 | Ga0395898_0053541 | 3300037466 | Bacteria | 3941 |
| 769 | Ga0395905_0000040 | 3300037471 | Bacteria | 251247 |
| 770 | Ga0395905_0053611 | 3300037471 | Bacteria | 3774 |
| 771 | Ga0395905_0067168 | 3300037471 | Bacteria | 3358 |
| 772 | Ga0395905_0082304 | 3300037471 | Bacteria | 3017 |
| 773 | Ga0395905_0176205 | 3300037471 | Bacteria | 2008 |
| 774 | Ga0316581_0001785 | 3300037588 | Unclassified | 4978 |
| 775 | Ga0316581_0106146 | 3300037588 | Bacteria | 865 |
| 776 | Ga0395901_0042335 | 3300038443 | Bacteria | 4721 |
| 777 | Ga0395901_0072744 | 3300038443 | Bacteria | 3584 |
| 778 | Ga0436365_0419801 | 3300039437 | Bacteria | 5292 |
| 779 | Ga0436365_0735035 | 3300039437 | Bacteria | 3782 |
| 780 | Ga0436365_1019786 | 3300039437 | Bacteria | 3225 |
| 781 | Ga0436365_1658325 | 3300039437 | Bacteria | 5163 |
| 782 | Ga0439436_0010189 | 3300041404 | Bacteria | 2870 |
| 783 | Ga0439439_0006295 | 3300041406 | Bacteria | 2743 |
| 784 | Ga0439439_0009348 | 3300041406 | Bacteria | 2331 |
| 785 | Ga0439449_0006238 | 3300042007 | Bacteria | 4556 |
| 786 | Ga0439449_0016056 | 3300042007 | Bacteria | 2816 |
| 787 | Ga0439457_000399 | 3300042014 | Bacteria | 12335 |
| 788 | Ga0439457_006263 | 3300042014 | Bacteria | 2925 |
| 789 | Ga0439462_0010507 | 3300042015 | Bacteria | 2345 |
| 790 | Ga0439462_0082326 | 3300042015 | Bacteria | 879 |
| 791 | Ga0439434_0020825 | 3300042435 | Bacteria | 1970 |
| 792 | Ga0439434_0047558 | 3300042435 | Bacteria | 1325 |
| 793 | Ga0451577_0009739 | 3300042876 | Bacteria | 9212 |
| 794 | Ga0451577_0117342 | 3300042876 | Bacteria | 2384 |
| 795 | Ga0451577_0172493 | 3300042876 | Unclassified | 1949 |
| 796 | Ga0466969_0000293 | 3300044656 | Bacteria | 27315 |
| 797 | Ga0466972_0000014 | 3300044658 | Bacteria | 216776 |
| 798 | Ga0466972_0000250 | 3300044658 | Bacteria | 36169 |
| 799 | Ga0466972_0000477 | 3300044658 | Bacteria | 20281 |
| 800 | Ga0466966_0000028 | 3300044684 | Bacteria | 105667 |
| 801 | Ga0453684_0000108 | 3300044712 | Bacteria | 361085 |
| 802 | Ga0453684_0001771 | 3300044712 | Bacteria | 57646 |
| 803 | Ga0453684_0191394 | 3300044712 | Bacteria | 2393 |
| 804 | Ga0453684_0205116 | 3300044712 | Bacteria | 2295 |
| 805 | Ga0453684_0214306 | 3300044712 | Bacteria | 2236 |
| 806 | Ga0466968_0008930 | 3300044735 | Bacteria | 3848 |
| 807 | Ga0466968_0023147 | 3300044735 | Bacteria | 2529 |
| 808 | Ga0466970_0001468 | 3300044765 | Bacteria | 11384 |
| 809 | Ga0466957_0000123 | 3300044842 | Bacteria | 32543 |
| 810 | Ga0466959_0000039 | 3300045049 | Bacteria | 101186 |
| 811 | Ga0466959_0035662 | 3300045049 | Bacteria | 3677 |
| 812 | Ga0451576_0016411 | 3300045051 | Bacteria | 8175 |
| 813 | Ga0466967_0076668 | 3300045976 | Bacteria | 3008 |
| 814 | Ga0466967_0395490 | 3300045976 | Bacteria | 1344 |
| 815 | Ga0495651_0123422 | 3300046462 | Bacteria | 1900 |
| 816 | Ga0495664_0061219 | 3300046477 | Unclassified | 2242 |
| 817 | Ga0495606_0005219 | 3300046507 | Bacteria | 12536 |
| 818 | Ga0495630_0150442 | 3300046517 | Unclassified | 1771 |
| 819 | Ga0495630_0180336 | 3300046517 | Bacteria | 1610 |
| 820 | Ga0495643_0032341 | 3300046522 | Bacteria | 2905 |
| 821 | Ga0495648_0008977 | 3300046524 | Bacteria | 7808 |
| 822 | Ga0495586_0133191 | 3300046535 | Unclassified | 1392 |
| 823 | Ga0495645_0228718 | 3300046543 | Bacteria | 1247 |
| 824 | Ga0495656_0000004 | 3300046615 | Bacteria | 242784 |
| 825 | Ga0495668_0001408 | 3300046616 | Bacteria | 23422 |
| 826 | Ga0495668_0001611 | 3300046616 | Bacteria | 21126 |
| 827 | Ga0495634_0012523 | 3300046642 | Bacteria | 6137 |
| 828 | Ga0495625_0094619 | 3300046660 | Bacteria | 2061 |
| 829 | Ga0495659_0000580 | 3300046664 | Bacteria | 13484 |
| 830 | Ga0495657_0068433 | 3300046675 | Bacteria | 2327 |
| 831 | Ga0495623_0092939 | 3300046679 | Bacteria | 1848 |
| 832 | Ga0495670_0125775 | 3300046691 | Bacteria | 1334 |
| 833 | Ga0495604_0087987 | 3300047317 | Unclassified | 2312 |
| 834 | Ga0495674_0236940 | 3300047319 | Bacteria | 1505 |
| 835 | Ga0495672_0026023 | 3300047320 | Bacteria | 3738 |
| 836 | Ga0495672_0065375 | 3300047320 | Unclassified | 2079 |
| 837 | Ga0495672_0081734 | 3300047320 | Bacteria | 1798 |
| 838 | Ga0495687_000056 | 3300047443 | Bacteria | 188227 |
| 839 | Ga0495684_0249530 | 3300047471 | Bacteria | 1292 |
| 840 | Ga0495686_0130542 | 3300047472 | Bacteria | 1490 |
| 841 | Ga0496101_0054484 | 3300048904 | Bacteria | 2888 |
| 842 | Ga0496102_0317033 | 3300048905 | Bacteria | 1469 |
| 843 | Ga0496108_0211119 | 3300048911 | Bacteria | 1685 |
| 844 | Ga0496114_0117615 | 3300048917 | Bacteria | 2283 |
| 845 | Ga0496115_0292143 | 3300048918 | Unclassified | 1337 |
| 846 | Ga0496124_0044005 | 3300048927 | Bacteria | 3834 |
| 847 | Ga0501031_0073046 | 3300049568 | Bacteria | 2233 |
| 848 | Ga0501032_0000105 | 3300049569 | Bacteria | 71525 |
| 849 | Ga0501032_0057079 | 3300049569 | Bacteria | 2623 |
| 850 | Ga0501034_0000363 | 3300049571 | Bacteria | 77256 |
| 851 | Ga0501034_0020326 | 3300049571 | Bacteria | 6778 |
| 852 | Ga0501034_0023760 | 3300049571 | Bacteria | 6243 |
| 853 | Ga0501034_0058351 | 3300049571 | Bacteria | 3879 |
| 854 | Ga0501034_0327662 | 3300049571 | Bacteria | 1463 |
| 855 | Ga0501034_0400905 | 3300049571 | Bacteria | 1294 |
| 856 | Ga0501034_0414027 | 3300049571 | Unclassified | 1270 |
| 857 | Ga0501034_0500007 | 3300049571 | Bacteria | 1129 |
| 858 | Ga0501034_0566480 | 3300049571 | Bacteria | 1044 |
| 859 | Ga0501036_0008626 | 3300049572 | Bacteria | 8365 |
| 860 | Ga0501036_0015178 | 3300049572 | Bacteria | 6433 |
| 861 | Ga0501036_0089161 | 3300049572 | Bacteria | 2606 |
| 862 | Ga0501037_0036199 | 3300049573 | Bacteria | 3638 |
| 863 | Ga0501037_0128887 | 3300049573 | Bacteria | 1815 |
| 864 | Ga0501037_0129521 | 3300049573 | Bacteria | 1810 |
| 865 | Ga0501037_0222459 | 3300049573 | Bacteria | 1328 |
| 866 | Ga0501037_0321285 | 3300049573 | Unclassified | 1072 |
| 867 | Ga0501038_0036362 | 3300049574 | Bacteria | 4322 |
| 868 | Ga0501038_0072889 | 3300049574 | Bacteria | 2909 |
| 869 | Ga0501038_0086995 | 3300049574 | Bacteria | 2625 |
| 870 | Ga0501038_0191304 | 3300049574 | Bacteria | 1646 |
| 871 | Ga0501039_0019257 | 3300049575 | Bacteria | 5234 |
| 872 | Ga0501039_0144315 | 3300049575 | Bacteria | 1870 |
| 873 | Ga0501039_0490293 | 3300049575 | Bacteria | 965 |
| 874 | Ga0501043_0025312 | 3300049579 | Bacteria | 4655 |
| 875 | Ga0501043_0033904 | 3300049579 | Bacteria | 4017 |
| 876 | Ga0501043_0128951 | 3300049579 | Bacteria | 1982 |
| 877 | Ga0501043_0145079 | 3300049579 | Bacteria | 1859 |
| 878 | Ga0501043_0161440 | 3300049579 | Bacteria | 1751 |
| 879 | Ga0501043_0211997 | 3300049579 | Bacteria | 1501 |
| 880 | Ga0501046_0007138 | 3300049580 | Bacteria | 9826 |
| 881 | Ga0501046_0109050 | 3300049580 | Bacteria | 2117 |
| 882 | Ga0501047_0008441 | 3300049581 | Bacteria | 9723 |
| 883 | Ga0501047_0023465 | 3300049581 | Bacteria | 5921 |
| 884 | Ga0501047_0118369 | 3300049581 | Bacteria | 2531 |
| 885 | Ga0501047_0170001 | 3300049581 | Bacteria | 2049 |
| 886 | Ga0501047_0270173 | 3300049581 | Bacteria | 1547 |
| 887 | Ga0501047_0322644 | 3300049581 | Unclassified | 1384 |
| 888 | Ga0501048_0053337 | 3300049582 | Bacteria | 2876 |
| 889 | Ga0501067_0031941 | 3300049583 | Bacteria | 2921 |
| 890 | Ga0501068_0050600 | 3300049584 | Bacteria | 2512 |
| 891 | Ga0501068_0282282 | 3300049584 | Bacteria | 1061 |
| 892 | Ga0501069_0060217 | 3300049585 | Bacteria | 2119 |
| 893 | Ga0501070_0162072 | 3300049586 | Bacteria | 1843 |
| 894 | Ga0501073_0205126 | 3300049589 | Bacteria | 1362 |
| 895 | Ga0501074_0034682 | 3300049590 | Bacteria | 3658 |
| 896 | Ga0501074_0160719 | 3300049590 | Bacteria | 1604 |
| 897 | Ga0501202_000556 | 3300049652 | Bacteria | 5413 |
| 898 | Ga0501207_018216 | 3300049654 | Unclassified | 1102 |
| 899 | Ga0501217_007182 | 3300049661 | Bacteria | 2383 |
| 900 | Ga0501223_003405 | 3300049663 | Bacteria | 3471 |
| 901 | Ga0501224_000662 | 3300049664 | Bacteria | 4281 |
| 902 | Ga0501227_014783 | 3300049665 | Bacteria | 1737 |
| 903 | Ga0501242_002083 | 3300049674 | Bacteria | 2086 |
| 904 | Ga0501243_000597 | 3300049675 | Bacteria | 4875 |
| 905 | Ga0501252_003669 | 3300049682 | Unclassified | 1597 |
| 906 | Ga0501253_026702 | 3300049683 | Bacteria | 1067 |
| 907 | Ga0501257_001076 | 3300049686 | Bacteria | 5535 |
| 908 | Ga0501257_026261 | 3300049686 | Bacteria | 1389 |
| 909 | Ga0501259_000155 | 3300049688 | Bacteria | 10299 |
| 910 | Ga0501259_000915 | 3300049688 | Bacteria | 4868 |
| 911 | Ga0501221_006730 | 3300049704 | Unclassified | 1950 |
| 912 | Ga0501225_0002223 | 3300049705 | Bacteria | 5999 |
| 913 | Ga0501225_0031215 | 3300049705 | Bacteria | 1466 |
| 914 | Ga0501234_000444 | 3300049707 | Bacteria | 6230 |
| 915 | Ga0501245_000325 | 3300049708 | Bacteria | 5660 |
| 916 | Ga0501079_0079388 | 3300049741 | Bacteria | 2538 |
| 917 | Ga0501080_0116817 | 3300049742 | Bacteria | 2473 |
| 918 | Ga0501080_0265447 | 3300049742 | Bacteria | 1563 |
| 919 | Ga0501080_0437825 | 3300049742 | Bacteria | 1173 |
| 920 | Ga0501083_0022448 | 3300049744 | Bacteria | 4380 |
| 921 | Ga0501083_0073596 | 3300049744 | Bacteria | 2271 |
| 922 | Ga0501241_017865 | 3300049758 | Unclassified | 1297 |
| 923 | Ga0501268_005545 | 3300049765 | Bacteria | 1819 |
| 924 | Ga0501273_010746 | 3300049770 | Bacteria | 1130 |
| 925 | Ga0501280_015129 | 3300049776 | Bacteria | 1103 |
| 926 | Ga0501283_015883 | 3300049779 | Bacteria | 1162 |
| 927 | Ga0501035_0084081 | 3300049822 | Unclassified | 2807 |
| 928 | Ga0501035_0105981 | 3300049822 | Bacteria | 2465 |
| 929 | Ga0501035_0145956 | 3300049822 | Bacteria | 2055 |
| 930 | Ga0501035_0417977 | 3300049822 | Bacteria | 1113 |
| 931 | Ga0501044_0002352 | 3300049823 | Bacteria | 21578 |
| 932 | Ga0501044_0011986 | 3300049823 | Bacteria | 9392 |
| 933 | Ga0501044_0025772 | 3300049823 | Bacteria | 6234 |
| 934 | Ga0501044_0050958 | 3300049823 | Bacteria | 4270 |
| 935 | Ga0501044_0107114 | 3300049823 | Bacteria | 2807 |
| 936 | Ga0501044_0167070 | 3300049823 | Unclassified | 2174 |
| 937 | Ga0501044_0176022 | 3300049823 | Bacteria | 2109 |
| 938 | Ga0501044_0195803 | 3300049823 | Bacteria | 1981 |
| 939 | Ga0501284_00011 | 3300050005 | Bacteria | 131008 |
| 940 | nmdc:mga00v17_68331_c1 | 3300050491 | Unclassified | 2196 |
| 941 | nmdc:mga0k408_139188_c1 | 3300050493 | Bacteria | 1443 |
| 942 | nmdc:mga0k408_5876_c1 | 3300050493 | Bacteria | 6540 |
| 943 | nmdc:mga0k408_87688_c1 | 3300050493 | Bacteria | 1828 |
