F487230

General Info

Members Datasets Scaffolds Average Seq Length
975 253 1950 213

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10000012|Ga0213873_10000012169
Length 199
Sequence MSKPVLHDYFRSSACYRVRIALNLKGVDYRAVSVNLLEGAQRSEDYKAANPQGLVPMLEIDGHRLTQSLAIILYLDGTRPSPPLLPPHPCDIHPLNNLRVLKYLKDELGQPQEARDAWYRHWVTEGFEALEAMAAPRAGRFLFGDTPTLADVCLVPQMFNARRFEVPLDAYPTLVRADSEASALEPFARAHPDAIAAAA

Samples

Sample ID Description Type Environment
1 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
195 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
196 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
197 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
235 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
238 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
239 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
240 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
241 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
244 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.64
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213873_10000012 3300021358 Bacteria 210531
2 JGI24736J21556_1000576 3300001904 Bacteria 6718
3 JGI24740J21852_10002069 3300001979 Bacteria 9169
4 JGI24740J21852_10002142 3300001979 Bacteria 9023
5 JGI24740J21852_10013153 3300001979 Bacteria 3097
6 JGI24740J21852_10017863 3300001979 Bacteria 2528
7 JGI24739J22299_10001859 3300001989 Bacteria 8054
8 JGI24739J22299_10002462 3300001989 Bacteria 7141
9 JGI24739J22299_10023180 3300001989 Bacteria 2196
10 JGI24739J22299_10110394 3300001989 Bacteria 825
11 JGI24737J22298_10000548 3300001990 Bacteria 13144
12 JGI24737J22298_10000821 3300001990 Bacteria 11047
13 JGI24737J22298_10010369 3300001990 Bacteria 3076
14 JGI24737J22298_10026711 3300001990 Bacteria 1822
15 JGI24737J22298_10066636 3300001990 Bacteria 1078
16 JGI24743J22301_10037758 3300001991 Bacteria 963
17 JGI24735J21928_10025041 3300002067 Bacteria 1802
18 JGI24735J21928_10036456 3300002067 Bacteria 1442
19 JGI24738J21930_10001458 3300002075 Bacteria 6573
20 JGI24738J21930_10001895 3300002075 Bacteria 5650
21 JGI24742J22300_10046142 3300002244 Bacteria 783
22 Ga0065715_10480269 3300005293 Bacteria 798
23 Ga0065707_10258703 3300005295 Bacteria 1103
24 Ga0070658_10000220 3300005327 Bacteria 50700
25 Ga0070658_10030170 3300005327 Bacteria 4357
26 Ga0070658_10071181 3300005327 Bacteria 2848
27 Ga0070658_10078460 3300005327 Bacteria 2711
28 Ga0070658_10100859 3300005327 Bacteria 2386
29 Ga0070658_10136711 3300005327 Bacteria 2045
30 Ga0070658_10152462 3300005327 Bacteria 1935
31 Ga0070658_10179237 3300005327 Bacteria 1782
32 Ga0070658_10844342 3300005327 Bacteria 796
33 Ga0070658_11010114 3300005327 Bacteria 723
34 Ga0070676_10020992 3300005328 Bacteria 3654
35 Ga0070676_10059751 3300005328 Bacteria 2262
36 Ga0070683_100003373 3300005329 Bacteria 12941
37 Ga0070683_100027975 3300005329 Bacteria 5091
38 Ga0070683_100084862 3300005329 Bacteria 2968
39 Ga0070683_100141589 3300005329 Bacteria 2278
40 Ga0070683_100141613 3300005329 Bacteria 2278
41 Ga0070683_100297361 3300005329 Bacteria 1535
42 Ga0070683_100444031 3300005329 Bacteria 1238
43 Ga0070690_100034100 3300005330 Bacteria 3189
44 Ga0070690_100220359 3300005330 Bacteria 1329
45 Ga0070670_100012025 3300005331 Bacteria 7404
46 Ga0070670_100342848 3300005331 Bacteria 1312
47 Ga0070670_100365503 3300005331 Bacteria 1269
48 Ga0070670_100515698 3300005331 Bacteria 1064
49 Ga0068869_100000443 3300005334 Bacteria 22657
50 Ga0068869_100147532 3300005334 Bacteria 1822
51 Ga0068869_100240288 3300005334 Bacteria 1443
52 Ga0070666_10017824 3300005335 Bacteria 4557
53 Ga0070666_10084363 3300005335 Bacteria 2174
54 Ga0070666_10175674 3300005335 Bacteria 1501
55 Ga0070666_10310188 3300005335 Bacteria 1124
56 Ga0070680_100256555 3300005336 Bacteria 1479
57 Ga0070682_100030269 3300005337 Bacteria 3266
58 Ga0070682_100120292 3300005337 Bacteria 1762
59 Ga0070682_100176181 3300005337 Bacteria 1490
60 Ga0070682_100413639 3300005337 Bacteria 1023
61 Ga0070682_100430981 3300005337 Bacteria 1005
62 Ga0068868_100001904 3300005338 Bacteria 14330
63 Ga0068868_100060036 3300005338 Bacteria 3009
64 Ga0070660_100000218 3300005339 Bacteria 37921
65 Ga0070660_100006122 3300005339 Bacteria 8322
66 Ga0070660_100009510 3300005339 Bacteria 6840
67 Ga0070660_100022235 3300005339 Bacteria 4687
68 Ga0070660_100042238 3300005339 Bacteria 3479
69 Ga0070660_100051279 3300005339 Bacteria 3177
70 Ga0070660_100081859 3300005339 Bacteria 2534
71 Ga0070660_100110262 3300005339 Bacteria 2188
72 Ga0070660_100114506 3300005339 Bacteria 2148
73 Ga0070660_100355069 3300005339 Bacteria 1208
74 Ga0070689_100034452 3300005340 Bacteria 3863
75 Ga0070691_10092739 3300005341 Bacteria 1491
76 Ga0070661_100000181 3300005344 Bacteria 52052
77 Ga0070661_100010804 3300005344 Bacteria 6355
78 Ga0070661_100041645 3300005344 Bacteria 3351
79 Ga0070661_100048896 3300005344 Bacteria 3096
80 Ga0070661_100070692 3300005344 Bacteria 2567
81 Ga0070661_100102287 3300005344 Bacteria 2132
82 Ga0070661_100280332 3300005344 Bacteria 1293
83 Ga0070661_100484746 3300005344 Bacteria 988
84 Ga0070692_10009547 3300005345 Bacteria 4378
85 Ga0070692_10024650 3300005345 Bacteria 2958
86 Ga0070692_10064428 3300005345 Bacteria 1938
87 Ga0070692_10125342 3300005345 Bacteria 1437
88 Ga0070692_10127859 3300005345 Bacteria 1425
89 Ga0070668_100002807 3300005347 Bacteria 12820
90 Ga0070668_100004982 3300005347 Bacteria 9834
91 Ga0070668_100202497 3300005347 Bacteria 1630
92 Ga0070668_100501816 3300005347 Bacteria 1050
93 Ga0070669_100001401 3300005353 Bacteria 17397
94 Ga0070669_100005960 3300005353 Bacteria 8792
95 Ga0070669_100027357 3300005353 Bacteria 4103
96 Ga0070669_100036569 3300005353 Bacteria 3558
97 Ga0070669_100037659 3300005353 Bacteria 3508
98 Ga0070669_100040079 3300005353 Bacteria 3404
99 Ga0070669_100573948 3300005353 Bacteria 943
100 Ga0070675_100012535 3300005354 Bacteria 6646
101 Ga0070675_100427639 3300005354 Bacteria 1185
102 Ga0070675_100571061 3300005354 Bacteria 1024
103 Ga0070671_100007089 3300005355 Bacteria 8970
104 Ga0070671_100009863 3300005355 Bacteria 7667
105 Ga0070671_100011341 3300005355 Bacteria 7163
106 Ga0070671_100189008 3300005355 Bacteria 1745
107 Ga0070671_100329814 3300005355 Bacteria 1301
108 Ga0070674_100003561 3300005356 Bacteria 8751
109 Ga0070673_100001138 3300005364 Bacteria 15291
110 Ga0070673_100039227 3300005364 Bacteria 3623
111 Ga0070673_100077903 3300005364 Bacteria 2680
112 Ga0070673_100693468 3300005364 Bacteria 935
113 Ga0070673_100761367 3300005364 Bacteria 892
114 Ga0070659_100000310 3300005366 Bacteria 37921
115 Ga0070659_100000653 3300005366 Bacteria 25246
116 Ga0070659_100003703 3300005366 Bacteria 10905
117 Ga0070659_100021829 3300005366 Bacteria 4881
118 Ga0070659_100030599 3300005366 Bacteria 4166
119 Ga0070659_100116511 3300005366 Bacteria 2160
120 Ga0070659_100174875 3300005366 Bacteria 1760
121 Ga0070659_100199062 3300005366 Bacteria 1648
122 Ga0070659_100224352 3300005366 Bacteria 1552
123 Ga0070659_100237408 3300005366 Bacteria 1507
124 Ga0070659_100247076 3300005366 Bacteria 1478
125 Ga0070659_100295381 3300005366 Bacteria 1350
126 Ga0070659_100457348 3300005366 Bacteria 1084
127 Ga0070659_100495919 3300005366 Bacteria 1040
128 Ga0070659_100535352 3300005366 Bacteria 1001
129 Ga0070667_100005201 3300005367 Bacteria 10876
130 Ga0070667_100009852 3300005367 Bacteria 7922
131 Ga0070667_100011907 3300005367 Bacteria 7196
132 Ga0070667_100019462 3300005367 Bacteria 5633
133 Ga0070667_100063055 3300005367 Bacteria 3140
134 Ga0070667_100153809 3300005367 Bacteria 2022
135 Ga0070667_100293170 3300005367 Bacteria 1463
136 Ga0070667_100319237 3300005367 Bacteria 1401
137 Ga0070667_100696859 3300005367 Bacteria 940
138 Ga0070714_100235073 3300005435 Bacteria 1690
139 Ga0070714_100689966 3300005435 Bacteria 985
140 Ga0070714_100764043 3300005435 Bacteria 935
141 Ga0070713_100007217 3300005436 Bacteria 7780
142 Ga0070713_100698717 3300005436 Bacteria 968
143 Ga0070710_10230269 3300005437 Bacteria 1183
144 Ga0070694_100003942 3300005444 Bacteria 8882
145 Ga0070694_100004844 3300005444 Bacteria 8105
146 Ga0070663_100032513 3300005455 Bacteria 3596
147 Ga0070663_100057231 3300005455 Bacteria 2796
148 Ga0070663_100080483 3300005455 Bacteria 2392
149 Ga0070663_100088223 3300005455 Bacteria 2293
150 Ga0070663_100391090 3300005455 Bacteria 1134
151 Ga0070663_100411323 3300005455 Bacteria 1108
152 Ga0070663_100657639 3300005455 Bacteria 887
153 Ga0070678_100813551 3300005456 Bacteria 849
154 Ga0070662_100000080 3300005457 Bacteria 53280
155 Ga0070662_100000441 3300005457 Bacteria 24553
156 Ga0070662_100001943 3300005457 Bacteria 12698
157 Ga0070662_100019464 3300005457 Bacteria 4608
158 Ga0070662_100024092 3300005457 Bacteria 4189
159 Ga0070662_100070042 3300005457 Bacteria 2583
160 Ga0070662_100070716 3300005457 Bacteria 2571
161 Ga0070662_100171374 3300005457 Bacteria 1704
162 Ga0070662_100256889 3300005457 Bacteria 1406
163 Ga0070662_100802170 3300005457 Bacteria 800
164 Ga0070681_10038070 3300005458 Bacteria 4822
165 Ga0070681_10462787 3300005458 Bacteria 1181
166 Ga0068867_100000772 3300005459 Bacteria 21595
