F487249
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 976 | 367 | 1952 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10079225|Ga0065704_100792254 |
| Length | 274 |
| Sequence | MKRTHLPLNGLRVLDAAARHLSFTRAADELAVTPAAVGQQIRALEDLLGVVLFRRTSKGLELTDEAAAGLDAIREGFLRFEEGVQAMQAGQSSHVYTIACPRDFFAAWFSQRLATFRAENPALRFSLVGGDGDIDFTEANLDLAVRWAEGPGELEGIPLGAPETVVVAAPGFAETSHDNSDGAWIGWPGDPVPAGDGREVAFSVGDAGTAISAAAAGLGKARVPYLLAEYILSTGRVVALGEVERGRRGYWLVAPLPQWRQKKVKALVAALAQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 177 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 178 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 197 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 198 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 199 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 200 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 201 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 202 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 203 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 268 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 269 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 270 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 271 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 285 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 286 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 293 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 294 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 295 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 296 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 298 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 299 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 300 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 313 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 314 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 315 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 316 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 317 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 320 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 321 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 322 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 326 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 327 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 328 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 332 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 334 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 335 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 336 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 337 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 338 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 339 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 340 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 341 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 342 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 343 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 344 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 345 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 346 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 347 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 348 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 349 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 350 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 351 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 352 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 353 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 354 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 355 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 356 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 357 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 358 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 359 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 360 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 361 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 362 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 363 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 364 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 365 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 366 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 367 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.13 |
| Metatranscriptomes | 0 |
| Isolates | 2.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.73 |
| Nodule | 0.1 |
| Rhizoplane | 4.41 |
| Rhizosphere | 76.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10079225 | 3300005289 | Bacteria | 4220 |
| 2 | SwRhRL2b_contig_1489105 | 2162886007 | Bacteria | 7422 |
| 3 | SwRhRL2b_contig_2402994 | 2162886007 | Bacteria | 55296 |
| 4 | JGI24752J21851_1000048 | 3300001976 | Bacteria | 14796 |
| 5 | JGI24739J22299_10000251 | 3300001989 | Bacteria | 18071 |
| 6 | JGI24739J22299_10001511 | 3300001989 | Bacteria | 8783 |
| 7 | JGI24739J22299_10002733 | 3300001989 | Bacteria | 6794 |
| 8 | JGI24739J22299_10023091 | 3300001989 | Bacteria | 2201 |
| 9 | JGI24739J22299_10027769 | 3300001989 | Bacteria | 1976 |
| 10 | JGI24737J22298_10001603 | 3300001990 | Bacteria | 8047 |
| 11 | JGI24737J22298_10002940 | 3300001990 | Bacteria | 6039 |
| 12 | JGI24737J22298_10007027 | 3300001990 | Bacteria | 3816 |
| 13 | JGI24737J22298_10013657 | 3300001990 | Bacteria | 2640 |
| 14 | JGI24743J22301_10049053 | 3300001991 | Bacteria | 858 |
| 15 | JGI24735J21928_10002659 | 3300002067 | Bacteria | 6178 |
| 16 | JGI24735J21928_10003032 | 3300002067 | Bacteria | 5764 |
| 17 | JGI24735J21928_10003729 | 3300002067 | Bacteria | 5170 |
| 18 | JGI24735J21928_10010426 | 3300002067 | Bacteria | 2963 |
| 19 | JGI24750J21931_1000042 | 3300002070 | Bacteria | 16868 |
| 20 | JGI24750J21931_1011003 | 3300002070 | Bacteria | 1185 |
| 21 | JGI24748J21848_1000063 | 3300002074 | Bacteria | 40664 |
| 22 | JGI24738J21930_10000468 | 3300002075 | Bacteria | 11470 |
| 23 | JGI24738J21930_10000632 | 3300002075 | Bacteria | 10141 |
| 24 | JGI24738J21930_10009517 | 3300002075 | Bacteria | 2184 |
| 25 | JGI24749J21850_1000252 | 3300002076 | Bacteria | 8384 |
| 26 | JGI24749J21850_1000472 | 3300002076 | Bacteria | 5977 |
| 27 | JGI24034J26672_10000007 | 3300002239 | Bacteria | 224370 |
| 28 | JGI24742J22300_10004892 | 3300002244 | Bacteria | 2198 |
| 29 | JGI24751J29686_10000046 | 3300002459 | Bacteria | 73259 |
| 30 | JGI24751J29686_10000473 | 3300002459 | Bacteria | 12068 |
| 31 | JGI24751J29686_10003360 | 3300002459 | Bacteria | 3227 |
| 32 | JGI24751J29686_10033737 | 3300002459 | Bacteria | 1061 |
| 33 | JGI25165J46597_1000112 | 3300003214 | Bacteria | 147097 |
| 34 | rootH1_10346595 | 3300003323 | Bacteria | 1408 |
| 35 | Ga0055536_1001242 | 3300003781 | Bacteria | 15709 |
| 36 | Ga0055536_1001703 | 3300003781 | Bacteria | 13019 |
| 37 | Ga0055530_10012661 | 3300003791 | Bacteria | 2927 |
| 38 | Ga0065704_10000191 | 3300005289 | Bacteria | 318191 |
| 39 | Ga0065704_10002210 | 3300005289 | Bacteria | 5634 |
| 40 | Ga0065704_10072419 | 3300005289 | Bacteria | 8555 |
| 41 | Ga0065707_10082140 | 3300005295 | Bacteria | 21029 |
| 42 | Ga0065707_10114593 | 3300005295 | Bacteria | 2293 |
| 43 | Ga0070658_10000089 | 3300005327 | Bacteria | 83791 |
| 44 | Ga0070658_10001742 | 3300005327 | Bacteria | 18340 |
| 45 | Ga0070658_10004304 | 3300005327 | Bacteria | 11636 |
| 46 | Ga0070658_10016592 | 3300005327 | Bacteria | 5893 |
| 47 | Ga0070658_10030940 | 3300005327 | Bacteria | 4299 |
| 48 | Ga0070658_10129269 | 3300005327 | Bacteria | 2104 |
| 49 | Ga0070658_10169252 | 3300005327 | Bacteria | 1835 |
| 50 | Ga0070676_10000909 | 3300005328 | Bacteria | 14655 |
| 51 | Ga0070690_100000110 | 3300005330 | Bacteria | 42574 |
| 52 | Ga0070670_100000006 | 3300005331 | Bacteria | 319420 |
| 53 | Ga0070670_100000068 | 3300005331 | Bacteria | 106494 |
| 54 | Ga0070670_100004402 | 3300005331 | Bacteria | 11793 |
| 55 | Ga0070670_100011758 | 3300005331 | Bacteria | 7487 |
| 56 | Ga0070670_100017184 | 3300005331 | Bacteria | 6205 |
| 57 | Ga0070670_100054238 | 3300005331 | Bacteria | 3441 |
| 58 | Ga0068869_100004212 | 3300005334 | Bacteria | 8929 |
| 59 | Ga0070666_10000068 | 3300005335 | Bacteria | 76194 |
| 60 | Ga0070666_10000417 | 3300005335 | Bacteria | 26409 |
| 61 | Ga0070666_10003859 | 3300005335 | Bacteria | 9097 |
| 62 | Ga0070666_10027816 | 3300005335 | Bacteria | 3706 |
| 63 | Ga0070666_10214903 | 3300005335 | Bacteria | 1355 |
| 64 | Ga0070680_100007674 | 3300005336 | Bacteria | 8231 |
| 65 | Ga0068868_100000023 | 3300005338 | Bacteria | 85334 |
| 66 | Ga0070660_100000916 | 3300005339 | Bacteria | 19719 |
| 67 | Ga0070660_100004613 | 3300005339 | Bacteria | 9537 |
| 68 | Ga0070660_100014971 | 3300005339 | Bacteria | 5594 |
| 69 | Ga0070660_100023922 | 3300005339 | Bacteria | 4530 |
| 70 | Ga0070660_100048126 | 3300005339 | Bacteria | 3274 |
| 71 | Ga0070660_100054117 | 3300005339 | Bacteria | 3098 |
| 72 | Ga0070660_100563887 | 3300005339 | Bacteria | 950 |
| 73 | Ga0070661_100008440 | 3300005344 | Bacteria | 7122 |
| 74 | Ga0070661_100272667 | 3300005344 | Bacteria | 1311 |
| 75 | Ga0070661_100527374 | 3300005344 | Bacteria | 948 |
| 76 | Ga0070692_10148947 | 3300005345 | Bacteria | 1331 |
| 77 | Ga0070668_100000026 | 3300005347 | Bacteria | 92584 |
| 78 | Ga0070668_100002833 | 3300005347 | Bacteria | 12778 |
| 79 | Ga0070668_100007337 | 3300005347 | Bacteria | 8177 |
| 80 | Ga0070668_100010222 | 3300005347 | Bacteria | 6962 |
| 81 | Ga0070668_100023436 | 3300005347 | Bacteria | 4669 |
| 82 | Ga0070668_100023648 | 3300005347 | Bacteria | 4649 |
| 83 | Ga0070668_100039261 | 3300005347 | Bacteria | 3621 |
| 84 | Ga0070668_100136399 | 3300005347 | Bacteria | 1974 |
| 85 | Ga0070668_100264567 | 3300005347 | Bacteria | 1431 |
| 86 | Ga0070668_100433211 | 3300005347 | Bacteria | 1127 |
| 87 | Ga0070669_100000018 | 3300005353 | Bacteria | 195789 |
| 88 | Ga0070669_100000083 | 3300005353 | Bacteria | 91096 |
| 89 | Ga0070669_100000102 | 3300005353 | Bacteria | 82010 |
| 90 | Ga0070669_100000193 | 3300005353 | Bacteria | 53850 |
| 91 | Ga0070669_100000332 | 3300005353 | Bacteria | 36750 |
| 92 | Ga0070669_100064196 | 3300005353 | Bacteria | 2704 |
| 93 | Ga0070669_100407873 | 3300005353 | Bacteria | 1113 |
| 94 | Ga0070671_100000011 | 3300005355 | Bacteria | 202057 |
| 95 | Ga0070671_100000107 | 3300005355 | Bacteria | 52884 |
| 96 | Ga0070671_100000266 | 3300005355 | Bacteria | 35281 |
| 97 | Ga0070671_100001068 | 3300005355 | Bacteria | 20213 |
| 98 | Ga0070671_100020174 | 3300005355 | Bacteria | 5432 |
| 99 | Ga0070671_100048676 | 3300005355 | Bacteria | 3526 |
| 100 | Ga0070671_100055799 | 3300005355 | Bacteria | 3287 |
| 101 | Ga0070671_100273701 | 3300005355 | Bacteria | 1435 |
| 102 | Ga0070674_100144483 | 3300005356 | Bacteria | 1789 |
| 103 | Ga0070673_100000001 | 3300005364 | Bacteria | 239842 |
| 104 | Ga0070688_100002132 | 3300005365 | Bacteria | 9972 |
| 105 | Ga0070659_100043766 | 3300005366 | Bacteria | 3503 |
| 106 | Ga0070659_100084366 | 3300005366 | Bacteria | 2540 |
| 107 | Ga0070659_100228119 | 3300005366 | Bacteria | 1539 |
| 108 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 109 | Ga0070667_100000098 | 3300005367 | Bacteria | 108706 |
| 110 | Ga0070667_100001002 | 3300005367 | Bacteria | 25860 |
| 111 | Ga0070667_100004151 | 3300005367 | Bacteria | 12245 |
| 112 | Ga0070667_100004153 | 3300005367 | Bacteria | 12243 |
| 113 | Ga0070667_100005317 | 3300005367 | Bacteria | 10754 |
| 114 | Ga0070667_100009896 | 3300005367 | Bacteria | 7904 |
| 115 | Ga0070667_100048771 | 3300005367 | Bacteria | 3565 |
| 116 | Ga0070667_100118697 | 3300005367 | Bacteria | 2299 |
| 117 | Ga0070663_100024996 | 3300005455 | Bacteria | 4028 |
| 118 | Ga0070663_100045390 | 3300005455 | Bacteria | 3104 |
| 119 | Ga0070663_100134867 | 3300005455 | Bacteria | 1879 |
| 120 | Ga0070678_100029355 | 3300005456 | Bacteria | 3764 |
| 121 | Ga0070678_100194887 | 3300005456 | Bacteria | 1668 |
| 122 | Ga0070662_100000887 | 3300005457 | Bacteria | 18289 |
| 123 | Ga0070662_100009685 | 3300005457 | Bacteria | 6303 |