| 944 | nmdc:mga05p37_504936_c1 | 3300050507 | Bacteria | 1387 |
| 945 | nmdc:mga05p37_5549_c1 | 3300050507 | Bacteria | 14824 |
| 946 | nmdc:mga09592_12657_c1 | 3300050508 | Bacteria | 6877 |
| 947 | nmdc:mga09592_2970_c1 | 3300050508 | Bacteria | 13746 |
| 948 | nmdc:mga09592_37657_c1 | 3300050508 | Bacteria | 4058 |
| 949 | nmdc:mga0qj67_21010_c1 | 3300050509 | Bacteria | 5005 |
| 950 | nmdc:mga06r32_62752_c1 | 3300050510 | Bacteria | 3580 |
| 951 | Ga0500578_0000027 | 3300053086 | Bacteria | 144362 |
| 952 | Ga0500646_0000241 | 3300053090 | Bacteria | 16732 |
| 953 | Ga0500646_0026088 | 3300053090 | Bacteria | 1582 |
| 954 | Ga0500583_0000042 | 3300053092 | Bacteria | 82406 |
| 955 | Ga0500583_0000651 | 3300053092 | Bacteria | 10276 |
| 956 | Ga0500583_0003160 | 3300053092 | Bacteria | 5116 |
| 957 | Ga0500562_000004 | 3300053108 | Bacteria | 270087 |
| 958 | Ga0500572_006582 | 3300053111 | Bacteria | 2666 |
| 959 | Ga0500594_0015123 | 3300053118 | Bacteria | 1858 |
| 960 | Ga0500642_0056099 | 3300053130 | Unclassified | 1754 |
| 961 | Ga0500568_0000407 | 3300053139 | Bacteria | 32843 |
| 962 | Ga0500568_0039687 | 3300053139 | Unclassified | 1899 |
| 963 | Ga0500616_0036566 | 3300053153 | Bacteria | 2665 |
| 964 | Ga0500616_0097578 | 3300053153 | Bacteria | 1442 |
| 965 | Ga0500622_0002745 | 3300053156 | Bacteria | 12426 |
| 966 | Ga0500622_0004729 | 3300053156 | Bacteria | 8410 |
| 967 | Ga0500639_079843 | 3300053163 | Bacteria | 1650 |
| 968 | Ga0500636_0071028 | 3300053177 | Bacteria | 2019 |
| 969 | Ga0500611_000007 | 3300053727 | Bacteria | 210964 |
| 970 | Ga0500611_009690 | 3300053727 | Bacteria | 1535 |
| 971 | Ga0500645_008755 | 3300053730 | Bacteria | 3432 |
| 972 | Ga0501082_0235193 | 3300060353 | Bacteria | 1594 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042015 | Ga0439462_0082326 | Ga0439462_0082326_23_838 | 268 |
| 2 | 3300036647 | Ga0316582_0338069 | Ga0316582_0338069_16_840 | 271 |
| 3 | 3300037588 | Ga0316581_0106146 | Ga0316581_0106146_22_846 | 271 |
| 4 | 3300049573 | Ga0501037_0222459 | Ga0501037_0222459_101_979 | 289 |
| 5 | 3300049823 | Ga0501044_0050958 | Ga0501044_0050958_2802_3680 | 289 |
| 6 | 3300005335 | Ga0070666_10221353 | Ga0070666_102213531 | 293 |
| 7 | 3300005355 | Ga0070671_100006354 | Ga0070671_1000063543 | 293 |
| 8 | 3300005459 | Ga0068867_100094717 | Ga0068867_1000947172 | 293 |
| 9 | 3300005841 | Ga0068863_100028484 | Ga0068863_1000284844 | 293 |
| 10 | 3300005842 | Ga0068858_100216307 | Ga0068858_1002163072 | 293 |
| 11 | 3300005843 | Ga0068860_100536505 | Ga0068860_1005365051 | 293 |
| 12 | 3300006237 | Ga0097621_100000489 | Ga0097621_10000048913 | 293 |
| 13 | 3300006358 | Ga0068871_100000419 | Ga0068871_1000004199 | 293 |
| 14 | 3300013297 | Ga0157378_10020824 | Ga0157378_100208242 | 293 |
| 15 | 3300013306 | Ga0163162_10001017 | Ga0163162_100010175 | 293 |
| 16 | 3300013308 | Ga0157375_10000134 | Ga0157375_1000013443 | 293 |
| 17 | 3300014969 | Ga0157376_10001080 | Ga0157376_100010801 | 293 |
| 18 | 3300017792 | Ga0163161_10009332 | Ga0163161_100093325 | 293 |
| 19 | 3300025903 | Ga0207680_10235041 | Ga0207680_102350412 | 293 |
| 20 | 3300025931 | Ga0207644_10004058 | Ga0207644_100040584 | 293 |
| 21 | 3300026089 | Ga0207648_10135085 | Ga0207648_101350852 | 293 |
| 22 | 3300026121 | Ga0207683_10340472 | Ga0207683_103404722 | 293 |
| 23 | 3300048905 | Ga0496102_0317033 | Ga0496102_0317033_468_1457 | 293 |
| 24 | 3300048917 | Ga0496114_0117615 | Ga0496114_0117615_58_1047 | 293 |
| 25 | 3300042435 | Ga0439434_0047558 | Ga0439434_0047558_31_1014 | 295 |
| 26 | 3300049575 | Ga0501039_0490293 | Ga0501039_0490293_15_917 | 297 |
| 27 | 3300013296 | Ga0157374_10034561 | Ga0157374_100345614 | 298 |
| 28 | 3300013308 | Ga0157375_10189337 | Ga0157375_101893373 | 298 |
| 29 | 3300014968 | Ga0157379_10062987 | Ga0157379_100629873 | 298 |
| 30 | 3300025893 | Ga0207682_10006983 | Ga0207682_100069832 | 298 |
| 31 | 3300025940 | Ga0207691_10023719 | Ga0207691_100237194 | 298 |
| 32 | 3300025960 | Ga0207651_10042532 | Ga0207651_100425322 | 298 |
| 33 | 3300005331 | Ga0070670_100245947 | Ga0070670_1002459471 | 299 |
| 34 | 3300005334 | Ga0068869_100166170 | Ga0068869_1001661702 | 299 |
| 35 | 3300005456 | Ga0070678_100093372 | Ga0070678_1000933722 | 299 |
| 36 | 3300005459 | Ga0068867_100199215 | Ga0068867_1001992152 | 299 |
| 37 | 3300005618 | Ga0068864_100096174 | Ga0068864_1000961742 | 299 |
| 38 | 3300006881 | Ga0068865_100074189 | Ga0068865_1000741892 | 299 |
| 39 | 3300013306 | Ga0163162_10069689 | Ga0163162_100696891 | 299 |
| 40 | 3300013308 | Ga0157375_10563744 | Ga0157375_105637442 | 299 |
| 41 | 3300017792 | Ga0163161_10232229 | Ga0163161_102322291 | 299 |
| 42 | 3300025925 | Ga0207650_10161218 | Ga0207650_101612182 | 299 |
| 43 | 3300025942 | Ga0207689_10174932 | Ga0207689_101749321 | 299 |
| 44 | 3300026121 | Ga0207683_10043729 | Ga0207683_100437293 | 299 |
| 45 | 3300044712 | Ga0453684_0214306 | Ga0453684_0214306_951_1874 | 304 |
| 46 | 3300005617 | Ga0068859_100193607 | Ga0068859_1001936072 | 305 |
| 47 | 3300005834 | Ga0068851_10260391 | Ga0068851_102603911 | 305 |
| 48 | 3300005843 | Ga0068860_100249360 | Ga0068860_1002493602 | 305 |
| 49 | 3300006931 | Ga0097620_100193601 | Ga0097620_1001936012 | 305 |
| 50 | 3300021384 | Ga0213876_10003364 | Ga0213876_100033647 | 305 |
| 51 | 3300025904 | Ga0207647_10025262 | Ga0207647_100252623 | 305 |
| 52 | 3300025920 | Ga0207649_10075155 | Ga0207649_100751552 | 305 |
| 53 | 3300025942 | Ga0207689_10013229 | Ga0207689_100132291 | 305 |
| 54 | 3300025945 | Ga0207679_10021105 | Ga0207679_100211054 | 305 |
| 55 | 3300026067 | Ga0207678_10171365 | Ga0207678_101713652 | 305 |
| 56 | 3300026088 | Ga0207641_10515453 | Ga0207641_105154532 | 305 |
| 57 | 3300026095 | Ga0207676_10025764 | Ga0207676_100257642 | 305 |
| 58 | 3300031903 | Ga0307407_10199329 | Ga0307407_101993291 | 305 |
| 59 | 3300037471 | Ga0395905_0067168 | Ga0395905_0067168_2381_3307 | 305 |
| 60 | 3300039437 | Ga0436365_1658325 | Ga0436365_1658325_3419_4345 | 305 |
| 61 | 3300042876 | Ga0451577_0117342 | Ga0451577_0117342_1445_2371 | 305 |
| 62 | 3300049575 | Ga0501039_0019257 | Ga0501039_0019257_4270_5196 | 305 |
| 63 | 3300053153 | Ga0500616_0097578 | Ga0500616_0097578_469_1395 | 305 |
| 64 | 3300003316 | rootH1_10033438 | rootH1_100334383 | 306 |
| 65 | 3300049571 | Ga0501034_0566480 | Ga0501034_0566480_44_991 | 308 |
| 66 | 3300049742 | Ga0501080_0437825 | Ga0501080_0437825_199_1146 | 308 |
| 67 | 3300006358 | Ga0068871_100270480 | Ga0068871_1002704801 | 311 |
| 68 | 3300009553 | Ga0105249_10022267 | Ga0105249_100222672 | 312 |
| 69 | 3300013306 | Ga0163162_10012423 | Ga0163162_100124233 | 312 |
| 70 | 3300013308 | Ga0157375_10070820 | Ga0157375_100708202 | 312 |
| 71 | 3300025961 | Ga0207712_10138273 | Ga0207712_101382731 | 312 |
| 72 | 3300006881 | Ga0068865_100030779 | Ga0068865_1000307794 | 315 |
| 73 | 3300026023 | Ga0207677_10068565 | Ga0207677_100685651 | 315 |
| 74 | 3300026118 | Ga0207675_100096566 | Ga0207675_1000965662 | 315 |
| 75 | 3300046535 | Ga0495586_0133191 | Ga0495586_0133191_18_974 | 315 |
| 76 | 3300005333 | Ga0070677_10003327 | Ga0070677_100033273 | 317 |
| 77 | 3300005354 | Ga0070675_100018400 | Ga0070675_1000184005 | 317 |
| 78 | 3300005364 | Ga0070673_100063512 | Ga0070673_1000635122 | 317 |
| 79 | 3300006237 | Ga0097621_100033562 | Ga0097621_1000335624 | 317 |
| 80 | 3300014326 | Ga0157380_10150409 | Ga0157380_101504092 | 317 |
| 81 | 3300025908 | Ga0207643_10096354 | Ga0207643_100963542 | 317 |
| 82 | 3300042876 | Ga0451577_0172493 | Ga0451577_0172493_316_1281 | 318 |
| 83 | 3300044712 | Ga0453684_0000108 | Ga0453684_0000108_327025_327990 | 318 |
| 84 | 3300044712 | Ga0453684_0001771 | Ga0453684_0001771_9818_10783 | 318 |
| 85 | 3300045051 | Ga0451576_0016411 | Ga0451576_0016411_5742_6707 | 318 |
| 86 | 3300031691 | Ga0316579_10041913 | Ga0316579_100419132 | 319 |
| 87 | 3300037588 | Ga0316581_0001785 | Ga0316581_0001785_1653_2621 | 319 |
| 88 | 3300025900 | Ga0207710_10002801 | Ga0207710_100028012 | 320 |
| 89 | iso_pu_bacteria | 2738541278 | 2738727650 | 320 |
| 90 | iso_pu_bacteria | 2818991444 | 2819590605 | 320 |
| 91 | iso_pu_bacteria | 2929154850 | 2929156010 | 320 |
| 92 | 3300031344 | Ga0265316_10001346 | Ga0265316_1000134613 | 321 |
| 93 | 3300037418 | Ga0395900_0008236 | Ga0395900_0008236_1299_2279 | 321 |
| 94 | 3300037471 | Ga0395905_0082304 | Ga0395905_0082304_1394_2374 | 321 |
| 95 | 3300048904 | Ga0496101_0054484 | Ga0496101_0054484_1350_2327 | 321 |
| 96 | 3300003316 | rootH1_10051512 | rootH1_1005151213 | 322 |
| 97 | 3300005295 | Ga0065707_10107553 | Ga0065707_101075532 | 322 |
| 98 | 3300005330 | Ga0070690_100066010 | Ga0070690_1000660102 | 322 |
| 99 | 3300005354 | Ga0070675_100002264 | Ga0070675_10000226410 | 322 |
| 100 | 3300005365 | Ga0070688_100004500 | Ga0070688_1000045006 | 322 |
| 101 | 3300005543 | Ga0070672_100020254 | Ga0070672_1000202541 | 322 |
| 102 | 3300005578 | Ga0068854_100101146 | Ga0068854_1001011462 | 322 |
| 103 | 3300005719 | Ga0068861_100013192 | Ga0068861_1000131925 | 322 |
| 104 | 3300005840 | Ga0068870_10010987 | Ga0068870_100109875 | 322 |
| 105 | 3300005844 | Ga0068862_100028062 | Ga0068862_1000280625 | 322 |
| 106 | 3300009094 | Ga0111539_10007214 | Ga0111539_1000721411 | 322 |
| 107 | 3300009148 | Ga0105243_10055846 | Ga0105243_100558462 | 322 |
| 108 | 3300009553 | Ga0105249_10082575 | Ga0105249_100825752 | 322 |
| 109 | 3300014745 | Ga0157377_10000660 | Ga0157377_100006603 | 322 |
| 110 | 3300025908 | Ga0207643_10080915 | Ga0207643_100809152 | 322 |
| 111 | 3300025936 | Ga0207670_10049393 | Ga0207670_100493932 | 322 |
| 112 | 3300026118 | Ga0207675_100001069 | Ga0207675_1000010694 | 322 |
| 113 | 3300035115 | Ga0373941_0009668 | Ga0373941_0009668_478_1458 | 322 |
| 114 | 3300045976 | Ga0466967_0076668 | Ga0466967_0076668_719_1702 | 322 |
| 115 | 3300045976 | Ga0466967_0395490 | Ga0466967_0395490_32_1015 | 322 |
| 116 | 3300046615 | Ga0495656_0000004 | Ga0495656_0000004_25790_26773 | 322 |
| 117 | 3300046664 | Ga0495659_0000580 | Ga0495659_0000580_8204_9187 | 322 |
| 118 | 3300005329 | Ga0070683_100081383 | Ga0070683_1000813832 | 323 |
| 119 | 3300005335 | Ga0070666_10094392 | Ga0070666_100943922 | 323 |
| 120 | 3300005336 | Ga0070680_100010215 | Ga0070680_1000102155 | 323 |
| 121 | 3300005336 | Ga0070680_100070426 | Ga0070680_1000704262 | 323 |
| 122 | 3300005338 | Ga0068868_100034133 | Ga0068868_1000341332 | 323 |