167 Ga0068867_100216482 3300005459 Bacteria 1541
168 Ga0068867_100341995 3300005459 Bacteria 1246
169 Ga0070706_100264252 3300005467 Bacteria 1606
170 Ga0070679_100014346 3300005530 Bacteria 7610
171 Ga0070679_100040091 3300005530 Bacteria 4658
172 Ga0070679_100124612 3300005530 Bacteria 2559
173 Ga0070679_100179853 3300005530 Bacteria 2087
174 Ga0070679_100483986 3300005530 Bacteria 1182
175 Ga0070679_100491151 3300005530 Bacteria 1172
176 Ga0070679_100541510 3300005530 Bacteria 1108
177 Ga0070679_100961097 3300005530 Bacteria 798
178 Ga0070684_100007195 3300005535 Bacteria 8646
179 Ga0070684_100026657 3300005535 Bacteria 4870
180 Ga0068853_100000134 3300005539 Bacteria 50184
181 Ga0068853_100000707 3300005539 Bacteria 23081
182 Ga0068853_100093343 3300005539 Bacteria 2649
183 Ga0068853_100121918 3300005539 Bacteria 2326
184 Ga0068853_100330234 3300005539 Bacteria 1415
185 Ga0068853_100362374 3300005539 Bacteria 1351
186 Ga0068853_100500781 3300005539 Bacteria 1147
187 Ga0070672_100000140 3300005543 Bacteria 38747
188 Ga0070672_100040478 3300005543 Bacteria 3576
189 Ga0070672_100134009 3300005543 Bacteria 2039
190 Ga0070686_100560853 3300005544 Bacteria 895
191 Ga0070696_100011547 3300005546 Bacteria 5918
192 Ga0070696_100094167 3300005546 Bacteria 2137
193 Ga0070696_100206411 3300005546 Bacteria 1469
194 Ga0070693_100019921 3300005547 Bacteria 3529
195 Ga0070693_100019931 3300005547 Bacteria 3528
196 Ga0070693_100098064 3300005547 Bacteria 1780
197 Ga0070665_100002647 3300005548 Bacteria 19474
198 Ga0070665_100003354 3300005548 Bacteria 17135
199 Ga0070665_100022024 3300005548 Bacteria 6411
200 Ga0070665_100211839 3300005548 Bacteria 1938
201 Ga0070665_100360489 3300005548 Bacteria 1460
202 Ga0070665_100465414 3300005548 Bacteria 1274
203 Ga0068855_100002690 3300005563 Bacteria 21916
204 Ga0068855_100006137 3300005563 Bacteria 14646
205 Ga0068855_100006734 3300005563 Bacteria 13940
206 Ga0068855_100378995 3300005563 Bacteria 1553
207 Ga0068855_100482992 3300005563 Bacteria 1348
208 Ga0068855_100583921 3300005563 Bacteria 1207
209 Ga0068855_100650181 3300005563 Bacteria 1132
210 Ga0070664_100000961 3300005564 Bacteria 22520
211 Ga0070664_100015273 3300005564 Bacteria 6276
212 Ga0070664_100027154 3300005564 Bacteria 4756
213 Ga0070664_100048714 3300005564 Bacteria 3581
214 Ga0070664_100098859 3300005564 Bacteria 2535
215 Ga0070664_100099232 3300005564 Bacteria 2530
216 Ga0070664_100145542 3300005564 Bacteria 2089
217 Ga0070664_100192051 3300005564 Bacteria 1820
218 Ga0070664_100268362 3300005564 Bacteria 1537
219 Ga0070664_100346684 3300005564 Bacteria 1350
220 Ga0070664_100470504 3300005564 Bacteria 1156
221 Ga0068857_100000090 3300005577 Bacteria 52424
222 Ga0068857_100018698 3300005577 Bacteria 6083
223 Ga0068857_100130491 3300005577 Bacteria 2266
224 Ga0068857_100241917 3300005577 Bacteria 1653
225 Ga0068857_100279385 3300005577 Bacteria 1536
226 Ga0068857_100710353 3300005577 Bacteria 955
227 Ga0068854_100003349 3300005578 Bacteria 9988
228 Ga0068854_100011326 3300005578 Bacteria 5800
229 Ga0068854_100018383 3300005578 Bacteria 4691
230 Ga0068854_100028155 3300005578 Bacteria 3879
231 Ga0068854_100048110 3300005578 Bacteria 3041
232 Ga0068854_100279370 3300005578 Bacteria 1344
233 Ga0068854_100326100 3300005578 Bacteria 1250
234 Ga0068854_100350741 3300005578 Bacteria 1208
235 Ga0068854_100416090 3300005578 Bacteria 1115
236 Ga0068854_100460436 3300005578 Bacteria 1064
237 Ga0068854_100721000 3300005578 Bacteria 862
238 Ga0068856_100001082 3300005614 Bacteria 28757
239 Ga0068856_100044902 3300005614 Bacteria 4349
240 Ga0068856_100074402 3300005614 Bacteria 3363
241 Ga0068856_100092975 3300005614 Bacteria 3001
242 Ga0068856_100098071 3300005614 Bacteria 2921
243 Ga0068856_100168846 3300005614 Bacteria 2199
244 Ga0068852_100000532 3300005616 Bacteria 24997
245 Ga0068852_100004509 3300005616 Bacteria 9849
246 Ga0068852_100005574 3300005616 Bacteria 9027
247 Ga0068852_100017312 3300005616 Bacteria 5650
248 Ga0068852_100054490 3300005616 Bacteria 3447
249 Ga0068852_100142152 3300005616 Bacteria 2222
250 Ga0068852_100275151 3300005616 Bacteria 1621
251 Ga0068852_100341703 3300005616 Bacteria 1459
252 Ga0068852_100398911 3300005616 Bacteria 1353
253 Ga0068852_100503155 3300005616 Bacteria 1207
254 Ga0068852_100541597 3300005616 Bacteria 1163
255 Ga0068859_100000464 3300005617 Bacteria 40106
256 Ga0068859_100001249 3300005617 Bacteria 25972
257 Ga0068859_100035033 3300005617 Bacteria 5035
258 Ga0068859_100196533 3300005617 Bacteria 2101
259 Ga0068859_100212420 3300005617 Bacteria 2021
260 Ga0068859_100421730 3300005617 Bacteria 1430
261 Ga0068859_100463871 3300005617 Bacteria 1362
262 Ga0068859_101092010 3300005617 Bacteria 877
263 Ga0068864_100000676 3300005618 Bacteria 28515
264 Ga0068864_100000842 3300005618 Bacteria 25877
265 Ga0068864_100008233 3300005618 Bacteria 8600
266 Ga0068864_100426845 3300005618 Bacteria 1264
267 Ga0068866_10388855 3300005718 Bacteria 896
268 Ga0068861_100150318 3300005719 Bacteria 1910
269 Ga0068861_100834390 3300005719 Bacteria 868
270 Ga0068851_10011418 3300005834 Bacteria 4165
271 Ga0068851_10226375 3300005834 Bacteria 1053
272 Ga0068851_10253457 3300005834 Bacteria 999
273 Ga0068851_10369289 3300005834 Bacteria 838
274 Ga0068870_10249793 3300005840 Bacteria 1099
275 Ga0068863_100001768 3300005841 Bacteria 21423
276 Ga0068863_100001937 3300005841 Bacteria 20557
277 Ga0068863_100021780 3300005841 Bacteria 6116
278 Ga0068863_100137556 3300005841 Bacteria 2334
279 Ga0068863_100165173 3300005841 Bacteria 2122
280 Ga0068863_100196278 3300005841 Bacteria 1940
281 Ga0068863_100519858 3300005841 Bacteria 1173
282 Ga0068858_100001850 3300005842 Bacteria 21570
283 Ga0068858_100002115 3300005842 Bacteria 20151
284 Ga0068858_100003441 3300005842 Bacteria 15717
285 Ga0068858_100052474 3300005842 Bacteria 3773
286 Ga0068858_100815782 3300005842 Bacteria 910
287 Ga0068860_100002483 3300005843 Bacteria 19348
288 Ga0068860_100005039 3300005843 Bacteria 13445
289 Ga0068860_100005670 3300005843 Bacteria 12608
290 Ga0068860_100053074 3300005843 Bacteria 3854
291 Ga0068862_100006405 3300005844 Bacteria 9790
292 Ga0068862_100028321 3300005844 Bacteria 4716
293 Ga0068862_100067608 3300005844 Bacteria 3081
294 Ga0068862_100112100 3300005844 Bacteria 2395
295 Ga0068862_100118973 3300005844 Bacteria 2326
296 Ga0068862_100138519 3300005844 Bacteria 2158
297 Ga0068862_100297402 3300005844 Bacteria 1484
298 Ga0068862_100875755 3300005844 Bacteria 881
299 Ga0081539_10008202 3300005985 Bacteria 9198
300 Ga0070717_10022282 3300006028 Bacteria 5003
301 Ga0070715_10138250 3300006163 Bacteria 1180
302 Ga0075367_10243273 3300006178 Bacteria 1128
303 Ga0075369_10133496 3300006186 Bacteria 1129
304 Ga0097621_100013670 3300006237 Bacteria 6060
305 Ga0097621_100064108 3300006237 Bacteria 3021
306 Ga0097621_100178478 3300006237 Bacteria 1834
307 Ga0097621_100927839 3300006237 Bacteria 812
308 Ga0068871_100006328 3300006358 Bacteria 8368
309 Ga0068871_100089883 3300006358 Bacteria 2557
310 Ga0068871_100104019 3300006358 Bacteria 2381
311 Ga0068871_100230645 3300006358 Bacteria 1607
312 Ga0075433_10107241 3300006852 Bacteria 2476
313 Ga0075429_100256821 3300006880 Bacteria 1530
314 Ga0068865_100000519 3300006881 Bacteria 21564
315 Ga0068865_100063967 3300006881 Bacteria 2588
316 Ga0068865_100230871 3300006881 Bacteria 1452
317 Ga0097620_100000464 3300006931 Bacteria 40106
318 Ga0097620_100001249 3300006931 Bacteria 25972
319 Ga0097620_100035036 3300006931 Bacteria 5035
320 Ga0097620_100196529 3300006931 Bacteria 2101
321 Ga0097620_100212409 3300006931 Bacteria 2021
322 Ga0097620_100421733 3300006931 Bacteria 1430
323 Ga0097620_100463848 3300006931 Bacteria 1362
324 Ga0097620_101091990 3300006931 Bacteria 877
325 Ga0075435_100810793 3300007076 Bacteria 815
326 Ga0105251_10079970 3300009011 Bacteria 1512
327 Ga0105240_10010940 3300009093 Bacteria 12711
328 Ga0105240_10016645 3300009093 Bacteria 9944
329 Ga0105240_10108385 3300009093 Bacteria 3365
330 Ga0105240_10305963 3300009093 Bacteria 1817
331 Ga0111539_10005572 3300009094 Bacteria 16277
332 Ga0105245_10000958 3300009098 Bacteria 26239
333 Ga0105247_10351210 3300009101 Bacteria 1037
334 Ga0105247_10453605 3300009101 Bacteria 925
335 Ga0105243_10110557 3300009148 Bacteria 2298
336 Ga0105241_10024818 3300009174 Bacteria 4454
337 Ga0105241_10127798 3300009174 Bacteria 2054
338 Ga0105241_10178157 3300009174 Bacteria 1761
339 Ga0105241_10295626 3300009174 Bacteria 1388
340 Ga0105242_10082084 3300009176 Bacteria 2697
341 Ga0105242_10471554 3300009176 Bacteria 1188
342 Ga0105242_10832405 3300009176 Bacteria 916
343 Ga0105248_10000276 3300009177 Bacteria 60451
344 Ga0105248_10001159 3300009177 Bacteria 29428
345 Ga0105248_10001339 3300009177 Bacteria 27438
346 Ga0105248_10176874 3300009177 Bacteria 2405
347 Ga0105248_10215419 3300009177 Bacteria 2163
348 Ga0105248_10313803 3300009177 Bacteria 1766
349 Ga0105248_11730766 3300009177 Bacteria 709
350 Ga0105237_10141087 3300009545 Bacteria 2404
351 Ga0105237_10385956 3300009545 Bacteria 1405
352 Ga0105238_10061139 3300009551 Bacteria 3770
353 Ga0105238_10158906 3300009551 Bacteria 2236