| 124 | Ga0070662_100190414 | 3300005457 | Bacteria | 1622 |
| 125 | Ga0070662_100229419 | 3300005457 | Bacteria | 1485 |
| 126 | Ga0070662_100266757 | 3300005457 | Bacteria | 1381 |
| 127 | Ga0070681_10004470 | 3300005458 | Bacteria | 13326 |
| 128 | Ga0068867_100000027 | 3300005459 | Bacteria | 90445 |
| 129 | Ga0070685_10000036 | 3300005466 | Bacteria | 80641 |
| 130 | Ga0070707_100182464 | 3300005468 | Bacteria | 2046 |
| 131 | Ga0070679_100012621 | 3300005530 | Bacteria | 8080 |
| 132 | Ga0070679_100022533 | 3300005530 | Bacteria | 6157 |
| 133 | Ga0070679_100030802 | 3300005530 | Bacteria | 5299 |
| 134 | Ga0070679_100612007 | 3300005530 | Bacteria | 1032 |
| 135 | Ga0070684_100023818 | 3300005535 | Bacteria | 5128 |
| 136 | Ga0068853_100004246 | 3300005539 | Bacteria | 11067 |
| 137 | Ga0068853_100017555 | 3300005539 | Bacteria | 5906 |
| 138 | Ga0068853_100042359 | 3300005539 | Bacteria | 3892 |
| 139 | Ga0068853_100597048 | 3300005539 | Bacteria | 1048 |
| 140 | Ga0070672_100088116 | 3300005543 | Bacteria | 2499 |
| 141 | Ga0070686_100000045 | 3300005544 | Bacteria | 101988 |
| 142 | Ga0070686_100071892 | 3300005544 | Bacteria | 2266 |
| 143 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 144 | Ga0070665_100000269 | 3300005548 | Bacteria | 85401 |
| 145 | Ga0070665_100037764 | 3300005548 | Bacteria | 4855 |
| 146 | Ga0070665_100057760 | 3300005548 | Bacteria | 3890 |
| 147 | Ga0070665_100065726 | 3300005548 | Bacteria | 3638 |
| 148 | Ga0070665_100088255 | 3300005548 | Bacteria | 3107 |
| 149 | Ga0070665_100112938 | 3300005548 | Bacteria | 2719 |
| 150 | Ga0070665_100194116 | 3300005548 | Bacteria | 2031 |
| 151 | Ga0068855_100000092 | 3300005563 | Bacteria | 107195 |
| 152 | Ga0068855_100010472 | 3300005563 | Bacteria | 11188 |
| 153 | Ga0068855_100024314 | 3300005563 | Bacteria | 7252 |
| 154 | Ga0068855_100038768 | 3300005563 | Bacteria | 5660 |
| 155 | Ga0068855_100044343 | 3300005563 | Bacteria | 5263 |
| 156 | Ga0068855_100056220 | 3300005563 | Bacteria | 4618 |
| 157 | Ga0068855_100117473 | 3300005563 | Bacteria | 3047 |
| 158 | Ga0070664_100120328 | 3300005564 | Bacteria | 2298 |
| 159 | Ga0068857_100012124 | 3300005577 | Bacteria | 7497 |
| 160 | Ga0068857_100017141 | 3300005577 | Bacteria | 6345 |
| 161 | Ga0068857_100112698 | 3300005577 | Bacteria | 2445 |
| 162 | Ga0068857_100345836 | 3300005577 | Bacteria | 1376 |
| 163 | Ga0068857_100566885 | 3300005577 | Bacteria | 1071 |
| 164 | Ga0068854_100000684 | 3300005578 | Bacteria | 20204 |
| 165 | Ga0068854_100010675 | 3300005578 | Bacteria | 5962 |
| 166 | Ga0068854_100013424 | 3300005578 | Bacteria | 5377 |
| 167 | Ga0068854_100018762 | 3300005578 | Bacteria | 4649 |
| 168 | Ga0068854_100044644 | 3300005578 | Bacteria | 3147 |
| 169 | Ga0068854_100130588 | 3300005578 | Bacteria | 1918 |
| 170 | Ga0068854_100273112 | 3300005578 | Bacteria | 1358 |
| 171 | Ga0068854_100456003 | 3300005578 | Bacteria | 1069 |
| 172 | Ga0068856_100014407 | 3300005614 | Bacteria | 7641 |
| 173 | Ga0068856_100028654 | 3300005614 | Bacteria | 5440 |
| 174 | Ga0068856_100029700 | 3300005614 | Bacteria | 5340 |
| 175 | Ga0068856_100040569 | 3300005614 | Bacteria | 4573 |
| 176 | Ga0068856_100480172 | 3300005614 | Bacteria | 1264 |
| 177 | Ga0068852_100002388 | 3300005616 | Bacteria | 12937 |
| 178 | Ga0068852_100008366 | 3300005616 | Bacteria | 7623 |
| 179 | Ga0068852_100038495 | 3300005616 | Bacteria | 4020 |
| 180 | Ga0068852_100121455 | 3300005616 | Bacteria | 2393 |
| 181 | Ga0068852_100214724 | 3300005616 | Bacteria | 1827 |
| 182 | Ga0068852_100247162 | 3300005616 | Bacteria | 1708 |
| 183 | Ga0068852_100256372 | 3300005616 | Bacteria | 1678 |
| 184 | Ga0068859_100006602 | 3300005617 | Bacteria | 11776 |
| 185 | Ga0068859_100007283 | 3300005617 | Bacteria | 11222 |
| 186 | Ga0068859_100009002 | 3300005617 | Bacteria | 10084 |
| 187 | Ga0068859_100010776 | 3300005617 | Bacteria | 9202 |
| 188 | Ga0068859_100039024 | 3300005617 | Bacteria | 4762 |
| 189 | Ga0068859_100039829 | 3300005617 | Bacteria | 4716 |
| 190 | Ga0068859_100358142 | 3300005617 | Bacteria | 1554 |
| 191 | Ga0068859_100574468 | 3300005617 | Bacteria | 1221 |
| 192 | Ga0068864_100000014 | 3300005618 | Bacteria | 308927 |
| 193 | Ga0068864_100000019 | 3300005618 | Bacteria | 271650 |
| 194 | Ga0068864_100001740 | 3300005618 | Bacteria | 17896 |
| 195 | Ga0068864_100007768 | 3300005618 | Bacteria | 8838 |
| 196 | Ga0068864_100018289 | 3300005618 | Bacteria | 5853 |
| 197 | Ga0068864_100018652 | 3300005618 | Bacteria | 5798 |
| 198 | Ga0068864_100020326 | 3300005618 | Bacteria | 5554 |
| 199 | Ga0068864_100104581 | 3300005618 | Bacteria | 2515 |
| 200 | Ga0068866_10206302 | 3300005718 | Bacteria | 1177 |
| 201 | Ga0068861_100006194 | 3300005719 | Bacteria | 8142 |
| 202 | Ga0068861_100009141 | 3300005719 | Bacteria | 6835 |
| 203 | Ga0068861_100028058 | 3300005719 | Bacteria | 4105 |
| 204 | Ga0068861_100054223 | 3300005719 | Bacteria | 3053 |
| 205 | Ga0068851_10059906 | 3300005834 | Bacteria | 1948 |
| 206 | Ga0068851_10259249 | 3300005834 | Bacteria | 988 |
| 207 | Ga0068863_100000015 | 3300005841 | Bacteria | 214824 |
| 208 | Ga0068863_100000138 | 3300005841 | Bacteria | 77596 |
| 209 | Ga0068863_100000280 | 3300005841 | Bacteria | 52729 |
| 210 | Ga0068863_100002835 | 3300005841 | Bacteria | 17168 |
| 211 | Ga0068863_100003685 | 3300005841 | Bacteria | 15137 |
| 212 | Ga0068863_100003927 | 3300005841 | Bacteria | 14689 |
| 213 | Ga0068863_100004738 | 3300005841 | Bacteria | 13405 |
| 214 | Ga0068863_100012255 | 3300005841 | Bacteria | 8278 |
| 215 | Ga0068863_100050813 | 3300005841 | Bacteria | 3929 |
| 216 | Ga0068863_100150305 | 3300005841 | Bacteria | 2228 |
| 217 | Ga0068863_100568864 | 3300005841 | Bacteria | 1120 |
| 218 | Ga0068858_100003226 | 3300005842 | Bacteria | 16280 |
| 219 | Ga0068858_100005917 | 3300005842 | Bacteria | 11936 |
| 220 | Ga0068858_100006381 | 3300005842 | Bacteria | 11489 |
| 221 | Ga0068858_100007900 | 3300005842 | Bacteria | 10254 |
| 222 | Ga0068858_100045666 | 3300005842 | Bacteria | 4060 |
| 223 | Ga0068858_100220756 | 3300005842 | Bacteria | 1795 |
| 224 | Ga0068860_100000028 | 3300005843 | Bacteria | 266461 |
| 225 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 226 | Ga0068860_100000164 | 3300005843 | Bacteria | 108706 |
| 227 | Ga0068860_100000182 | 3300005843 | Bacteria | 100888 |
| 228 | Ga0068860_100006964 | 3300005843 | Bacteria | 11334 |
| 229 | Ga0068860_100014112 | 3300005843 | Bacteria | 7835 |
| 230 | Ga0068860_100019551 | 3300005843 | Bacteria | 6566 |
| 231 | Ga0068860_100039405 | 3300005843 | Bacteria | 4519 |
| 232 | Ga0068860_100086950 | 3300005843 | Bacteria | 2975 |
| 233 | Ga0068862_100000007 | 3300005844 | Bacteria | 313933 |
| 234 | Ga0068862_100000067 | 3300005844 | Bacteria | 123668 |
| 235 | Ga0068862_100000094 | 3300005844 | Bacteria | 106159 |
| 236 | Ga0068862_100000308 | 3300005844 | Bacteria | 53687 |
| 237 | Ga0068862_100000543 | 3300005844 | Bacteria | 39504 |
| 238 | Ga0068862_100002528 | 3300005844 | Bacteria | 16189 |
| 239 | Ga0068862_100006100 | 3300005844 | Bacteria | 10033 |
| 240 | Ga0068862_100010416 | 3300005844 | Bacteria | 7676 |
| 241 | Ga0075368_10000033 | 3300006042 | Bacteria | 32184 |
| 242 | Ga0075368_10000095 | 3300006042 | Bacteria | 22249 |
| 243 | Ga0075363_100001584 | 3300006048 | Bacteria | 8748 |
| 244 | Ga0075364_10003212 | 3300006051 | Bacteria | 9267 |
| 245 | Ga0075362_10000054 | 3300006177 | Bacteria | 37332 |
| 246 | Ga0075362_10000265 | 3300006177 | Bacteria | 14605 |
| 247 | Ga0075367_10001701 | 3300006178 | Bacteria | 9616 |
| 248 | Ga0075369_10000150 | 3300006186 | Bacteria | 19561 |
| 249 | Ga0075366_10000376 | 3300006195 | Bacteria | 20753 |
| 250 | Ga0075366_10016501 | 3300006195 | Bacteria | 4247 |
| 251 | Ga0075366_10033312 | 3300006195 | Bacteria | 3034 |
| 252 | Ga0075366_10069306 | 3300006195 | Bacteria | 2099 |
| 253 | Ga0075366_10358444 | 3300006195 | Bacteria | 896 |
| 254 | Ga0097621_100281049 | 3300006237 | Bacteria | 1465 |
| 255 | Ga0075370_10000018 | 3300006353 | Bacteria | 59800 |
| 256 | Ga0075370_10001563 | 3300006353 | Bacteria | 10048 |
| 257 | Ga0075370_10001922 | 3300006353 | Bacteria | 9359 |
| 258 | Ga0075370_10067685 | 3300006353 | Bacteria | 2039 |
| 259 | Ga0075370_10072304 | 3300006353 | Bacteria | 1974 |
| 260 | Ga0068871_100197641 | 3300006358 | Bacteria | 1735 |
| 261 | Ga0068865_100000030 | 3300006881 | Bacteria | 88854 |
| 262 | Ga0097620_100006602 | 3300006931 | Bacteria | 11776 |
| 263 | Ga0097620_100007283 | 3300006931 | Bacteria | 11222 |
| 264 | Ga0097620_100009002 | 3300006931 | Bacteria | 10084 |
| 265 | Ga0097620_100010776 | 3300006931 | Bacteria | 9202 |
| 266 | Ga0097620_100039023 | 3300006931 | Bacteria | 4762 |
| 267 | Ga0097620_100039829 | 3300006931 | Bacteria | 4716 |
| 268 | Ga0097620_100358177 | 3300006931 | Bacteria | 1554 |
| 269 | Ga0097620_100574479 | 3300006931 | Bacteria | 1221 |
| 270 | Ga0079104_1011365 | 3300006946 | Bacteria | 2866 |
| 271 | Ga0075435_100548087 | 3300007076 | Bacteria | 1001 |
| 272 | Ga0105251_10000853 | 3300009011 | Bacteria | 27320 |
| 273 | Ga0105251_10002316 | 3300009011 | Bacteria | 15078 |
| 274 | Ga0105250_10063100 | 3300009092 | Bacteria | 1491 |
| 275 | Ga0105240_10007666 | 3300009093 | Bacteria | 15628 |
| 276 | Ga0105240_10015794 | 3300009093 | Bacteria | 10244 |
| 277 | Ga0105240_10026155 | 3300009093 | Bacteria | 7658 |
| 278 | Ga0105240_10042646 | 3300009093 | Bacteria | 5781 |
| 279 | Ga0105240_10048773 | 3300009093 | Bacteria | 5350 |
| 280 | Ga0105240_10886414 | 3300009093 | Bacteria | 961 |
| 281 | Ga0105245_10003967 | 3300009098 | Bacteria | 13153 |
| 282 | Ga0105247_10003627 | 3300009101 | Bacteria | 10024 |
| 283 | Ga0105247_10006168 | 3300009101 | Bacteria | 7439 |
| 284 | Ga0105247_10031044 | 3300009101 | Bacteria | 3241 |
| 285 | Ga0105247_10041519 | 3300009101 | Bacteria | 2816 |
| 286 | Ga0114129_10128773 | 3300009147 | Bacteria | 3478 |
| 287 | Ga0105243_10000389 | 3300009148 | Bacteria | 46747 |
| 288 | Ga0105241_10120389 | 3300009174 | Bacteria | 2113 |
| 289 | Ga0105242_10016891 | 3300009176 | Bacteria | 5680 |
| 290 | Ga0105248_10000311 | 3300009177 | Bacteria | 57870 |
| 291 | Ga0105248_10000651 | 3300009177 | Bacteria | 39450 |
| 292 | Ga0105248_10003293 | 3300009177 | Bacteria | 17921 |
| 293 | Ga0105248_10021266 | 3300009177 | Bacteria | 7189 |
| 294 | Ga0105248_10048979 | 3300009177 | Bacteria | 4739 |
| 295 | Ga0105248_10060981 | 3300009177 | Bacteria | 4234 |
| 296 | Ga0105248_10083782 | 3300009177 | Bacteria | 3586 |
| 297 | Ga0105248_10088933 | 3300009177 | Bacteria | 3476 |
| 298 | Ga0105248_10103354 | 3300009177 | Bacteria | 3211 |
| 299 | Ga0105248_10250096 | 3300009177 | Bacteria | 1995 |
| 300 | Ga0105237_10009418 | 3300009545 | Bacteria | 10463 |
| 301 | Ga0105237_10031194 | 3300009545 | Bacteria | 5406 |
| 302 | Ga0105237_10495230 | 3300009545 | Bacteria | 1229 |
| 303 | Ga0105238_10040689 | 3300009551 | Bacteria | 4709 |
| 304 | Ga0105238_10161361 | 3300009551 | Bacteria | 2217 |
| 305 | Ga0105238_10374791 | 3300009551 | Bacteria | 1414 |
| 306 | Ga0105238_10379805 | 3300009551 | Bacteria | 1404 |
| 307 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 308 | Ga0105249_10000105 | 3300009553 | Bacteria | 117181 |
| 309 | Ga0105249_10000568 | 3300009553 | Bacteria | 33920 |
| 310 | Ga0105249_10003294 | 3300009553 | Bacteria | 13998 |
| 311 | Ga0105249_10015137 | 3300009553 | Bacteria | 6825 |
| 312 | Ga0105239_10000183 | 3300010375 | Bacteria | 91439 |
| 313 | Ga0105246_10000730 | 3300011119 | Bacteria | 18634 |
| 314 | Ga0105246_10017619 | 3300011119 | Bacteria | 4543 |
| 315 | Ga0157373_10012241 | 3300013100 | Bacteria | 6307 |
| 316 | Ga0157373_10045323 | 3300013100 | Bacteria | 3139 |
| 317 | Ga0157373_10158932 | 3300013100 | Bacteria | 1590 |
| 318 | Ga0157371_10002824 | 3300013102 | Bacteria | 16252 |
| 319 | Ga0157371_10029859 | 3300013102 | Bacteria | 3936 |
| 320 | Ga0157371_10070962 | 3300013102 | Bacteria | 2466 |
| 321 | Ga0157370_10013144 | 3300013104 | Bacteria | 8539 |
| 322 | Ga0157370_10097070 | 3300013104 | Bacteria | 2764 |
| 323 | Ga0157369_10003242 | 3300013105 | Bacteria | 19373 |
| 324 | Ga0157369_10013185 | 3300013105 | Bacteria | 9354 |