| 123 | 3300005339 | Ga0070660_100041686 | Ga0070660_1000416864 | 323 |
| 124 | 3300005340 | Ga0070689_100035015 | Ga0070689_1000350152 | 323 |
| 125 | 3300005345 | Ga0070692_10086390 | Ga0070692_100863902 | 323 |
| 126 | 3300005354 | Ga0070675_100057499 | Ga0070675_1000574992 | 323 |
| 127 | 3300005355 | Ga0070671_100061563 | Ga0070671_1000615632 | 323 |
| 128 | 3300005356 | Ga0070674_100083656 | Ga0070674_1000836562 | 323 |
| 129 | 3300005367 | Ga0070667_100051778 | Ga0070667_1000517782 | 323 |
| 130 | 3300005367 | Ga0070667_100112464 | Ga0070667_1001124642 | 323 |
| 131 | 3300005455 | Ga0070663_100085750 | Ga0070663_1000857502 | 323 |
| 132 | 3300005458 | Ga0070681_10040195 | Ga0070681_100401952 | 323 |
| 133 | 3300005458 | Ga0070681_10064938 | Ga0070681_100649383 | 323 |
| 134 | 3300005458 | Ga0070681_10366796 | Ga0070681_103667961 | 323 |
| 135 | 3300005459 | Ga0068867_100009666 | Ga0068867_1000096664 | 323 |
| 136 | 3300005530 | Ga0070679_100001616 | Ga0070679_10000161614 | 323 |
| 137 | 3300005530 | Ga0070679_100021368 | Ga0070679_1000213682 | 323 |
| 138 | 3300005530 | Ga0070679_100121092 | Ga0070679_1001210922 | 323 |
| 139 | 3300005530 | Ga0070679_100122840 | Ga0070679_1001228402 | 323 |
| 140 | 3300005543 | Ga0070672_100260306 | Ga0070672_1002603062 | 323 |
| 141 | 3300005563 | Ga0068855_100000351 | Ga0068855_10000035146 | 323 |
| 142 | 3300005563 | Ga0068855_100025281 | Ga0068855_1000252814 | 323 |
| 143 | 3300005563 | Ga0068855_100062948 | Ga0068855_1000629482 | 323 |
| 144 | 3300005563 | Ga0068855_100615828 | Ga0068855_1006158281 | 323 |
| 145 | 3300005578 | Ga0068854_100094159 | Ga0068854_1000941592 | 323 |
| 146 | 3300005616 | Ga0068852_100018176 | Ga0068852_1000181765 | 323 |
| 147 | 3300005616 | Ga0068852_100286069 | Ga0068852_1002860692 | 323 |
| 148 | 3300005617 | Ga0068859_100050537 | Ga0068859_1000505374 | 323 |
| 149 | 3300005843 | Ga0068860_100036404 | Ga0068860_1000364042 | 323 |
| 150 | 3300005844 | Ga0068862_100023254 | Ga0068862_1000232543 | 323 |
| 151 | 3300006051 | Ga0075364_10172039 | Ga0075364_101720392 | 323 |
| 152 | 3300006880 | Ga0075429_100306491 | Ga0075429_1003064911 | 323 |
| 153 | 3300006931 | Ga0097620_100050537 | Ga0097620_1000505372 | 323 |
| 154 | 3300013100 | Ga0157373_10006436 | Ga0157373_100064364 | 323 |
| 155 | 3300013100 | Ga0157373_10018871 | Ga0157373_100188713 | 323 |
| 156 | 3300013102 | Ga0157371_10002334 | Ga0157371_100023347 | 323 |
| 157 | 3300013102 | Ga0157371_10006507 | Ga0157371_100065074 | 323 |
| 158 | 3300013102 | Ga0157371_10007605 | Ga0157371_100076057 | 323 |
| 159 | 3300013102 | Ga0157371_10032312 | Ga0157371_100323122 | 323 |
| 160 | 3300013104 | Ga0157370_10001463 | Ga0157370_1000146320 | 323 |
| 161 | 3300013104 | Ga0157370_10001948 | Ga0157370_1000194820 | 323 |
| 162 | 3300013104 | Ga0157370_10003125 | Ga0157370_1000312510 | 323 |
| 163 | 3300013105 | Ga0157369_10043116 | Ga0157369_100431163 | 323 |
| 164 | 3300013105 | Ga0157369_10046180 | Ga0157369_100461804 | 323 |
| 165 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002138 | 323 |
| 166 | 3300013297 | Ga0157378_10001024 | Ga0157378_1000102413 | 323 |
| 167 | 3300013306 | Ga0163162_10411001 | Ga0163162_104110012 | 323 |
| 168 | 3300013307 | Ga0157372_10039725 | Ga0157372_100397253 | 323 |
| 169 | 3300013307 | Ga0157372_10050213 | Ga0157372_100502132 | 323 |
| 170 | 3300013307 | Ga0157372_10076264 | Ga0157372_100762643 | 323 |
| 171 | 3300013307 | Ga0157372_10171244 | Ga0157372_101712442 | 323 |
| 172 | 3300013307 | Ga0157372_10342281 | Ga0157372_103422812 | 323 |
| 173 | 3300014326 | Ga0157380_10648820 | Ga0157380_106488201 | 323 |
| 174 | 3300014745 | Ga0157377_10004324 | Ga0157377_100043242 | 323 |
| 175 | 3300014969 | Ga0157376_10006164 | Ga0157376_100061643 | 323 |
| 176 | 3300025907 | Ga0207645_10027872 | Ga0207645_100278722 | 323 |
| 177 | 3300025909 | Ga0207705_10099865 | Ga0207705_100998652 | 323 |
| 178 | 3300025909 | Ga0207705_10244474 | Ga0207705_102444741 | 323 |
| 179 | 3300025912 | Ga0207707_10090982 | Ga0207707_100909822 | 323 |
| 180 | 3300025912 | Ga0207707_10154907 | Ga0207707_101549073 | 323 |
| 181 | 3300025912 | Ga0207707_10348212 | Ga0207707_103482121 | 323 |
| 182 | 3300025917 | Ga0207660_10073469 | Ga0207660_100734692 | 323 |
| 183 | 3300025917 | Ga0207660_10149659 | Ga0207660_101496592 | 323 |
| 184 | 3300025918 | Ga0207662_10005444 | Ga0207662_100054442 | 323 |
| 185 | 3300025919 | Ga0207657_10012535 | Ga0207657_100125353 | 323 |
| 186 | 3300025919 | Ga0207657_10037421 | Ga0207657_100374213 | 323 |
| 187 | 3300025919 | Ga0207657_10061002 | Ga0207657_100610022 | 323 |
| 188 | 3300025921 | Ga0207652_10000055 | Ga0207652_1000005564 | 323 |
| 189 | 3300025921 | Ga0207652_10003097 | Ga0207652_1000309711 | 323 |
| 190 | 3300025921 | Ga0207652_10016240 | Ga0207652_100162404 | 323 |
| 191 | 3300025921 | Ga0207652_10046663 | Ga0207652_100466632 | 323 |
| 192 | 3300025921 | Ga0207652_10293079 | Ga0207652_102930791 | 323 |
| 193 | 3300025923 | Ga0207681_10025072 | Ga0207681_100250722 | 323 |
| 194 | 3300025925 | Ga0207650_10296982 | Ga0207650_102969822 | 323 |
| 195 | 3300025926 | Ga0207659_10080766 | Ga0207659_100807662 | 323 |
| 196 | 3300025931 | Ga0207644_10044879 | Ga0207644_100448792 | 323 |
| 197 | 3300025932 | Ga0207690_10007149 | Ga0207690_100071495 | 323 |
| 198 | 3300025932 | Ga0207690_10017444 | Ga0207690_100174441 | 323 |
| 199 | 3300025934 | Ga0207686_10365701 | Ga0207686_103657011 | 323 |
| 200 | 3300025936 | Ga0207670_10134537 | Ga0207670_101345372 | 323 |
| 201 | 3300025940 | Ga0207691_10050317 | Ga0207691_100503171 | 323 |
| 202 | 3300025942 | Ga0207689_10038375 | Ga0207689_100383752 | 323 |
| 203 | 3300025945 | Ga0207679_10020849 | Ga0207679_100208492 | 323 |
| 204 | 3300025949 | Ga0207667_10000721 | Ga0207667_1000072133 | 323 |
| 205 | 3300025949 | Ga0207667_10011490 | Ga0207667_100114905 | 323 |
| 206 | 3300025949 | Ga0207667_10075991 | Ga0207667_100759912 | 323 |
| 207 | 3300025960 | Ga0207651_10038783 | Ga0207651_100387832 | 323 |
| 208 | 3300025981 | Ga0207640_10115742 | Ga0207640_101157422 | 323 |
| 209 | 3300026023 | Ga0207677_10325428 | Ga0207677_103254282 | 323 |
| 210 | 3300026041 | Ga0207639_10401623 | Ga0207639_104016231 | 323 |
| 211 | 3300026067 | Ga0207678_10048748 | Ga0207678_100487481 | 323 |
| 212 | 3300026067 | Ga0207678_10093966 | Ga0207678_100939661 | 323 |
| 213 | 3300026075 | Ga0207708_10062482 | Ga0207708_100624823 | 323 |
| 214 | 3300026078 | Ga0207702_10014859 | Ga0207702_100148595 | 323 |
| 215 | 3300026116 | Ga0207674_10023234 | Ga0207674_100232342 | 323 |
| 216 | 3300026116 | Ga0207674_10153912 | Ga0207674_101539122 | 323 |
| 217 | 3300026121 | Ga0207683_10182867 | Ga0207683_101828672 | 323 |
| 218 | 3300026142 | Ga0207698_10001738 | Ga0207698_1000173811 | 323 |
| 219 | 3300026142 | Ga0207698_10282447 | Ga0207698_102824472 | 323 |
| 220 | 3300028381 | Ga0268264_10020393 | Ga0268264_100203934 | 323 |
| 221 | 3300028800 | Ga0265338_10000408 | Ga0265338_100004089 | 323 |
| 222 | 3300037466 | Ga0395898_0053541 | Ga0395898_0053541_1198_2178 | 323 |
| 223 | 3300037471 | Ga0395905_0000040 | Ga0395905_0000040_82066_83082 | 323 |
| 224 | 3300037471 | Ga0395905_0176205 | Ga0395905_0176205_309_1289 | 323 |
| 225 | 3300038443 | Ga0395901_0042335 | Ga0395901_0042335_1325_2305 | 323 |
| 226 | 3300038443 | Ga0395901_0072744 | Ga0395901_0072744_612_1592 | 323 |
| 227 | 3300042007 | Ga0439449_0006238 | Ga0439449_0006238_202_1182 | 323 |
| 228 | 3300046507 | Ga0495606_0005219 | Ga0495606_0005219_3622_4599 | 323 |
| 229 | 3300049569 | Ga0501032_0000105 | Ga0501032_0000105_28405_29388 | 323 |
| 230 | 3300049571 | Ga0501034_0000363 | Ga0501034_0000363_17294_18289 | 323 |
| 231 | 3300049572 | Ga0501036_0015178 | Ga0501036_0015178_1444_2439 | 323 |
| 232 | 3300049574 | Ga0501038_0086995 | Ga0501038_0086995_280_1275 | 323 |
| 233 | 3300049654 | Ga0501207_018216 | Ga0501207_018216_61_1041 | 323 |
| 234 | 3300049663 | Ga0501223_003405 | Ga0501223_003405_2304_3284 | 323 |
| 235 | 3300049664 | Ga0501224_000662 | Ga0501224_000662_1757_2737 | 323 |
| 236 | 3300049675 | Ga0501243_000597 | Ga0501243_000597_507_1487 | 323 |
| 237 | 3300049682 | Ga0501252_003669 | Ga0501252_003669_49_1029 | 323 |
| 238 | 3300049686 | Ga0501257_026261 | Ga0501257_026261_352_1332 | 323 |
| 239 | 3300049688 | Ga0501259_000155 | Ga0501259_000155_9151_10131 | 323 |
| 240 | 3300049704 | Ga0501221_006730 | Ga0501221_006730_619_1599 | 323 |
| 241 | 3300049707 | Ga0501234_000444 | Ga0501234_000444_4420_5400 | 323 |
| 242 | 3300049708 | Ga0501245_000325 | Ga0501245_000325_2525_3505 | 323 |
| 243 | 3300049758 | Ga0501241_017865 | Ga0501241_017865_75_1055 | 323 |
| 244 | 3300049770 | Ga0501273_010746 | Ga0501273_010746_79_1059 | 323 |
| 245 | 3300049822 | Ga0501035_0084081 | Ga0501035_0084081_1592_2572 | 323 |
| 246 | 3300049823 | Ga0501044_0107114 | Ga0501044_0107114_153_1133 | 323 |
| 247 | 3300050491 | nmdc:mga00v17_68331_c1 | nmdc:mga00v17_68331_c1_842_1837 | 323 |
| 248 | 3300002459 | JGI24751J29686_10001328 | JGI24751J29686_100013284 | 324 |
| 249 | 3300003323 | rootH1_10078088 | rootH1_100780886 | 324 |
| 250 | 3300003323 | rootH1_10103550 | rootH1_101035504 | 324 |
| 251 | 3300005288 | Ga0065714_10125089 | Ga0065714_101250891 | 324 |
| 252 | 3300005290 | Ga0065712_10070715 | Ga0065712_100707153 | 324 |
| 253 | 3300005293 | Ga0065715_10127067 | Ga0065715_101270672 | 324 |
| 254 | 3300005293 | Ga0065715_10139861 | Ga0065715_101398612 | 324 |
| 255 | 3300005295 | Ga0065707_10010810 | Ga0065707_100108102 | 324 |
| 256 | 3300005328 | Ga0070676_10001251 | Ga0070676_100012515 | 324 |
| 257 | 3300005328 | Ga0070676_10009728 | Ga0070676_100097286 | 324 |
| 258 | 3300005328 | Ga0070676_10028708 | Ga0070676_100287082 | 324 |
| 259 | 3300005328 | Ga0070676_10161613 | Ga0070676_101616131 | 324 |
| 260 | 3300005329 | Ga0070683_100010127 | Ga0070683_1000101273 | 324 |
| 261 | 3300005329 | Ga0070683_100054784 | Ga0070683_1000547841 | 324 |
| 262 | 3300005329 | Ga0070683_100076884 | Ga0070683_1000768845 | 324 |
| 263 | 3300005329 | Ga0070683_100299434 | Ga0070683_1002994342 | 324 |
| 264 | 3300005330 | Ga0070690_100123210 | Ga0070690_1001232102 | 324 |
| 265 | 3300005331 | Ga0070670_100012438 | Ga0070670_1000124382 | 324 |
| 266 | 3300005331 | Ga0070670_100037182 | Ga0070670_1000371823 | 324 |
| 267 | 3300005331 | Ga0070670_100038260 | Ga0070670_1000382601 | 324 |
| 268 | 3300005331 | Ga0070670_100052058 | Ga0070670_1000520583 | 324 |