354 Ga0105238_10250603 3300009551 Bacteria 1749
355 Ga0105249_10007337 3300009553 Bacteria 9612
356 Ga0105249_10310443 3300009553 Bacteria 1585
357 Ga0105239_10039562 3300010375 Bacteria 5166
358 Ga0105246_10014496 3300011119 Bacteria 4959
359 Ga0105246_10066708 3300011119 Bacteria 2520
360 Ga0105246_10119991 3300011119 Bacteria 1947
361 Ga0157373_10010954 3300013100 Bacteria 6675
362 Ga0157373_10043793 3300013100 Bacteria 3196
363 Ga0157373_10068868 3300013100 Bacteria 2502
364 Ga0157373_10115959 3300013100 Bacteria 1883
365 Ga0157373_10159516 3300013100 Bacteria 1587
366 Ga0157373_10160412 3300013100 Bacteria 1582
367 Ga0157373_10164438 3300013100 Bacteria 1562
368 Ga0157373_10336123 3300013100 Bacteria 1076
369 Ga0157373_10445829 3300013100 Bacteria 931
370 Ga0157371_10002258 3300013102 Bacteria 18601
371 Ga0157371_10002431 3300013102 Bacteria 17754
372 Ga0157371_10030425 3300013102 Bacteria 3895
373 Ga0157371_10065575 3300013102 Bacteria 2572
374 Ga0157371_10081917 3300013102 Bacteria 2285
375 Ga0157371_10085943 3300013102 Bacteria 2228
376 Ga0157371_10088804 3300013102 Bacteria 2189
377 Ga0157371_10092596 3300013102 Bacteria 2141
378 Ga0157371_10119474 3300013102 Bacteria 1874
379 Ga0157371_10124248 3300013102 Bacteria 1835
380 Ga0157371_10158760 3300013102 Bacteria 1615
381 Ga0157371_10220282 3300013102 Bacteria 1363
382 Ga0157371_10376454 3300013102 Bacteria 1036
383 Ga0157370_10010844 3300013104 Bacteria 9571
384 Ga0157370_10046698 3300013104 Bacteria 4152
385 Ga0157370_10219122 3300013104 Bacteria 1763
386 Ga0157370_10426848 3300013104 Bacteria 1219
387 Ga0157370_10523194 3300013104 Bacteria 1088
388 Ga0157369_10080442 3300013105 Bacteria 3489
389 Ga0157369_10101553 3300013105 Bacteria 3065
390 Ga0157369_10188115 3300013105 Bacteria 2170
391 Ga0157369_10782440 3300013105 Bacteria 981
392 Ga0157374_10025778 3300013296 Bacteria 5284
393 Ga0157374_10058257 3300013296 Bacteria 3609
394 Ga0157378_10046518 3300013297 Bacteria 3857
395 Ga0157378_10979451 3300013297 Bacteria 879
396 Ga0163162_10092260 3300013306 Bacteria 3112
397 Ga0163162_10277063 3300013306 Bacteria 1809
398 Ga0163162_10365419 3300013306 Bacteria 1576
399 Ga0157372_10018683 3300013307 Bacteria 7458
400 Ga0157372_10263446 3300013307 Bacteria 2002
401 Ga0157372_10281299 3300013307 Bacteria 1934
402 Ga0157372_10325314 3300013307 Bacteria 1790
403 Ga0157372_10388392 3300013307 Bacteria 1626
404 Ga0157372_10709972 3300013307 Bacteria 1170
405 Ga0157372_11016073 3300013307 Bacteria 960
406 Ga0157372_11086024 3300013307 Bacteria 926
407 Ga0157375_10046833 3300013308 Bacteria 4219
408 Ga0157375_10078421 3300013308 Bacteria 3336
409 Ga0157375_10364586 3300013308 Bacteria 1611
410 Ga0157375_11100228 3300013308 Bacteria 930
411 Ga0163163_10000139 3300014325 Bacteria 75197
412 Ga0163163_10000799 3300014325 Bacteria 26696
413 Ga0163163_10009909 3300014325 Bacteria 8542
414 Ga0157380_10002116 3300014326 Bacteria 13314
415 Ga0157380_10037711 3300014326 Bacteria 3746
416 Ga0157377_10334887 3300014745 Bacteria 1010
417 Ga0157379_10011784 3300014968 Bacteria 7636
418 Ga0213876_10000021 3300021384 Bacteria 260105
419 Ga0207697_10000261 3300025315 Bacteria 29019
420 Ga0207697_10022747 3300025315 Bacteria 2567
421 Ga0207697_10109104 3300025315 Bacteria 1184
422 Ga0207656_10000759 3300025321 Bacteria 10569
423 Ga0207656_10006291 3300025321 Bacteria 4255
424 Ga0207682_10007404 3300025893 Bacteria 4373
425 Ga0207682_10033276 3300025893 Bacteria 2075
426 Ga0207688_10000960 3300025901 Bacteria 14662
427 Ga0207688_10077438 3300025901 Bacteria 1895
428 Ga0207688_10101643 3300025901 Bacteria 1661
429 Ga0207680_10018356 3300025903 Bacteria 3717
430 Ga0207680_10126931 3300025903 Bacteria 1676
431 Ga0207647_10005894 3300025904 Bacteria 8932
432 Ga0207647_10006920 3300025904 Bacteria 8221
433 Ga0207647_10012421 3300025904 Bacteria 5927
434 Ga0207647_10031536 3300025904 Bacteria 3410
435 Ga0207647_10033600 3300025904 Bacteria 3284
436 Ga0207647_10054637 3300025904 Bacteria 2457
437 Ga0207647_10059961 3300025904 Bacteria 2327
438 Ga0207647_10085486 3300025904 Bacteria 1887
439 Ga0207647_10211834 3300025904 Bacteria 1119
440 Ga0207647_10214596 3300025904 Bacteria 1110
441 Ga0207645_10003103 3300025907 Bacteria 12739
442 Ga0207645_10020450 3300025907 Bacteria 4333
443 Ga0207645_10043286 3300025907 Bacteria 2882
444 Ga0207645_10078206 3300025907 Bacteria 2120
445 Ga0207643_10044795 3300025908 Bacteria 2498
446 Ga0207643_10278355 3300025908 Bacteria 1037
447 Ga0207705_10000030 3300025909 Bacteria 239341
448 Ga0207705_10000164 3300025909 Bacteria 71606
449 Ga0207705_10000382 3300025909 Bacteria 39603
450 Ga0207705_10003138 3300025909 Bacteria 12586
451 Ga0207705_10004450 3300025909 Bacteria 10590
452 Ga0207705_10005276 3300025909 Bacteria 9672
453 Ga0207705_10007994 3300025909 Bacteria 7759
454 Ga0207705_10013448 3300025909 Bacteria 5903
455 Ga0207705_10201557 3300025909 Bacteria 1508
456 Ga0207705_10214533 3300025909 Bacteria 1460
457 Ga0207705_10262722 3300025909 Bacteria 1318
458 Ga0207705_10427195 3300025909 Bacteria 1026
459 Ga0207705_10440947 3300025909 Bacteria 1009
460 Ga0207705_10499082 3300025909 Bacteria 945
461 Ga0207654_10014959 3300025911 Bacteria 4017
462 Ga0207654_10119320 3300025911 Bacteria 1653
463 Ga0207707_10094767 3300025912 Bacteria 2609
464 Ga0207707_10124110 3300025912 Bacteria 2258
465 Ga0207707_10125991 3300025912 Bacteria 2240
466 Ga0207707_10343855 3300025912 Bacteria 1286
467 Ga0207707_10409642 3300025912 Bacteria 1163
468 Ga0207707_10697555 3300025912 Bacteria 852
469 Ga0207695_10003659 3300025913 Bacteria 21455
470 Ga0207695_10013923 3300025913 Bacteria 9561
471 Ga0207695_10101462 3300025913 Bacteria 2871
472 Ga0207660_10000400 3300025917 Bacteria 28576
473 Ga0207660_10052623 3300025917 Bacteria 2899
474 Ga0207660_10078260 3300025917 Bacteria 2423
475 Ga0207660_10158562 3300025917 Bacteria 1744
476 Ga0207660_10260005 3300025917 Bacteria 1372
477 Ga0207662_10229167 3300025918 Bacteria 1213
478 Ga0207657_10000090 3300025919 Bacteria 86852
479 Ga0207657_10000966 3300025919 Bacteria 30468
480 Ga0207657_10002284 3300025919 Bacteria 20780
481 Ga0207657_10003169 3300025919 Bacteria 17602
482 Ga0207657_10004583 3300025919 Bacteria 14606
483 Ga0207657_10006005 3300025919 Bacteria 12638
484 Ga0207657_10012628 3300025919 Bacteria 8325
485 Ga0207657_10015081 3300025919 Bacteria 7505
486 Ga0207657_10021634 3300025919 Bacteria 6046
487 Ga0207657_10047114 3300025919 Bacteria 3772
488 Ga0207657_10047788 3300025919 Bacteria 3739
489 Ga0207657_10050394 3300025919 Bacteria 3624
490 Ga0207657_10077739 3300025919 Bacteria 2796
491 Ga0207657_10084158 3300025919 Bacteria 2667
492 Ga0207657_10107449 3300025919 Bacteria 2308
493 Ga0207657_10236847 3300025919 Bacteria 1458
494 Ga0207657_10475017 3300025919 Bacteria 980
495 Ga0207649_10000324 3300025920 Bacteria 36296
496 Ga0207649_10001913 3300025920 Bacteria 11889
497 Ga0207649_10037569 3300025920 Bacteria 2926
498 Ga0207649_10188306 3300025920 Bacteria 1449
499 Ga0207649_10347917 3300025920 Bacteria 1096
500 Ga0207652_10027129 3300025921 Bacteria 4772
501 Ga0207652_10028132 3300025921 Bacteria 4688
502 Ga0207652_10055492 3300025921 Bacteria 3408
503 Ga0207652_10103477 3300025921 Bacteria 2517
504 Ga0207652_10150044 3300025921 Bacteria 2087
505 Ga0207681_10014489 3300025923 Bacteria 4900
506 Ga0207681_10036861 3300025923 Bacteria 3228
507 Ga0207681_10071285 3300025923 Bacteria 2423
508 Ga0207681_10101558 3300025923 Bacteria 2075
509 Ga0207681_10195621 3300025923 Bacteria 1550
510 Ga0207681_10587686 3300025923 Bacteria 919
511 Ga0207694_10216644 3300025924 Bacteria 1561
512 Ga0207694_10269932 3300025924 Bacteria 1395
513 Ga0207694_10388274 3300025924 Bacteria 1159
514 Ga0207650_10036661 3300025925 Bacteria 3568
515 Ga0207650_10092024 3300025925 Bacteria 2319
516 Ga0207650_11048854 3300025925 Bacteria 694
517 Ga0207659_10012678 3300025926 Bacteria 5376
518 Ga0207659_10301927 3300025926 Bacteria 1315
519 Ga0207659_10560522 3300025926 Bacteria 972
520 Ga0207687_10001103 3300025927 Bacteria 18339
521 Ga0207700_10066091 3300025928 Bacteria 2762
522 Ga0207664_10041241 3300025929 Bacteria 3595
523 Ga0207644_10008141 3300025931 Bacteria 6868
524 Ga0207644_10037075 3300025931 Bacteria 3427
525 Ga0207644_10156729 3300025931 Bacteria 1766
526 Ga0207644_10307505 3300025931 Bacteria 1279
527 Ga0207644_10441725 3300025931 Bacteria 1068
528 Ga0207644_10684395 3300025931 Bacteria 855
529 Ga0207690_10000184 3300025932 Bacteria 48035
530 Ga0207690_10001341 3300025932 Bacteria 15473
531 Ga0207690_10002961 3300025932 Bacteria 10226
532 Ga0207690_10031485 3300025932 Bacteria 3395
533 Ga0207690_10040601 3300025932 Bacteria 3043
534 Ga0207690_10102266 3300025932 Bacteria 2048
535 Ga0207690_10144847 3300025932 Bacteria 1755
536 Ga0207690_10203622 3300025932 Bacteria 1505
537 Ga0207690_10313361 3300025932 Bacteria 1231
538 Ga0207690_10389910 3300025932 Bacteria 1109
539 Ga0207690_10428583 3300025932 Bacteria 1059
540 Ga0207690_10454998 3300025932 Bacteria 1029
541 Ga0207706_10000110 3300025933 Bacteria 87522
542 Ga0207706_10000407 3300025933 Bacteria 46229
543 Ga0207706_10002190 3300025933 Bacteria 19037