| 325 | Ga0157369_10031631 | 3300013105 | Bacteria | 5825 |
| 326 | Ga0157369_10255826 | 3300013105 | Bacteria | 1827 |
| 327 | Ga0157374_10025842 | 3300013296 | Bacteria | 5278 |
| 328 | Ga0157378_10038350 | 3300013297 | Bacteria | 4246 |
| 329 | Ga0163162_10008723 | 3300013306 | Bacteria | 9865 |
| 330 | Ga0157372_10011931 | 3300013307 | Bacteria | 9259 |
| 331 | Ga0157372_10065914 | 3300013307 | Bacteria | 4068 |
| 332 | Ga0157372_10074192 | 3300013307 | Bacteria | 3836 |
| 333 | Ga0157372_10126062 | 3300013307 | Bacteria | 2944 |
| 334 | Ga0157372_10217553 | 3300013307 | Bacteria | 2214 |
| 335 | Ga0157372_10578941 | 3300013307 | Bacteria | 1308 |
| 336 | Ga0157375_10000776 | 3300013308 | Bacteria | 28021 |
| 337 | Ga0157375_10828136 | 3300013308 | Bacteria | 1073 |
| 338 | Ga0163163_10067350 | 3300014325 | Bacteria | 3560 |
| 339 | Ga0163163_10233366 | 3300014325 | Bacteria | 1889 |
| 340 | Ga0163163_10577781 | 3300014325 | Bacteria | 1187 |
| 341 | Ga0157380_10000014 | 3300014326 | Bacteria | 130737 |
| 342 | Ga0157380_10000151 | 3300014326 | Bacteria | 39765 |
| 343 | Ga0157380_10003723 | 3300014326 | Bacteria | 10487 |
| 344 | Ga0157377_10066200 | 3300014745 | Bacteria | 2077 |
| 345 | Ga0157379_10062412 | 3300014968 | Bacteria | 3333 |
| 346 | Ga0157376_10000145 | 3300014969 | Bacteria | 48872 |
| 347 | Ga0163161_10000202 | 3300017792 | Bacteria | 54518 |
| 348 | Ga0163161_10012008 | 3300017792 | Bacteria | 6010 |
| 349 | Ga0163161_10085572 | 3300017792 | Bacteria | 2326 |
| 350 | Ga0207672_1000690 | 3300025223 | Bacteria | 3889 |
| 351 | Ga0207427_100820 | 3300025231 | Bacteria | 14004 |
| 352 | Ga0209026_1003814 | 3300025250 | Bacteria | 4759 |
| 353 | Ga0209148_1000133 | 3300025254 | Bacteria | 171351 |
| 354 | Ga0209233_1000078 | 3300025261 | Bacteria | 348118 |
| 355 | Ga0209455_1000592 | 3300025272 | Bacteria | 23349 |
| 356 | Ga0209676_1008949 | 3300025292 | Bacteria | 4394 |
| 357 | Ga0209676_1048247 | 3300025292 | Bacteria | 1139 |
| 358 | Ga0209050_1001308 | 3300025298 | Bacteria | 27984 |
| 359 | Ga0209257_1000987 | 3300025304 | Bacteria | 38577 |
| 360 | Ga0207697_10000184 | 3300025315 | Bacteria | 32509 |
| 361 | Ga0207713_1002057 | 3300025735 | Bacteria | 15050 |
| 362 | Ga0207713_1002657 | 3300025735 | Bacteria | 12826 |
| 363 | Ga0207713_1044565 | 3300025735 | Bacteria | 1821 |
| 364 | Ga0207710_10006133 | 3300025900 | Bacteria | 5147 |
| 365 | Ga0207710_10022311 | 3300025900 | Bacteria | 2717 |
| 366 | Ga0207710_10036560 | 3300025900 | Bacteria | 2165 |
| 367 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 368 | Ga0207680_10002312 | 3300025903 | Bacteria | 8878 |
| 369 | Ga0207680_10012031 | 3300025903 | Bacteria | 4397 |
| 370 | Ga0207680_10075062 | 3300025903 | Bacteria | 2108 |
| 371 | Ga0207680_10130668 | 3300025903 | Bacteria | 1655 |
| 372 | Ga0207647_10000293 | 3300025904 | Bacteria | 40991 |
| 373 | Ga0207647_10000789 | 3300025904 | Bacteria | 24590 |
| 374 | Ga0207647_10015957 | 3300025904 | Bacteria | 5135 |
| 375 | Ga0207647_10026801 | 3300025904 | Bacteria | 3765 |
| 376 | Ga0207645_10002416 | 3300025907 | Bacteria | 14712 |
| 377 | Ga0207645_10103028 | 3300025907 | Bacteria | 1842 |
| 378 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 379 | Ga0207705_10000018 | 3300025909 | Bacteria | 319792 |
| 380 | Ga0207705_10000140 | 3300025909 | Bacteria | 78223 |
| 381 | Ga0207705_10000468 | 3300025909 | Bacteria | 34564 |
| 382 | Ga0207705_10002762 | 3300025909 | Bacteria | 13421 |
| 383 | Ga0207705_10051777 | 3300025909 | Bacteria | 2955 |
| 384 | Ga0207705_10055151 | 3300025909 | Bacteria | 2865 |
| 385 | Ga0207705_10118671 | 3300025909 | Bacteria | 1961 |
| 386 | Ga0207654_10001661 | 3300025911 | Bacteria | 11622 |
| 387 | Ga0207707_10136464 | 3300025912 | Bacteria | 2145 |
| 388 | Ga0207695_10000641 | 3300025913 | Bacteria | 69705 |
| 389 | Ga0207695_10006576 | 3300025913 | Bacteria | 15034 |
| 390 | Ga0207695_10012328 | 3300025913 | Bacteria | 10269 |
| 391 | Ga0207695_10036598 | 3300025913 | Bacteria | 5304 |
| 392 | Ga0207695_10041984 | 3300025913 | Bacteria | 4890 |
| 393 | Ga0207671_10002738 | 3300025914 | Bacteria | 18433 |
| 394 | Ga0207671_10042781 | 3300025914 | Bacteria | 3352 |
| 395 | Ga0207671_10394088 | 3300025914 | Bacteria | 1101 |
| 396 | Ga0207660_10006580 | 3300025917 | Bacteria | 7544 |
| 397 | Ga0207657_10001013 | 3300025919 | Bacteria | 29888 |
| 398 | Ga0207657_10025295 | 3300025919 | Bacteria | 5477 |
| 399 | Ga0207657_10027635 | 3300025919 | Bacteria | 5193 |
| 400 | Ga0207657_10066223 | 3300025919 | Bacteria | 3076 |
| 401 | Ga0207657_10080800 | 3300025919 | Bacteria | 2732 |
| 402 | Ga0207649_10018237 | 3300025920 | Bacteria | 3987 |
| 403 | Ga0207652_10010744 | 3300025921 | Bacteria | 7371 |
| 404 | Ga0207652_10028408 | 3300025921 | Bacteria | 4667 |
| 405 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 406 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 407 | Ga0207681_10000060 | 3300025923 | Bacteria | 102672 |
| 408 | Ga0207681_10000076 | 3300025923 | Bacteria | 89353 |
| 409 | Ga0207681_10000176 | 3300025923 | Bacteria | 52358 |
| 410 | Ga0207681_10045165 | 3300025923 | Bacteria | 2957 |
| 411 | Ga0207681_10269809 | 3300025923 | Bacteria | 1335 |
| 412 | Ga0207681_10293069 | 3300025923 | Bacteria | 1285 |
| 413 | Ga0207681_10309369 | 3300025923 | Bacteria | 1253 |
| 414 | Ga0207694_10001461 | 3300025924 | Bacteria | 20212 |
| 415 | Ga0207694_10039785 | 3300025924 | Bacteria | 3619 |
| 416 | Ga0207650_10000023 | 3300025925 | Bacteria | 308148 |
| 417 | Ga0207650_10000054 | 3300025925 | Bacteria | 162602 |
| 418 | Ga0207650_10000657 | 3300025925 | Bacteria | 27265 |
| 419 | Ga0207650_10057574 | 3300025925 | Bacteria | 2891 |
| 420 | Ga0207650_10133041 | 3300025925 | Bacteria | 1948 |
| 421 | Ga0207687_10002491 | 3300025927 | Bacteria | 12497 |
| 422 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 423 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 424 | Ga0207644_10000067 | 3300025931 | Bacteria | 76116 |
| 425 | Ga0207644_10002492 | 3300025931 | Bacteria | 11852 |
| 426 | Ga0207644_10013127 | 3300025931 | Bacteria | 5514 |
| 427 | Ga0207644_10032632 | 3300025931 | Bacteria | 3634 |
| 428 | Ga0207644_10060614 | 3300025931 | Bacteria | 2738 |
| 429 | Ga0207644_10146333 | 3300025931 | Bacteria | 1824 |
| 430 | Ga0207690_10029576 | 3300025932 | Bacteria | 3485 |
| 431 | Ga0207690_10125628 | 3300025932 | Bacteria | 1870 |
| 432 | Ga0207690_10187264 | 3300025932 | Bacteria | 1563 |
| 433 | Ga0207690_10210726 | 3300025932 | Bacteria | 1481 |
| 434 | Ga0207690_10271229 | 3300025932 | Bacteria | 1318 |
| 435 | Ga0207706_10000554 | 3300025933 | Bacteria | 39755 |
| 436 | Ga0207706_10003511 | 3300025933 | Bacteria | 14975 |
| 437 | Ga0207706_10014020 | 3300025933 | Bacteria | 7267 |
| 438 | Ga0207706_10017119 | 3300025933 | Bacteria | 6536 |
| 439 | Ga0207706_10018187 | 3300025933 | Bacteria | 6322 |
| 440 | Ga0207706_10106441 | 3300025933 | Bacteria | 2468 |
| 441 | Ga0207706_10355218 | 3300025933 | Bacteria | 1274 |
| 442 | Ga0207686_10002215 | 3300025934 | Bacteria | 10686 |
| 443 | Ga0207709_10000203 | 3300025935 | Bacteria | 77491 |
| 444 | Ga0207670_10087894 | 3300025936 | Bacteria | 2191 |
| 445 | Ga0207704_10000032 | 3300025938 | Bacteria | 108408 |
| 446 | Ga0207691_10074908 | 3300025940 | Bacteria | 3052 |
| 447 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 448 | Ga0207711_10002909 | 3300025941 | Bacteria | 15006 |
| 449 | Ga0207711_10007104 | 3300025941 | Bacteria | 9380 |
| 450 | Ga0207711_10028990 | 3300025941 | Bacteria | 4665 |
| 451 | Ga0207711_10068532 | 3300025941 | Bacteria | 3073 |
| 452 | Ga0207711_10115399 | 3300025941 | Bacteria | 2393 |
| 453 | Ga0207711_10216704 | 3300025941 | Bacteria | 1750 |
| 454 | Ga0207711_10326683 | 3300025941 | Bacteria | 1418 |
| 455 | Ga0207689_10000108 | 3300025942 | Bacteria | 68132 |
| 456 | Ga0207661_10117279 | 3300025944 | Bacteria | 2261 |
| 457 | Ga0207679_10195064 | 3300025945 | Bacteria | 1687 |
| 458 | Ga0207679_10489509 | 3300025945 | Bacteria | 1096 |
| 459 | Ga0207667_10000013 | 3300025949 | Bacteria | 435875 |
| 460 | Ga0207667_10004663 | 3300025949 | Bacteria | 16793 |
| 461 | Ga0207667_10006842 | 3300025949 | Bacteria | 13779 |
| 462 | Ga0207667_10017750 | 3300025949 | Bacteria | 8002 |
| 463 | Ga0207667_10069701 | 3300025949 | Bacteria | 3660 |
| 464 | Ga0207667_10069703 | 3300025949 | Bacteria | 3660 |
| 465 | Ga0207667_10125810 | 3300025949 | Bacteria | 2640 |
| 466 | Ga0207667_10144188 | 3300025949 | Bacteria | 2452 |
| 467 | Ga0207667_10672478 | 3300025949 | Bacteria | 1039 |
| 468 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 469 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 470 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 471 | Ga0207712_10000163 | 3300025961 | Bacteria | 68522 |
| 472 | Ga0207712_10006075 | 3300025961 | Bacteria | 7623 |
| 473 | Ga0207712_10077855 | 3300025961 | Bacteria | 2405 |
| 474 | Ga0207668_10000081 | 3300025972 | Bacteria | 72145 |
| 475 | Ga0207668_10000706 | 3300025972 | Bacteria | 20420 |
| 476 | Ga0207668_10079196 | 3300025972 | Bacteria | 2376 |
| 477 | Ga0207668_10117830 | 3300025972 | Bacteria | 2005 |
| 478 | Ga0207668_10129130 | 3300025972 | Bacteria | 1927 |
| 479 | Ga0207668_10387276 | 3300025972 | Bacteria | 1178 |
| 480 | Ga0207668_10500130 | 3300025972 | Bacteria | 1045 |
| 481 | Ga0207640_10000050 | 3300025981 | Bacteria | 96203 |
| 482 | Ga0207640_10004057 | 3300025981 | Bacteria | 7912 |
| 483 | Ga0207640_10006582 | 3300025981 | Bacteria | 6378 |
| 484 | Ga0207640_10043702 | 3300025981 | Bacteria | 2865 |
| 485 | Ga0207640_10077581 | 3300025981 | Bacteria | 2259 |
| 486 | Ga0207640_10105407 | 3300025981 | Bacteria | 1987 |
| 487 | Ga0207640_10145707 | 3300025981 | Bacteria | 1732 |
| 488 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 489 | Ga0207658_10000196 | 3300025986 | Bacteria | 63933 |
| 490 | Ga0207658_10000223 | 3300025986 | Bacteria | 59510 |
| 491 | Ga0207658_10001629 | 3300025986 | Bacteria | 17221 |
| 492 | Ga0207658_10004644 | 3300025986 | Bacteria | 9522 |
| 493 | Ga0207658_10006781 | 3300025986 | Bacteria | 7799 |
| 494 | Ga0207658_10027929 | 3300025986 | Bacteria | 3969 |
| 495 | Ga0207658_10049470 | 3300025986 | Bacteria | 3089 |
| 496 | Ga0207658_10151211 | 3300025986 | Bacteria | 1891 |
| 497 | Ga0207677_10000214 | 3300026023 | Bacteria | 46317 |
| 498 | Ga0207703_10007829 | 3300026035 | Bacteria | 8451 |
| 499 | Ga0207703_10012705 | 3300026035 | Bacteria | 6565 |
| 500 | Ga0207703_10022029 | 3300026035 | Bacteria | 4991 |
| 501 | Ga0207703_10027135 | 3300026035 | Bacteria | 4510 |
| 502 | Ga0207703_10327271 | 3300026035 | Bacteria | 1405 |
| 503 | Ga0207639_10001919 | 3300026041 | Bacteria | 13963 |
| 504 | Ga0207639_10007281 | 3300026041 | Bacteria | 7537 |
| 505 | Ga0207639_10029801 | 3300026041 | Bacteria | 3999 |
| 506 | Ga0207639_10033617 | 3300026041 | Bacteria | 3784 |
| 507 | Ga0207639_10140035 | 3300026041 | Bacteria | 2014 |
| 508 | Ga0207639_10361804 | 3300026041 | Bacteria | 1298 |
| 509 | Ga0207639_10463823 | 3300026041 | Bacteria | 1152 |
| 510 | Ga0207678_10003417 | 3300026067 | Bacteria | 14294 |
| 511 | Ga0207678_10005375 | 3300026067 | Bacteria | 11472 |
| 512 | Ga0207678_10046697 | 3300026067 | Bacteria | 3745 |
| 513 | Ga0207678_10073264 | 3300026067 | Bacteria | 2935 |
| 514 | Ga0207678_10436419 | 3300026067 | Bacteria | 1137 |
| 515 | Ga0207678_10439874 | 3300026067 | Bacteria | 1132 |
| 516 | Ga0207702_10002016 | 3300026078 | Bacteria | 19681 |
| 517 | Ga0207702_10002082 | 3300026078 | Bacteria | 19328 |
| 518 | Ga0207702_10008254 | 3300026078 | Bacteria | 8801 |
| 519 | Ga0207702_10038451 | 3300026078 | Bacteria | 4007 |
| 520 | Ga0207702_10284530 | 3300026078 | Bacteria | 1564 |
| 521 | Ga0207702_10751777 | 3300026078 | Bacteria | 962 |
| 522 | Ga0207641_10000008 | 3300026088 | Bacteria | 424415 |
| 523 | Ga0207641_10000195 | 3300026088 | Bacteria | 82043 |
| 524 | Ga0207641_10000414 | 3300026088 | Bacteria | 49835 |
| 525 | Ga0207641_10000657 | 3300026088 | Bacteria | 37717 |
| 526 | Ga0207641_10002967 | 3300026088 | Bacteria | 15351 |
| 527 | Ga0207641_10012207 | 3300026088 | Bacteria | 7050 |