| 269 | 3300005331 | Ga0070670_100068287 | Ga0070670_1000682872 | 324 |
| 270 | 3300005331 | Ga0070670_100129098 | Ga0070670_1001290982 | 324 |
| 271 | 3300005331 | Ga0070670_100137765 | Ga0070670_1001377652 | 324 |
| 272 | 3300005331 | Ga0070670_100428721 | Ga0070670_1004287211 | 324 |
| 273 | 3300005334 | Ga0068869_100021417 | Ga0068869_1000214174 | 324 |
| 274 | 3300005334 | Ga0068869_100047178 | Ga0068869_1000471783 | 324 |
| 275 | 3300005334 | Ga0068869_100084375 | Ga0068869_1000843752 | 324 |
| 276 | 3300005334 | Ga0068869_100102078 | Ga0068869_1001020781 | 324 |
| 277 | 3300005335 | Ga0070666_10000024 | Ga0070666_1000002471 | 324 |
| 278 | 3300005335 | Ga0070666_10000913 | Ga0070666_100009137 | 324 |
| 279 | 3300005335 | Ga0070666_10021112 | Ga0070666_100211122 | 324 |
| 280 | 3300005335 | Ga0070666_10072432 | Ga0070666_100724322 | 324 |
| 281 | 3300005335 | Ga0070666_10119228 | Ga0070666_101192282 | 324 |
| 282 | 3300005337 | Ga0070682_100000054 | Ga0070682_10000005458 | 324 |
| 283 | 3300005337 | Ga0070682_100000460 | Ga0070682_10000046016 | 324 |
| 284 | 3300005338 | Ga0068868_100002272 | Ga0068868_1000022723 | 324 |
| 285 | 3300005338 | Ga0068868_100020428 | Ga0068868_1000204282 | 324 |
| 286 | 3300005338 | Ga0068868_100048811 | Ga0068868_1000488112 | 324 |
| 287 | 3300005338 | Ga0068868_100088422 | Ga0068868_1000884222 | 324 |
| 288 | 3300005338 | Ga0068868_100301234 | Ga0068868_1003012341 | 324 |
| 289 | 3300005339 | Ga0070660_100211037 | Ga0070660_1002110373 | 324 |
| 290 | 3300005340 | Ga0070689_100009290 | Ga0070689_1000092901 | 324 |
| 291 | 3300005340 | Ga0070689_100105916 | Ga0070689_1001059161 | 324 |
| 292 | 3300005341 | Ga0070691_10011617 | Ga0070691_100116173 | 324 |
| 293 | 3300005343 | Ga0070687_100211194 | Ga0070687_1002111941 | 324 |
| 294 | 3300005344 | Ga0070661_100000277 | Ga0070661_10000027718 | 324 |
| 295 | 3300005344 | Ga0070661_100008859 | Ga0070661_1000088594 | 324 |
| 296 | 3300005344 | Ga0070661_100070422 | Ga0070661_1000704222 | 324 |
| 297 | 3300005347 | Ga0070668_100000036 | Ga0070668_10000003626 | 324 |
| 298 | 3300005347 | Ga0070668_100019902 | Ga0070668_1000199022 | 324 |
| 299 | 3300005347 | Ga0070668_100044662 | Ga0070668_1000446622 | 324 |
| 300 | 3300005347 | Ga0070668_100108012 | Ga0070668_1001080122 | 324 |
| 301 | 3300005353 | Ga0070669_100014389 | Ga0070669_1000143893 | 324 |
| 302 | 3300005353 | Ga0070669_100095488 | Ga0070669_1000954882 | 324 |
| 303 | 3300005353 | Ga0070669_100225592 | Ga0070669_1002255923 | 324 |
| 304 | 3300005354 | Ga0070675_100009802 | Ga0070675_1000098027 | 324 |
| 305 | 3300005354 | Ga0070675_100084143 | Ga0070675_1000841432 | 324 |
| 306 | 3300005354 | Ga0070675_100093349 | Ga0070675_1000933493 | 324 |
| 307 | 3300005355 | Ga0070671_100066424 | Ga0070671_1000664242 | 324 |
| 308 | 3300005355 | Ga0070671_100288334 | Ga0070671_1002883342 | 324 |
| 309 | 3300005355 | Ga0070671_100424691 | Ga0070671_1004246911 | 324 |
| 310 | 3300005356 | Ga0070674_100034399 | Ga0070674_1000343992 | 324 |
| 311 | 3300005364 | Ga0070673_100000556 | Ga0070673_10000055611 | 324 |
| 312 | 3300005364 | Ga0070673_100016851 | Ga0070673_1000168512 | 324 |
| 313 | 3300005364 | Ga0070673_100028728 | Ga0070673_1000287282 | 324 |
| 314 | 3300005364 | Ga0070673_100040146 | Ga0070673_1000401464 | 324 |
| 315 | 3300005364 | Ga0070673_100090635 | Ga0070673_1000906352 | 324 |
| 316 | 3300005364 | Ga0070673_100123716 | Ga0070673_1001237161 | 324 |
| 317 | 3300005364 | Ga0070673_100198996 | Ga0070673_1001989962 | 324 |
| 318 | 3300005365 | Ga0070688_100009741 | Ga0070688_1000097412 | 324 |
| 319 | 3300005365 | Ga0070688_100050604 | Ga0070688_1000506044 | 324 |
| 320 | 3300005365 | Ga0070688_100119577 | Ga0070688_1001195771 | 324 |
| 321 | 3300005365 | Ga0070688_100207598 | Ga0070688_1002075981 | 324 |
| 322 | 3300005366 | Ga0070659_100004064 | Ga0070659_1000040645 | 324 |
| 323 | 3300005366 | Ga0070659_100151161 | Ga0070659_1001511612 | 324 |
| 324 | 3300005367 | Ga0070667_100000151 | Ga0070667_10000015110 | 324 |
| 325 | 3300005367 | Ga0070667_100032757 | Ga0070667_1000327572 | 324 |
| 326 | 3300005367 | Ga0070667_100069703 | Ga0070667_1000697033 | 324 |
| 327 | 3300005367 | Ga0070667_100096463 | Ga0070667_1000964632 | 324 |
| 328 | 3300005367 | Ga0070667_100277595 | Ga0070667_1002775952 | 324 |
| 329 | 3300005367 | Ga0070667_100339554 | Ga0070667_1003395542 | 324 |
| 330 | 3300005455 | Ga0070663_100027279 | Ga0070663_1000272792 | 324 |
| 331 | 3300005456 | Ga0070678_100014996 | Ga0070678_1000149962 | 324 |
| 332 | 3300005456 | Ga0070678_100066015 | Ga0070678_1000660152 | 324 |
| 333 | 3300005457 | Ga0070662_100001152 | Ga0070662_1000011527 | 324 |
| 334 | 3300005457 | Ga0070662_100004539 | Ga0070662_1000045398 | 324 |
| 335 | 3300005457 | Ga0070662_100476107 | Ga0070662_1004761071 | 324 |
| 336 | 3300005458 | Ga0070681_10151863 | Ga0070681_101518632 | 324 |
| 337 | 3300005459 | Ga0068867_100001821 | Ga0068867_1000018213 | 324 |
| 338 | 3300005459 | Ga0068867_100013422 | Ga0068867_1000134222 | 324 |
| 339 | 3300005459 | Ga0068867_100221391 | Ga0068867_1002213912 | 324 |
| 340 | 3300005466 | Ga0070685_10024532 | Ga0070685_100245321 | 324 |
| 341 | 3300005466 | Ga0070685_10128415 | Ga0070685_101284151 | 324 |
| 342 | 3300005471 | Ga0070698_100000791 | Ga0070698_10000079113 | 324 |
| 343 | 3300005471 | Ga0070698_100004354 | Ga0070698_1000043548 | 324 |
| 344 | 3300005530 | Ga0070679_100007747 | Ga0070679_1000077477 | 324 |
| 345 | 3300005535 | Ga0070684_100001505 | Ga0070684_1000015057 | 324 |
| 346 | 3300005535 | Ga0070684_100002570 | Ga0070684_10000257010 | 324 |
| 347 | 3300005539 | Ga0068853_100027817 | Ga0068853_1000278173 | 324 |
| 348 | 3300005539 | Ga0068853_100050606 | Ga0068853_1000506062 | 324 |
| 349 | 3300005539 | Ga0068853_100095600 | Ga0068853_1000956002 | 324 |
| 350 | 3300005539 | Ga0068853_100101790 | Ga0068853_1001017903 | 324 |
| 351 | 3300005543 | Ga0070672_100000471 | Ga0070672_10000047110 | 324 |
| 352 | 3300005543 | Ga0070672_100008357 | Ga0070672_1000083576 | 324 |
| 353 | 3300005543 | Ga0070672_100383415 | Ga0070672_1003834152 | 324 |
| 354 | 3300005544 | Ga0070686_100103219 | Ga0070686_1001032192 | 324 |
| 355 | 3300005547 | Ga0070693_100016506 | Ga0070693_1000165062 | 324 |
| 356 | 3300005548 | Ga0070665_100000009 | Ga0070665_100000009437 | 324 |
| 357 | 3300005548 | Ga0070665_100001215 | Ga0070665_10000121521 | 324 |
| 358 | 3300005548 | Ga0070665_100078363 | Ga0070665_1000783632 | 324 |
| 359 | 3300005563 | Ga0068855_100031346 | Ga0068855_1000313464 | 324 |
| 360 | 3300005563 | Ga0068855_100121742 | Ga0068855_1001217422 | 324 |
| 361 | 3300005564 | Ga0070664_100015973 | Ga0070664_1000159732 | 324 |
| 362 | 3300005564 | Ga0070664_100060527 | Ga0070664_1000605272 | 324 |
| 363 | 3300005564 | Ga0070664_100087930 | Ga0070664_1000879303 | 324 |
| 364 | 3300005577 | Ga0068857_100014912 | Ga0068857_1000149123 | 324 |
| 365 | 3300005577 | Ga0068857_100043833 | Ga0068857_1000438333 | 324 |
| 366 | 3300005577 | Ga0068857_100085530 | Ga0068857_1000855304 | 324 |
| 367 | 3300005577 | Ga0068857_100345480 | Ga0068857_1003454802 | 324 |
| 368 | 3300005578 | Ga0068854_100035369 | Ga0068854_1000353694 | 324 |
| 369 | 3300005578 | Ga0068854_100054384 | Ga0068854_1000543842 | 324 |
| 370 | 3300005578 | Ga0068854_100120901 | Ga0068854_1001209012 | 324 |
| 371 | 3300005614 | Ga0068856_100017543 | Ga0068856_1000175435 | 324 |
| 372 | 3300005614 | Ga0068856_100021165 | Ga0068856_1000211652 | 324 |
| 373 | 3300005616 | Ga0068852_100006236 | Ga0068852_1000062362 | 324 |
| 374 | 3300005616 | Ga0068852_100016758 | Ga0068852_1000167582 | 324 |
| 375 | 3300005616 | Ga0068852_100018083 | Ga0068852_1000180832 | 324 |
| 376 | 3300005616 | Ga0068852_100040366 | Ga0068852_1000403663 | 324 |
| 377 | 3300005616 | Ga0068852_100050384 | Ga0068852_1000503842 | 324 |
| 378 | 3300005616 | Ga0068852_100076301 | Ga0068852_1000763012 | 324 |
| 379 | 3300005616 | Ga0068852_100149170 | Ga0068852_1001491702 | 324 |
| 380 | 3300005617 | Ga0068859_100000018 | Ga0068859_100000018206 | 324 |
| 381 | 3300005617 | Ga0068859_100000727 | Ga0068859_1000007278 | 324 |
| 382 | 3300005617 | Ga0068859_100082282 | Ga0068859_1000822822 | 324 |
| 383 | 3300005617 | Ga0068859_100094668 | Ga0068859_1000946682 | 324 |
| 384 | 3300005617 | Ga0068859_100103911 | Ga0068859_1001039112 | 324 |
| 385 | 3300005617 | Ga0068859_100171514 | Ga0068859_1001715142 | 324 |
| 386 | 3300005617 | Ga0068859_100285069 | Ga0068859_1002850691 | 324 |
| 387 | 3300005618 | Ga0068864_100001161 | Ga0068864_1000011616 | 324 |
| 388 | 3300005618 | Ga0068864_100003796 | Ga0068864_1000037962 | 324 |
| 389 | 3300005618 | Ga0068864_100009228 | Ga0068864_1000092286 | 324 |
| 390 | 3300005618 | Ga0068864_100033921 | Ga0068864_1000339213 | 324 |
| 391 | 3300005618 | Ga0068864_100117879 | Ga0068864_1001178791 | 324 |
| 392 | 3300005618 | Ga0068864_100154045 | Ga0068864_1001540452 | 324 |
| 393 | 3300005718 | Ga0068866_10011090 | Ga0068866_100110903 | 324 |
| 394 | 3300005719 | Ga0068861_100028014 | Ga0068861_1000280143 | 324 |
| 395 | 3300005719 | Ga0068861_100036108 | Ga0068861_1000361084 | 324 |
| 396 | 3300005719 | Ga0068861_100183267 | Ga0068861_1001832672 | 324 |
| 397 | 3300005719 | Ga0068861_100226540 | Ga0068861_1002265402 | 324 |
| 398 | 3300005719 | Ga0068861_100324462 | Ga0068861_1003244622 | 324 |
| 399 | 3300005834 | Ga0068851_10002501 | Ga0068851_100025013 | 324 |
| 400 | 3300005834 | Ga0068851_10022038 | Ga0068851_100220382 | 324 |
| 401 | 3300005834 | Ga0068851_10080575 | Ga0068851_100805752 | 324 |
| 402 | 3300005841 | Ga0068863_100001435 | Ga0068863_10000143512 | 324 |
| 403 | 3300005841 | Ga0068863_100027885 | Ga0068863_1000278853 | 324 |
| 404 | 3300005841 | Ga0068863_100039684 | Ga0068863_1000396844 | 324 |
| 405 | 3300005841 | Ga0068863_100046488 | Ga0068863_1000464882 | 324 |
| 406 | 3300005841 | Ga0068863_100064593 | Ga0068863_1000645933 | 324 |
| 407 | 3300005841 | Ga0068863_100433218 | Ga0068863_1004332181 | 324 |
| 408 | 3300005842 | Ga0068858_100001071 | Ga0068858_10000107110 | 324 |
| 409 | 3300005842 | Ga0068858_100010503 | Ga0068858_1000105036 | 324 |
| 410 | 3300005842 | Ga0068858_100139680 | Ga0068858_1001396802 | 324 |
| 411 | 3300005843 | Ga0068860_100000078 | Ga0068860_100000078126 | 324 |
| 412 | 3300005843 | Ga0068860_100000824 | Ga0068860_10000082427 | 324 |
| 413 | 3300005843 | Ga0068860_100009310 | Ga0068860_1000093105 | 324 |