544 Ga0207706_10005564 3300025933 Bacteria 11747
545 Ga0207706_10015317 3300025933 Bacteria 6931
546 Ga0207706_10016228 3300025933 Bacteria 6730
547 Ga0207706_10022613 3300025933 Bacteria 5643
548 Ga0207706_10063039 3300025933 Bacteria 3264
549 Ga0207706_10094852 3300025933 Bacteria 2625
550 Ga0207706_10189581 3300025933 Bacteria 1805
551 Ga0207706_10236441 3300025933 Bacteria 1597
552 Ga0207706_10244460 3300025933 Bacteria 1568
553 Ga0207706_10309683 3300025933 Bacteria 1375
554 Ga0207709_10437132 3300025935 Bacteria 1008
555 Ga0207709_10707650 3300025935 Bacteria 807
556 Ga0207669_10039205 3300025937 Bacteria 2735
557 Ga0207669_10072209 3300025937 Bacteria 2172
558 Ga0207704_10008609 3300025938 Bacteria 4888
559 Ga0207704_10049293 3300025938 Bacteria 2532
560 Ga0207691_10001863 3300025940 Bacteria 20621
561 Ga0207691_10048625 3300025940 Bacteria 3888
562 Ga0207691_10098629 3300025940 Bacteria 2610
563 Ga0207691_10340919 3300025940 Bacteria 1283
564 Ga0207691_10522783 3300025940 Bacteria 1007
565 Ga0207691_10568676 3300025940 Bacteria 961
566 Ga0207711_10000258 3300025941 Bacteria 57473
567 Ga0207711_10000586 3300025941 Bacteria 36944
568 Ga0207711_10008002 3300025941 Bacteria 8844
569 Ga0207711_10024036 3300025941 Bacteria 5101
570 Ga0207711_10396386 3300025941 Bacteria 1282
571 Ga0207689_10000341 3300025942 Bacteria 43585
572 Ga0207689_10037788 3300025942 Bacteria 4002
573 Ga0207689_10090091 3300025942 Bacteria 2520
574 Ga0207689_10330669 3300025942 Bacteria 1265
575 Ga0207661_10000179 3300025944 Bacteria 40861
576 Ga0207661_10016307 3300025944 Bacteria 5481
577 Ga0207661_10049021 3300025944 Bacteria 3360
578 Ga0207661_10176509 3300025944 Bacteria 1863
579 Ga0207661_10218208 3300025944 Bacteria 1684
580 Ga0207661_11013308 3300025944 Bacteria 765
581 Ga0207679_10000329 3300025945 Bacteria 35247
582 Ga0207679_10023827 3300025945 Bacteria 4191
583 Ga0207679_10031409 3300025945 Bacteria 3717
584 Ga0207679_10041529 3300025945 Bacteria 3299
585 Ga0207679_10120259 3300025945 Bacteria 2089
586 Ga0207679_10184695 3300025945 Bacteria 1728
587 Ga0207679_10189310 3300025945 Bacteria 1709
588 Ga0207679_10194337 3300025945 Bacteria 1690
589 Ga0207679_10248949 3300025945 Bacteria 1510
590 Ga0207679_10338088 3300025945 Bacteria 1309
591 Ga0207679_10462868 3300025945 Bacteria 1126
592 Ga0207667_10002920 3300025949 Bacteria 21220
593 Ga0207667_10021644 3300025949 Bacteria 7123
594 Ga0207667_10023410 3300025949 Bacteria 6801
595 Ga0207667_10036194 3300025949 Bacteria 5291
596 Ga0207667_10058049 3300025949 Bacteria 4061
597 Ga0207667_10087948 3300025949 Bacteria 3214
598 Ga0207667_10105008 3300025949 Bacteria 2914
599 Ga0207667_10259463 3300025949 Bacteria 1777
600 Ga0207667_10266574 3300025949 Bacteria 1751
601 Ga0207667_10386057 3300025949 Bacteria 1427
602 Ga0207667_10392970 3300025949 Bacteria 1412
603 Ga0207667_10415806 3300025949 Bacteria 1368
604 Ga0207651_10009435 3300025960 Bacteria 5344
605 Ga0207651_10157662 3300025960 Bacteria 1775
606 Ga0207651_10182790 3300025960 Bacteria 1665
607 Ga0207651_10216049 3300025960 Bacteria 1547
608 Ga0207651_10359004 3300025960 Bacteria 1229
609 Ga0207651_10482913 3300025960 Bacteria 1068
610 Ga0207712_10002871 3300025961 Bacteria 11020
611 Ga0207668_10000101 3300025972 Bacteria 60529
612 Ga0207668_10036169 3300025972 Bacteria 3294
613 Ga0207668_10074765 3300025972 Bacteria 2433
614 Ga0207668_10098135 3300025972 Bacteria 2170
615 Ga0207668_10176344 3300025972 Bacteria 1681
616 Ga0207668_10877264 3300025972 Bacteria 798
617 Ga0207640_10008088 3300025981 Bacteria 5819
618 Ga0207640_10011150 3300025981 Bacteria 5083
619 Ga0207640_10017217 3300025981 Bacteria 4223
620 Ga0207640_10018067 3300025981 Bacteria 4137
621 Ga0207640_10023018 3300025981 Bacteria 3739
622 Ga0207640_10071916 3300025981 Bacteria 2331
623 Ga0207640_10121647 3300025981 Bacteria 1871
624 Ga0207640_10327435 3300025981 Bacteria 1222
625 Ga0207640_10448551 3300025981 Bacteria 1062
626 Ga0207640_10517789 3300025981 Bacteria 996
627 Ga0207658_10007940 3300025986 Bacteria 7228
628 Ga0207658_10009186 3300025986 Bacteria 6705
629 Ga0207658_10011763 3300025986 Bacteria 5960
630 Ga0207658_10025865 3300025986 Bacteria 4111
631 Ga0207658_10037526 3300025986 Bacteria 3483
632 Ga0207658_10075589 3300025986 Bacteria 2563
633 Ga0207658_10355703 3300025986 Bacteria 1276
634 Ga0207658_10430614 3300025986 Bacteria 1165
635 Ga0207658_10709537 3300025986 Bacteria 909
636 Ga0207677_10001288 3300026023 Bacteria 13444
637 Ga0207677_10411698 3300026023 Bacteria 1149
638 Ga0207677_10530914 3300026023 Bacteria 1022
639 Ga0207703_10001366 3300026035 Bacteria 22284
640 Ga0207703_10003682 3300026035 Bacteria 12771
641 Ga0207703_10015105 3300026035 Bacteria 6027
642 Ga0207703_10055791 3300026035 Bacteria 3215
643 Ga0207639_10000458 3300026041 Bacteria 28145
644 Ga0207639_10170267 3300026041 Bacteria 1844
645 Ga0207639_10282908 3300026041 Bacteria 1459
646 Ga0207639_10288505 3300026041 Bacteria 1446
647 Ga0207639_10296384 3300026041 Bacteria 1428
648 Ga0207678_10008049 3300026067 Bacteria 9295
649 Ga0207678_10033788 3300026067 Bacteria 4454
650 Ga0207678_10036629 3300026067 Bacteria 4271
651 Ga0207678_10044001 3300026067 Bacteria 3864
652 Ga0207678_10050700 3300026067 Bacteria 3585
653 Ga0207678_10112058 3300026067 Bacteria 2327
654 Ga0207678_10133849 3300026067 Bacteria 2115
655 Ga0207678_10184027 3300026067 Bacteria 1784
656 Ga0207678_10380527 3300026067 Bacteria 1220
657 Ga0207678_10440540 3300026067 Bacteria 1132
658 Ga0207702_10000391 3300026078 Bacteria 49957
659 Ga0207702_10017169 3300026078 Bacteria 5987
660 Ga0207702_10020548 3300026078 Bacteria 5466
661 Ga0207702_10025039 3300026078 Bacteria 4950
662 Ga0207702_10077331 3300026078 Bacteria 2878
663 Ga0207702_10113622 3300026078 Bacteria 2412
664 Ga0207702_10595424 3300026078 Bacteria 1084
665 Ga0207702_10678239 3300026078 Bacteria 1015
666 Ga0207702_11220538 3300026078 Bacteria 746
667 Ga0207641_10002425 3300026088 Bacteria 17226
668 Ga0207641_10007172 3300026088 Bacteria 9297
669 Ga0207641_10010041 3300026088 Bacteria 7786
670 Ga0207641_10019956 3300026088 Bacteria 5501
671 Ga0207641_10361234 3300026088 Bacteria 1386
672 Ga0207648_10001125 3300026089 Bacteria 30026
673 Ga0207648_10039980 3300026089 Bacteria 4122
674 Ga0207648_10100240 3300026089 Bacteria 2537
675 Ga0207648_10198079 3300026089 Bacteria 1781
676 Ga0207648_10880583 3300026089 Bacteria 836
677 Ga0207676_10000917 3300026095 Bacteria 22834
678 Ga0207676_10002064 3300026095 Bacteria 14583
679 Ga0207676_10122527 3300026095 Bacteria 2195
680 Ga0207674_10001209 3300026116 Bacteria 33653
681 Ga0207674_10003497 3300026116 Bacteria 19180
682 Ga0207674_10005284 3300026116 Bacteria 15364
683 Ga0207674_10042003 3300026116 Bacteria 4726
684 Ga0207674_10044295 3300026116 Bacteria 4583
685 Ga0207674_10061960 3300026116 Bacteria 3778
686 Ga0207674_10065180 3300026116 Bacteria 3673
687 Ga0207674_10074069 3300026116 Bacteria 3417
688 Ga0207674_10078017 3300026116 Bacteria 3318
689 Ga0207674_10078271 3300026116 Bacteria 3311
690 Ga0207674_10098357 3300026116 Bacteria 2909
691 Ga0207674_10155935 3300026116 Bacteria 2239
692 Ga0207674_10283560 3300026116 Bacteria 1605
693 Ga0207675_100187435 3300026118 Bacteria 1983
694 Ga0207675_100206909 3300026118 Bacteria 1886
695 Ga0207675_100214906 3300026118 Bacteria 1851
696 Ga0207683_10235374 3300026121 Bacteria 1670
697 Ga0207698_10000737 3300026142 Bacteria 18984
698 Ga0207698_10010204 3300026142 Bacteria 6020
699 Ga0207698_10011465 3300026142 Bacteria 5751
700 Ga0207698_10032947 3300026142 Bacteria 3759
701 Ga0207698_10052280 3300026142 Bacteria 3129
702 Ga0207698_10281075 3300026142 Bacteria 1539
703 Ga0207698_10306515 3300026142 Bacteria 1481
704 Ga0207698_10410662 3300026142 Bacteria 1296
705 Ga0207698_10422514 3300026142 Bacteria 1279
706 Ga0207698_10474018 3300026142 Bacteria 1213
707 Ga0209983_1031785 3300027665 Bacteria 1126
708 Ga0268266_10000919 3300028379 Bacteria 37886
709 Ga0268266_10004144 3300028379 Bacteria 13996
710 Ga0268266_10012979 3300028379 Bacteria 7183
711 Ga0268266_10034858 3300028379 Bacteria 4281
712 Ga0268266_10347528 3300028379 Bacteria 1393
713 Ga0268266_10407360 3300028379 Bacteria 1287
714 Ga0268265_10006075 3300028380 Bacteria 8200
715 Ga0268265_10014289 3300028380 Bacteria 5407
716 Ga0268265_10020286 3300028380 Bacteria 4637
717 Ga0268265_10096961 3300028380 Bacteria 2371
718 Ga0268265_10121673 3300028380 Bacteria 2151
719 Ga0268265_10241132 3300028380 Bacteria 1595
720 Ga0268265_10291109 3300028380 Bacteria 1466
721 Ga0268265_10457381 3300028380 Bacteria 1193
722 Ga0268264_10001981 3300028381 Bacteria 18421
723 Ga0268264_10002566 3300028381 Bacteria 15920
724 Ga0268264_10021577 3300028381 Bacteria 5257
725 Ga0268264_10030213 3300028381 Bacteria 4442
726 Ga0268264_10035541 3300028381 Bacteria 4103
727 Ga0268264_10308812 3300028381 Bacteria 1491
728 Ga0268264_10760945 3300028381 Bacteria 966
729 Ga0307408_100288943 3300031548 Bacteria 1368
730 Ga0307405_10002230 3300031731 Bacteria 8473
731 Ga0307405_10647610 3300031731 Bacteria 868
732 Ga0307405_10715786 3300031731 Bacteria 831
733 Ga0307413_10018437 3300031824 Bacteria 3662