| 528 | Ga0207641_10016785 | 3300026088 | Bacteria | 5995 |
| 529 | Ga0207641_10080470 | 3300026088 | Bacteria | 2826 |
| 530 | Ga0207641_10089559 | 3300026088 | Bacteria | 2689 |
| 531 | Ga0207641_10130432 | 3300026088 | Bacteria | 2256 |
| 532 | Ga0207641_10964004 | 3300026088 | Bacteria | 849 |
| 533 | Ga0207648_10000073 | 3300026089 | Bacteria | 94751 |
| 534 | Ga0207676_10000017 | 3300026095 | Bacteria | 308709 |
| 535 | Ga0207676_10000019 | 3300026095 | Bacteria | 305653 |
| 536 | Ga0207676_10003099 | 3300026095 | Bacteria | 11861 |
| 537 | Ga0207676_10004129 | 3300026095 | Bacteria | 10252 |
| 538 | Ga0207676_10009609 | 3300026095 | Bacteria | 6885 |
| 539 | Ga0207676_10011403 | 3300026095 | Bacteria | 6352 |
| 540 | Ga0207676_10415560 | 3300026095 | Bacteria | 1260 |
| 541 | Ga0207674_10019146 | 3300026116 | Bacteria | 7421 |
| 542 | Ga0207674_10036832 | 3300026116 | Bacteria | 5092 |
| 543 | Ga0207674_10041562 | 3300026116 | Bacteria | 4753 |
| 544 | Ga0207674_10047233 | 3300026116 | Bacteria | 4415 |
| 545 | Ga0207674_10103694 | 3300026116 | Bacteria | 2823 |
| 546 | Ga0207674_10307026 | 3300026116 | Bacteria | 1536 |
| 547 | Ga0207675_100000227 | 3300026118 | Bacteria | 53090 |
| 548 | Ga0207675_100000341 | 3300026118 | Bacteria | 44495 |
| 549 | Ga0207675_100025073 | 3300026118 | Bacteria | 5550 |
| 550 | Ga0207683_10053845 | 3300026121 | Bacteria | 3529 |
| 551 | Ga0207698_10000541 | 3300026142 | Bacteria | 21921 |
| 552 | Ga0207698_10010737 | 3300026142 | Bacteria | 5907 |
| 553 | Ga0207698_10040877 | 3300026142 | Bacteria | 3451 |
| 554 | Ga0207698_10041529 | 3300026142 | Bacteria | 3428 |
| 555 | Ga0207698_10134591 | 3300026142 | Bacteria | 2118 |
| 556 | Ga0207698_10158087 | 3300026142 | Bacteria | 1978 |
| 557 | Ga0207698_10162666 | 3300026142 | Bacteria | 1954 |
| 558 | Ga0207698_10191798 | 3300026142 | Bacteria | 1821 |
| 559 | Ga0207698_10221442 | 3300026142 | Bacteria | 1710 |
| 560 | Ga0207698_10264605 | 3300026142 | Bacteria | 1582 |
| 561 | Ga0207698_10272570 | 3300026142 | Bacteria | 1561 |
| 562 | Ga0207698_10467386 | 3300026142 | Bacteria | 1221 |
| 563 | Ga0209813_10000013 | 3300027866 | Bacteria | 89768 |
| 564 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 565 | Ga0268266_10000334 | 3300028379 | Bacteria | 73724 |
| 566 | Ga0268266_10012828 | 3300028379 | Bacteria | 7235 |
| 567 | Ga0268266_10020141 | 3300028379 | Bacteria | 5686 |
| 568 | Ga0268266_10048874 | 3300028379 | Bacteria | 3626 |
| 569 | Ga0268266_10083699 | 3300028379 | Bacteria | 2785 |
| 570 | Ga0268266_10103047 | 3300028379 | Bacteria | 2518 |
| 571 | Ga0268266_10234301 | 3300028379 | Bacteria | 1692 |
| 572 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 573 | Ga0268265_10000011 | 3300028380 | Bacteria | 343832 |
| 574 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 575 | Ga0268265_10000433 | 3300028380 | Bacteria | 44275 |
| 576 | Ga0268265_10001980 | 3300028380 | Bacteria | 16210 |
| 577 | Ga0268265_10004916 | 3300028380 | Bacteria | 9189 |
| 578 | Ga0268265_10005892 | 3300028380 | Bacteria | 8351 |
| 579 | Ga0268265_10063534 | 3300028380 | Bacteria | 2840 |
| 580 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 581 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 582 | Ga0268264_10000066 | 3300028381 | Bacteria | 285125 |
| 583 | Ga0268264_10000074 | 3300028381 | Bacteria | 259555 |
| 584 | Ga0268264_10000228 | 3300028381 | Bacteria | 108722 |
| 585 | Ga0268264_10003652 | 3300028381 | Bacteria | 13230 |
| 586 | Ga0268264_10018854 | 3300028381 | Bacteria | 5641 |
| 587 | Ga0268264_10021334 | 3300028381 | Bacteria | 5289 |
| 588 | Ga0268264_10027561 | 3300028381 | Bacteria | 4644 |
| 589 | Ga0268264_10041094 | 3300028381 | Bacteria | 3823 |
| 590 | Ga0268264_10338754 | 3300028381 | Bacteria | 1428 |
| 591 | Ga0268264_10424034 | 3300028381 | Bacteria | 1284 |
| 592 | Ga0265331_10146796 | 3300031250 | Bacteria | 1071 |
| 593 | Ga0307513_10079230 | 3300031456 | Bacteria | 3395 |
| 594 | Ga0307408_100005065 | 3300031548 | Bacteria | 8843 |
| 595 | Ga0307408_100049229 | 3300031548 | Bacteria | 3026 |
| 596 | Ga0307408_100064439 | 3300031548 | Bacteria | 2684 |
| 597 | Ga0307408_100159006 | 3300031548 | Bacteria | 1792 |
| 598 | Ga0307408_100226455 | 3300031548 | Bacteria | 1529 |
| 599 | Ga0307508_10167737 | 3300031616 | Bacteria | 1799 |
| 600 | Ga0316579_10145580 | 3300031691 | Bacteria | 1142 |
| 601 | Ga0307516_10139362 | 3300031730 | Bacteria | 2197 |
| 602 | Ga0307405_10004121 | 3300031731 | Bacteria | 6829 |
| 603 | Ga0307405_10060786 | 3300031731 | Bacteria | 2385 |
| 604 | Ga0307405_10209361 | 3300031731 | Bacteria | 1422 |
| 605 | Ga0307405_10338884 | 3300031731 | Bacteria | 1155 |
| 606 | Ga0307413_10011789 | 3300031824 | Bacteria | 4317 |
| 607 | Ga0307413_10096814 | 3300031824 | Bacteria | 1938 |
| 608 | Ga0307410_10221593 | 3300031852 | Bacteria | 1455 |
| 609 | Ga0307412_10000453 | 3300031911 | Bacteria | 24741 |
| 610 | Ga0307412_10009214 | 3300031911 | Bacteria | 5658 |
| 611 | Ga0307412_10012078 | 3300031911 | Bacteria | 5021 |
| 612 | Ga0307412_10045512 | 3300031911 | Bacteria | 2869 |
| 613 | Ga0307412_10249572 | 3300031911 | Bacteria | 1377 |
| 614 | Ga0307412_10659606 | 3300031911 | Bacteria | 893 |
| 615 | Ga0307409_100054392 | 3300031995 | Bacteria | 3082 |
| 616 | Ga0307409_100626795 | 3300031995 | Bacteria | 1066 |
| 617 | Ga0307416_100073601 | 3300032002 | Bacteria | 2849 |
| 618 | Ga0307416_100090147 | 3300032002 | Bacteria | 2628 |
| 619 | Ga0307416_100320071 | 3300032002 | Bacteria | 1552 |
| 620 | Ga0307416_100717436 | 3300032002 | Bacteria | 1090 |
| 621 | Ga0307416_100767007 | 3300032002 | Bacteria | 1058 |
| 622 | Ga0307414_10000248 | 3300032004 | Bacteria | 33977 |
| 623 | Ga0307414_10001322 | 3300032004 | Bacteria | 12801 |
| 624 | Ga0307414_10046944 | 3300032004 | Bacteria | 2969 |
| 625 | Ga0307411_10020048 | 3300032005 | Bacteria | 3879 |
| 626 | Ga0307411_10334890 | 3300032005 | Bacteria | 1228 |
| 627 | Ga0307411_10494636 | 3300032005 | Bacteria | 1033 |
| 628 | Ga0307415_100306820 | 3300032126 | Bacteria | 1317 |
| 629 | Ga0316583_10005084 | 3300032133 | Bacteria | 4709 |
| 630 | Ga0373943_0113108 | 3300035170 | Bacteria | 1434 |
| 631 | Ga0373931_0030223 | 3300035691 | Bacteria | 2788 |
| 632 | Ga0316582_0001383 | 3300036647 | Bacteria | 10561 |
| 633 | Ga0395899_0014090 | 3300037312 | Bacteria | 6104 |
| 634 | Ga0395900_0360006 | 3300037418 | Bacteria | 1426 |
| 635 | Ga0395905_0118962 | 3300037471 | Bacteria | 2483 |
| 636 | Ga0395901_0379831 | 3300038443 | Bacteria | 1454 |
| 637 | Ga0237819_00867 | 3300038705 | Bacteria | 9511 |
| 638 | Ga0451802_1385565 | 3300041460 | Bacteria | 3103 |
| 639 | Ga0439448_0000324 | 3300042005 | Bacteria | 10592 |
| 640 | Ga0439448_0007182 | 3300042005 | Bacteria | 3220 |
| 641 | Ga0439448_0010488 | 3300042005 | Bacteria | 2750 |
| 642 | Ga0439448_0043183 | 3300042005 | Bacteria | 1463 |
| 643 | Ga0439455_0000320 | 3300042012 | Bacteria | 6073 |
| 644 | Ga0439455_0006017 | 3300042012 | Bacteria | 2495 |
| 645 | Ga0439458_0000018 | 3300042157 | Bacteria | 26069 |
| 646 | Ga0439458_0001408 | 3300042157 | Bacteria | 6066 |
| 647 | Ga0439435_0011236 | 3300042436 | Bacteria | 2145 |
| 648 | Ga0466966_0205751 | 3300044684 | Bacteria | 1190 |
| 649 | Ga0466961_0050001 | 3300044693 | Bacteria | 2670 |
| 650 | Ga0466963_0013645 | 3300044694 | Bacteria | 4994 |
| 651 | Ga0466957_0005926 | 3300044842 | Bacteria | 6886 |
| 652 | Ga0466959_0125302 | 3300045049 | Bacteria | 1823 |
| 653 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 654 | Ga0451576_0264963 | 3300045051 | Bacteria | 1796 |
| 655 | Ga0466958_0025469 | 3300045836 | Bacteria | 3489 |
| 656 | Ga0466967_0085645 | 3300045976 | Bacteria | 2853 |
| 657 | Ga0495617_002497 | 3300046452 | Bacteria | 7301 |
| 658 | Ga0495627_000124 | 3300046453 | Bacteria | 93651 |
| 659 | Ga0495627_005805 | 3300046453 | Bacteria | 4912 |
| 660 | Ga0495638_0013799 | 3300046460 | Bacteria | 5486 |
| 661 | Ga0495638_0168798 | 3300046460 | Bacteria | 1257 |
| 662 | Ga0495650_0000647 | 3300046471 | Bacteria | 45905 |
| 663 | Ga0495596_0000204 | 3300046500 | Bacteria | 40606 |
| 664 | Ga0495596_0006154 | 3300046500 | Bacteria | 5572 |
| 665 | Ga0495607_0005890 | 3300046501 | Bacteria | 8704 |
| 666 | Ga0495583_0000010 | 3300046506 | Bacteria | 353523 |
| 667 | Ga0495606_0000837 | 3300046507 | Bacteria | 46284 |
| 668 | Ga0495606_0028847 | 3300046507 | Bacteria | 3907 |
| 669 | Ga0495610_0000022 | 3300046512 | Bacteria | 317107 |
| 670 | Ga0495610_0000094 | 3300046512 | Bacteria | 105131 |
| 671 | Ga0495610_0000206 | 3300046512 | Bacteria | 65469 |
| 672 | Ga0495610_0001863 | 3300046512 | Bacteria | 18268 |
| 673 | Ga0495616_0000189 | 3300046513 | Bacteria | 51610 |
| 674 | Ga0495616_0033455 | 3300046513 | Bacteria | 2678 |
| 675 | Ga0495620_0019022 | 3300046515 | Bacteria | 3389 |
| 676 | Ga0495631_0103860 | 3300046518 | Bacteria | 1223 |
| 677 | Ga0495632_0001275 | 3300046519 | Bacteria | 21330 |
| 678 | Ga0495637_0036823 | 3300046520 | Bacteria | 2128 |
| 679 | Ga0495637_0047857 | 3300046520 | Bacteria | 1803 |
| 680 | Ga0495643_0000054 | 3300046522 | Bacteria | 198757 |
| 681 | Ga0495643_0059481 | 3300046522 | Bacteria | 2031 |
| 682 | Ga0495643_0109608 | 3300046522 | Bacteria | 1405 |
| 683 | Ga0495648_0054412 | 3300046524 | Bacteria | 2418 |
| 684 | Ga0495654_0045829 | 3300046530 | Bacteria | 2156 |
| 685 | Ga0495654_0057571 | 3300046530 | Bacteria | 1877 |
| 686 | Ga0495654_0063612 | 3300046530 | Bacteria | 1766 |
| 687 | Ga0495598_0003104 | 3300046537 | Bacteria | 3498 |
| 688 | Ga0495609_0004390 | 3300046538 | Bacteria | 7738 |
| 689 | Ga0495622_0083810 | 3300046557 | Bacteria | 1466 |
| 690 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 691 | Ga0495668_0034893 | 3300046616 | Bacteria | 2820 |
| 692 | Ga0495668_0081418 | 3300046616 | Bacteria | 1776 |
| 693 | Ga0495668_0104249 | 3300046616 | Bacteria | 1551 |
| 694 | Ga0495668_0151025 | 3300046616 | Bacteria | 1272 |
| 695 | Ga0495611_0180523 | 3300046648 | Bacteria | 986 |
| 696 | Ga0495625_0002892 | 3300046660 | Bacteria | 17941 |
| 697 | Ga0495625_0003219 | 3300046660 | Bacteria | 16539 |
| 698 | Ga0495625_0011306 | 3300046660 | Bacteria | 7288 |
| 699 | Ga0495625_0151816 | 3300046660 | Bacteria | 1557 |
| 700 | Ga0495661_0071006 | 3300046665 | Bacteria | 2036 |
| 701 | Ga0495671_0065087 | 3300046692 | Bacteria | 1794 |
| 702 | Ga0495671_0139996 | 3300046692 | Bacteria | 1179 |
| 703 | Ga0495649_0076419 | 3300046694 | Bacteria | 1793 |
| 704 | Ga0495673_0012038 | 3300047469 | Bacteria | 4614 |
| 705 | Ga0495681_0000106 | 3300047470 | Bacteria | 72369 |
| 706 | Ga0495681_0000187 | 3300047470 | Bacteria | 52995 |
| 707 | Ga0495686_0000278 | 3300047472 | Bacteria | 90520 |
| 708 | Ga0495686_0000366 | 3300047472 | Bacteria | 73243 |
| 709 | Ga0495686_0000986 | 3300047472 | Bacteria | 34762 |
| 710 | Ga0495686_0006371 | 3300047472 | Bacteria | 9052 |
| 711 | Ga0495686_0015352 | 3300047472 | Bacteria | 5232 |
| 712 | Ga0495686_0069590 | 3300047472 | Bacteria | 2169 |
| 713 | Ga0495686_0111285 | 3300047472 | Bacteria | 1642 |
| 714 | Ga0495615_0000162 | 3300048090 | Bacteria | 16971 |
| 715 | Ga0495626_0004324 | 3300048091 | Bacteria | 8754 |
| 716 | Ga0496100_0042368 | 3300048903 | Bacteria | 2907 |
| 717 | Ga0496100_0047375 | 3300048903 | Bacteria | 2769 |
| 718 | Ga0496100_0160795 | 3300048903 | Bacteria | 1610 |
| 719 | Ga0496101_0004642 | 3300048904 | Bacteria | 8687 |
| 720 | Ga0496101_0053758 | 3300048904 | Bacteria | 2907 |
| 721 | Ga0496101_0137103 | 3300048904 | Bacteria | 1863 |
| 722 | Ga0496101_0361114 | 3300048904 | Bacteria | 1142 |
| 723 | Ga0496102_0000308 | 3300048905 | Bacteria | 62245 |
| 724 | Ga0496102_0029156 | 3300048905 | Bacteria | 4935 |
| 725 | Ga0496102_0295344 | 3300048905 | Bacteria | 1527 |
| 726 | Ga0496103_0000021 | 3300048906 | Bacteria | 229062 |
| 727 | Ga0496103_0001901 | 3300048906 | Bacteria | 13580 |
| 728 | Ga0496103_0012595 | 3300048906 | Bacteria | 5016 |
| 729 | Ga0496103_0094882 | 3300048906 | Bacteria | 1885 |
| 730 | Ga0496103_0113703 | 3300048906 | Bacteria | 1721 |
| 731 | Ga0496103_0151067 | 3300048906 | Bacteria | 1488 |
| 732 | Ga0496104_0000131 | 3300048907 | Bacteria | 69658 |