| 414 | 3300005843 | Ga0068860_100025779 | Ga0068860_1000257792 | 324 |
| 415 | 3300005843 | Ga0068860_100033819 | Ga0068860_1000338194 | 324 |
| 416 | 3300005843 | Ga0068860_100233903 | Ga0068860_1002339032 | 324 |
| 417 | 3300005843 | Ga0068860_100282073 | Ga0068860_1002820732 | 324 |
| 418 | 3300005843 | Ga0068860_100371050 | Ga0068860_1003710502 | 324 |
| 419 | 3300005844 | Ga0068862_100085470 | Ga0068862_1000854702 | 324 |
| 420 | 3300005844 | Ga0068862_100140557 | Ga0068862_1001405573 | 324 |
| 421 | 3300005985 | Ga0081539_10030635 | Ga0081539_100306352 | 324 |
| 422 | 3300006173 | Ga0070716_100072149 | Ga0070716_1000721492 | 324 |
| 423 | 3300006195 | Ga0075366_10163842 | Ga0075366_101638422 | 324 |
| 424 | 3300006237 | Ga0097621_100001040 | Ga0097621_1000010404 | 324 |
| 425 | 3300006237 | Ga0097621_100001758 | Ga0097621_1000017582 | 324 |
| 426 | 3300006237 | Ga0097621_100004022 | Ga0097621_1000040229 | 324 |
| 427 | 3300006237 | Ga0097621_100014475 | Ga0097621_1000144754 | 324 |
| 428 | 3300006237 | Ga0097621_100053932 | Ga0097621_1000539322 | 324 |
| 429 | 3300006237 | Ga0097621_100067776 | Ga0097621_1000677762 | 324 |
| 430 | 3300006237 | Ga0097621_100298441 | Ga0097621_1002984412 | 324 |
| 431 | 3300006237 | Ga0097621_100401889 | Ga0097621_1004018891 | 324 |
| 432 | 3300006237 | Ga0097621_100454887 | Ga0097621_1004548871 | 324 |
| 433 | 3300006358 | Ga0068871_100003690 | Ga0068871_1000036905 | 324 |
| 434 | 3300006358 | Ga0068871_100009315 | Ga0068871_1000093153 | 324 |
| 435 | 3300006358 | Ga0068871_100010582 | Ga0068871_1000105822 | 324 |
| 436 | 3300006358 | Ga0068871_100023999 | Ga0068871_1000239994 | 324 |
| 437 | 3300006358 | Ga0068871_100046364 | Ga0068871_1000463644 | 324 |
| 438 | 3300006358 | Ga0068871_100050409 | Ga0068871_1000504092 | 324 |
| 439 | 3300006358 | Ga0068871_100353245 | Ga0068871_1003532452 | 324 |
| 440 | 3300006844 | Ga0075428_100027076 | Ga0075428_1000270766 | 324 |
| 441 | 3300006844 | Ga0075428_100099952 | Ga0075428_1000999522 | 324 |
| 442 | 3300006846 | Ga0075430_100018647 | Ga0075430_1000186473 | 324 |
| 443 | 3300006871 | Ga0075434_100082728 | Ga0075434_1000827283 | 324 |
| 444 | 3300006880 | Ga0075429_100012284 | Ga0075429_1000122845 | 324 |
| 445 | 3300006880 | Ga0075429_100027936 | Ga0075429_1000279362 | 324 |
| 446 | 3300006881 | Ga0068865_100003069 | Ga0068865_1000030694 | 324 |
| 447 | 3300006881 | Ga0068865_100006157 | Ga0068865_1000061572 | 324 |
| 448 | 3300006881 | Ga0068865_100112625 | Ga0068865_1001126253 | 324 |
| 449 | 3300006931 | Ga0097620_100000018 | Ga0097620_100000018206 | 324 |
| 450 | 3300006931 | Ga0097620_100000727 | Ga0097620_1000007278 | 324 |
| 451 | 3300006931 | Ga0097620_100082273 | Ga0097620_1000822732 | 324 |
| 452 | 3300006931 | Ga0097620_100094667 | Ga0097620_1000946672 | 324 |
| 453 | 3300006931 | Ga0097620_100103924 | Ga0097620_1001039242 | 324 |
| 454 | 3300006931 | Ga0097620_100171518 | Ga0097620_1001715182 | 324 |
| 455 | 3300006931 | Ga0097620_100285055 | Ga0097620_1002850551 | 324 |
| 456 | 3300009093 | Ga0105240_10001174 | Ga0105240_1000117411 | 324 |
| 457 | 3300009093 | Ga0105240_10006711 | Ga0105240_100067112 | 324 |
| 458 | 3300009093 | Ga0105240_10007959 | Ga0105240_1000795912 | 324 |
| 459 | 3300009093 | Ga0105240_10019358 | Ga0105240_100193586 | 324 |
| 460 | 3300009093 | Ga0105240_10026922 | Ga0105240_100269222 | 324 |
| 461 | 3300009093 | Ga0105240_10268206 | Ga0105240_102682062 | 324 |
| 462 | 3300009093 | Ga0105240_10403496 | Ga0105240_104034962 | 324 |
| 463 | 3300009094 | Ga0111539_10046265 | Ga0111539_100462652 | 324 |
| 464 | 3300009094 | Ga0111539_10456846 | Ga0111539_104568462 | 324 |
| 465 | 3300009101 | Ga0105247_10003256 | Ga0105247_100032568 | 324 |
| 466 | 3300009101 | Ga0105247_10025102 | Ga0105247_100251022 | 324 |
| 467 | 3300009101 | Ga0105247_10293309 | Ga0105247_102933091 | 324 |
| 468 | 3300009147 | Ga0114129_10019090 | Ga0114129_100190904 | 324 |
| 469 | 3300009147 | Ga0114129_10890866 | Ga0114129_108908662 | 324 |
| 470 | 3300009148 | Ga0105243_10035212 | Ga0105243_100352122 | 324 |
| 471 | 3300009174 | Ga0105241_10000113 | Ga0105241_100001136 | 324 |
| 472 | 3300009174 | Ga0105241_10008843 | Ga0105241_100088434 | 324 |
| 473 | 3300009174 | Ga0105241_10164893 | Ga0105241_101648932 | 324 |
| 474 | 3300009174 | Ga0105241_10461240 | Ga0105241_104612401 | 324 |
| 475 | 3300009176 | Ga0105242_10020045 | Ga0105242_100200456 | 324 |
| 476 | 3300009176 | Ga0105242_10036590 | Ga0105242_100365903 | 324 |
| 477 | 3300009176 | Ga0105242_10122863 | Ga0105242_101228632 | 324 |
| 478 | 3300009176 | Ga0105242_10263542 | Ga0105242_102635422 | 324 |
| 479 | 3300009177 | Ga0105248_10191674 | Ga0105248_101916742 | 324 |
| 480 | 3300009177 | Ga0105248_10252470 | Ga0105248_102524701 | 324 |
| 481 | 3300009545 | Ga0105237_10002621 | Ga0105237_100026212 | 324 |
| 482 | 3300009545 | Ga0105237_10013947 | Ga0105237_100139475 | 324 |
| 483 | 3300009545 | Ga0105237_10026452 | Ga0105237_100264522 | 324 |
| 484 | 3300009545 | Ga0105237_10249279 | Ga0105237_102492791 | 324 |
| 485 | 3300009551 | Ga0105238_10003534 | Ga0105238_1000353413 | 324 |
| 486 | 3300009551 | Ga0105238_10092377 | Ga0105238_100923772 | 324 |
| 487 | 3300009551 | Ga0105238_10329127 | Ga0105238_103291271 | 324 |
| 488 | 3300009553 | Ga0105249_10004065 | Ga0105249_1000406510 | 324 |
| 489 | 3300009553 | Ga0105249_10007291 | Ga0105249_100072913 | 324 |
| 490 | 3300009553 | Ga0105249_10008533 | Ga0105249_100085337 | 324 |
| 491 | 3300009553 | Ga0105249_10014840 | Ga0105249_100148405 | 324 |
| 492 | 3300009553 | Ga0105249_10032858 | Ga0105249_100328584 | 324 |
| 493 | 3300009553 | Ga0105249_10035500 | Ga0105249_100355004 | 324 |
| 494 | 3300009553 | Ga0105249_10041571 | Ga0105249_100415714 | 324 |
| 495 | 3300009553 | Ga0105249_10114077 | Ga0105249_101140771 | 324 |
| 496 | 3300010375 | Ga0105239_10045032 | Ga0105239_100450322 | 324 |
| 497 | 3300010375 | Ga0105239_10051853 | Ga0105239_100518534 | 324 |
| 498 | 3300010375 | Ga0105239_10061607 | Ga0105239_100616073 | 324 |
| 499 | 3300010375 | Ga0105239_10093791 | Ga0105239_100937913 | 324 |
| 500 | 3300010375 | Ga0105239_10210324 | Ga0105239_102103242 | 324 |
| 501 | 3300010375 | Ga0105239_10497852 | Ga0105239_104978521 | 324 |
| 502 | 3300011119 | Ga0105246_10023678 | Ga0105246_100236783 | 324 |
| 503 | 3300011119 | Ga0105246_10153082 | Ga0105246_101530821 | 324 |
| 504 | 3300013100 | Ga0157373_10016050 | Ga0157373_100160504 | 324 |
| 505 | 3300013100 | Ga0157373_10075484 | Ga0157373_100754842 | 324 |
| 506 | 3300013102 | Ga0157371_10001020 | Ga0157371_1000102018 | 324 |
| 507 | 3300013102 | Ga0157371_10005815 | Ga0157371_100058156 | 324 |
| 508 | 3300013102 | Ga0157371_10131355 | Ga0157371_101313552 | 324 |
| 509 | 3300013104 | Ga0157370_10010240 | Ga0157370_100102407 | 324 |
| 510 | 3300013104 | Ga0157370_10018009 | Ga0157370_100180095 | 324 |
| 511 | 3300013104 | Ga0157370_10055569 | Ga0157370_100555692 | 324 |
| 512 | 3300013105 | Ga0157369_10200311 | Ga0157369_102003112 | 324 |
| 513 | 3300013296 | Ga0157374_10000153 | Ga0157374_1000015310 | 324 |
| 514 | 3300013296 | Ga0157374_10001371 | Ga0157374_1000137118 | 324 |
| 515 | 3300013296 | Ga0157374_10013148 | Ga0157374_100131486 | 324 |
| 516 | 3300013296 | Ga0157374_10072440 | Ga0157374_100724402 | 324 |
| 517 | 3300013296 | Ga0157374_10077674 | Ga0157374_100776743 | 324 |
| 518 | 3300013296 | Ga0157374_10128472 | Ga0157374_101284723 | 324 |
| 519 | 3300013297 | Ga0157378_10010369 | Ga0157378_100103694 | 324 |
| 520 | 3300013297 | Ga0157378_10037481 | Ga0157378_100374811 | 324 |
| 521 | 3300013297 | Ga0157378_10041446 | Ga0157378_100414462 | 324 |
| 522 | 3300013297 | Ga0157378_10053851 | Ga0157378_100538512 | 324 |
| 523 | 3300013297 | Ga0157378_10054549 | Ga0157378_100545494 | 324 |
| 524 | 3300013297 | Ga0157378_10290790 | Ga0157378_102907902 | 324 |
| 525 | 3300013297 | Ga0157378_10443283 | Ga0157378_104432832 | 324 |
| 526 | 3300013306 | Ga0163162_10000040 | Ga0163162_1000004082 | 324 |
| 527 | 3300013306 | Ga0163162_10002762 | Ga0163162_1000276213 | 324 |
| 528 | 3300013306 | Ga0163162_10003821 | Ga0163162_100038212 | 324 |
| 529 | 3300013306 | Ga0163162_10004842 | Ga0163162_100048422 | 324 |
| 530 | 3300013306 | Ga0163162_10005595 | Ga0163162_100055956 | 324 |
| 531 | 3300013306 | Ga0163162_10013858 | Ga0163162_100138586 | 324 |
| 532 | 3300013306 | Ga0163162_10022133 | Ga0163162_100221332 | 324 |
| 533 | 3300013306 | Ga0163162_10031458 | Ga0163162_100314583 | 324 |
| 534 | 3300013306 | Ga0163162_10156466 | Ga0163162_101564661 | 324 |
| 535 | 3300013306 | Ga0163162_10471123 | Ga0163162_104711231 | 324 |
| 536 | 3300013306 | Ga0163162_10569159 | Ga0163162_105691591 | 324 |
| 537 | 3300013307 | Ga0157372_10012319 | Ga0157372_100123199 | 324 |
| 538 | 3300013307 | Ga0157372_10022707 | Ga0157372_100227072 | 324 |
| 539 | 3300013307 | Ga0157372_10198923 | Ga0157372_101989232 | 324 |
| 540 | 3300013308 | Ga0157375_10000407 | Ga0157375_1000040730 | 324 |
| 541 | 3300013308 | Ga0157375_10008093 | Ga0157375_100080932 | 324 |
| 542 | 3300013308 | Ga0157375_10040651 | Ga0157375_100406513 | 324 |
| 543 | 3300013308 | Ga0157375_10075732 | Ga0157375_100757322 | 324 |
| 544 | 3300013308 | Ga0157375_10144651 | Ga0157375_101446511 | 324 |
| 545 | 3300013308 | Ga0157375_10201662 | Ga0157375_102016622 | 324 |
| 546 | 3300013308 | Ga0157375_10332425 | Ga0157375_103324253 | 324 |
| 547 | 3300014325 | Ga0163163_10000110 | Ga0163163_1000011061 | 324 |
| 548 | 3300014325 | Ga0163163_10000348 | Ga0163163_1000034839 | 324 |
| 549 | 3300014325 | Ga0163163_10133369 | Ga0163163_101333692 | 324 |
| 550 | 3300014325 | Ga0163163_10143490 | Ga0163163_101434902 | 324 |
| 551 | 3300014325 | Ga0163163_10213492 | Ga0163163_102134921 | 324 |
| 552 | 3300014326 | Ga0157380_10002726 | Ga0157380_100027265 | 324 |
| 553 | 3300014326 | Ga0157380_10311836 | Ga0157380_103118361 | 324 |
| 554 | 3300014745 | Ga0157377_10039277 | Ga0157377_100392772 | 324 |
| 555 | 3300014968 | Ga0157379_10000173 | Ga0157379_1000017321 | 324 |
| 556 | 3300014968 | Ga0157379_10077186 | Ga0157379_100771862 | 324 |
| 557 | 3300014968 | Ga0157379_10087882 | Ga0157379_100878825 | 324 |
| 558 | 3300014968 | Ga0157379_10093184 | Ga0157379_100931842 | 324 |
| 559 | 3300014968 | Ga0157379_10111555 | Ga0157379_101115553 | 324 |
| 560 | 3300014969 | Ga0157376_10000535 | Ga0157376_1000053513 | 324 |
| 561 | 3300014969 | Ga0157376_10012851 | Ga0157376_100128516 | 324 |