734 Ga0307413_10018732 3300031824 Bacteria 3639
735 Ga0307413_10183879 3300031824 Bacteria 1493
736 Ga0307413_10876659 3300031824 Bacteria 760
737 Ga0307410_10062395 3300031852 Bacteria 2554
738 Ga0307410_10071155 3300031852 Bacteria 2412
739 Ga0307410_10083932 3300031852 Bacteria 2244
740 Ga0307410_10150682 3300031852 Bacteria 1731
741 Ga0307410_10208991 3300031852 Bacteria 1494
742 Ga0307410_10245863 3300031852 Bacteria 1389
743 Ga0307410_10314374 3300031852 Bacteria 1240
744 Ga0307406_10021751 3300031901 Bacteria 3797
745 Ga0307406_10022733 3300031901 Bacteria 3723
746 Ga0307406_10292724 3300031901 Bacteria 1247
747 Ga0307407_10007084 3300031903 Bacteria 5051
748 Ga0307407_10010208 3300031903 Bacteria 4417
749 Ga0307407_10419088 3300031903 Bacteria 964
750 Ga0307407_10624551 3300031903 Bacteria 804
751 Ga0307412_10024880 3300031911 Bacteria 3701
752 Ga0307412_10150248 3300031911 Bacteria 1718
753 Ga0307412_10326669 3300031911 Bacteria 1223
754 Ga0307412_10384428 3300031911 Bacteria 1137
755 Ga0307412_10645189 3300031911 Bacteria 902
756 Ga0307409_100001293 3300031995 Bacteria 12132
757 Ga0307409_100011830 3300031995 Bacteria 5525
758 Ga0307409_100143190 3300031995 Bacteria 2063
759 Ga0307409_100330241 3300031995 Bacteria 1431
760 Ga0307409_100367526 3300031995 Bacteria 1363
761 Ga0307409_100451222 3300031995 Bacteria 1241
762 Ga0307409_100547589 3300031995 Bacteria 1135
763 Ga0307416_100011575 3300032002 Bacteria 5892
764 Ga0307416_100246126 3300032002 Bacteria 1736
765 Ga0307416_100409683 3300032002 Bacteria 1396
766 Ga0307416_100745036 3300032002 Bacteria 1072
767 Ga0307416_101312951 3300032002 Bacteria 829
768 Ga0307414_10120882 3300032004 Bacteria 2013
769 Ga0307414_10268577 3300032004 Bacteria 1427
770 Ga0307414_10397845 3300032004 Bacteria 1195
771 Ga0307414_10442924 3300032004 Bacteria 1137
772 Ga0307414_10463249 3300032004 Bacteria 1114
773 Ga0307411_10000556 3300032005 Bacteria 13284
774 Ga0307411_10136089 3300032005 Bacteria 1804
775 Ga0307411_10280668 3300032005 Bacteria 1325
776 Ga0307411_10321121 3300032005 Bacteria 1250
777 Ga0307411_10458468 3300032005 Bacteria 1068
778 Ga0307411_10567768 3300032005 Bacteria 971
779 Ga0307411_10747209 3300032005 Bacteria 856
780 Ga0307415_100010082 3300032126 Bacteria 5331
781 Ga0307415_100104164 3300032126 Bacteria 2089
782 Ga0307415_100357838 3300032126 Bacteria 1231
783 Ga0307415_100422745 3300032126 Bacteria 1144
784 Ga0307415_100505701 3300032126 Bacteria 1057
785 Ga0307415_100818113 3300032126 Bacteria 852
786 Ga0373923_0011578 3300035111 Bacteria 3241
787 Ga0373953_0042883 3300035117 Bacteria 1804
788 Ga0373954_0016927 3300035118 Bacteria 3271
789 Ga0373956_0123288 3300035119 Bacteria 1211
790 Ga0373955_0008362 3300035172 Bacteria 4804
791 Ga0373931_0003582 3300035691 Bacteria 7002
792 Ga0373933_0043995 3300035724 Bacteria 2644
793 Ga0373937_0001514 3300036401 Bacteria 19522
794 Ga0395899_0001715 3300037312 Bacteria 18225
795 Ga0395899_0027829 3300037312 Bacteria 4259
796 Ga0395899_0039476 3300037312 Bacteria 3533
797 Ga0395899_0048679 3300037312 Bacteria 3153
798 Ga0395899_0072505 3300037312 Bacteria 2519
799 Ga0395899_0152794 3300037312 Bacteria 1635
800 Ga0395899_0200630 3300037312 Bacteria 1391
801 Ga0395899_0229658 3300037312 Bacteria 1282
802 Ga0395899_0239717 3300037312 Bacteria 1248
803 Ga0395899_0323064 3300037312 Bacteria 1039
804 Ga0395899_0401779 3300037312 Bacteria 906
805 Ga0395899_0405685 3300037312 Bacteria 901
806 Ga0395899_0478158 3300037312 Bacteria 811
807 Ga0395900_0000840 3300037418 Bacteria 40454
808 Ga0395900_0034608 3300037418 Bacteria 5203
809 Ga0395900_0045745 3300037418 Bacteria 4508
810 Ga0395900_0052995 3300037418 Bacteria 4176
811 Ga0395900_0054630 3300037418 Bacteria 4112
812 Ga0395900_0059342 3300037418 Bacteria 3938
813 Ga0395900_0080672 3300037418 Bacteria 3343
814 Ga0395900_0080762 3300037418 Bacteria 3341
815 Ga0395900_0089139 3300037418 Bacteria 3171
816 Ga0395900_0111456 3300037418 Bacteria 2810
817 Ga0395900_0150736 3300037418 Bacteria 2375
818 Ga0395900_0167614 3300037418 Bacteria 2238
819 Ga0395900_0168291 3300037418 Bacteria 2232
820 Ga0395900_0193052 3300037418 Bacteria 2064
821 Ga0395900_0310140 3300037418 Bacteria 1561
822 Ga0395900_0355643 3300037418 Bacteria 1437
823 Ga0395900_0384635 3300037418 Unclassified 1370
824 Ga0395900_0449624 3300037418 Bacteria 1245
825 Ga0395900_0452739 3300037418 Bacteria 1239
826 Ga0395900_0539657 3300037418 Bacteria 1112
827 Ga0395900_0705321 3300037418 Bacteria 942
828 Ga0395898_0012167 3300037466 Bacteria 8902
829 Ga0395898_0028849 3300037466 Bacteria 5562
830 Ga0395898_0040407 3300037466 Bacteria 4612
831 Ga0395898_0041698 3300037466 Bacteria 4532
832 Ga0395898_0051400 3300037466 Bacteria 4030
833 Ga0395898_0088562 3300037466 Bacteria 2980
834 Ga0395898_0094563 3300037466 Bacteria 2872
835 Ga0395898_0215355 3300037466 Bacteria 1832
836 Ga0395898_0228681 3300037466 Bacteria 1774
837 Ga0395898_0261596 3300037466 Bacteria 1650
838 Ga0395898_0279542 3300037466 Bacteria 1592
839 Ga0395898_0699318 3300037466 Bacteria 955
840 Ga0395898_1415883 3300037466 Bacteria 622
841 Ga0395905_0000204 3300037471 Bacteria 92152
842 Ga0395905_0005199 3300037471 Bacteria 13324
843 Ga0395905_0011167 3300037471 Bacteria 8683
844 Ga0395905_0011807 3300037471 Bacteria 8434
845 Ga0395905_0021288 3300037471 Bacteria 6135
846 Ga0395905_0029361 3300037471 Bacteria 5181
847 Ga0395905_0035906 3300037471 Bacteria 4654
848 Ga0395905_0051937 3300037471 Bacteria 3839
849 Ga0395905_0052280 3300037471 Bacteria 3824
850 Ga0395905_0052540 3300037471 Bacteria 3814
851 Ga0395905_0066578 3300037471 Bacteria 3374
852 Ga0395905_0066976 3300037471 Bacteria 3363
853 Ga0395905_0084760 3300037471 Bacteria 2969
854 Ga0395905_0134936 3300037471 Bacteria 2322
855 Ga0395905_0140156 3300037471 Bacteria 2275
856 Ga0395905_0162033 3300037471 Bacteria 2102
857 Ga0395905_0227560 3300037471 Bacteria 1744
858 Ga0395905_0260885 3300037471 Bacteria 1618
859 Ga0395905_0284767 3300037471 Bacteria 1539
860 Ga0395905_0323615 3300037471 Bacteria 1432
861 Ga0395905_0333565 3300037471 Bacteria 1407
862 Ga0395905_0334317 3300037471 Bacteria 1405
863 Ga0395905_0354413 3300037471 Bacteria 1360
864 Ga0395905_0400993 3300037471 Bacteria 1266
865 Ga0395905_0406653 3300037471 Bacteria 1256
866 Ga0395905_0523684 3300037471 Bacteria 1086
867 Ga0395905_0648953 3300037471 Bacteria 957
868 Ga0395905_0866292 3300037471 Bacteria 806
869 Ga0395901_0000783 3300038443 Bacteria 35511
870 Ga0395901_0052384 3300038443 Bacteria 4241
871 Ga0395901_0056784 3300038443 Bacteria 4072
872 Ga0395901_0082569 3300038443 Bacteria 3357
873 Ga0395901_0116550 3300038443 Bacteria 2806
874 Ga0395901_0123837 3300038443 Bacteria 2716
875 Ga0395901_0143542 3300038443 Bacteria 2509
876 Ga0395901_0162544 3300038443 Bacteria 2345
877 Ga0395901_0234998 3300038443 Bacteria 1913
878 Ga0395901_0298819 3300038443 Bacteria 1669
879 Ga0395901_0330258 3300038443 Bacteria 1576
880 Ga0395901_0402823 3300038443 Bacteria 1405
881 Ga0395901_0829496 3300038443 Bacteria 911
882 Ga0395901_1001561 3300038443 Bacteria 811
883 Ga0436365_1794861 3300039437 Bacteria 40929
884 Ga0436362_0126459 3300039453 Bacteria 236400
885 Ga0439449_0037222 3300042007 Bacteria 1810
886 Ga0450914_000283 3300042118 Bacteria 2118
887 Ga0450905_000467 3300042142 Bacteria 4952
888 Ga0450889_000037 3300042144 Bacteria 11669
889 Ga0439458_0012905 3300042157 Bacteria 1878
890 Ga0439464_0004801 3300042439 Bacteria 3465
891 Ga0439460_0060260 3300042461 Bacteria 1157
892 Ga0466972_0079994 3300044658 Bacteria 1556
893 Ga0466972_0086756 3300044658 Bacteria 1487
894 Ga0466966_0000041 3300044684 Bacteria 97092
895 Ga0466966_0011898 3300044684 Bacteria 5765
896 Ga0466961_0018770 3300044693 Bacteria 4449
897 Ga0466963_0022112 3300044694 Bacteria 4023
898 Ga0466963_0042670 3300044694 Bacteria 2979
899 Ga0466963_0079222 3300044694 Bacteria 2222
900 Ga0466963_0192427 3300044694 Bacteria 1425
901 Ga0466964_0044365 3300044706 Bacteria 1806
902 Ga0466971_0023573 3300044719 Bacteria 2744
903 Ga0466970_0184869 3300044765 Bacteria 1157
904 Ga0466957_0042471 3300044842 Bacteria 2751
905 Ga0466957_0118195 3300044842 Bacteria 1688
906 Ga0466960_0306246 3300044901 Bacteria 896
907 Ga0466959_0200135 3300045049 Bacteria 1391
908 Ga0466959_0418173 3300045049 Bacteria 910
909 Ga0466959_0431526 3300045049 Bacteria 894
910 Ga0466959_0605496 3300045049 Bacteria 737
911 Ga0466958_0134997 3300045836 Bacteria 1551
912 Ga0466958_0156567 3300045836 Bacteria 1438
913 Ga0466967_0018712 3300045976 Bacteria 5546
914 Ga0466967_0030958 3300045976 Bacteria 4497
915 Ga0466967_0037232 3300045976 Bacteria 4161
916 Ga0466967_0145667 3300045976 Bacteria 2209
917 Ga0466967_0597077 3300045976 Bacteria 1089
918 Ga0466967_1348412 3300045976 Bacteria 710
919 Ga0495585_0119631 3300046492 Bacteria 1394
920 Ga0495663_0003269 3300046525 Bacteria 4708
921 Ga0495663_0050758 3300046525 Bacteria 1283
922 Ga0495621_0001841 3300046539 Bacteria 5572
923 Ga0495621_0029182 3300046539 Bacteria 1879
924 Ga0495633_0058654 3300046558 Bacteria 1806
925 Ga0495633_0081237 3300046558 Bacteria 1508
926 Ga0495625_0245711 3300046660 Bacteria 1163