| 733 | Ga0496104_0040263 | 3300048907 | Bacteria | 4379 |
| 734 | Ga0496104_0073721 | 3300048907 | Bacteria | 3248 |
| 735 | Ga0496104_0124392 | 3300048907 | Bacteria | 2476 |
| 736 | Ga0496104_0595467 | 3300048907 | Bacteria | 1016 |
| 737 | Ga0496105_0000111 | 3300048908 | Bacteria | 55868 |
| 738 | Ga0496105_0001688 | 3300048908 | Bacteria | 15747 |
| 739 | Ga0496105_0081331 | 3300048908 | Bacteria | 2675 |
| 740 | Ga0496106_0001103 | 3300048909 | Bacteria | 19971 |
| 741 | Ga0496106_0737854 | 3300048909 | Bacteria | 783 |
| 742 | Ga0496107_0000975 | 3300048910 | Bacteria | 16984 |
| 743 | Ga0496107_0040979 | 3300048910 | Bacteria | 3325 |
| 744 | Ga0496107_0082643 | 3300048910 | Bacteria | 2342 |
| 745 | Ga0496107_0196806 | 3300048910 | Bacteria | 1498 |
| 746 | Ga0496108_0013686 | 3300048911 | Bacteria | 6623 |
| 747 | Ga0496109_0018196 | 3300048912 | Bacteria | 6170 |
| 748 | Ga0496109_0085274 | 3300048912 | Bacteria | 2915 |
| 749 | Ga0496110_0138322 | 3300048913 | Bacteria | 2202 |
| 750 | Ga0496111_0021644 | 3300048914 | Bacteria | 4494 |
| 751 | Ga0496111_0133783 | 3300048914 | Bacteria | 1836 |
| 752 | Ga0496112_0000957 | 3300048915 | Bacteria | 21009 |
| 753 | Ga0496112_0078645 | 3300048915 | Bacteria | 3261 |
| 754 | Ga0496113_0000112 | 3300048916 | Bacteria | 35072 |
| 755 | Ga0496113_0000648 | 3300048916 | Bacteria | 17543 |
| 756 | Ga0496114_0028698 | 3300048917 | Bacteria | 4568 |
| 757 | Ga0496114_0077633 | 3300048917 | Bacteria | 2800 |
| 758 | Ga0496116_0000039 | 3300048919 | Bacteria | 349134 |
| 759 | Ga0496116_0007876 | 3300048919 | Bacteria | 9349 |
| 760 | Ga0496116_0011817 | 3300048919 | Bacteria | 7187 |
| 761 | Ga0496116_0072490 | 3300048919 | Bacteria | 2176 |
| 762 | Ga0496116_0098742 | 3300048919 | Bacteria | 1751 |
| 763 | Ga0496117_0000284 | 3300048920 | Bacteria | 92675 |
| 764 | Ga0496117_0003796 | 3300048920 | Bacteria | 17237 |
| 765 | Ga0496117_0006080 | 3300048920 | Bacteria | 12379 |
| 766 | Ga0496117_0011471 | 3300048920 | Bacteria | 7936 |
| 767 | Ga0496117_0015913 | 3300048920 | Bacteria | 6373 |
| 768 | Ga0496117_0031009 | 3300048920 | Bacteria | 4090 |
| 769 | Ga0496117_0138507 | 3300048920 | Bacteria | 1462 |
| 770 | Ga0496117_0187512 | 3300048920 | Bacteria | 1182 |
| 771 | Ga0496118_0000870 | 3300048921 | Bacteria | 47798 |
| 772 | Ga0496118_0004782 | 3300048921 | Bacteria | 15825 |
| 773 | Ga0496118_0021045 | 3300048921 | Bacteria | 5758 |
| 774 | Ga0496118_0027199 | 3300048921 | Bacteria | 4847 |
| 775 | Ga0496118_0042271 | 3300048921 | Bacteria | 3597 |
| 776 | Ga0496118_0059631 | 3300048921 | Bacteria | 2839 |
| 777 | Ga0496118_0146582 | 3300048921 | Bacteria | 1485 |
| 778 | Ga0496118_0206876 | 3300048921 | Bacteria | 1156 |
| 779 | Ga0496119_0000339 | 3300048922 | Bacteria | 65402 |
| 780 | Ga0496119_0048032 | 3300048922 | Bacteria | 2650 |
| 781 | Ga0496120_0000334 | 3300048923 | Bacteria | 78728 |
| 782 | Ga0496121_0000175 | 3300048924 | Bacteria | 142910 |
| 783 | Ga0496121_0000650 | 3300048924 | Bacteria | 65007 |
| 784 | Ga0496121_0000733 | 3300048924 | Bacteria | 60446 |
| 785 | Ga0496121_0001098 | 3300048924 | Bacteria | 47733 |
| 786 | Ga0496121_0002945 | 3300048924 | Bacteria | 24853 |
| 787 | Ga0496121_0004766 | 3300048924 | Bacteria | 17897 |
| 788 | Ga0496121_0074007 | 3300048924 | Bacteria | 2727 |
| 789 | Ga0496121_0153766 | 3300048924 | Bacteria | 1690 |
| 790 | Ga0496122_0001086 | 3300048925 | Bacteria | 47240 |
| 791 | Ga0496122_0001206 | 3300048925 | Bacteria | 44057 |
| 792 | Ga0496122_0001526 | 3300048925 | Bacteria | 36870 |
| 793 | Ga0496122_0006643 | 3300048925 | Bacteria | 13186 |
| 794 | Ga0496122_0025699 | 3300048925 | Bacteria | 5104 |
| 795 | Ga0496122_0031675 | 3300048925 | Bacteria | 4393 |
| 796 | Ga0496122_0046186 | 3300048925 | Bacteria | 3376 |
| 797 | Ga0496123_0000367 | 3300048926 | Bacteria | 84634 |
| 798 | Ga0496123_0000536 | 3300048926 | Bacteria | 65382 |
| 799 | Ga0496123_0000804 | 3300048926 | Bacteria | 50773 |
| 800 | Ga0496123_0002207 | 3300048926 | Bacteria | 24751 |
| 801 | Ga0496123_0003565 | 3300048926 | Bacteria | 17252 |
| 802 | Ga0496123_0015818 | 3300048926 | Bacteria | 6163 |
| 803 | Ga0496124_0003977 | 3300048927 | Bacteria | 17619 |
| 804 | Ga0496124_0004725 | 3300048927 | Bacteria | 15729 |
| 805 | Ga0496124_0007994 | 3300048927 | Bacteria | 11129 |
| 806 | Ga0496124_0017269 | 3300048927 | Bacteria | 6807 |
| 807 | Ga0496124_0066867 | 3300048927 | Bacteria | 2992 |
| 808 | Ga0496124_0298201 | 3300048927 | Bacteria | 1166 |
| 809 | Ga0496124_0316618 | 3300048927 | Bacteria | 1119 |
| 810 | Ga0496124_0482984 | 3300048927 | Bacteria | 836 |
| 811 | Ga0496125_0002033 | 3300048928 | Bacteria | 27406 |
| 812 | Ga0496125_0004368 | 3300048928 | Bacteria | 16377 |
| 813 | Ga0496125_0007177 | 3300048928 | Bacteria | 11883 |
| 814 | Ga0496125_0017851 | 3300048928 | Bacteria | 6752 |
| 815 | Ga0496125_0055142 | 3300048928 | Bacteria | 3241 |
| 816 | Ga0496125_0056955 | 3300048928 | Bacteria | 3170 |
| 817 | Ga0496125_0355345 | 3300048928 | Bacteria | 873 |
| 818 | Ga0496126_0000041 | 3300048929 | Bacteria | 340389 |
| 819 | Ga0496126_0000175 | 3300048929 | Bacteria | 146389 |
| 820 | Ga0496126_0004825 | 3300048929 | Bacteria | 15816 |
| 821 | Ga0496126_0005044 | 3300048929 | Bacteria | 15331 |
| 822 | Ga0496126_0005910 | 3300048929 | Bacteria | 13803 |
| 823 | Ga0496126_0030518 | 3300048929 | Bacteria | 5105 |
| 824 | Ga0496126_0069424 | 3300048929 | Bacteria | 3143 |
| 825 | Ga0496126_0081882 | 3300048929 | Bacteria | 2853 |
| 826 | Ga0496126_0117565 | 3300048929 | Bacteria | 2309 |
| 827 | Ga0501290_000205 | 3300049513 | Bacteria | 9770 |
| 828 | Ga0501292_000189 | 3300049515 | Bacteria | 9869 |
| 829 | Ga0501293_003299 | 3300049516 | Bacteria | 1244 |
| 830 | Ga0501300_000660 | 3300049523 | Bacteria | 5171 |
| 831 | Ga0501031_0043575 | 3300049568 | Bacteria | 2928 |
| 832 | Ga0501032_0034947 | 3300049569 | Bacteria | 3437 |
| 833 | Ga0501032_0106253 | 3300049569 | Bacteria | 1859 |
| 834 | Ga0501033_0007801 | 3300049570 | Bacteria | 8292 |
| 835 | Ga0501033_0036932 | 3300049570 | Bacteria | 3659 |
| 836 | Ga0501033_0064870 | 3300049570 | Bacteria | 2687 |
| 837 | Ga0501033_0409935 | 3300049570 | Bacteria | 944 |
| 838 | Ga0501034_0026214 | 3300049571 | Bacteria | 5936 |
| 839 | Ga0501034_0409921 | 3300049571 | Bacteria | 1277 |
| 840 | Ga0501036_0008497 | 3300049572 | Bacteria | 8416 |
| 841 | Ga0501036_0613802 | 3300049572 | Bacteria | 902 |
| 842 | Ga0501037_0048952 | 3300049573 | Bacteria | 3095 |
| 843 | Ga0501038_0036353 | 3300049574 | Bacteria | 4322 |
| 844 | Ga0501039_0041950 | 3300049575 | Bacteria | 3535 |
| 845 | Ga0501043_0025689 | 3300049579 | Bacteria | 4621 |
| 846 | Ga0501043_0156189 | 3300049579 | Bacteria | 1784 |
| 847 | Ga0501046_0055695 | 3300049580 | Bacteria | 3106 |
| 848 | Ga0501046_0093053 | 3300049580 | Bacteria | 2317 |
| 849 | Ga0501047_0000277 | 3300049581 | Bacteria | 59304 |
| 850 | Ga0501047_0052860 | 3300049581 | Bacteria | 3927 |
| 851 | Ga0501047_0108798 | 3300049581 | Bacteria | 2654 |
| 852 | Ga0501047_0116918 | 3300049581 | Bacteria | 2548 |
| 853 | Ga0501047_0352436 | 3300049581 | Bacteria | 1308 |
| 854 | Ga0501048_0038246 | 3300049582 | Bacteria | 3444 |
| 855 | Ga0501070_0359653 | 3300049586 | Bacteria | 1181 |
| 856 | Ga0501206_001832 | 3300049653 | Bacteria | 2667 |
| 857 | Ga0501222_001312 | 3300049662 | Bacteria | 3482 |
| 858 | Ga0501223_000317 | 3300049663 | Bacteria | 12000 |
| 859 | Ga0501223_003158 | 3300049663 | Bacteria | 3601 |
| 860 | Ga0501224_000076 | 3300049664 | Bacteria | 10275 |
| 861 | Ga0501227_013899 | 3300049665 | Bacteria | 1780 |
| 862 | Ga0501233_000558 | 3300049668 | Bacteria | 6046 |
| 863 | Ga0501235_030555 | 3300049669 | Bacteria | 1214 |
| 864 | Ga0501249_000121 | 3300049679 | Bacteria | 23955 |
| 865 | Ga0501257_000008 | 3300049686 | Bacteria | 54624 |
| 866 | Ga0501259_001343 | 3300049688 | Bacteria | 4115 |
| 867 | Ga0501261_000148 | 3300049690 | Bacteria | 10156 |
| 868 | Ga0501221_002919 | 3300049704 | Bacteria | 2816 |
| 869 | Ga0501225_0001994 | 3300049705 | Bacteria | 6378 |
| 870 | Ga0501225_0012545 | 3300049705 | Bacteria | 2379 |
| 871 | Ga0501279_000145 | 3300049775 | Bacteria | 9968 |
| 872 | Ga0501281_00174 | 3300049777 | Bacteria | 7389 |
| 873 | Ga0501282_000075 | 3300049778 | Bacteria | 11879 |
| 874 | Ga0501283_000488 | 3300049779 | Bacteria | 5221 |
| 875 | Ga0501035_0017136 | 3300049822 | Bacteria | 6675 |
| 876 | Ga0501035_0300994 | 3300049822 | Bacteria | 1351 |
| 877 | Ga0501044_0000053 | 3300049823 | Bacteria | 141732 |
| 878 | Ga0501044_0046760 | 3300049823 | Bacteria | 4479 |
| 879 | Ga0501044_0237237 | 3300049823 | Bacteria | 1769 |
| 880 | Ga0501044_0237278 | 3300049823 | Bacteria | 1769 |
| 881 | Ga0501044_0408972 | 3300049823 | Bacteria | 1268 |
| 882 | Ga0501044_0543842 | 3300049823 | Bacteria | 1059 |
| 883 | Ga0501226_000183 | 3300049853 | Bacteria | 10218 |
| 884 | nmdc:mga03683_28_c2 | 3300050489 | Bacteria | 61805 |
| 885 | nmdc:mga03683_41_c1 | 3300050489 | Bacteria | 60927 |
| 886 | nmdc:mga03n38_176_c1 | 3300050490 | Bacteria | 14308 |
| 887 | nmdc:mga00v17_18164_c1 | 3300050491 | Bacteria | 3990 |
| 888 | nmdc:mga00v17_2587_c1 | 3300050491 | Bacteria | 9275 |
| 889 | nmdc:mga00v17_80678_c1 | 3300050491 | Bacteria | 2030 |
| 890 | nmdc:mga0k408_242422_c1 | 3300050493 | Bacteria | 1076 |
| 891 | nmdc:mga0k408_256099_c1 | 3300050493 | Bacteria | 1045 |
| 892 | nmdc:mga0k408_9_c1 | 3300050493 | Bacteria | 82578 |
| 893 | nmdc:mga06z11_49_c1 | 3300050494 | Bacteria | 50406 |
| 894 | nmdc:mga07m45_130768_c1 | 3300050496 | Bacteria | 1452 |
| 895 | nmdc:mga07m45_13_c2 | 3300050496 | Bacteria | 88503 |
| 896 | nmdc:mga07m45_1455_c1 | 3300050496 | Bacteria | 10863 |
| 897 | nmdc:mga07m45_16_c1 | 3300050496 | Bacteria | 151695 |
| 898 | nmdc:mga0sz30_106_c1 | 3300050516 | Bacteria | 31275 |
| 899 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 900 | Ga0500643_000169 | 3300053087 | Bacteria | 64699 |
| 901 | Ga0500643_002115 | 3300053087 | Bacteria | 10549 |
| 902 | Ga0500643_005518 | 3300053087 | Bacteria | 5439 |
| 903 | Ga0500643_005814 | 3300053087 | Bacteria | 5256 |
| 904 | Ga0500643_022686 | 3300053087 | Bacteria | 2017 |
| 905 | Ga0500583_0290108 | 3300053092 | Bacteria | 802 |
| 906 | Ga0500651_0041970 | 3300053093 | Bacteria | 2883 |
| 907 | Ga0500555_000684 | 3300053103 | Bacteria | 12890 |
| 908 | Ga0500556_0000013 | 3300053104 | Bacteria | 243797 |
| 909 | Ga0500592_000050 | 3300053116 | Bacteria | 35179 |
| 910 | Ga0500592_000243 | 3300053116 | Bacteria | 9903 |
| 911 | Ga0500594_0005354 | 3300053118 | Bacteria | 2845 |
| 912 | Ga0500594_0013050 | 3300053118 | Bacteria | 1969 |
| 913 | Ga0500597_007259 | 3300053120 | Bacteria | 3739 |
| 914 | Ga0500607_000140 | 3300053121 | Bacteria | 60736 |
| 915 | Ga0500607_000188 | 3300053121 | Bacteria | 55367 |
| 916 | Ga0500608_000566 | 3300053122 | Bacteria | 13807 |
| 917 | Ga0500608_013074 | 3300053122 | Bacteria | 3668 |
| 918 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 919 | Ga0500642_0043025 | 3300053130 | Bacteria | 1960 |
| 920 | Ga0500658_0038015 | 3300053134 | Bacteria | 1917 |
| 921 | Ga0500559_0000722 | 3300053136 | Bacteria | 21736 |
| 922 | Ga0500559_0000883 | 3300053136 | Bacteria | 19195 |
| 923 | Ga0500559_0016726 | 3300053136 | Bacteria | 3098 |
| 924 | Ga0500559_0020301 | 3300053136 | Bacteria | 2809 |
| 925 | Ga0500564_000123 | 3300053138 | Bacteria | 19609 |
| 926 | Ga0500573_0040821 | 3300053140 | Bacteria | 2680 |
| 927 | Ga0500590_001058 | 3300053148 | Bacteria | 10777 |
| 928 | Ga0500604_0026205 | 3300053151 | Bacteria | 1680 |
| 929 | Ga0500604_0052207 | 3300053151 | Bacteria | 1265 |
| 930 | Ga0500604_0127237 | 3300053151 | Bacteria | 855 |
| 931 | Ga0500616_0002623 | 3300053153 | Bacteria | 14681 |
| 932 | Ga0500616_0007941 | 3300053153 | Bacteria | 6665 |
| 933 | Ga0500624_000038 | 3300053157 | Bacteria | 93803 |
| 934 | Ga0500624_000324 | 3300053157 | Bacteria | 16298 |
| 935 | Ga0500627_0000004 | 3300053158 | Bacteria | 174208 |
| 936 | Ga0500627_0000081 | 3300053158 | Bacteria | 34802 |
| 937 | Ga0500627_0000452 | 3300053158 | Bacteria | 11132 |