| 562 | 3300014969 | Ga0157376_10084200 | Ga0157376_100842002 | 324 |
| 563 | 3300014969 | Ga0157376_10098191 | Ga0157376_100981913 | 324 |
| 564 | 3300014969 | Ga0157376_10115140 | Ga0157376_101151402 | 324 |
| 565 | 3300017792 | Ga0163161_10118364 | Ga0163161_101183641 | 324 |
| 566 | 3300025321 | Ga0207656_10009239 | Ga0207656_100092392 | 324 |
| 567 | 3300025893 | Ga0207682_10089980 | Ga0207682_100899801 | 324 |
| 568 | 3300025899 | Ga0207642_10067256 | Ga0207642_100672562 | 324 |
| 569 | 3300025900 | Ga0207710_10017415 | Ga0207710_100174152 | 324 |
| 570 | 3300025900 | Ga0207710_10040315 | Ga0207710_100403152 | 324 |
| 571 | 3300025901 | Ga0207688_10009307 | Ga0207688_100093073 | 324 |
| 572 | 3300025903 | Ga0207680_10000026 | Ga0207680_1000002649 | 324 |
| 573 | 3300025903 | Ga0207680_10001727 | Ga0207680_100017275 | 324 |
| 574 | 3300025903 | Ga0207680_10022854 | Ga0207680_100228541 | 324 |
| 575 | 3300025903 | Ga0207680_10025926 | Ga0207680_100259262 | 324 |
| 576 | 3300025903 | Ga0207680_10135397 | Ga0207680_101353971 | 324 |
| 577 | 3300025903 | Ga0207680_10176991 | Ga0207680_101769912 | 324 |
| 578 | 3300025904 | Ga0207647_10000587 | Ga0207647_1000058714 | 324 |
| 579 | 3300025907 | Ga0207645_10000572 | Ga0207645_1000057216 | 324 |
| 580 | 3300025907 | Ga0207645_10005197 | Ga0207645_100051977 | 324 |
| 581 | 3300025907 | Ga0207645_10015652 | Ga0207645_100156525 | 324 |
| 582 | 3300025907 | Ga0207645_10021767 | Ga0207645_100217673 | 324 |
| 583 | 3300025908 | Ga0207643_10023881 | Ga0207643_100238812 | 324 |
| 584 | 3300025909 | Ga0207705_10003028 | Ga0207705_100030284 | 324 |
| 585 | 3300025911 | Ga0207654_10007258 | Ga0207654_100072584 | 324 |
| 586 | 3300025912 | Ga0207707_10000189 | Ga0207707_1000018960 | 324 |
| 587 | 3300025913 | Ga0207695_10000585 | Ga0207695_1000058548 | 324 |
| 588 | 3300025913 | Ga0207695_10005428 | Ga0207695_1000542811 | 324 |
| 589 | 3300025913 | Ga0207695_10031168 | Ga0207695_100311685 | 324 |
| 590 | 3300025913 | Ga0207695_10091861 | Ga0207695_100918613 | 324 |
| 591 | 3300025913 | Ga0207695_10134827 | Ga0207695_101348272 | 324 |
| 592 | 3300025913 | Ga0207695_10174755 | Ga0207695_101747552 | 324 |
| 593 | 3300025913 | Ga0207695_10195644 | Ga0207695_101956442 | 324 |
| 594 | 3300025914 | Ga0207671_10000992 | Ga0207671_100009928 | 324 |
| 595 | 3300025914 | Ga0207671_10001520 | Ga0207671_1000152029 | 324 |
| 596 | 3300025914 | Ga0207671_10001809 | Ga0207671_1000180911 | 324 |
| 597 | 3300025914 | Ga0207671_10021058 | Ga0207671_100210582 | 324 |
| 598 | 3300025917 | Ga0207660_10001432 | Ga0207660_100014322 | 324 |
| 599 | 3300025918 | Ga0207662_10063665 | Ga0207662_100636651 | 324 |
| 600 | 3300025919 | Ga0207657_10112893 | Ga0207657_101128932 | 324 |
| 601 | 3300025920 | Ga0207649_10005596 | Ga0207649_100055963 | 324 |
| 602 | 3300025920 | Ga0207649_10054113 | Ga0207649_100541133 | 324 |
| 603 | 3300025921 | Ga0207652_10000488 | Ga0207652_100004882 | 324 |
| 604 | 3300025923 | Ga0207681_10085278 | Ga0207681_100852782 | 324 |
| 605 | 3300025923 | Ga0207681_10102423 | Ga0207681_101024232 | 324 |
| 606 | 3300025924 | Ga0207694_10008276 | Ga0207694_100082765 | 324 |
| 607 | 3300025924 | Ga0207694_10119132 | Ga0207694_101191322 | 324 |
| 608 | 3300025925 | Ga0207650_10006072 | Ga0207650_100060727 | 324 |
| 609 | 3300025925 | Ga0207650_10060159 | Ga0207650_100601592 | 324 |
| 610 | 3300025925 | Ga0207650_10105680 | Ga0207650_101056802 | 324 |
| 611 | 3300025925 | Ga0207650_10116575 | Ga0207650_101165752 | 324 |
| 612 | 3300025926 | Ga0207659_10046878 | Ga0207659_100468782 | 324 |
| 613 | 3300025926 | Ga0207659_10048335 | Ga0207659_100483352 | 324 |
| 614 | 3300025926 | Ga0207659_10124792 | Ga0207659_101247921 | 324 |
| 615 | 3300025927 | Ga0207687_10223876 | Ga0207687_102238762 | 324 |
| 616 | 3300025931 | Ga0207644_10053396 | Ga0207644_100533962 | 324 |
| 617 | 3300025931 | Ga0207644_10054700 | Ga0207644_100547003 | 324 |
| 618 | 3300025931 | Ga0207644_10292459 | Ga0207644_102924592 | 324 |
| 619 | 3300025932 | Ga0207690_10125103 | Ga0207690_101251031 | 324 |
| 620 | 3300025932 | Ga0207690_10382478 | Ga0207690_103824781 | 324 |
| 621 | 3300025933 | Ga0207706_10002485 | Ga0207706_1000248511 | 324 |
| 622 | 3300025933 | Ga0207706_10024766 | Ga0207706_100247662 | 324 |
| 623 | 3300025933 | Ga0207706_10074429 | Ga0207706_100744292 | 324 |
| 624 | 3300025933 | Ga0207706_10090741 | Ga0207706_100907412 | 324 |
| 625 | 3300025934 | Ga0207686_10030443 | Ga0207686_100304432 | 324 |
| 626 | 3300025934 | Ga0207686_10034541 | Ga0207686_100345413 | 324 |
| 627 | 3300025934 | Ga0207686_10095714 | Ga0207686_100957142 | 324 |
| 628 | 3300025934 | Ga0207686_10141565 | Ga0207686_101415651 | 324 |
| 629 | 3300025936 | Ga0207670_10048036 | Ga0207670_100480362 | 324 |
| 630 | 3300025936 | Ga0207670_10109958 | Ga0207670_101099581 | 324 |
| 631 | 3300025936 | Ga0207670_10158458 | Ga0207670_101584583 | 324 |
| 632 | 3300025937 | Ga0207669_10029323 | Ga0207669_100293233 | 324 |
| 633 | 3300025937 | Ga0207669_10278024 | Ga0207669_102780241 | 324 |
| 634 | 3300025938 | Ga0207704_10001601 | Ga0207704_100016016 | 324 |
| 635 | 3300025938 | Ga0207704_10077829 | Ga0207704_100778292 | 324 |
| 636 | 3300025938 | Ga0207704_10174349 | Ga0207704_101743492 | 324 |
| 637 | 3300025938 | Ga0207704_10322697 | Ga0207704_103226972 | 324 |
| 638 | 3300025940 | Ga0207691_10000504 | Ga0207691_1000050415 | 324 |
| 639 | 3300025940 | Ga0207691_10003556 | Ga0207691_1000355613 | 324 |
| 640 | 3300025940 | Ga0207691_10076260 | Ga0207691_100762601 | 324 |
| 641 | 3300025940 | Ga0207691_10089022 | Ga0207691_100890222 | 324 |
| 642 | 3300025940 | Ga0207691_10111096 | Ga0207691_101110962 | 324 |
| 643 | 3300025941 | Ga0207711_10120925 | Ga0207711_101209252 | 324 |
| 644 | 3300025941 | Ga0207711_10394646 | Ga0207711_103946461 | 324 |
| 645 | 3300025942 | Ga0207689_10001176 | Ga0207689_100011768 | 324 |
| 646 | 3300025942 | Ga0207689_10009612 | Ga0207689_100096128 | 324 |
| 647 | 3300025942 | Ga0207689_10014847 | Ga0207689_100148474 | 324 |
| 648 | 3300025942 | Ga0207689_10019979 | Ga0207689_100199793 | 324 |
| 649 | 3300025942 | Ga0207689_10020131 | Ga0207689_100201312 | 324 |
| 650 | 3300025942 | Ga0207689_10029042 | Ga0207689_100290422 | 324 |
| 651 | 3300025942 | Ga0207689_10033265 | Ga0207689_100332653 | 324 |
| 652 | 3300025942 | Ga0207689_10072098 | Ga0207689_100720982 | 324 |
| 653 | 3300025944 | Ga0207661_10000840 | Ga0207661_1000084014 | 324 |
| 654 | 3300025944 | Ga0207661_10010476 | Ga0207661_100104766 | 324 |
| 655 | 3300025944 | Ga0207661_10018872 | Ga0207661_100188723 | 324 |
| 656 | 3300025945 | Ga0207679_10008617 | Ga0207679_100086174 | 324 |
| 657 | 3300025945 | Ga0207679_10008706 | Ga0207679_100087066 | 324 |
| 658 | 3300025945 | Ga0207679_10078429 | Ga0207679_100784292 | 324 |
| 659 | 3300025949 | Ga0207667_10000275 | Ga0207667_1000027555 | 324 |
| 660 | 3300025949 | Ga0207667_10074372 | Ga0207667_100743724 | 324 |
| 661 | 3300025949 | Ga0207667_10107057 | Ga0207667_101070572 | 324 |
| 662 | 3300025960 | Ga0207651_10000164 | Ga0207651_1000016421 | 324 |
| 663 | 3300025961 | Ga0207712_10002266 | Ga0207712_100022668 | 324 |
| 664 | 3300025961 | Ga0207712_10003837 | Ga0207712_100038372 | 324 |
| 665 | 3300025961 | Ga0207712_10009791 | Ga0207712_100097916 | 324 |
| 666 | 3300025961 | Ga0207712_10011308 | Ga0207712_100113082 | 324 |
| 667 | 3300025961 | Ga0207712_10170095 | Ga0207712_101700952 | 324 |
| 668 | 3300025972 | Ga0207668_10000568 | Ga0207668_1000056810 | 324 |
| 669 | 3300025972 | Ga0207668_10005433 | Ga0207668_100054335 | 324 |
| 670 | 3300025972 | Ga0207668_10262122 | Ga0207668_102621222 | 324 |
| 671 | 3300025981 | Ga0207640_10008552 | Ga0207640_100085523 | 324 |
| 672 | 3300025981 | Ga0207640_10027730 | Ga0207640_100277304 | 324 |
| 673 | 3300025986 | Ga0207658_10000225 | Ga0207658_1000022549 | 324 |
| 674 | 3300025986 | Ga0207658_10018882 | Ga0207658_100188823 | 324 |
| 675 | 3300025986 | Ga0207658_10102971 | Ga0207658_101029712 | 324 |
| 676 | 3300025986 | Ga0207658_10114310 | Ga0207658_101143102 | 324 |
| 677 | 3300025986 | Ga0207658_10433626 | Ga0207658_104336262 | 324 |
| 678 | 3300026023 | Ga0207677_10004033 | Ga0207677_100040334 | 324 |
| 679 | 3300026023 | Ga0207677_10020431 | Ga0207677_100204314 | 324 |
| 680 | 3300026035 | Ga0207703_10001012 | Ga0207703_1000101218 | 324 |
| 681 | 3300026035 | Ga0207703_10004551 | Ga0207703_1000455110 | 324 |
| 682 | 3300026035 | Ga0207703_10078745 | Ga0207703_100787451 | 324 |
| 683 | 3300026041 | Ga0207639_10011129 | Ga0207639_100111292 | 324 |
| 684 | 3300026041 | Ga0207639_10016999 | Ga0207639_100169992 | 324 |
| 685 | 3300026041 | Ga0207639_10019305 | Ga0207639_100193053 | 324 |
| 686 | 3300026041 | Ga0207639_10030049 | Ga0207639_100300492 | 324 |
| 687 | 3300026041 | Ga0207639_10035531 | Ga0207639_100355311 | 324 |
| 688 | 3300026067 | Ga0207678_10073535 | Ga0207678_100735352 | 324 |
| 689 | 3300026078 | Ga0207702_10048289 | Ga0207702_100482893 | 324 |
| 690 | 3300026088 | Ga0207641_10000167 | Ga0207641_1000016758 | 324 |
| 691 | 3300026088 | Ga0207641_10006442 | Ga0207641_100064425 | 324 |
| 692 | 3300026088 | Ga0207641_10025224 | Ga0207641_100252241 | 324 |
| 693 | 3300026088 | Ga0207641_10215578 | Ga0207641_102155782 | 324 |
| 694 | 3300026088 | Ga0207641_10223475 | Ga0207641_102234752 | 324 |
| 695 | 3300026089 | Ga0207648_10000560 | Ga0207648_100005602 | 324 |
| 696 | 3300026089 | Ga0207648_10001895 | Ga0207648_100018953 | 324 |
| 697 | 3300026089 | Ga0207648_10013539 | Ga0207648_100135394 | 324 |
| 698 | 3300026089 | Ga0207648_10025240 | Ga0207648_100252403 | 324 |
| 699 | 3300026089 | Ga0207648_10084464 | Ga0207648_100844643 | 324 |
| 700 | 3300026089 | Ga0207648_10153901 | Ga0207648_101539012 | 324 |
| 701 | 3300026095 | Ga0207676_10000992 | Ga0207676_1000099213 | 324 |
| 702 | 3300026095 | Ga0207676_10105191 | Ga0207676_101051911 | 324 |
| 703 | 3300026095 | Ga0207676_10108328 | Ga0207676_101083282 | 324 |
| 704 | 3300026095 | Ga0207676_10517281 | Ga0207676_105172811 | 324 |
| 705 | 3300026116 | Ga0207674_10024690 | Ga0207674_100246908 | 324 |
| 706 | 3300026116 | Ga0207674_10127552 | Ga0207674_101275522 | 324 |
| 707 | 3300026116 | Ga0207674_10144646 | Ga0207674_101446462 | 324 |
| 708 | 3300026116 | Ga0207674_10150557 | Ga0207674_101505573 | 324 |
| 709 | 3300026118 | Ga0207675_100053199 | Ga0207675_1000531992 | 324 |
| 710 | 3300026118 | Ga0207675_100074576 | Ga0207675_1000745763 | 324 |