927 Ga0495659_0049857 3300046664 Bacteria 1521
928 Ga0495623_0034941 3300046679 Bacteria 3223
929 Ga0495669_0021393 3300046684 Bacteria 2806
930 Ga0495669_0021496 3300046684 Bacteria 2801
931 Ga0495669_0038178 3300046684 Bacteria 2127
932 Ga0495669_0121500 3300046684 Bacteria 1224
933 Ga0495669_0276359 3300046684 Bacteria 808
934 Ga0495670_0022665 3300046691 Bacteria 3101
935 Ga0495670_0049483 3300046691 Bacteria 2103
936 Ga0495670_0378801 3300046691 Bacteria 763
937 Ga0495677_0110259 3300047445 Bacteria 1046
938 Ga0495602_0017708 3300048088 Bacteria 7136
939 Ga0496102_0873512 3300048905 Bacteria 821
940 Ga0496103_0434124 3300048906 Bacteria 843
941 Ga0496104_0272919 3300048907 Bacteria 1604
942 Ga0496107_0019983 3300048910 Bacteria 4729
943 Ga0496107_0072275 3300048910 Bacteria 2508
944 Ga0496108_0012109 3300048911 Bacteria 7012
945 Ga0496108_0240037 3300048911 Bacteria 1576
946 Ga0496109_0088239 3300048912 Bacteria 2866
947 Ga0496110_0078723 3300048913 Bacteria 2935
948 Ga0496110_0148399 3300048913 Bacteria 2122
949 Ga0496111_0206986 3300048914 Bacteria 1458
950 Ga0496111_0645787 3300048914 Bacteria 772
951 Ga0496112_0010249 3300048915 Bacteria 8495
952 Ga0496112_0017528 3300048915 Bacteria 6730
953 Ga0496112_0233166 3300048915 Bacteria 1795
954 Ga0496113_0765331 3300048916 Bacteria 768
955 Ga0501071_0473364 3300049587 Bacteria 960
956 Ga0501216_022483 3300049660 Bacteria 1115
957 Ga0501224_005140 3300049664 Bacteria 1868
958 Ga0501235_006398 3300049669 Bacteria 2565
959 Ga0501247_003499 3300049677 Bacteria 1684
960 Ga0501249_006930 3300049679 Bacteria 2335
961 Ga0501259_075214 3300049688 Bacteria 732
962 Ga0501221_003507 3300049704 Bacteria 2584
963 Ga0501229_003977 3300049706 Bacteria 1788
964 Ga0501080_0334433 3300049742 Bacteria 1369
965 Ga0501267_004398 3300049764 Bacteria 1308
966 Ga0501272_001065 3300049769 Bacteria 2529
967 nmdc:mga09592_164424_c1 3300050508 Bacteria 1917
968 nmdc:mga06r32_323452_c1 3300050510 Bacteria 1527
969 nmdc:mga08y16_776911_c1 3300050511 Bacteria 952
970 nmdc:mga0n895_432723_c1 3300050512 Bacteria 1329
971 nmdc:mga0rr50_506674_c1 3300050513 Bacteria 1026
972 nmdc:mga0a205_10767_c1 3300050515 Bacteria 8410
973 Ga0495612_0102269 3300053078 Bacteria 1221
974 Ga0466962_0090277 3300061719 Bacteria 1468
975 2896431524 2896429255 Bacteria 2557483
976 Ga0213873_10000012
977 JGI24736J21556_1000576
978 JGI24740J21852_10002069
979 JGI24740J21852_10002142
980 JGI24740J21852_10013153
981 JGI24740J21852_10017863
982 JGI24739J22299_10001859
983 JGI24739J22299_10002462
984 JGI24739J22299_10023180
985 JGI24739J22299_10110394
986 JGI24737J22298_10000548
987 JGI24737J22298_10000821
988 JGI24737J22298_10010369
989 JGI24737J22298_10026711
990 JGI24737J22298_10066636
991 JGI24743J22301_10037758
992 JGI24735J21928_10025041
993 JGI24735J21928_10036456
994 JGI24738J21930_10001458
995 JGI24738J21930_10001895
996 JGI24742J22300_10046142
997 Ga0065715_10480269
998 Ga0065707_10258703
999 Ga0070658_10000220
1000 Ga0070658_10030170
1001 Ga0070658_10071181
1002 Ga0070658_10078460
1003 Ga0070658_10100859
1004 Ga0070658_10136711
1005 Ga0070658_10152462
1006 Ga0070658_10179237
1007 Ga0070658_10844342
1008 Ga0070658_11010114
1009 Ga0070676_10020992
1010 Ga0070676_10059751
1011 Ga0070683_100003373
1012 Ga0070683_100027975
1013 Ga0070683_100084862
1014 Ga0070683_100141589
1015 Ga0070683_100141613
1016 Ga0070683_100297361
1017 Ga0070683_100444031
1018 Ga0070690_100034100
1019 Ga0070690_100220359
1020 Ga0070670_100012025
1021 Ga0070670_100342848
1022 Ga0070670_100365503
1023 Ga0070670_100515698
1024 Ga0068869_100000443
1025 Ga0068869_100147532
1026 Ga0068869_100240288
1027 Ga0070666_10017824
1028 Ga0070666_10084363
1029 Ga0070666_10175674
1030 Ga0070666_10310188
1031 Ga0070680_100256555
1032 Ga0070682_100030269
1033 Ga0070682_100120292
1034 Ga0070682_100176181
1035 Ga0070682_100413639
1036 Ga0070682_100430981
1037 Ga0068868_100001904
1038 Ga0068868_100060036
1039 Ga0070660_100000218
1040 Ga0070660_100006122
1041 Ga0070660_100009510
1042 Ga0070660_100022235
1043 Ga0070660_100042238
1044 Ga0070660_100051279
1045 Ga0070660_100081859
1046 Ga0070660_100110262
1047 Ga0070660_100114506
1048 Ga0070660_100355069
1049 Ga0070689_100034452
1050 Ga0070691_10092739
1051 Ga0070661_100000181
1052 Ga0070661_100010804
1053 Ga0070661_100041645
1054 Ga0070661_100048896
1055 Ga0070661_100070692
1056 Ga0070661_100102287
1057 Ga0070661_100280332
1058 Ga0070661_100484746
1059 Ga0070692_10009547
1060 Ga0070692_10024650
1061 Ga0070692_10064428
1062 Ga0070692_10125342
1063 Ga0070692_10127859
1064 Ga0070668_100002807
1065 Ga0070668_100004982
1066 Ga0070668_100202497
1067 Ga0070668_100501816
1068 Ga0070669_100001401
1069 Ga0070669_100005960
1070 Ga0070669_100027357
1071 Ga0070669_100036569
1072 Ga0070669_100037659
1073 Ga0070669_100040079
1074 Ga0070669_100573948
1075 Ga0070675_100012535
1076 Ga0070675_100427639
1077 Ga0070675_100571061
1078 Ga0070671_100007089
1079 Ga0070671_100009863
1080 Ga0070671_100011341
1081 Ga0070671_100189008
1082 Ga0070671_100329814
1083 Ga0070674_100003561
1084 Ga0070673_100001138
1085 Ga0070673_100039227
1086 Ga0070673_100077903
1087 Ga0070673_100693468
1088 Ga0070673_100761367
1089 Ga0070659_100000310
1090 Ga0070659_100000653
1091 Ga0070659_100003703
1092 Ga0070659_100021829
1093 Ga0070659_100030599
1094 Ga0070659_100116511
1095 Ga0070659_100174875
1096 Ga0070659_100199062
1097 Ga0070659_100224352
1098 Ga0070659_100237408
1099 Ga0070659_100247076
1100 Ga0070659_100295381
1101 Ga0070659_100457348
1102 Ga0070659_100495919
1103 Ga0070659_100535352
1104 Ga0070667_100005201
1105 Ga0070667_100009852
1106 Ga0070667_100011907
1107 Ga0070667_100019462
1108 Ga0070667_100063055
1109 Ga0070667_100153809
1110 Ga0070667_100293170
1111 Ga0070667_100319237
1112 Ga0070667_100696859
1113 Ga0070714_100235073
1114 Ga0070714_100689966
1115 Ga0070714_100764043
1116 Ga0070713_100007217
1117 Ga0070713_100698717
1118 Ga0070710_10230269
1119 Ga0070694_100003942
1120 Ga0070694_100004844
1121 Ga0070663_100032513
1122 Ga0070663_100057231
1123 Ga0070663_100080483
1124 Ga0070663_100088223
1125 Ga0070663_100391090
1126 Ga0070663_100411323
1127 Ga0070663_100657639
1128 Ga0070678_100813551
1129 Ga0070662_100000080
1130 Ga0070662_100000441
1131 Ga0070662_100001943
1132 Ga0070662_100019464
1133 Ga0070662_100024092
1134 Ga0070662_100070042
1135 Ga0070662_100070716
1136 Ga0070662_100171374
1137 Ga0070662_100256889
1138 Ga0070662_100802170
1139 Ga0070681_10038070
1140 Ga0070681_10462787
1141 Ga0068867_100000772
1142 Ga0068867_100216482
1143 Ga0068867_100341995
1144 Ga0070706_100264252
1145 Ga0070679_100014346
1146 Ga0070679_100040091
1147 Ga0070679_100124612
1148 Ga0070679_100179853
1149 Ga0070679_100483986
1150 Ga0070679_100491151
1151 Ga0070679_100541510
1152 Ga0070679_100961097
1153 Ga0070684_100007195
1154 Ga0070684_100026657
1155 Ga0068853_100000134
1156 Ga0068853_100000707
1157 Ga0068853_100093343
1158 Ga0068853_100121918
1159 Ga0068853_100330234
1160 Ga0068853_100362374
1161 Ga0068853_100500781
1162 Ga0070672_100000140
1163 Ga0070672_100040478
1164 Ga0070672_100134009
1165 Ga0070686_100560853
1166 Ga0070696_100011547
1167 Ga0070696_100094167
1168 Ga0070696_100206411
1169 Ga0070693_100019921
1170 Ga0070693_100019931
1171 Ga0070693_100098064
1172 Ga0070665_100002647
1173 Ga0070665_100003354
1174 Ga0070665_100022024
1175 Ga0070665_100211839
1176 Ga0070665_100360489
1177 Ga0070665_100465414
1178 Ga0068855_100002690
1179 Ga0068855_100006137
1180 Ga0068855_100006734
1181 Ga0068855_100378995
1182 Ga0068855_100482992
1183 Ga0068855_100583921
1184 Ga0068855_100650181
1185 Ga0070664_100000961
1186 Ga0070664_100015273
1187 Ga0070664_100027154
1188 Ga0070664_100048714
1189 Ga0070664_100098859
1190 Ga0070664_100099232
1191 Ga0070664_100145542
1192 Ga0070664_100192051
1193 Ga0070664_100268362
1194 Ga0070664_100346684
1195 Ga0070664_100470504
1196 Ga0068857_100000090
1197 Ga0068857_100018698
1198 Ga0068857_100130491
1199 Ga0068857_100241917
1200 Ga0068857_100279385
1201 Ga0068857_100710353
1202 Ga0068854_100003349
1203 Ga0068854_100011326
1204 Ga0068854_100018383
1205 Ga0068854_100028155
1206 Ga0068854_100048110
1207 Ga0068854_100279370
1208 Ga0068854_100326100
1209 Ga0068854_100350741
1210 Ga0068854_100416090
1211 Ga0068854_100460436
1212 Ga0068854_100721000
1213 Ga0068856_100001082
1214 Ga0068856_100044902
1215 Ga0068856_100074402
1216 Ga0068856_100092975
1217 Ga0068856_100098071
1218 Ga0068856_100168846
1219 Ga0068852_100000532
1220 Ga0068852_100004509
1221 Ga0068852_100005574
1222 Ga0068852_100017312
1223 Ga0068852_100054490
1224 Ga0068852_100142152
1225 Ga0068852_100275151
1226 Ga0068852_100341703
1227 Ga0068852_100398911
1228 Ga0068852_100503155
1229 Ga0068852_100541597
1230 Ga0068859_100000464
1231 Ga0068859_100001249
1232 Ga0068859_100035033
1233 Ga0068859_100196533
1234 Ga0068859_100212420
1235 Ga0068859_100421730
1236 Ga0068859_100463871
1237 Ga0068859_101092010
1238 Ga0068864_100000676
1239 Ga0068864_100000842
1240 Ga0068864_100008233
1241 Ga0068864_100426845
1242 Ga0068866_10388855
1243 Ga0068861_100150318
1244 Ga0068861_100834390
1245 Ga0068851_10011418
1246 Ga0068851_10226375
1247 Ga0068851_10253457