| 938 | Ga0500639_141310 | 3300053163 | Bacteria | 1125 |
| 939 | Ga0500636_0006654 | 3300053177 | Bacteria | 6646 |
| 940 | Ga0500637_0000047 | 3300053178 | Bacteria | 43949 |
| 941 | Ga0500567_000691 | 3300053723 | Bacteria | 12345 |
| 942 | Ga0500570_002110 | 3300053724 | Bacteria | 9674 |
| 943 | Ga0500611_000358 | 3300053727 | Bacteria | 4660 |
| 944 | Ga0500625_000035 | 3300053729 | Bacteria | 47893 |
| 945 | Ga0500645_001027 | 3300053730 | Bacteria | 15634 |
| 946 | Ga0500645_001749 | 3300053730 | Bacteria | 10535 |
| 947 | Ga0500645_046732 | 3300053730 | Bacteria | 1270 |
| 948 | Ga0466962_0000605 | 3300061719 | Bacteria | 15878 |
| 949 | 2511126364 | 2510917021 | Bacteria | 5705459 |
| 950 | 2585260775 | 2582581305 | Bacteria | 4895574 |
| 951 | 2643728696 | 2643221541 | Bacteria | 5498788 |
| 952 | 2643823517 | 2643221560 | Bacteria | 4801179 |
| 953 | 2643948825 | 2643221588 | Bacteria | 3692460 |
| 954 | 2644037965 | 2643221605 | Bacteria | 4772303 |
| 955 | 2644044711 | 2643221606 | Bacteria | 5588032 |
| 956 | 2644390884 | 2643221671 | Bacteria | 5496681 |
| 957 | 2738709903 | 2738541275 | Bacteria | 4830863 |
| 958 | 2738848328 | 2738541301 | Bacteria | 4834102 |
| 959 | 2738864057 | 2738541304 | Bacteria | 4833665 |
| 960 | 2739296575 | 2738543022 | Bacteria | 4835059 |
| 961 | 2739358253 | 2738543033 | Bacteria | 4833336 |
| 962 | 2739650543 | 2739367664 | Bacteria | 4114334 |
| 963 | 2740029016 | 2739367865 | Bacteria | 4114482 |
| 964 | 2819550676 | 2818991438 | Bacteria | 5793701 |
| 965 | 2852655501 | 2852653556 | Bacteria | 4050083 |
| 966 | 2852681109 | 2852680915 | Bacteria | 4100189 |
| 967 | 2882808240 | 2882806704 | Bacteria | 3007728 |
| 968 | 2895882723 | 2895880812 | Bacteria | 11255272 |
| 969 | 2896185244 | 2896184354 | Bacteria | 3258548 |
| 970 | 2896255655 | 2896253425 | Bacteria | 3418029 |
| 971 | 2919142635 | 2919138771 | Bacteria | 5281312 |
| 972 | 2919713339 | 2919709256 | Bacteria | 4318106 |
| 973 | 2928101451 | 2928100450 | Bacteria | 4837635 |
| 974 | 2928960138 | 2928959182 | Bacteria | 4725774 |
| 975 | 3000867757 | 3000865235 | Bacteria | 3106258 |
| 976 | 8054305609 | 8054302542 | Bacteria | 5698134 |
| 977 | Ga0065704_10079225 | |||
| 978 | SwRhRL2b_contig_1489105 | |||
| 979 | SwRhRL2b_contig_2402994 | |||
| 980 | JGI24752J21851_1000048 | |||
| 981 | JGI24739J22299_10000251 | |||
| 982 | JGI24739J22299_10001511 | |||
| 983 | JGI24739J22299_10002733 | |||
| 984 | JGI24739J22299_10023091 | |||
| 985 | JGI24739J22299_10027769 | |||
| 986 | JGI24737J22298_10001603 | |||
| 987 | JGI24737J22298_10002940 | |||
| 988 | JGI24737J22298_10007027 | |||
| 989 | JGI24737J22298_10013657 | |||
| 990 | JGI24743J22301_10049053 | |||
| 991 | JGI24735J21928_10002659 | |||
| 992 | JGI24735J21928_10003032 | |||
| 993 | JGI24735J21928_10003729 | |||
| 994 | JGI24735J21928_10010426 | |||
| 995 | JGI24750J21931_1000042 | |||
| 996 | JGI24750J21931_1011003 | |||
| 997 | JGI24748J21848_1000063 | |||
| 998 | JGI24738J21930_10000468 | |||
| 999 | JGI24738J21930_10000632 | |||
| 1000 | JGI24738J21930_10009517 | |||
| 1001 | JGI24749J21850_1000252 | |||
| 1002 | JGI24749J21850_1000472 | |||
| 1003 | JGI24034J26672_10000007 | |||
| 1004 | JGI24742J22300_10004892 | |||
| 1005 | JGI24751J29686_10000046 | |||
| 1006 | JGI24751J29686_10000473 | |||
| 1007 | JGI24751J29686_10003360 | |||
| 1008 | JGI24751J29686_10033737 | |||
| 1009 | JGI25165J46597_1000112 | |||
| 1010 | rootH1_10346595 | |||
| 1011 | Ga0055536_1001242 | |||
| 1012 | Ga0055536_1001703 | |||
| 1013 | Ga0055530_10012661 | |||
| 1014 | Ga0065704_10000191 | |||
| 1015 | Ga0065704_10002210 | |||
| 1016 | Ga0065704_10072419 | |||
| 1017 | Ga0065707_10082140 | |||
| 1018 | Ga0065707_10114593 | |||
| 1019 | Ga0070658_10000089 | |||
| 1020 | Ga0070658_10001742 | |||
| 1021 | Ga0070658_10004304 | |||
| 1022 | Ga0070658_10016592 | |||
| 1023 | Ga0070658_10030940 | |||
| 1024 | Ga0070658_10129269 | |||
| 1025 | Ga0070658_10169252 | |||
| 1026 | Ga0070676_10000909 | |||
| 1027 | Ga0070690_100000110 | |||
| 1028 | Ga0070670_100000006 | |||
| 1029 | Ga0070670_100000068 | |||
| 1030 | Ga0070670_100004402 | |||
| 1031 | Ga0070670_100011758 | |||
| 1032 | Ga0070670_100017184 | |||
| 1033 | Ga0070670_100054238 | |||
| 1034 | Ga0068869_100004212 | |||
| 1035 | Ga0070666_10000068 | |||
| 1036 | Ga0070666_10000417 | |||
| 1037 | Ga0070666_10003859 | |||
| 1038 | Ga0070666_10027816 | |||
| 1039 | Ga0070666_10214903 | |||
| 1040 | Ga0070680_100007674 | |||
| 1041 | Ga0068868_100000023 | |||
| 1042 | Ga0070660_100000916 | |||
| 1043 | Ga0070660_100004613 | |||
| 1044 | Ga0070660_100014971 | |||
| 1045 | Ga0070660_100023922 | |||
| 1046 | Ga0070660_100048126 | |||
| 1047 | Ga0070660_100054117 | |||
| 1048 | Ga0070660_100563887 | |||
| 1049 | Ga0070661_100008440 | |||
| 1050 | Ga0070661_100272667 | |||
| 1051 | Ga0070661_100527374 | |||
| 1052 | Ga0070692_10148947 | |||
| 1053 | Ga0070668_100000026 | |||
| 1054 | Ga0070668_100002833 | |||
| 1055 | Ga0070668_100007337 | |||
| 1056 | Ga0070668_100010222 | |||
| 1057 | Ga0070668_100023436 | |||
| 1058 | Ga0070668_100023648 | |||
| 1059 | Ga0070668_100039261 | |||
| 1060 | Ga0070668_100136399 | |||
| 1061 | Ga0070668_100264567 | |||
| 1062 | Ga0070668_100433211 | |||
| 1063 | Ga0070669_100000018 | |||
| 1064 | Ga0070669_100000083 | |||
| 1065 | Ga0070669_100000102 | |||
| 1066 | Ga0070669_100000193 | |||
| 1067 | Ga0070669_100000332 | |||
| 1068 | Ga0070669_100064196 | |||
| 1069 | Ga0070669_100407873 | |||
| 1070 | Ga0070671_100000011 | |||
| 1071 | Ga0070671_100000107 | |||
| 1072 | Ga0070671_100000266 | |||
| 1073 | Ga0070671_100001068 | |||
| 1074 | Ga0070671_100020174 | |||
| 1075 | Ga0070671_100048676 | |||
| 1076 | Ga0070671_100055799 | |||
| 1077 | Ga0070671_100273701 | |||
| 1078 | Ga0070674_100144483 | |||
| 1079 | Ga0070673_100000001 | |||
| 1080 | Ga0070688_100002132 | |||
| 1081 | Ga0070659_100043766 | |||
| 1082 | Ga0070659_100084366 | |||
| 1083 | Ga0070659_100228119 | |||
| 1084 | Ga0070667_100000019 | |||
| 1085 | Ga0070667_100000098 | |||
| 1086 | Ga0070667_100001002 | |||
| 1087 | Ga0070667_100004151 | |||
| 1088 | Ga0070667_100004153 | |||
| 1089 | Ga0070667_100005317 | |||
| 1090 | Ga0070667_100009896 | |||
| 1091 | Ga0070667_100048771 | |||
| 1092 | Ga0070667_100118697 | |||
| 1093 | Ga0070663_100024996 | |||
| 1094 | Ga0070663_100045390 | |||
| 1095 | Ga0070663_100134867 | |||
| 1096 | Ga0070678_100029355 | |||
| 1097 | Ga0070678_100194887 | |||
| 1098 | Ga0070662_100000887 | |||
| 1099 | Ga0070662_100009685 | |||
| 1100 | Ga0070662_100190414 | |||
| 1101 | Ga0070662_100229419 | |||
| 1102 | Ga0070662_100266757 | |||
| 1103 | Ga0070681_10004470 | |||
| 1104 | Ga0068867_100000027 | |||
| 1105 | Ga0070685_10000036 | |||
| 1106 | Ga0070707_100182464 | |||
| 1107 | Ga0070679_100012621 | |||
| 1108 | Ga0070679_100022533 | |||
| 1109 | Ga0070679_100030802 | |||
| 1110 | Ga0070679_100612007 | |||
| 1111 | Ga0070684_100023818 | |||
| 1112 | Ga0068853_100004246 | |||
| 1113 | Ga0068853_100017555 | |||
| 1114 | Ga0068853_100042359 | |||
| 1115 | Ga0068853_100597048 | |||
| 1116 | Ga0070672_100088116 | |||
| 1117 | Ga0070686_100000045 | |||
| 1118 | Ga0070686_100071892 | |||
| 1119 | Ga0070665_100000042 | |||
| 1120 | Ga0070665_100000269 | |||
| 1121 | Ga0070665_100037764 | |||
| 1122 | Ga0070665_100057760 | |||
| 1123 | Ga0070665_100065726 | |||
| 1124 | Ga0070665_100088255 | |||
| 1125 | Ga0070665_100112938 | |||
| 1126 | Ga0070665_100194116 | |||
| 1127 | Ga0068855_100000092 | |||
| 1128 | Ga0068855_100010472 | |||
| 1129 | Ga0068855_100024314 | |||
| 1130 | Ga0068855_100038768 | |||
| 1131 | Ga0068855_100044343 | |||
| 1132 | Ga0068855_100056220 | |||
| 1133 | Ga0068855_100117473 | |||
| 1134 | Ga0070664_100120328 | |||
| 1135 | Ga0068857_100012124 | |||
| 1136 | Ga0068857_100017141 | |||
| 1137 | Ga0068857_100112698 | |||
| 1138 | Ga0068857_100345836 | |||
| 1139 | Ga0068857_100566885 | |||
| 1140 | Ga0068854_100000684 | |||
| 1141 | Ga0068854_100010675 | |||
| 1142 | Ga0068854_100013424 | |||
| 1143 | Ga0068854_100018762 | |||
| 1144 | Ga0068854_100044644 | |||
| 1145 | Ga0068854_100130588 | |||
| 1146 | Ga0068854_100273112 | |||
| 1147 | Ga0068854_100456003 | |||
| 1148 | Ga0068856_100014407 | |||
| 1149 | Ga0068856_100028654 | |||
| 1150 | Ga0068856_100029700 | |||
| 1151 | Ga0068856_100040569 | |||
| 1152 | Ga0068856_100480172 | |||
| 1153 | Ga0068852_100002388 | |||
| 1154 | Ga0068852_100008366 | |||
| 1155 | Ga0068852_100038495 | |||
| 1156 | Ga0068852_100121455 | |||
| 1157 | Ga0068852_100214724 | |||
| 1158 | Ga0068852_100247162 | |||
| 1159 | Ga0068852_100256372 | |||
| 1160 | Ga0068859_100006602 | |||
| 1161 | Ga0068859_100007283 | |||
| 1162 | Ga0068859_100009002 | |||
| 1163 | Ga0068859_100010776 | |||
| 1164 | Ga0068859_100039024 | |||
| 1165 | Ga0068859_100039829 | |||
| 1166 | Ga0068859_100358142 | |||
| 1167 | Ga0068859_100574468 | |||
| 1168 | Ga0068864_100000014 | |||
| 1169 | Ga0068864_100000019 | |||
| 1170 | Ga0068864_100001740 | |||
| 1171 | Ga0068864_100007768 | |||
| 1172 | Ga0068864_100018289 | |||
| 1173 | Ga0068864_100018652 | |||
| 1174 | Ga0068864_100020326 | |||
| 1175 | Ga0068864_100104581 | |||
| 1176 | Ga0068866_10206302 | |||
| 1177 | Ga0068861_100006194 | |||
| 1178 | Ga0068861_100009141 | |||
| 1179 | Ga0068861_100028058 | |||
| 1180 | Ga0068861_100054223 | |||
| 1181 | Ga0068851_10059906 | |||
| 1182 | Ga0068851_10259249 | |||
| 1183 | Ga0068863_100000015 | |||
| 1184 | Ga0068863_100000138 | |||
| 1185 | Ga0068863_100000280 | |||
| 1186 | Ga0068863_100002835 | |||
| 1187 | Ga0068863_100003685 | |||
| 1188 | Ga0068863_100003927 | |||
| 1189 | Ga0068863_100004738 | |||
| 1190 | Ga0068863_100012255 | |||
| 1191 | Ga0068863_100050813 | |||
| 1192 | Ga0068863_100150305 | |||
| 1193 | Ga0068863_100568864 | |||
| 1194 | Ga0068858_100003226 | |||
| 1195 | Ga0068858_100005917 | |||
| 1196 | Ga0068858_100006381 | |||
| 1197 | Ga0068858_100007900 | |||
| 1198 | Ga0068858_100045666 | |||
| 1199 | Ga0068858_100220756 | |||
| 1200 | Ga0068860_100000028 | |||
| 1201 | Ga0068860_100000036 | |||
| 1202 | Ga0068860_100000164 | |||
| 1203 | Ga0068860_100000182 | |||
| 1204 | Ga0068860_100006964 | |||
| 1205 | Ga0068860_100014112 | |||
| 1206 | Ga0068860_100019551 | |||
| 1207 | Ga0068860_100039405 | |||
| 1208 | Ga0068860_100086950 | |||
| 1209 | Ga0068862_100000007 | |||
| 1210 | Ga0068862_100000067 | |||
| 1211 | Ga0068862_100000094 | |||
| 1212 | Ga0068862_100000308 | |||
| 1213 | Ga0068862_100000543 | |||
| 1214 | Ga0068862_100002528 | |||
| 1215 | Ga0068862_100006100 | |||
| 1216 | Ga0068862_100010416 | |||
| 1217 | Ga0075368_10000033 | |||
| 1218 | Ga0075368_10000095 | |||
| 1219 | Ga0075363_100001584 | |||
| 1220 | Ga0075364_10003212 | |||
| 1221 | Ga0075362_10000054 | |||
| 1222 | Ga0075362_10000265 | |||
| 1223 | Ga0075367_10001701 | |||
| 1224 | Ga0075369_10000150 | |||
| 1225 | Ga0075366_10000376 | |||
| 1226 | Ga0075366_10016501 | |||
| 1227 | Ga0075366_10033312 | |||
| 1228 | Ga0075366_10069306 | |||
| 1229 | Ga0075366_10358444 | |||
| 1230 | Ga0097621_100281049 | |||
| 1231 | Ga0075370_10000018 | |||
| 1232 | Ga0075370_10001563 | |||
| 1233 | Ga0075370_10001922 | |||
| 1234 | Ga0075370_10067685 | |||
| 1235 | Ga0075370_10072304 | |||
| 1236 | Ga0068871_100197641 | |||
| 1237 | Ga0068865_100000030 | |||
| 1238 | Ga0097620_100006602 | |||
| 1239 | Ga0097620_100007283 | |||
| 1240 | Ga0097620_100009002 | |||
| 1241 | Ga0097620_100010776 | |||
| 1242 | Ga0097620_100039023 | |||
| 1243 | Ga0097620_100039829 | |||
| 1244 | Ga0097620_100358177 | |||
| 1245 | Ga0097620_100574479 | |||
| 1246 | Ga0079104_1011365 | |||
| 1247 | Ga0075435_100548087 | |||
| 1248 | Ga0105251_10000853 | |||
| 1249 | Ga0105251_10002316 | |||
| 1250 | Ga0105250_10063100 | |||
| 1251 | Ga0105240_10007666 | |||
| 1252 | Ga0105240_10015794 | |||
| 1253 | Ga0105240_10026155 | |||
| 1254 | Ga0105240_10042646 | |||
| 1255 | Ga0105240_10048773 | |||
| 1256 | Ga0105240_10886414 | |||
| 1257 | Ga0105245_10003967 | |||
| 1258 | Ga0105247_10003627 | |||
| 1259 | Ga0105247_10006168 | |||
| 1260 | Ga0105247_10031044 | |||
| 1261 | Ga0105247_10041519 | |||
| 1262 | Ga0114129_10128773 | |||
| 1263 | Ga0105243_10000389 | |||