| 711 | 3300026118 | Ga0207675_100134723 | Ga0207675_1001347232 | 324 |
| 712 | 3300026118 | Ga0207675_100194001 | Ga0207675_1001940011 | 324 |
| 713 | 3300026121 | Ga0207683_10001675 | Ga0207683_100016759 | 324 |
| 714 | 3300026121 | Ga0207683_10042151 | Ga0207683_100421513 | 324 |
| 715 | 3300026121 | Ga0207683_10211932 | Ga0207683_102119322 | 324 |
| 716 | 3300026142 | Ga0207698_10011377 | Ga0207698_100113774 | 324 |
| 717 | 3300026142 | Ga0207698_10039833 | Ga0207698_100398332 | 324 |
| 718 | 3300026142 | Ga0207698_10064058 | Ga0207698_100640583 | 324 |
| 719 | 3300026142 | Ga0207698_10192049 | Ga0207698_101920491 | 324 |
| 720 | 3300028379 | Ga0268266_10000014 | Ga0268266_10000014235 | 324 |
| 721 | 3300028379 | Ga0268266_10001023 | Ga0268266_1000102324 | 324 |
| 722 | 3300028379 | Ga0268266_10127702 | Ga0268266_101277022 | 324 |
| 723 | 3300028380 | Ga0268265_10108869 | Ga0268265_101088692 | 324 |
| 724 | 3300028380 | Ga0268265_10316489 | Ga0268265_103164892 | 324 |
| 725 | 3300028381 | Ga0268264_10000105 | Ga0268264_1000010557 | 324 |
| 726 | 3300028381 | Ga0268264_10001646 | Ga0268264_1000164610 | 324 |
| 727 | 3300028381 | Ga0268264_10024621 | Ga0268264_100246214 | 324 |
| 728 | 3300028381 | Ga0268264_10032257 | Ga0268264_100322572 | 324 |
| 729 | 3300028786 | Ga0307517_10016657 | Ga0307517_100166575 | 324 |
| 730 | 3300028794 | Ga0307515_10001274 | Ga0307515_1000127450 | 324 |
| 731 | 3300030521 | Ga0307511_10000579 | Ga0307511_1000057911 | 324 |
| 732 | 3300031456 | Ga0307513_10012204 | Ga0307513_100122043 | 324 |
| 733 | 3300031456 | Ga0307513_10141289 | Ga0307513_101412892 | 324 |
| 734 | 3300031507 | Ga0307509_10045786 | Ga0307509_100457862 | 324 |
| 735 | 3300031507 | Ga0307509_10174833 | Ga0307509_101748331 | 324 |
| 736 | 3300031507 | Ga0307509_10292170 | Ga0307509_102921702 | 324 |
| 737 | 3300031616 | Ga0307508_10002565 | Ga0307508_100025657 | 324 |
| 738 | 3300031730 | Ga0307516_10004180 | Ga0307516_100041808 | 324 |
| 739 | 3300031852 | Ga0307410_10020334 | Ga0307410_100203341 | 324 |
| 740 | 3300031995 | Ga0307409_100009385 | Ga0307409_1000093852 | 324 |
| 741 | 3300032002 | Ga0307416_100069838 | Ga0307416_1000698382 | 324 |
| 742 | 3300032126 | Ga0307415_100001047 | Ga0307415_1000010474 | 324 |
| 743 | 3300035170 | Ga0373943_0140224 | Ga0373943_0140224_173_1156 | 324 |
| 744 | 3300035695 | Ga0373927_0049219 | Ga0373927_0049219_1208_2191 | 324 |
| 745 | 3300035724 | Ga0373933_0051362 | Ga0373933_0051362_1452_2444 | 324 |
| 746 | 3300036401 | Ga0373937_0004801 | Ga0373937_0004801_290_1282 | 324 |
| 747 | 3300036401 | Ga0373937_0169918 | Ga0373937_0169918_964_1947 | 324 |
| 748 | 3300037068 | Ga0373925_0455590 | Ga0373925_0455590_30_1022 | 324 |
| 749 | 3300037471 | Ga0395905_0053611 | Ga0395905_0053611_2288_3271 | 324 |
| 750 | 3300039437 | Ga0436365_1019786 | Ga0436365_1019786_995_1981 | 324 |
| 751 | 3300041404 | Ga0439436_0010189 | Ga0439436_0010189_1129_2112 | 324 |
| 752 | 3300041406 | Ga0439439_0009348 | Ga0439439_0009348_944_1927 | 324 |
| 753 | 3300042014 | Ga0439457_000399 | Ga0439457_000399_10660_11643 | 324 |
| 754 | 3300042015 | Ga0439462_0010507 | Ga0439462_0010507_802_1785 | 324 |
| 755 | 3300042876 | Ga0451577_0009739 | Ga0451577_0009739_128_1114 | 324 |
| 756 | 3300044656 | Ga0466969_0000293 | Ga0466969_0000293_3981_4964 | 324 |
| 757 | 3300044658 | Ga0466972_0000014 | Ga0466972_0000014_47026_48009 | 324 |
| 758 | 3300044658 | Ga0466972_0000250 | Ga0466972_0000250_17951_18934 | 324 |
| 759 | 3300044658 | Ga0466972_0000477 | Ga0466972_0000477_12527_13510 | 324 |
| 760 | 3300044684 | Ga0466966_0000028 | Ga0466966_0000028_10866_11849 | 324 |
| 761 | 3300044712 | Ga0453684_0191394 | Ga0453684_0191394_937_1929 | 324 |
| 762 | 3300044712 | Ga0453684_0205116 | Ga0453684_0205116_456_1439 | 324 |
| 763 | 3300044735 | Ga0466968_0008930 | Ga0466968_0008930_76_1059 | 324 |
| 764 | 3300044735 | Ga0466968_0023147 | Ga0466968_0023147_966_1949 | 324 |
| 765 | 3300044765 | Ga0466970_0001468 | Ga0466970_0001468_5556_6539 | 324 |
| 766 | 3300044842 | Ga0466957_0000123 | Ga0466957_0000123_15834_16817 | 324 |
| 767 | 3300045049 | Ga0466959_0000039 | Ga0466959_0000039_21163_22146 | 324 |
| 768 | 3300045049 | Ga0466959_0035662 | Ga0466959_0035662_1985_2968 | 324 |
| 769 | 3300046462 | Ga0495651_0123422 | Ga0495651_0123422_448_1431 | 324 |
| 770 | 3300046477 | Ga0495664_0061219 | Ga0495664_0061219_954_1946 | 324 |
| 771 | 3300046517 | Ga0495630_0150442 | Ga0495630_0150442_41_1024 | 324 |
| 772 | 3300046517 | Ga0495630_0180336 | Ga0495630_0180336_15_998 | 324 |
| 773 | 3300046524 | Ga0495648_0008977 | Ga0495648_0008977_6359_7342 | 324 |
| 774 | 3300046543 | Ga0495645_0228718 | Ga0495645_0228718_252_1235 | 324 |
| 775 | 3300046616 | Ga0495668_0001408 | Ga0495668_0001408_20757_21740 | 324 |
| 776 | 3300046616 | Ga0495668_0001611 | Ga0495668_0001611_19438_20421 | 324 |
| 777 | 3300046642 | Ga0495634_0012523 | Ga0495634_0012523_4163_5155 | 324 |
| 778 | 3300046660 | Ga0495625_0094619 | Ga0495625_0094619_494_1483 | 324 |
| 779 | 3300046675 | Ga0495657_0068433 | Ga0495657_0068433_902_1885 | 324 |
| 780 | 3300046679 | Ga0495623_0092939 | Ga0495623_0092939_570_1553 | 324 |
| 781 | 3300046691 | Ga0495670_0125775 | Ga0495670_0125775_190_1173 | 324 |
| 782 | 3300047317 | Ga0495604_0087987 | Ga0495604_0087987_701_1693 | 324 |
| 783 | 3300047320 | Ga0495672_0026023 | Ga0495672_0026023_2306_3289 | 324 |
| 784 | 3300047320 | Ga0495672_0065375 | Ga0495672_0065375_380_1363 | 324 |
| 785 | 3300047320 | Ga0495672_0081734 | Ga0495672_0081734_794_1777 | 324 |
| 786 | 3300047443 | Ga0495687_000056 | Ga0495687_000056_39128_40111 | 324 |
| 787 | 3300047471 | Ga0495684_0249530 | Ga0495684_0249530_70_1062 | 324 |
| 788 | 3300047472 | Ga0495686_0130542 | Ga0495686_0130542_144_1127 | 324 |
| 789 | 3300048911 | Ga0496108_0211119 | Ga0496108_0211119_303_1286 | 324 |
| 790 | 3300048918 | Ga0496115_0292143 | Ga0496115_0292143_284_1267 | 324 |
| 791 | 3300048927 | Ga0496124_0044005 | Ga0496124_0044005_2419_3402 | 324 |
| 792 | 3300049568 | Ga0501031_0073046 | Ga0501031_0073046_754_1737 | 324 |
| 793 | 3300049569 | Ga0501032_0057079 | Ga0501032_0057079_630_1613 | 324 |
| 794 | 3300049571 | Ga0501034_0020326 | Ga0501034_0020326_4637_5623 | 324 |
| 795 | 3300049571 | Ga0501034_0023760 | Ga0501034_0023760_1984_2967 | 324 |
| 796 | 3300049571 | Ga0501034_0058351 | Ga0501034_0058351_418_1404 | 324 |
| 797 | 3300049571 | Ga0501034_0327662 | Ga0501034_0327662_38_1024 | 324 |
| 798 | 3300049571 | Ga0501034_0400905 | Ga0501034_0400905_96_1079 | 324 |
| 799 | 3300049571 | Ga0501034_0414027 | Ga0501034_0414027_28_1014 | 324 |
| 800 | 3300049571 | Ga0501034_0500007 | Ga0501034_0500007_36_1019 | 324 |
| 801 | 3300049572 | Ga0501036_0008626 | Ga0501036_0008626_849_1832 | 324 |
| 802 | 3300049572 | Ga0501036_0089161 | Ga0501036_0089161_1126_2109 | 324 |
| 803 | 3300049573 | Ga0501037_0036199 | Ga0501037_0036199_494_1477 | 324 |
| 804 | 3300049573 | Ga0501037_0128887 | Ga0501037_0128887_754_1737 | 324 |
| 805 | 3300049573 | Ga0501037_0129521 | Ga0501037_0129521_472_1455 | 324 |
| 806 | 3300049573 | Ga0501037_0321285 | Ga0501037_0321285_37_1023 | 324 |
| 807 | 3300049574 | Ga0501038_0036362 | Ga0501038_0036362_2025_3008 | 324 |
| 808 | 3300049574 | Ga0501038_0072889 | Ga0501038_0072889_1703_2686 | 324 |
| 809 | 3300049574 | Ga0501038_0191304 | Ga0501038_0191304_386_1369 | 324 |
| 810 | 3300049575 | Ga0501039_0144315 | Ga0501039_0144315_308_1291 | 324 |
| 811 | 3300049579 | Ga0501043_0025312 | Ga0501043_0025312_2566_3549 | 324 |
| 812 | 3300049579 | Ga0501043_0033904 | Ga0501043_0033904_2296_3279 | 324 |
| 813 | 3300049579 | Ga0501043_0128951 | Ga0501043_0128951_10_993 | 324 |
| 814 | 3300049579 | Ga0501043_0145079 | Ga0501043_0145079_704_1690 | 324 |
| 815 | 3300049579 | Ga0501043_0161440 | Ga0501043_0161440_33_1016 | 324 |
| 816 | 3300049579 | Ga0501043_0211997 | Ga0501043_0211997_339_1322 | 324 |
| 817 | 3300049580 | Ga0501046_0007138 | Ga0501046_0007138_7749_8732 | 324 |
| 818 | 3300049580 | Ga0501046_0109050 | Ga0501046_0109050_153_1136 | 324 |
| 819 | 3300049581 | Ga0501047_0008441 | Ga0501047_0008441_2190_3173 | 324 |
| 820 | 3300049581 | Ga0501047_0023465 | Ga0501047_0023465_1265_2248 | 324 |
| 821 | 3300049581 | Ga0501047_0118369 | Ga0501047_0118369_481_1464 | 324 |
| 822 | 3300049581 | Ga0501047_0170001 | Ga0501047_0170001_291_1274 | 324 |
| 823 | 3300049581 | Ga0501047_0270173 | Ga0501047_0270173_247_1233 | 324 |
| 824 | 3300049581 | Ga0501047_0322644 | Ga0501047_0322644_337_1320 | 324 |
| 825 | 3300049582 | Ga0501048_0053337 | Ga0501048_0053337_1396_2379 | 324 |
| 826 | 3300049583 | Ga0501067_0031941 | Ga0501067_0031941_280_1263 | 324 |
| 827 | 3300049584 | Ga0501068_0050600 | Ga0501068_0050600_278_1261 | 324 |
| 828 | 3300049584 | Ga0501068_0282282 | Ga0501068_0282282_18_1001 | 324 |
| 829 | 3300049585 | Ga0501069_0060217 | Ga0501069_0060217_154_1137 | 324 |
| 830 | 3300049586 | Ga0501070_0162072 | Ga0501070_0162072_563_1546 | 324 |
| 831 | 3300049589 | Ga0501073_0205126 | Ga0501073_0205126_138_1121 | 324 |
| 832 | 3300049590 | Ga0501074_0034682 | Ga0501074_0034682_1402_2385 | 324 |
| 833 | 3300049590 | Ga0501074_0160719 | Ga0501074_0160719_484_1467 | 324 |
| 834 | 3300049652 | Ga0501202_000556 | Ga0501202_000556_4157_5140 | 324 |
| 835 | 3300049661 | Ga0501217_007182 | Ga0501217_007182_1049_2032 | 324 |
| 836 | 3300049665 | Ga0501227_014783 | Ga0501227_014783_381_1364 | 324 |
| 837 | 3300049674 | Ga0501242_002083 | Ga0501242_002083_1073_2056 | 324 |
| 838 | 3300049683 | Ga0501253_026702 | Ga0501253_026702_62_1045 | 324 |
| 839 | 3300049686 | Ga0501257_001076 | Ga0501257_001076_1286_2269 | 324 |
| 840 | 3300049688 | Ga0501259_000915 | Ga0501259_000915_1620_2603 | 324 |
| 841 | 3300049705 | Ga0501225_0002223 | Ga0501225_0002223_446_1429 | 324 |
| 842 | 3300049705 | Ga0501225_0031215 | Ga0501225_0031215_34_1017 | 324 |
| 843 | 3300049741 | Ga0501079_0079388 | Ga0501079_0079388_638_1621 | 324 |
| 844 | 3300049742 | Ga0501080_0116817 | Ga0501080_0116817_184_1167 | 324 |
| 845 | 3300049742 | Ga0501080_0265447 | Ga0501080_0265447_311_1294 | 324 |
| 846 | 3300049744 | Ga0501083_0022448 | Ga0501083_0022448_2599_3582 | 324 |
| 847 | 3300049744 | Ga0501083_0073596 | Ga0501083_0073596_981_1964 | 324 |
| 848 | 3300049765 | Ga0501268_005545 | Ga0501268_005545_797_1780 | 324 |
| 849 | 3300049776 | Ga0501280_015129 | Ga0501280_015129_55_1038 | 324 |