1248 Ga0068851_10369289
1249 Ga0068870_10249793
1250 Ga0068863_100001768
1251 Ga0068863_100001937
1252 Ga0068863_100021780
1253 Ga0068863_100137556
1254 Ga0068863_100165173
1255 Ga0068863_100196278
1256 Ga0068863_100519858
1257 Ga0068858_100001850
1258 Ga0068858_100002115
1259 Ga0068858_100003441
1260 Ga0068858_100052474
1261 Ga0068858_100815782
1262 Ga0068860_100002483
1263 Ga0068860_100005039
1264 Ga0068860_100005670
1265 Ga0068860_100053074
1266 Ga0068862_100006405
1267 Ga0068862_100028321
1268 Ga0068862_100067608
1269 Ga0068862_100112100
1270 Ga0068862_100118973
1271 Ga0068862_100138519
1272 Ga0068862_100297402
1273 Ga0068862_100875755
1274 Ga0081539_10008202
1275 Ga0070717_10022282
1276 Ga0070715_10138250
1277 Ga0075367_10243273
1278 Ga0075369_10133496
1279 Ga0097621_100013670
1280 Ga0097621_100064108
1281 Ga0097621_100178478
1282 Ga0097621_100927839
1283 Ga0068871_100006328
1284 Ga0068871_100089883
1285 Ga0068871_100104019
1286 Ga0068871_100230645
1287 Ga0075433_10107241
1288 Ga0075429_100256821
1289 Ga0068865_100000519
1290 Ga0068865_100063967
1291 Ga0068865_100230871
1292 Ga0097620_100000464
1293 Ga0097620_100001249
1294 Ga0097620_100035036
1295 Ga0097620_100196529
1296 Ga0097620_100212409
1297 Ga0097620_100421733
1298 Ga0097620_100463848
1299 Ga0097620_101091990
1300 Ga0075435_100810793
1301 Ga0105251_10079970
1302 Ga0105240_10010940
1303 Ga0105240_10016645
1304 Ga0105240_10108385
1305 Ga0105240_10305963
1306 Ga0111539_10005572
1307 Ga0105245_10000958
1308 Ga0105247_10351210
1309 Ga0105247_10453605
1310 Ga0105243_10110557
1311 Ga0105241_10024818
1312 Ga0105241_10127798
1313 Ga0105241_10178157
1314 Ga0105241_10295626
1315 Ga0105242_10082084
1316 Ga0105242_10471554
1317 Ga0105242_10832405
1318 Ga0105248_10000276
1319 Ga0105248_10001159
1320 Ga0105248_10001339
1321 Ga0105248_10176874
1322 Ga0105248_10215419
1323 Ga0105248_10313803
1324 Ga0105248_11730766
1325 Ga0105237_10141087
1326 Ga0105237_10385956
1327 Ga0105238_10061139
1328 Ga0105238_10158906
1329 Ga0105238_10250603
1330 Ga0105249_10007337
1331 Ga0105249_10310443
1332 Ga0105239_10039562
1333 Ga0105246_10014496
1334 Ga0105246_10066708
1335 Ga0105246_10119991
1336 Ga0157373_10010954
1337 Ga0157373_10043793
1338 Ga0157373_10068868
1339 Ga0157373_10115959
1340 Ga0157373_10159516
1341 Ga0157373_10160412
1342 Ga0157373_10164438
1343 Ga0157373_10336123
1344 Ga0157373_10445829
1345 Ga0157371_10002258
1346 Ga0157371_10002431
1347 Ga0157371_10030425
1348 Ga0157371_10065575
1349 Ga0157371_10081917
1350 Ga0157371_10085943
1351 Ga0157371_10088804
1352 Ga0157371_10092596
1353 Ga0157371_10119474
1354 Ga0157371_10124248
1355 Ga0157371_10158760
1356 Ga0157371_10220282
1357 Ga0157371_10376454
1358 Ga0157370_10010844
1359 Ga0157370_10046698
1360 Ga0157370_10219122
1361 Ga0157370_10426848
1362 Ga0157370_10523194
1363 Ga0157369_10080442
1364 Ga0157369_10101553
1365 Ga0157369_10188115
1366 Ga0157369_10782440
1367 Ga0157374_10025778
1368 Ga0157374_10058257
1369 Ga0157378_10046518
1370 Ga0157378_10979451
1371 Ga0163162_10092260
1372 Ga0163162_10277063
1373 Ga0163162_10365419
1374 Ga0157372_10018683
1375 Ga0157372_10263446
1376 Ga0157372_10281299
1377 Ga0157372_10325314
1378 Ga0157372_10388392
1379 Ga0157372_10709972
1380 Ga0157372_11016073
1381 Ga0157372_11086024
1382 Ga0157375_10046833
1383 Ga0157375_10078421
1384 Ga0157375_10364586
1385 Ga0157375_11100228
1386 Ga0163163_10000139
1387 Ga0163163_10000799
1388 Ga0163163_10009909
1389 Ga0157380_10002116
1390 Ga0157380_10037711
1391 Ga0157377_10334887
1392 Ga0157379_10011784
1393 Ga0213876_10000021
1394 Ga0207697_10000261
1395 Ga0207697_10022747
1396 Ga0207697_10109104
1397 Ga0207656_10000759
1398 Ga0207656_10006291
1399 Ga0207682_10007404
1400 Ga0207682_10033276
1401 Ga0207688_10000960
1402 Ga0207688_10077438
1403 Ga0207688_10101643
1404 Ga0207680_10018356
1405 Ga0207680_10126931
1406 Ga0207647_10005894
1407 Ga0207647_10006920
1408 Ga0207647_10012421
1409 Ga0207647_10031536
1410 Ga0207647_10033600
1411 Ga0207647_10054637
1412 Ga0207647_10059961
1413 Ga0207647_10085486
1414 Ga0207647_10211834
1415 Ga0207647_10214596
1416 Ga0207645_10003103
1417 Ga0207645_10020450
1418 Ga0207645_10043286
1419 Ga0207645_10078206
1420 Ga0207643_10044795
1421 Ga0207643_10278355
1422 Ga0207705_10000030
1423 Ga0207705_10000164
1424 Ga0207705_10000382
1425 Ga0207705_10003138
1426 Ga0207705_10004450
1427 Ga0207705_10005276
1428 Ga0207705_10007994
1429 Ga0207705_10013448
1430 Ga0207705_10201557
1431 Ga0207705_10214533
1432 Ga0207705_10262722
1433 Ga0207705_10427195
1434 Ga0207705_10440947
1435 Ga0207705_10499082
1436 Ga0207654_10014959
1437 Ga0207654_10119320
1438 Ga0207707_10094767
1439 Ga0207707_10124110
1440 Ga0207707_10125991
1441 Ga0207707_10343855
1442 Ga0207707_10409642
1443 Ga0207707_10697555
1444 Ga0207695_10003659
1445 Ga0207695_10013923
1446 Ga0207695_10101462
1447 Ga0207660_10000400
1448 Ga0207660_10052623
1449 Ga0207660_10078260
1450 Ga0207660_10158562
1451 Ga0207660_10260005
1452 Ga0207662_10229167
1453 Ga0207657_10000090
1454 Ga0207657_10000966
1455 Ga0207657_10002284
1456 Ga0207657_10003169
1457 Ga0207657_10004583
1458 Ga0207657_10006005
1459 Ga0207657_10012628
1460 Ga0207657_10015081
1461 Ga0207657_10021634
1462 Ga0207657_10047114
1463 Ga0207657_10047788
1464 Ga0207657_10050394
1465 Ga0207657_10077739
1466 Ga0207657_10084158
1467 Ga0207657_10107449
1468 Ga0207657_10236847
1469 Ga0207657_10475017
1470 Ga0207649_10000324
1471 Ga0207649_10001913
1472 Ga0207649_10037569
1473 Ga0207649_10188306
1474 Ga0207649_10347917
1475 Ga0207652_10027129
1476 Ga0207652_10028132
1477 Ga0207652_10055492
1478 Ga0207652_10103477
1479 Ga0207652_10150044
1480 Ga0207681_10014489
1481 Ga0207681_10036861
1482 Ga0207681_10071285
1483 Ga0207681_10101558
1484 Ga0207681_10195621
1485 Ga0207681_10587686
1486 Ga0207694_10216644
1487 Ga0207694_10269932
1488 Ga0207694_10388274
1489 Ga0207650_10036661
1490 Ga0207650_10092024
1491 Ga0207650_11048854
1492 Ga0207659_10012678
1493 Ga0207659_10301927
1494 Ga0207659_10560522
1495 Ga0207687_10001103
1496 Ga0207700_10066091
1497 Ga0207664_10041241
1498 Ga0207644_10008141
1499 Ga0207644_10037075
1500 Ga0207644_10156729
1501 Ga0207644_10307505
1502 Ga0207644_10441725
1503 Ga0207644_10684395
1504 Ga0207690_10000184
1505 Ga0207690_10001341
1506 Ga0207690_10002961
1507 Ga0207690_10031485
1508 Ga0207690_10040601
1509 Ga0207690_10102266
1510 Ga0207690_10144847
1511 Ga0207690_10203622
1512 Ga0207690_10313361
1513 Ga0207690_10389910
1514 Ga0207690_10428583
1515 Ga0207690_10454998
1516 Ga0207706_10000110
1517 Ga0207706_10000407
1518 Ga0207706_10002190
1519 Ga0207706_10005564
1520 Ga0207706_10015317
1521 Ga0207706_10016228
1522 Ga0207706_10022613
1523 Ga0207706_10063039
1524 Ga0207706_10094852
1525 Ga0207706_10189581
1526 Ga0207706_10236441
1527 Ga0207706_10244460
1528 Ga0207706_10309683
1529 Ga0207709_10437132
1530 Ga0207709_10707650
1531 Ga0207669_10039205
1532 Ga0207669_10072209
1533 Ga0207704_10008609
1534 Ga0207704_10049293
1535 Ga0207691_10001863
1536 Ga0207691_10048625
1537 Ga0207691_10098629
1538 Ga0207691_10340919
1539 Ga0207691_10522783
1540 Ga0207691_10568676
1541 Ga0207711_10000258
1542 Ga0207711_10000586
1543 Ga0207711_10008002
1544 Ga0207711_10024036
1545 Ga0207711_10396386
1546 Ga0207689_10000341
1547 Ga0207689_10037788
1548 Ga0207689_10090091
1549 Ga0207689_10330669
1550 Ga0207661_10000179
1551 Ga0207661_10016307
1552 Ga0207661_10049021
1553 Ga0207661_10176509
1554 Ga0207661_10218208
1555 Ga0207661_11013308
1556 Ga0207679_10000329
1557 Ga0207679_10023827
1558 Ga0207679_10031409
1559 Ga0207679_10041529
1560 Ga0207679_10120259
1561 Ga0207679_10184695
1562 Ga0207679_10189310
1563 Ga0207679_10194337
1564 Ga0207679_10248949
1565 Ga0207679_10338088
1566 Ga0207679_10462868
1567 Ga0207667_10002920
1568 Ga0207667_10021644
1569 Ga0207667_10023410
1570 Ga0207667_10036194
1571 Ga0207667_10058049
1572 Ga0207667_10087948
1573 Ga0207667_10105008
1574 Ga0207667_10259463
1575 Ga0207667_10266574
1576 Ga0207667_10386057
1577 Ga0207667_10392970
1578 Ga0207667_10415806
1579 Ga0207651_10009435
1580 Ga0207651_10157662
1581 Ga0207651_10182790
1582 Ga0207651_10216049
1583 Ga0207651_10359004
1584 Ga0207651_10482913
1585 Ga0207712_10002871
1586 Ga0207668_10000101
1587 Ga0207668_10036169
1588 Ga0207668_10074765
1589 Ga0207668_10098135
1590 Ga0207668_10176344
1591 Ga0207668_10877264
1592 Ga0207640_10008088
1593 Ga0207640_10011150
1594 Ga0207640_10017217
1595 Ga0207640_10018067
1596 Ga0207640_10023018
1597 Ga0207640_10071916
1598 Ga0207640_10121647
1599 Ga0207640_10327435
1600 Ga0207640_10448551
1601 Ga0207640_10517789
1602 Ga0207658_10007940
1603 Ga0207658_10009186
1604 Ga0207658_10011763
1605 Ga0207658_10025865
1606 Ga0207658_10037526
1607 Ga0207658_10075589
1608 Ga0207658_10355703
1609 Ga0207658_10430614
1610 Ga0207658_10709537
1611 Ga0207677_10001288
1612 Ga0207677_10411698
1613 Ga0207677_10530914
1614 Ga0207703_10001366
1615 Ga0207703_10003682
1616 Ga0207703_10015105
1617 Ga0207703_10055791
1618 Ga0207639_10000458
1619 Ga0207639_10170267
1620 Ga0207639_10282908
1621 Ga0207639_10288505
1622 Ga0207639_10296384
1623 Ga0207678_10008049
1624 Ga0207678_10033788
1625 Ga0207678_10036629
1626 Ga0207678_10044001
1627 Ga0207678_10050700
1628 Ga0207678_10112058
1629 Ga0207678_10133849
1630 Ga0207678_10184027
1631 Ga0207678_10380527
1632 Ga0207678_10440540
1633 Ga0207702_10000391
1634 Ga0207702_10017169
1635 Ga0207702_10020548
1636 Ga0207702_10025039
1637 Ga0207702_10077331
1638 Ga0207702_10113622
1639 Ga0207702_10595424
1640 Ga0207702_10678239
1641 Ga0207702_11220538
1642 Ga0207641_10002425
1643 Ga0207641_10007172
1644 Ga0207641_10010041
1645 Ga0207641_10019956
1646 Ga0207641_10361234
1647 Ga0207648_10001125
1648 Ga0207648_10039980
1649 Ga0207648_10100240
1650 Ga0207648_10198079
1651 Ga0207648_10880583
1652 Ga0207676_10000917
1653 Ga0207676_10002064
1654 Ga0207676_10122527
1655 Ga0207674_10001209
1656 Ga0207674_10003497
1657 Ga0207674_10005284
1658 Ga0207674_10042003
1659 Ga0207674_10044295
1660 Ga0207674_10061960
1661 Ga0207674_10065180
1662 Ga0207674_10074069
1663 Ga0207674_10078017
1664 Ga0207674_10078271
1665 Ga0207674_10098357
1666 Ga0207674_10155935
1667 Ga0207674_10283560
1668 Ga0207675_100187435
1669 Ga0207675_100206909
1670 Ga0207675_100214906
1671 Ga0207683_10235374
1672 Ga0207698_10000737
1673 Ga0207698_10010204
1674 Ga0207698_10011465
1675 Ga0207698_10032947
1676 Ga0207698_10052280
1677 Ga0207698_10281075
1678 Ga0207698_10306515
1679 Ga0207698_10410662
1680 Ga0207698_10422514
1681 Ga0207698_10474018
1682 Ga0209983_1031785
1683 Ga0268266_10000919
1684 Ga0268266_10004144
1685 Ga0268266_10012979
1686 Ga0268266_10034858
1687 Ga0268266_10347528
1688 Ga0268266_10407360
1689 Ga0268265_10006075
1690 Ga0268265_10014289
1691 Ga0268265_10020286
1692 Ga0268265_10096961
1693 Ga0268265_10121673
1694 Ga0268265_10241132
1695 Ga0268265_10291109
1696 Ga0268265_10457381
1697 Ga0268264_10001981
1698 Ga0268264_10002566
1699 Ga0268264_10021577
1700 Ga0268264_10030213
1701 Ga0268264_10035541
1702 Ga0268264_10308812
1703 Ga0268264_10760945
1704 Ga0307408_100288943
1705 Ga0307405_10002230
1706 Ga0307405_10647610
1707 Ga0307405_10715786
1708 Ga0307413_10018437
1709 Ga0307413_10018732
1710 Ga0307413_10183879
1711 Ga0307413_10876659
1712 Ga0307410_10062395
1713 Ga0307410_10071155
1714 Ga0307410_10083932
1715 Ga0307410_10150682
1716 Ga0307410_10208991
1717 Ga0307410_10245863
1718 Ga0307410_10314374
1719 Ga0307406_10021751
1720 Ga0307406_10022733
1721 Ga0307406_10292724
1722 Ga0307407_10007084
1723 Ga0307407_10010208
1724 Ga0307407_10419088
1725 Ga0307407_10624551
1726 Ga0307412_10024880
1727 Ga0307412_10150248
1728 Ga0307412_10326669
1729 Ga0307412_10384428
1730 Ga0307412_10645189
1731 Ga0307409_100001293
1732 Ga0307409_100011830
1733 Ga0307409_100143190
1734 Ga0307409_100330241
1735 Ga0307409_100367526
1736 Ga0307409_100451222
1737 Ga0307409_100547589
1738 Ga0307416_100011575
1739 Ga0307416_100246126
1740 Ga0307416_100409683
1741 Ga0307416_100745036
1742 Ga0307416_101312951
1743 Ga0307414_10120882
1744 Ga0307414_10268577
1745 Ga0307414_10397845
1746 Ga0307414_10442924
1747 Ga0307414_10463249
1748 Ga0307411_10000556
1749 Ga0307411_10136089
1750 Ga0307411_10280668
1751 Ga0307411_10321121
1752 Ga0307411_10458468
1753 Ga0307411_10567768
1754 Ga0307411_10747209
1755 Ga0307415_100010082
1756 Ga0307415_100104164
1757 Ga0307415_100357838
1758 Ga0307415_100422745
1759 Ga0307415_100505701
1760 Ga0307415_100818113
1761 Ga0373923_0011578
1762 Ga0373953_0042883
1763 Ga0373954_0016927
1764 Ga0373956_0123288
1765 Ga0373955_0008362
1766 Ga0373931_0003582
1767 Ga0373933_0043995
1768 Ga0373937_0001514
1769 Ga0395899_0001715
1770 Ga0395899_0027829
1771 Ga0395899_0039476
1772 Ga0395899_0048679
1773 Ga0395899_0072505
1774 Ga0395899_0152794
1775 Ga0395899_0200630
1776 Ga0395899_0229658
1777 Ga0395899_0239717
1778 Ga0395899_0323064
1779 Ga0395899_0401779
1780 Ga0395899_0405685
1781 Ga0395899_0478158
1782 Ga0395900_0000840
1783 Ga0395900_0034608
1784 Ga0395900_0045745
1785 Ga0395900_0052995
1786 Ga0395900_0054630
1787 Ga0395900_0059342
1788 Ga0395900_0080672
1789 Ga0395900_0080762
1790 Ga0395900_0089139
1791 Ga0395900_0111456
1792 Ga0395900_0150736
1793 Ga0395900_0167614
1794 Ga0395900_0168291
1795 Ga0395900_0193052
1796 Ga0395900_0310140
1797 Ga0395900_0355643
1798 Ga0395900_0384635
1799 Ga0395900_0449624
1800 Ga0395900_0452739
1801 Ga0395900_0539657
1802 Ga0395900_0705321
1803 Ga0395898_0012167
1804 Ga0395898_0028849
1805 Ga0395898_0040407
1806 Ga0395898_0041698
1807 Ga0395898_0051400
1808 Ga0395898_0088562
1809 Ga0395898_0094563
1810 Ga0395898_0215355
1811 Ga0395898_0228681
1812 Ga0395898_0261596
1813 Ga0395898_0279542
1814 Ga0395898_0699318
1815 Ga0395898_1415883
1816 Ga0395905_0000204
1817 Ga0395905_0005199
1818 Ga0395905_0011167
1819 Ga0395905_0011807
1820 Ga0395905_0021288
1821 Ga0395905_0029361
1822 Ga0395905_0035906
1823 Ga0395905_0051937
1824 Ga0395905_0052280
1825 Ga0395905_0052540
1826 Ga0395905_0066578
1827 Ga0395905_0066976
1828 Ga0395905_0084760
1829 Ga0395905_0134936
1830 Ga0395905_0140156
1831 Ga0395905_0162033
1832 Ga0395905_0227560
1833 Ga0395905_0260885
1834 Ga0395905_0284767
1835 Ga0395905_0323615
1836 Ga0395905_0333565
1837 Ga0395905_0334317
1838 Ga0395905_0354413
1839 Ga0395905_0400993
1840 Ga0395905_0406653
1841 Ga0395905_0523684
1842 Ga0395905_0648953
1843 Ga0395905_0866292
1844 Ga0395901_0000783
1845 Ga0395901_0052384
1846 Ga0395901_0056784
1847 Ga0395901_0082569
1848 Ga0395901_0116550
1849 Ga0395901_0123837
1850 Ga0395901_0143542
1851 Ga0395901_0162544
1852 Ga0395901_0234998
1853 Ga0395901_0298819
1854 Ga0395901_0330258
1855 Ga0395901_0402823
1856 Ga0395901_0829496
1857 Ga0395901_1001561
1858 Ga0436365_1794861
1859 Ga0436362_0126459
1860 Ga0439449_0037222
1861 Ga0450914_000283
1862 Ga0450905_000467
1863 Ga0450889_000037
1864 Ga0439458_0012905
1865 Ga0439464_0004801
1866 Ga0439460_0060260
1867 Ga0466972_0079994
1868 Ga0466972_0086756
1869 Ga0466966_0000041
1870 Ga0466966_0011898
1871 Ga0466961_0018770
1872 Ga0466963_0022112
1873 Ga0466963_0042670
1874 Ga0466963_0079222
1875 Ga0466963_0192427
1876 Ga0466964_0044365
1877 Ga0466971_0023573
1878 Ga0466970_0184869
1879 Ga0466957_0042471
1880 Ga0466957_0118195
1881 Ga0466960_0306246
1882 Ga0466959_0200135
1883 Ga0466959_0418173
1884 Ga0466959_0431526
1885 Ga0466959_0605496
1886 Ga0466958_0134997
1887 Ga0466958_0156567
1888 Ga0466967_0018712
1889 Ga0466967_0030958
1890 Ga0466967_0037232
1891 Ga0466967_0145667
1892 Ga0466967_0597077
1893 Ga0466967_1348412
1894 Ga0495585_0119631
1895 Ga0495663_0003269
1896 Ga0495663_0050758
1897 Ga0495621_0001841
1898 Ga0495621_0029182
1899 Ga0495633_0058654
1900 Ga0495633_0081237
1901 Ga0495625_0245711
1902 Ga0495659_0049857
1903 Ga0495623_0034941
1904 Ga0495669_0021393
1905 Ga0495669_0021496
1906 Ga0495669_0038178
1907 Ga0495669_0121500
1908 Ga0495669_0276359
1909 Ga0495670_0022665
1910 Ga0495670_0049483
1911 Ga0495670_0378801
1912 Ga0495677_0110259
1913 Ga0495602_0017708
1914 Ga0496102_0873512
1915 Ga0496103_0434124
1916 Ga0496104_0272919
1917 Ga0496107_0019983
1918 Ga0496107_0072275
1919 Ga0496108_0012109
1920 Ga0496108_0240037
1921 Ga0496109_0088239
1922 Ga0496110_0078723
1923 Ga0496110_0148399
1924 Ga0496111_0206986
1925 Ga0496111_0645787
1926 Ga0496112_0010249
1927 Ga0496112_0017528
1928 Ga0496112_0233166
1929 Ga0496113_0765331
1930 Ga0501071_0473364
1931 Ga0501216_022483
1932 Ga0501224_005140
1933 Ga0501235_006398
1934 Ga0501247_003499
1935 Ga0501249_006930
1936 Ga0501259_075214
1937 Ga0501221_003507
1938 Ga0501229_003977
1939 Ga0501080_0334433
1940 Ga0501267_004398
1941 Ga0501272_001065
1942 nmdc:mga09592_164424_c1
1943 nmdc:mga06r32_323452_c1
1944 nmdc:mga08y16_776911_c1
1945 nmdc:mga0n895_432723_c1
1946 nmdc:mga0rr50_506674_c1
1947 nmdc:mga0a205_10767_c1
1948 Ga0495612_0102269
1949 Ga0466962_0090277
1950 2896431524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

5

77

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

11

78

0.95

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

6

83

0.91

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

112

190

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9697 5 213
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.9604 3 213
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9518 5 213
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9506 5 213
1fw1-assembly1.cif.gz_A-2 glutathione transferase zeta/maleylacetoacetate isomerase 0.9499 3 213
ID Description Score Start End Superfamily
3lg6D02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.966 90 210 1.20.1050.10
6jwkB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9616 86 209 1.20.1050.10
af_Q6DGL3_95_220_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9615 86 209 1.20.1050.10
4kaeA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9605 86 209 1.20.1050.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9578 86 213 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A7G7EPF5-F1-model_v4 deleted 0.9843 2 210
AF-A0A6J5C4J7-F1-model_v4 Maleylpyruvate isomerase (EC 5.2.1.4) 0.9842 2 210 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
GO:0050077
AF-A0A1F3ZLJ3-F1-model_v4 Maleylacetoacetate isomerase 0.9839 5 209 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A5VAU2-F1-model_v4 deleted 0.9821 4 206
AF-A0A443XC65-F1-model_v4 deleted 0.982 87 209

Map