| 1264 | Ga0105241_10120389 | |||
| 1265 | Ga0105242_10016891 | |||
| 1266 | Ga0105248_10000311 | |||
| 1267 | Ga0105248_10000651 | |||
| 1268 | Ga0105248_10003293 | |||
| 1269 | Ga0105248_10021266 | |||
| 1270 | Ga0105248_10048979 | |||
| 1271 | Ga0105248_10060981 | |||
| 1272 | Ga0105248_10083782 | |||
| 1273 | Ga0105248_10088933 | |||
| 1274 | Ga0105248_10103354 | |||
| 1275 | Ga0105248_10250096 | |||
| 1276 | Ga0105237_10009418 | |||
| 1277 | Ga0105237_10031194 | |||
| 1278 | Ga0105237_10495230 | |||
| 1279 | Ga0105238_10040689 | |||
| 1280 | Ga0105238_10161361 | |||
| 1281 | Ga0105238_10374791 | |||
| 1282 | Ga0105238_10379805 | |||
| 1283 | Ga0105249_10000012 | |||
| 1284 | Ga0105249_10000105 | |||
| 1285 | Ga0105249_10000568 | |||
| 1286 | Ga0105249_10003294 | |||
| 1287 | Ga0105249_10015137 | |||
| 1288 | Ga0105239_10000183 | |||
| 1289 | Ga0105246_10000730 | |||
| 1290 | Ga0105246_10017619 | |||
| 1291 | Ga0157373_10012241 | |||
| 1292 | Ga0157373_10045323 | |||
| 1293 | Ga0157373_10158932 | |||
| 1294 | Ga0157371_10002824 | |||
| 1295 | Ga0157371_10029859 | |||
| 1296 | Ga0157371_10070962 | |||
| 1297 | Ga0157370_10013144 | |||
| 1298 | Ga0157370_10097070 | |||
| 1299 | Ga0157369_10003242 | |||
| 1300 | Ga0157369_10013185 | |||
| 1301 | Ga0157369_10031631 | |||
| 1302 | Ga0157369_10255826 | |||
| 1303 | Ga0157374_10025842 | |||
| 1304 | Ga0157378_10038350 | |||
| 1305 | Ga0163162_10008723 | |||
| 1306 | Ga0157372_10011931 | |||
| 1307 | Ga0157372_10065914 | |||
| 1308 | Ga0157372_10074192 | |||
| 1309 | Ga0157372_10126062 | |||
| 1310 | Ga0157372_10217553 | |||
| 1311 | Ga0157372_10578941 | |||
| 1312 | Ga0157375_10000776 | |||
| 1313 | Ga0157375_10828136 | |||
| 1314 | Ga0163163_10067350 | |||
| 1315 | Ga0163163_10233366 | |||
| 1316 | Ga0163163_10577781 | |||
| 1317 | Ga0157380_10000014 | |||
| 1318 | Ga0157380_10000151 | |||
| 1319 | Ga0157380_10003723 | |||
| 1320 | Ga0157377_10066200 | |||
| 1321 | Ga0157379_10062412 | |||
| 1322 | Ga0157376_10000145 | |||
| 1323 | Ga0163161_10000202 | |||
| 1324 | Ga0163161_10012008 | |||
| 1325 | Ga0163161_10085572 | |||
| 1326 | Ga0207672_1000690 | |||
| 1327 | Ga0207427_100820 | |||
| 1328 | Ga0209026_1003814 | |||
| 1329 | Ga0209148_1000133 | |||
| 1330 | Ga0209233_1000078 | |||
| 1331 | Ga0209455_1000592 | |||
| 1332 | Ga0209676_1008949 | |||
| 1333 | Ga0209676_1048247 | |||
| 1334 | Ga0209050_1001308 | |||
| 1335 | Ga0209257_1000987 | |||
| 1336 | Ga0207697_10000184 | |||
| 1337 | Ga0207713_1002057 | |||
| 1338 | Ga0207713_1002657 | |||
| 1339 | Ga0207713_1044565 | |||
| 1340 | Ga0207710_10006133 | |||
| 1341 | Ga0207710_10022311 | |||
| 1342 | Ga0207710_10036560 | |||
| 1343 | Ga0207680_10000012 | |||
| 1344 | Ga0207680_10002312 | |||
| 1345 | Ga0207680_10012031 | |||
| 1346 | Ga0207680_10075062 | |||
| 1347 | Ga0207680_10130668 | |||
| 1348 | Ga0207647_10000293 | |||
| 1349 | Ga0207647_10000789 | |||
| 1350 | Ga0207647_10015957 | |||
| 1351 | Ga0207647_10026801 | |||
| 1352 | Ga0207645_10002416 | |||
| 1353 | Ga0207645_10103028 | |||
| 1354 | Ga0207705_10000009 | |||
| 1355 | Ga0207705_10000018 | |||
| 1356 | Ga0207705_10000140 | |||
| 1357 | Ga0207705_10000468 | |||
| 1358 | Ga0207705_10002762 | |||
| 1359 | Ga0207705_10051777 | |||
| 1360 | Ga0207705_10055151 | |||
| 1361 | Ga0207705_10118671 | |||
| 1362 | Ga0207654_10001661 | |||
| 1363 | Ga0207707_10136464 | |||
| 1364 | Ga0207695_10000641 | |||
| 1365 | Ga0207695_10006576 | |||
| 1366 | Ga0207695_10012328 | |||
| 1367 | Ga0207695_10036598 | |||
| 1368 | Ga0207695_10041984 | |||
| 1369 | Ga0207671_10002738 | |||
| 1370 | Ga0207671_10042781 | |||
| 1371 | Ga0207671_10394088 | |||
| 1372 | Ga0207660_10006580 | |||
| 1373 | Ga0207657_10001013 | |||
| 1374 | Ga0207657_10025295 | |||
| 1375 | Ga0207657_10027635 | |||
| 1376 | Ga0207657_10066223 | |||
| 1377 | Ga0207657_10080800 | |||
| 1378 | Ga0207649_10018237 | |||
| 1379 | Ga0207652_10010744 | |||
| 1380 | Ga0207652_10028408 | |||
| 1381 | Ga0207681_10000001 | |||
| 1382 | Ga0207681_10000008 | |||
| 1383 | Ga0207681_10000060 | |||
| 1384 | Ga0207681_10000076 | |||
| 1385 | Ga0207681_10000176 | |||
| 1386 | Ga0207681_10045165 | |||
| 1387 | Ga0207681_10269809 | |||
| 1388 | Ga0207681_10293069 | |||
| 1389 | Ga0207681_10309369 | |||
| 1390 | Ga0207694_10001461 | |||
| 1391 | Ga0207694_10039785 | |||
| 1392 | Ga0207650_10000023 | |||
| 1393 | Ga0207650_10000054 | |||
| 1394 | Ga0207650_10000657 | |||
| 1395 | Ga0207650_10057574 | |||
| 1396 | Ga0207650_10133041 | |||
| 1397 | Ga0207687_10002491 | |||
| 1398 | Ga0207644_10000004 | |||
| 1399 | Ga0207644_10000006 | |||
| 1400 | Ga0207644_10000067 | |||
| 1401 | Ga0207644_10002492 | |||
| 1402 | Ga0207644_10013127 | |||
| 1403 | Ga0207644_10032632 | |||
| 1404 | Ga0207644_10060614 | |||
| 1405 | Ga0207644_10146333 | |||
| 1406 | Ga0207690_10029576 | |||
| 1407 | Ga0207690_10125628 | |||
| 1408 | Ga0207690_10187264 | |||
| 1409 | Ga0207690_10210726 | |||
| 1410 | Ga0207690_10271229 | |||
| 1411 | Ga0207706_10000554 | |||
| 1412 | Ga0207706_10003511 | |||
| 1413 | Ga0207706_10014020 | |||
| 1414 | Ga0207706_10017119 | |||
| 1415 | Ga0207706_10018187 | |||
| 1416 | Ga0207706_10106441 | |||
| 1417 | Ga0207706_10355218 | |||
| 1418 | Ga0207686_10002215 | |||
| 1419 | Ga0207709_10000203 | |||
| 1420 | Ga0207670_10087894 | |||
| 1421 | Ga0207704_10000032 | |||
| 1422 | Ga0207691_10074908 | |||
| 1423 | Ga0207711_10000017 | |||
| 1424 | Ga0207711_10002909 | |||
| 1425 | Ga0207711_10007104 | |||
| 1426 | Ga0207711_10028990 | |||
| 1427 | Ga0207711_10068532 | |||
| 1428 | Ga0207711_10115399 | |||
| 1429 | Ga0207711_10216704 | |||
| 1430 | Ga0207711_10326683 | |||
| 1431 | Ga0207689_10000108 | |||
| 1432 | Ga0207661_10117279 | |||
| 1433 | Ga0207679_10195064 | |||
| 1434 | Ga0207679_10489509 | |||
| 1435 | Ga0207667_10000013 | |||
| 1436 | Ga0207667_10004663 | |||
| 1437 | Ga0207667_10006842 | |||
| 1438 | Ga0207667_10017750 | |||
| 1439 | Ga0207667_10069701 | |||
| 1440 | Ga0207667_10069703 | |||
| 1441 | Ga0207667_10125810 | |||
| 1442 | Ga0207667_10144188 | |||
| 1443 | Ga0207667_10672478 | |||
| 1444 | Ga0207651_10000001 | |||
| 1445 | Ga0207712_10000015 | |||
| 1446 | Ga0207712_10000021 | |||
| 1447 | Ga0207712_10000163 | |||
| 1448 | Ga0207712_10006075 | |||
| 1449 | Ga0207712_10077855 | |||
| 1450 | Ga0207668_10000081 | |||
| 1451 | Ga0207668_10000706 | |||
| 1452 | Ga0207668_10079196 | |||
| 1453 | Ga0207668_10117830 | |||
| 1454 | Ga0207668_10129130 | |||
| 1455 | Ga0207668_10387276 | |||
| 1456 | Ga0207668_10500130 | |||
| 1457 | Ga0207640_10000050 | |||
| 1458 | Ga0207640_10004057 | |||
| 1459 | Ga0207640_10006582 | |||
| 1460 | Ga0207640_10043702 | |||
| 1461 | Ga0207640_10077581 | |||
| 1462 | Ga0207640_10105407 | |||
| 1463 | Ga0207640_10145707 | |||
| 1464 | Ga0207658_10000002 | |||
| 1465 | Ga0207658_10000196 | |||
| 1466 | Ga0207658_10000223 | |||
| 1467 | Ga0207658_10001629 | |||
| 1468 | Ga0207658_10004644 | |||
| 1469 | Ga0207658_10006781 | |||
| 1470 | Ga0207658_10027929 | |||
| 1471 | Ga0207658_10049470 | |||
| 1472 | Ga0207658_10151211 | |||
| 1473 | Ga0207677_10000214 | |||
| 1474 | Ga0207703_10007829 | |||
| 1475 | Ga0207703_10012705 | |||
| 1476 | Ga0207703_10022029 | |||
| 1477 | Ga0207703_10027135 | |||
| 1478 | Ga0207703_10327271 | |||
| 1479 | Ga0207639_10001919 | |||
| 1480 | Ga0207639_10007281 | |||
| 1481 | Ga0207639_10029801 | |||
| 1482 | Ga0207639_10033617 | |||
| 1483 | Ga0207639_10140035 | |||
| 1484 | Ga0207639_10361804 | |||
| 1485 | Ga0207639_10463823 | |||
| 1486 | Ga0207678_10003417 | |||
| 1487 | Ga0207678_10005375 | |||
| 1488 | Ga0207678_10046697 | |||
| 1489 | Ga0207678_10073264 | |||
| 1490 | Ga0207678_10436419 | |||
| 1491 | Ga0207678_10439874 | |||
| 1492 | Ga0207702_10002016 | |||
| 1493 | Ga0207702_10002082 | |||
| 1494 | Ga0207702_10008254 | |||
| 1495 | Ga0207702_10038451 | |||
| 1496 | Ga0207702_10284530 | |||
| 1497 | Ga0207702_10751777 | |||
| 1498 | Ga0207641_10000008 | |||
| 1499 | Ga0207641_10000195 | |||
| 1500 | Ga0207641_10000414 | |||
| 1501 | Ga0207641_10000657 | |||
| 1502 | Ga0207641_10002967 | |||
| 1503 | Ga0207641_10012207 | |||
| 1504 | Ga0207641_10016785 | |||
| 1505 | Ga0207641_10080470 | |||
| 1506 | Ga0207641_10089559 | |||
| 1507 | Ga0207641_10130432 | |||
| 1508 | Ga0207641_10964004 | |||
| 1509 | Ga0207648_10000073 | |||
| 1510 | Ga0207676_10000017 | |||
| 1511 | Ga0207676_10000019 | |||
| 1512 | Ga0207676_10003099 | |||
| 1513 | Ga0207676_10004129 | |||
| 1514 | Ga0207676_10009609 | |||
| 1515 | Ga0207676_10011403 | |||
| 1516 | Ga0207676_10415560 | |||
| 1517 | Ga0207674_10019146 | |||
| 1518 | Ga0207674_10036832 | |||
| 1519 | Ga0207674_10041562 | |||
| 1520 | Ga0207674_10047233 | |||
| 1521 | Ga0207674_10103694 | |||
| 1522 | Ga0207674_10307026 | |||
| 1523 | Ga0207675_100000227 | |||
| 1524 | Ga0207675_100000341 | |||
| 1525 | Ga0207675_100025073 | |||
| 1526 | Ga0207683_10053845 | |||
| 1527 | Ga0207698_10000541 | |||
| 1528 | Ga0207698_10010737 | |||
| 1529 | Ga0207698_10040877 | |||
| 1530 | Ga0207698_10041529 | |||
| 1531 | Ga0207698_10134591 | |||
| 1532 | Ga0207698_10158087 | |||
| 1533 | Ga0207698_10162666 | |||
| 1534 | Ga0207698_10191798 | |||
| 1535 | Ga0207698_10221442 | |||
| 1536 | Ga0207698_10264605 | |||
| 1537 | Ga0207698_10272570 | |||
| 1538 | Ga0207698_10467386 | |||
| 1539 | Ga0209813_10000013 | |||
| 1540 | Ga0268266_10000054 | |||
| 1541 | Ga0268266_10000334 | |||
| 1542 | Ga0268266_10012828 | |||
| 1543 | Ga0268266_10020141 | |||
| 1544 | Ga0268266_10048874 | |||
| 1545 | Ga0268266_10083699 | |||
| 1546 | Ga0268266_10103047 | |||
| 1547 | Ga0268266_10234301 | |||
| 1548 | Ga0268265_10000002 | |||
| 1549 | Ga0268265_10000011 | |||
| 1550 | Ga0268265_10000021 | |||
| 1551 | Ga0268265_10000433 | |||
| 1552 | Ga0268265_10001980 | |||
| 1553 | Ga0268265_10004916 | |||
| 1554 | Ga0268265_10005892 | |||
| 1555 | Ga0268265_10063534 | |||
| 1556 | Ga0268264_10000001 | |||
| 1557 | Ga0268264_10000010 | |||
| 1558 | Ga0268264_10000066 | |||
| 1559 | Ga0268264_10000074 | |||
| 1560 | Ga0268264_10000228 | |||
| 1561 | Ga0268264_10003652 | |||
| 1562 | Ga0268264_10018854 | |||
| 1563 | Ga0268264_10021334 | |||
| 1564 | Ga0268264_10027561 | |||
| 1565 | Ga0268264_10041094 | |||
| 1566 | Ga0268264_10338754 | |||
| 1567 | Ga0268264_10424034 | |||
| 1568 | Ga0265331_10146796 | |||
| 1569 | Ga0307513_10079230 | |||
| 1570 | Ga0307408_100005065 | |||
| 1571 | Ga0307408_100049229 | |||
| 1572 | Ga0307408_100064439 | |||
| 1573 | Ga0307408_100159006 | |||
| 1574 | Ga0307408_100226455 | |||
| 1575 | Ga0307508_10167737 | |||
| 1576 | Ga0316579_10145580 | |||
| 1577 | Ga0307516_10139362 | |||
| 1578 | Ga0307405_10004121 | |||
| 1579 | Ga0307405_10060786 | |||
| 1580 | Ga0307405_10209361 | |||
| 1581 | Ga0307405_10338884 | |||
| 1582 | Ga0307413_10011789 | |||
| 1583 | Ga0307413_10096814 | |||
| 1584 | Ga0307410_10221593 | |||
| 1585 | Ga0307412_10000453 | |||
| 1586 | Ga0307412_10009214 | |||
| 1587 | Ga0307412_10012078 | |||
| 1588 | Ga0307412_10045512 | |||
| 1589 | Ga0307412_10249572 | |||
| 1590 | Ga0307412_10659606 | |||
| 1591 | Ga0307409_100054392 | |||
| 1592 | Ga0307409_100626795 | |||
| 1593 | Ga0307416_100073601 | |||
| 1594 | Ga0307416_100090147 | |||
| 1595 | Ga0307416_100320071 | |||
| 1596 | Ga0307416_100717436 | |||
| 1597 | Ga0307416_100767007 | |||
| 1598 | Ga0307414_10000248 | |||
| 1599 | Ga0307414_10001322 | |||
| 1600 | Ga0307414_10046944 | |||
| 1601 | Ga0307411_10020048 | |||
| 1602 | Ga0307411_10334890 | |||
| 1603 | Ga0307411_10494636 | |||
| 1604 | Ga0307415_100306820 | |||
| 1605 | Ga0316583_10005084 | |||
| 1606 | Ga0373943_0113108 | |||
| 1607 | Ga0373931_0030223 | |||
| 1608 | Ga0316582_0001383 | |||
| 1609 | Ga0395899_0014090 | |||
| 1610 | Ga0395900_0360006 | |||
| 1611 | Ga0395905_0118962 | |||
| 1612 | Ga0395901_0379831 | |||
| 1613 | Ga0237819_00867 | |||
| 1614 | Ga0451802_1385565 | |||
| 1615 | Ga0439448_0000324 | |||
| 1616 | Ga0439448_0007182 | |||
| 1617 | Ga0439448_0010488 | |||
| 1618 | Ga0439448_0043183 | |||
| 1619 | Ga0439455_0000320 | |||
| 1620 | Ga0439455_0006017 | |||
| 1621 | Ga0439458_0000018 | |||
| 1622 | Ga0439458_0001408 | |||
| 1623 | Ga0439435_0011236 | |||
| 1624 | Ga0466966_0205751 | |||
| 1625 | Ga0466961_0050001 | |||
| 1626 | Ga0466963_0013645 | |||
| 1627 | Ga0466957_0005926 | |||
| 1628 | Ga0466959_0125302 | |||
| 1629 | Ga0451576_0000023 | |||
| 1630 | Ga0451576_0264963 | |||
| 1631 | Ga0466958_0025469 | |||
| 1632 | Ga0466967_0085645 | |||
| 1633 | Ga0495617_002497 | |||
| 1634 | Ga0495627_000124 | |||
| 1635 | Ga0495627_005805 | |||
| 1636 | Ga0495638_0013799 | |||
| 1637 | Ga0495638_0168798 | |||
| 1638 | Ga0495650_0000647 | |||
| 1639 | Ga0495596_0000204 | |||
| 1640 | Ga0495596_0006154 | |||
| 1641 | Ga0495607_0005890 | |||
| 1642 | Ga0495583_0000010 | |||
| 1643 | Ga0495606_0000837 | |||
| 1644 | Ga0495606_0028847 | |||
| 1645 | Ga0495610_0000022 | |||
| 1646 | Ga0495610_0000094 | |||
| 1647 | Ga0495610_0000206 | |||
| 1648 | Ga0495610_0001863 | |||
| 1649 | Ga0495616_0000189 | |||
| 1650 | Ga0495616_0033455 | |||
| 1651 | Ga0495620_0019022 | |||
| 1652 | Ga0495631_0103860 | |||
| 1653 | Ga0495632_0001275 | |||
| 1654 | Ga0495637_0036823 | |||
| 1655 | Ga0495637_0047857 | |||
| 1656 | Ga0495643_0000054 | |||
| 1657 | Ga0495643_0059481 | |||
| 1658 | Ga0495643_0109608 | |||
| 1659 | Ga0495648_0054412 | |||
| 1660 | Ga0495654_0045829 | |||
| 1661 | Ga0495654_0057571 | |||
| 1662 | Ga0495654_0063612 | |||
| 1663 | Ga0495598_0003104 | |||
| 1664 | Ga0495609_0004390 | |||
| 1665 | Ga0495622_0083810 | |||
| 1666 | Ga0495668_0000001 | |||
| 1667 | Ga0495668_0034893 | |||
| 1668 | Ga0495668_0081418 | |||
| 1669 | Ga0495668_0104249 | |||
| 1670 | Ga0495668_0151025 | |||
| 1671 | Ga0495611_0180523 | |||
| 1672 | Ga0495625_0002892 | |||
| 1673 | Ga0495625_0003219 | |||
| 1674 | Ga0495625_0011306 | |||
| 1675 | Ga0495625_0151816 | |||
| 1676 | Ga0495661_0071006 | |||
| 1677 | Ga0495671_0065087 | |||
| 1678 | Ga0495671_0139996 | |||
| 1679 | Ga0495649_0076419 | |||
| 1680 | Ga0495673_0012038 | |||
| 1681 | Ga0495681_0000106 | |||
| 1682 | Ga0495681_0000187 | |||
| 1683 | Ga0495686_0000278 | |||
| 1684 | Ga0495686_0000366 | |||
| 1685 | Ga0495686_0000986 | |||
| 1686 | Ga0495686_0006371 | |||
| 1687 | Ga0495686_0015352 | |||
| 1688 | Ga0495686_0069590 | |||
| 1689 | Ga0495686_0111285 | |||
| 1690 | Ga0495615_0000162 | |||
| 1691 | Ga0495626_0004324 | |||
| 1692 | Ga0496100_0042368 | |||
| 1693 | Ga0496100_0047375 | |||
| 1694 | Ga0496100_0160795 | |||
| 1695 | Ga0496101_0004642 | |||
| 1696 | Ga0496101_0053758 | |||
| 1697 | Ga0496101_0137103 | |||
| 1698 | Ga0496101_0361114 | |||
| 1699 | Ga0496102_0000308 | |||
| 1700 | Ga0496102_0029156 | |||
| 1701 | Ga0496102_0295344 | |||
| 1702 | Ga0496103_0000021 | |||
| 1703 | Ga0496103_0001901 | |||
| 1704 | Ga0496103_0012595 | |||
| 1705 | Ga0496103_0094882 | |||
| 1706 | Ga0496103_0113703 | |||
| 1707 | Ga0496103_0151067 | |||
| 1708 | Ga0496104_0000131 | |||
| 1709 | Ga0496104_0040263 | |||
| 1710 | Ga0496104_0073721 | |||
| 1711 | Ga0496104_0124392 | |||
| 1712 | Ga0496104_0595467 | |||
| 1713 | Ga0496105_0000111 | |||
| 1714 | Ga0496105_0001688 | |||
| 1715 | Ga0496105_0081331 | |||
| 1716 | Ga0496106_0001103 | |||
| 1717 | Ga0496106_0737854 | |||
| 1718 | Ga0496107_0000975 | |||
| 1719 | Ga0496107_0040979 | |||
| 1720 | Ga0496107_0082643 | |||
| 1721 | Ga0496107_0196806 | |||
| 1722 | Ga0496108_0013686 | |||
| 1723 | Ga0496109_0018196 | |||
| 1724 | Ga0496109_0085274 | |||
| 1725 | Ga0496110_0138322 | |||
| 1726 | Ga0496111_0021644 | |||
| 1727 | Ga0496111_0133783 | |||
| 1728 | Ga0496112_0000957 | |||
| 1729 | Ga0496112_0078645 | |||
| 1730 | Ga0496113_0000112 | |||
| 1731 | Ga0496113_0000648 | |||
| 1732 | Ga0496114_0028698 | |||
| 1733 | Ga0496114_0077633 | |||
| 1734 | Ga0496116_0000039 | |||
| 1735 | Ga0496116_0007876 | |||
| 1736 | Ga0496116_0011817 | |||
| 1737 | Ga0496116_0072490 | |||
| 1738 | Ga0496116_0098742 | |||
| 1739 | Ga0496117_0000284 | |||
| 1740 | Ga0496117_0003796 | |||
| 1741 | Ga0496117_0006080 | |||
| 1742 | Ga0496117_0011471 | |||
| 1743 | Ga0496117_0015913 | |||
| 1744 | Ga0496117_0031009 | |||
| 1745 | Ga0496117_0138507 | |||
| 1746 | Ga0496117_0187512 | |||
| 1747 | Ga0496118_0000870 | |||
| 1748 | Ga0496118_0004782 | |||
| 1749 | Ga0496118_0021045 | |||
| 1750 | Ga0496118_0027199 | |||
| 1751 | Ga0496118_0042271 | |||
| 1752 | Ga0496118_0059631 | |||
| 1753 | Ga0496118_0146582 | |||
| 1754 | Ga0496118_0206876 | |||
| 1755 | Ga0496119_0000339 | |||
| 1756 | Ga0496119_0048032 | |||
| 1757 | Ga0496120_0000334 | |||
| 1758 | Ga0496121_0000175 | |||
| 1759 | Ga0496121_0000650 | |||
| 1760 | Ga0496121_0000733 | |||
| 1761 | Ga0496121_0001098 | |||
| 1762 | Ga0496121_0002945 | |||
| 1763 | Ga0496121_0004766 | |||
| 1764 | Ga0496121_0074007 | |||
| 1765 | Ga0496121_0153766 | |||
| 1766 | Ga0496122_0001086 | |||
| 1767 | Ga0496122_0001206 | |||
| 1768 | Ga0496122_0001526 | |||
| 1769 | Ga0496122_0006643 | |||
| 1770 | Ga0496122_0025699 | |||
| 1771 | Ga0496122_0031675 | |||
| 1772 | Ga0496122_0046186 | |||
| 1773 | Ga0496123_0000367 | |||
| 1774 | Ga0496123_0000536 | |||
| 1775 | Ga0496123_0000804 | |||
| 1776 | Ga0496123_0002207 | |||
| 1777 | Ga0496123_0003565 | |||
| 1778 | Ga0496123_0015818 | |||
| 1779 | Ga0496124_0003977 | |||
| 1780 | Ga0496124_0004725 | |||
| 1781 | Ga0496124_0007994 | |||
| 1782 | Ga0496124_0017269 | |||
| 1783 | Ga0496124_0066867 | |||
| 1784 | Ga0496124_0298201 | |||
| 1785 | Ga0496124_0316618 | |||
| 1786 | Ga0496124_0482984 | |||
| 1787 | Ga0496125_0002033 | |||
| 1788 | Ga0496125_0004368 | |||
| 1789 | Ga0496125_0007177 | |||
| 1790 | Ga0496125_0017851 | |||
| 1791 | Ga0496125_0055142 | |||
| 1792 | Ga0496125_0056955 | |||
| 1793 | Ga0496125_0355345 | |||
| 1794 | Ga0496126_0000041 | |||
| 1795 | Ga0496126_0000175 | |||
| 1796 | Ga0496126_0004825 | |||
| 1797 | Ga0496126_0005044 | |||
| 1798 | Ga0496126_0005910 | |||
| 1799 | Ga0496126_0030518 | |||
| 1800 | Ga0496126_0069424 | |||
| 1801 | Ga0496126_0081882 | |||
| 1802 | Ga0496126_0117565 | |||
| 1803 | Ga0501290_000205 | |||
| 1804 | Ga0501292_000189 | |||
| 1805 | Ga0501293_003299 | |||
| 1806 | Ga0501300_000660 | |||
| 1807 | Ga0501031_0043575 | |||
| 1808 | Ga0501032_0034947 | |||
| 1809 | Ga0501032_0106253 | |||
| 1810 | Ga0501033_0007801 | |||
| 1811 | Ga0501033_0036932 | |||
| 1812 | Ga0501033_0064870 | |||
| 1813 | Ga0501033_0409935 | |||
| 1814 | Ga0501034_0026214 | |||
| 1815 | Ga0501034_0409921 | |||
| 1816 | Ga0501036_0008497 | |||
| 1817 | Ga0501036_0613802 | |||
| 1818 | Ga0501037_0048952 | |||
| 1819 | Ga0501038_0036353 | |||
| 1820 | Ga0501039_0041950 | |||
| 1821 | Ga0501043_0025689 | |||
| 1822 | Ga0501043_0156189 | |||
| 1823 | Ga0501046_0055695 | |||
| 1824 | Ga0501046_0093053 | |||
| 1825 | Ga0501047_0000277 | |||
| 1826 | Ga0501047_0052860 | |||
| 1827 | Ga0501047_0108798 | |||
| 1828 | Ga0501047_0116918 | |||
| 1829 | Ga0501047_0352436 | |||
| 1830 | Ga0501048_0038246 | |||
| 1831 | Ga0501070_0359653 | |||
| 1832 | Ga0501206_001832 | |||
| 1833 | Ga0501222_001312 | |||
| 1834 | Ga0501223_000317 | |||
| 1835 | Ga0501223_003158 | |||
| 1836 | Ga0501224_000076 | |||
| 1837 | Ga0501227_013899 | |||
| 1838 | Ga0501233_000558 | |||
| 1839 | Ga0501235_030555 | |||
| 1840 | Ga0501249_000121 | |||
| 1841 | Ga0501257_000008 | |||
| 1842 | Ga0501259_001343 | |||
| 1843 | Ga0501261_000148 | |||
| 1844 | Ga0501221_002919 | |||
| 1845 | Ga0501225_0001994 | |||
| 1846 | Ga0501225_0012545 | |||
| 1847 | Ga0501279_000145 | |||
| 1848 | Ga0501281_00174 | |||
| 1849 | Ga0501282_000075 | |||
| 1850 | Ga0501283_000488 | |||
| 1851 | Ga0501035_0017136 | |||
| 1852 | Ga0501035_0300994 | |||
| 1853 | Ga0501044_0000053 | |||
| 1854 | Ga0501044_0046760 | |||
| 1855 | Ga0501044_0237237 | |||
| 1856 | Ga0501044_0237278 | |||
| 1857 | Ga0501044_0408972 | |||
| 1858 | Ga0501044_0543842 | |||
| 1859 | Ga0501226_000183 | |||
| 1860 | nmdc:mga03683_28_c2 | |||
| 1861 | nmdc:mga03683_41_c1 | |||
| 1862 | nmdc:mga03n38_176_c1 | |||
| 1863 | nmdc:mga00v17_18164_c1 | |||
| 1864 | nmdc:mga00v17_2587_c1 | |||
| 1865 | nmdc:mga00v17_80678_c1 | |||
| 1866 | nmdc:mga0k408_242422_c1 | |||
| 1867 | nmdc:mga0k408_256099_c1 | |||
| 1868 | nmdc:mga0k408_9_c1 | |||
| 1869 | nmdc:mga06z11_49_c1 | |||
| 1870 | nmdc:mga07m45_130768_c1 | |||
| 1871 | nmdc:mga07m45_13_c2 | |||
| 1872 | nmdc:mga07m45_1455_c1 | |||
| 1873 | nmdc:mga07m45_16_c1 | |||
| 1874 | nmdc:mga0sz30_106_c1 | |||
| 1875 | Ga0500643_000004 | |||
| 1876 | Ga0500643_000169 | |||
| 1877 | Ga0500643_002115 | |||
| 1878 | Ga0500643_005518 | |||
| 1879 | Ga0500643_005814 | |||
| 1880 | Ga0500643_022686 | |||
| 1881 | Ga0500583_0290108 | |||
| 1882 | Ga0500651_0041970 | |||
| 1883 | Ga0500555_000684 | |||
| 1884 | Ga0500556_0000013 | |||
| 1885 | Ga0500592_000050 | |||
| 1886 | Ga0500592_000243 | |||
| 1887 | Ga0500594_0005354 | |||
| 1888 | Ga0500594_0013050 | |||
| 1889 | Ga0500597_007259 | |||
| 1890 | Ga0500607_000140 | |||
| 1891 | Ga0500607_000188 | |||
| 1892 | Ga0500608_000566 | |||
| 1893 | Ga0500608_013074 | |||
| 1894 | Ga0500642_0000002 | |||
| 1895 | Ga0500642_0043025 | |||
| 1896 | Ga0500658_0038015 | |||
| 1897 | Ga0500559_0000722 | |||
| 1898 | Ga0500559_0000883 | |||
| 1899 | Ga0500559_0016726 | |||
| 1900 | Ga0500559_0020301 | |||
| 1901 | Ga0500564_000123 | |||
| 1902 | Ga0500573_0040821 | |||
| 1903 | Ga0500590_001058 | |||
| 1904 | Ga0500604_0026205 | |||
| 1905 | Ga0500604_0052207 | |||
| 1906 | Ga0500604_0127237 | |||
| 1907 | Ga0500616_0002623 | |||
| 1908 | Ga0500616_0007941 | |||
| 1909 | Ga0500624_000038 | |||
| 1910 | Ga0500624_000324 | |||
| 1911 | Ga0500627_0000004 | |||
| 1912 | Ga0500627_0000081 | |||
| 1913 | Ga0500627_0000452 | |||
| 1914 | Ga0500639_141310 | |||
| 1915 | Ga0500636_0006654 | |||
| 1916 | Ga0500637_0000047 | |||
| 1917 | Ga0500567_000691 | |||
| 1918 | Ga0500570_002110 | |||
| 1919 | Ga0500611_000358 | |||
| 1920 | Ga0500625_000035 | |||
| 1921 | Ga0500645_001027 | |||
| 1922 | Ga0500645_001749 | |||
| 1923 | Ga0500645_046732 | |||
| 1924 | Ga0466962_0000605 | |||
| 1925 | 2511126364 | |||
| 1926 | 2585260775 | |||
| 1927 | 2643728696 | |||
| 1928 | 2643823517 | |||
| 1929 | 2643948825 | |||
| 1930 | 2644037965 | |||
| 1931 | 2644044711 | |||
| 1932 | 2644390884 | |||
| 1933 | 2738709903 | |||
| 1934 | 2738848328 | |||
| 1935 | 2738864057 | |||
| 1936 | 2739296575 | |||
| 1937 | 2739358253 | |||
| 1938 | 2739650543 | |||
| 1939 | 2740029016 | |||
| 1940 | 2819550676 | |||
| 1941 | 2852655501 | |||
| 1942 | 2852681109 | |||
| 1943 | 2882808240 | |||
| 1944 | 2895882723 | |||
| 1945 | 2896185244 | |||
| 1946 | 2896255655 | |||
| 1947 | 2919142635 | |||
| 1948 | 2919713339 | |||
| 1949 | 2928101451 | |||
| 1950 | 2928960138 | |||
| 1951 | 3000867757 | |||
| 1952 | 8054305609 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6eo3-assembly1.cif.gz_A | conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c p212121 | 0.9104 | 4 | 50 |
| 4ldz-assembly1.cif.gz_B | crystal structure of the full-length response regulator desr in the active state | 0.9101 | 9 | 49 |
| 6cbq-assembly1.cif.gz_A | crystal structure of qscr bound to agonist s3 | 0.9087 | 10 | 50 |
| 6eo2-assembly1.cif.gz_A | conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed | 0.9063 | 6 | 50 |
| 5o8y-assembly1.cif.gz_D | conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. | 0.9052 | 6 | 50 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fzvC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9439 | 7 | 77 | 1.10.10.10 |
| af_Q2FZS7_1_83_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9429 | 7 | 87 | 1.10.10.10 |
| 3p7nA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9391 | 9 | 50 | 1.10.10.10 |
| af_P0A8R9_1_82_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9388 | 8 | 85 | 1.10.10.10 |
| af_P77309_1_86_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9347 | 7 | 83 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N3U979-F1-model_v4 | deleted | 0.9558 | 7 | 75 |
|
| AF-A0A1Q5IPR2-F1-model_v4 | Transcriptional regulator | 0.9203 | 7 | 90 |
GO:0000976
GO:0003700 |
| AF-E8UYI9-F1-model_v4 | Regulatory protein LysR | 0.9172 | 1 | 80 |
GO:0003700
|
| AF-A0A3C1Y027-F1-model_v4 | LysR family transcriptional regulator | 0.9025 | 7 | 91 |
GO:0003700
GO:0005829 |
| AF-A0A2D7YXU8-F1-model_v4 | deleted | 0.8978 | 7 | 92 |
|