| 850 | 3300049779 | Ga0501283_015883 | Ga0501283_015883_115_1098 | 324 |
| 851 | 3300049822 | Ga0501035_0105981 | Ga0501035_0105981_763_1746 | 324 |
| 852 | 3300049822 | Ga0501035_0145956 | Ga0501035_0145956_211_1194 | 324 |
| 853 | 3300049822 | Ga0501035_0417977 | Ga0501035_0417977_80_1066 | 324 |
| 854 | 3300049823 | Ga0501044_0002352 | Ga0501044_0002352_11291_12274 | 324 |
| 855 | 3300049823 | Ga0501044_0011986 | Ga0501044_0011986_2212_3198 | 324 |
| 856 | 3300049823 | Ga0501044_0025772 | Ga0501044_0025772_2130_3113 | 324 |
| 857 | 3300049823 | Ga0501044_0167070 | Ga0501044_0167070_900_1883 | 324 |
| 858 | 3300049823 | Ga0501044_0176022 | Ga0501044_0176022_925_1911 | 324 |
| 859 | 3300049823 | Ga0501044_0195803 | Ga0501044_0195803_335_1318 | 324 |
| 860 | 3300050005 | Ga0501284_00011 | Ga0501284_00011_52991_53974 | 324 |
| 861 | 3300050493 | nmdc:mga0k408_139188_c1 | nmdc:mga0k408_139188_c1_89_1072 | 324 |
| 862 | 3300050493 | nmdc:mga0k408_5876_c1 | nmdc:mga0k408_5876_c1_3567_4550 | 324 |
| 863 | 3300050493 | nmdc:mga0k408_87688_c1 | nmdc:mga0k408_87688_c1_307_1290 | 324 |
| 864 | 3300050507 | nmdc:mga05p37_504936_c1 | nmdc:mga05p37_504936_c1_358_1341 | 324 |
| 865 | 3300050507 | nmdc:mga05p37_5549_c1 | nmdc:mga05p37_5549_c1_6956_7939 | 324 |
| 866 | 3300050508 | nmdc:mga09592_12657_c1 | nmdc:mga09592_12657_c1_3847_4830 | 324 |
| 867 | 3300050508 | nmdc:mga09592_2970_c1 | nmdc:mga09592_2970_c1_1194_2177 | 324 |
| 868 | 3300050508 | nmdc:mga09592_37657_c1 | nmdc:mga09592_37657_c1_1025_2008 | 324 |
| 869 | 3300050509 | nmdc:mga0qj67_21010_c1 | nmdc:mga0qj67_21010_c1_1749_2732 | 324 |
| 870 | 3300050510 | nmdc:mga06r32_62752_c1 | nmdc:mga06r32_62752_c1_1347_2330 | 324 |
| 871 | 3300053086 | Ga0500578_0000027 | Ga0500578_0000027_44248_45231 | 324 |
| 872 | 3300053090 | Ga0500646_0000241 | Ga0500646_0000241_8061_9047 | 324 |
| 873 | 3300053090 | Ga0500646_0026088 | Ga0500646_0026088_268_1251 | 324 |
| 874 | 3300053092 | Ga0500583_0000042 | Ga0500583_0000042_58929_59912 | 324 |
| 875 | 3300053092 | Ga0500583_0000651 | Ga0500583_0000651_4933_5916 | 324 |
| 876 | 3300053092 | Ga0500583_0003160 | Ga0500583_0003160_1779_2762 | 324 |
| 877 | 3300053108 | Ga0500562_000004 | Ga0500562_000004_262729_263712 | 324 |
| 878 | 3300053111 | Ga0500572_006582 | Ga0500572_006582_1358_2341 | 324 |
| 879 | 3300053118 | Ga0500594_0015123 | Ga0500594_0015123_400_1389 | 324 |
| 880 | 3300053130 | Ga0500642_0056099 | Ga0500642_0056099_489_1472 | 324 |
| 881 | 3300053139 | Ga0500568_0000407 | Ga0500568_0000407_25103_26086 | 324 |
| 882 | 3300053139 | Ga0500568_0039687 | Ga0500568_0039687_551_1534 | 324 |
| 883 | 3300053153 | Ga0500616_0036566 | Ga0500616_0036566_1287_2270 | 324 |
| 884 | 3300053156 | Ga0500622_0002745 | Ga0500622_0002745_10783_11766 | 324 |
| 885 | 3300053156 | Ga0500622_0004729 | Ga0500622_0004729_441_1424 | 324 |
| 886 | 3300053163 | Ga0500639_079843 | Ga0500639_079843_188_1171 | 324 |
| 887 | 3300053177 | Ga0500636_0071028 | Ga0500636_0071028_30_1013 | 324 |
| 888 | 3300053727 | Ga0500611_000007 | Ga0500611_000007_62338_63321 | 324 |
| 889 | 3300053727 | Ga0500611_009690 | Ga0500611_009690_389_1372 | 324 |
| 890 | 3300053730 | Ga0500645_008755 | Ga0500645_008755_445_1428 | 324 |
| 891 | 3300060353 | Ga0501082_0235193 | Ga0501082_0235193_372_1355 | 324 |
| 892 | 3300005290 | Ga0065712_10145434 | Ga0065712_101454341 | 325 |
| 893 | 3300005331 | Ga0070670_100026443 | Ga0070670_1000264433 | 325 |
| 894 | 3300005340 | Ga0070689_100111827 | Ga0070689_1001118272 | 325 |
| 895 | 3300005364 | Ga0070673_100002842 | Ga0070673_1000028426 | 325 |
| 896 | 3300005459 | Ga0068867_100092819 | Ga0068867_1000928191 | 325 |
| 897 | 3300005617 | Ga0068859_100317606 | Ga0068859_1003176062 | 325 |
| 898 | 3300006931 | Ga0097620_100317619 | Ga0097620_1003176192 | 325 |
| 899 | 3300014326 | Ga0157380_10331890 | Ga0157380_103318902 | 325 |
| 900 | 3300025940 | Ga0207691_10070087 | Ga0207691_100700871 | 325 |
| 901 | 3300025960 | Ga0207651_10015652 | Ga0207651_100156521 | 325 |
| 902 | 3300026089 | Ga0207648_10109922 | Ga0207648_101099222 | 325 |
| 903 | 3300027907 | Ga0207428_10128535 | Ga0207428_101285352 | 325 |
| 904 | 3300032004 | Ga0307414_10422156 | Ga0307414_104221561 | 325 |
| 905 | 3300041406 | Ga0439439_0006295 | Ga0439439_0006295_83_1069 | 325 |
| 906 | 3300042007 | Ga0439449_0016056 | Ga0439449_0016056_1522_2508 | 325 |
| 907 | 3300042014 | Ga0439457_006263 | Ga0439457_006263_409_1395 | 325 |
| 908 | 3300042435 | Ga0439434_0020825 | Ga0439434_0020825_580_1566 | 325 |
| 909 | 3300046522 | Ga0495643_0032341 | Ga0495643_0032341_1318_2304 | 325 |
| 910 | 3300001979 | JGI24740J21852_10009205 | JGI24740J21852_100092052 | 327 |
| 911 | 3300003203 | JGI25406J46586_10000498 | JGI25406J46586_1000049818 | 327 |
| 912 | 3300005330 | Ga0070690_100036931 | Ga0070690_1000369313 | 327 |
| 913 | 3300005337 | Ga0070682_100012658 | Ga0070682_1000126583 | 327 |
| 914 | 3300005339 | Ga0070660_100015549 | Ga0070660_1000155492 | 327 |
| 915 | 3300005344 | Ga0070661_100059221 | Ga0070661_1000592212 | 327 |
| 916 | 3300005353 | Ga0070669_100114442 | Ga0070669_1001144422 | 327 |
| 917 | 3300005355 | Ga0070671_100144767 | Ga0070671_1001447673 | 327 |
| 918 | 3300005366 | Ga0070659_100010005 | Ga0070659_1000100053 | 327 |
| 919 | 3300005456 | Ga0070678_100101191 | Ga0070678_1001011911 | 327 |
| 920 | 3300005458 | Ga0070681_10044426 | Ga0070681_100444263 | 327 |
| 921 | 3300005530 | Ga0070679_100090552 | Ga0070679_1000905521 | 327 |
| 922 | 3300005530 | Ga0070679_100198827 | Ga0070679_1001988271 | 327 |
| 923 | 3300005535 | Ga0070684_100037366 | Ga0070684_1000373662 | 327 |
| 924 | 3300005539 | Ga0068853_100014362 | Ga0068853_1000143624 | 327 |
| 925 | 3300005563 | Ga0068855_100057463 | Ga0068855_1000574633 | 327 |
| 926 | 3300005564 | Ga0070664_100037086 | Ga0070664_1000370864 | 327 |
| 927 | 3300005577 | Ga0068857_100127787 | Ga0068857_1001277872 | 327 |
| 928 | 3300005577 | Ga0068857_100344965 | Ga0068857_1003449651 | 327 |
| 929 | 3300005578 | Ga0068854_100029484 | Ga0068854_1000294842 | 327 |
| 930 | 3300005578 | Ga0068854_100111978 | Ga0068854_1001119782 | 327 |
| 931 | 3300005614 | Ga0068856_100047298 | Ga0068856_1000472983 | 327 |
| 932 | 3300005616 | Ga0068852_100023882 | Ga0068852_1000238823 | 327 |
| 933 | 3300005618 | Ga0068864_100191887 | Ga0068864_1001918872 | 327 |
| 934 | 3300005985 | Ga0081539_10000708 | Ga0081539_1000070855 | 327 |
| 935 | 3300006358 | Ga0068871_100018752 | Ga0068871_1000187524 | 327 |
| 936 | 3300009174 | Ga0105241_10071809 | Ga0105241_100718093 | 327 |
| 937 | 3300009545 | Ga0105237_10036714 | Ga0105237_100367144 | 327 |
| 938 | 3300010375 | Ga0105239_10030291 | Ga0105239_100302912 | 327 |
| 939 | 3300013102 | Ga0157371_10012819 | Ga0157371_100128193 | 327 |
| 940 | 3300013104 | Ga0157370_10027963 | Ga0157370_100279632 | 327 |
| 941 | 3300013105 | Ga0157369_10056706 | Ga0157369_100567062 | 327 |
| 942 | 3300013296 | Ga0157374_10010315 | Ga0157374_100103153 | 327 |
| 943 | 3300013296 | Ga0157374_10318431 | Ga0157374_103184312 | 327 |
| 944 | 3300013297 | Ga0157378_10014239 | Ga0157378_100142393 | 327 |
| 945 | 3300013297 | Ga0157378_10074360 | Ga0157378_100743602 | 327 |
| 946 | 3300013306 | Ga0163162_10505387 | Ga0163162_105053872 | 327 |
| 947 | 3300013307 | Ga0157372_10020346 | Ga0157372_100203463 | 327 |
| 948 | 3300013307 | Ga0157372_10045221 | Ga0157372_100452214 | 327 |
| 949 | 3300013307 | Ga0157372_10120605 | Ga0157372_101206052 | 327 |
| 950 | 3300013307 | Ga0157372_10127941 | Ga0157372_101279412 | 327 |
| 951 | 3300013308 | Ga0157375_10515220 | Ga0157375_105152201 | 327 |
| 952 | 3300014745 | Ga0157377_10011172 | Ga0157377_100111721 | 327 |
| 953 | 3300021384 | Ga0213876_10020918 | Ga0213876_100209182 | 327 |
| 954 | 3300021384 | Ga0213876_10099424 | Ga0213876_100994241 | 327 |
| 955 | 3300025302 | Ga0207426_1000009 | Ga0207426_1000009332 | 327 |
| 956 | 3300025921 | Ga0207652_10037509 | Ga0207652_100375093 | 327 |
| 957 | 3300025925 | Ga0207650_10082891 | Ga0207650_100828912 | 327 |
| 958 | 3300025925 | Ga0207650_10365991 | Ga0207650_103659911 | 327 |
| 959 | 3300025932 | Ga0207690_10168805 | Ga0207690_101688052 | 327 |
| 960 | 3300025933 | Ga0207706_10005175 | Ga0207706_100051753 | 327 |
| 961 | 3300025944 | Ga0207661_10096723 | Ga0207661_100967232 | 327 |
| 962 | 3300025949 | Ga0207667_10095656 | Ga0207667_100956562 | 327 |
| 963 | 3300025981 | Ga0207640_10010668 | Ga0207640_100106683 | 327 |
| 964 | 3300026023 | Ga0207677_10243069 | Ga0207677_102430691 | 327 |
| 965 | 3300026067 | Ga0207678_10077023 | Ga0207678_100770232 | 327 |
| 966 | 3300026078 | Ga0207702_10097371 | Ga0207702_100973712 | 327 |
| 967 | 3300026095 | Ga0207676_10334902 | Ga0207676_103349021 | 327 |
| 968 | 3300026116 | Ga0207674_10057085 | Ga0207674_100570852 | 327 |
| 969 | 3300026116 | Ga0207674_10091138 | Ga0207674_100911383 | 327 |
| 970 | 3300028379 | Ga0268266_10300343 | Ga0268266_103003431 | 327 |
| 971 | 3300031251 | Ga0265327_10000107 | Ga0265327_10000107108 | 327 |
| 972 | 3300031251 | Ga0265327_10050815 | Ga0265327_100508152 | 327 |
| 973 | 3300039437 | Ga0436365_0419801 | Ga0436365_0419801_1661_2665 | 327 |
| 974 | 3300039437 | Ga0436365_0735035 | Ga0436365_0735035_49_1053 | 327 |
| 975 | 3300047319 | Ga0495674_0236940 | Ga0495674_0236940_78_1082 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mto-assembly2.cif.gz_E | crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate | 0.9798 | 6 | 327 |
| 3pfk-assembly1.cif.gz_A | phosphofructokinase. structure and control | 0.977 | 6 | 325 |
| 4a3s-assembly1.cif.gz_A | crystal structure of pfk from bacillus subtilis | 0.9757 | 6 | 327 |
| 3u39-assembly1.cif.gz_A | crystal structure of the apo bacillus stearothermophilus phosphofructokinase | 0.9757 | 6 | 327 |
| 1mto-assembly2.cif.gz_E | crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate | 0.9738 | 6 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q27483_12_171_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9839 | 8 | 143 | 3.40.50.450 |
| af_Q2FXM8_1_303_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.976 | 6 | 307 | 3.40.50.450 |
| 3u39A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9739 | 6 | 308 | 3.40.50.450 |
| af_Q2FXM8_1_303_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9634 | 6 | 307 | 3.40.50.450 |
| 3u39A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9536 | 6 | 308 | 3.40.50.450 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar