F487249

General Info

Members Datasets Scaffolds Average Seq Length
976 367 1952 258

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10079225|Ga0065704_100792254
Length 274
Sequence MKRTHLPLNGLRVLDAAARHLSFTRAADELAVTPAAVGQQIRALEDLLGVVLFRRTSKGLELTDEAAAGLDAIREGFLRFEEGVQAMQAGQSSHVYTIACPRDFFAAWFSQRLATFRAENPALRFSLVGGDGDIDFTEANLDLAVRWAEGPGELEGIPLGAPETVVVAAPGFAETSHDNSDGAWIGWPGDPVPAGDGREVAFSVGDAGTAISAAAAGLGKARVPYLLAEYILSTGRVVALGEVERGRRGYWLVAPLPQWRQKKVKALVAALAQA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
240 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
268 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
269 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
270 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
285 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
286 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
287 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
288 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
289 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
290 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
291 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
292 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
293 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
294 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
295 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
298 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
299 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
300 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
313 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
314 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
315 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
319 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
320 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
321 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
322 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
325 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
326 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
327 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
330 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
331 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
334 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
335 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
336 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
337 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
338 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
341 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
342 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
343 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
344 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
345 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
346 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
347 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
348 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
349 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
350 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
351 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
352 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
353 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
354 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
355 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
356 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
357 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
358 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
359 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
360 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
361 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
362 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
363 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
364 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
365 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
366 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
367 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.73
Nodule 0.1
Rhizoplane 4.41
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10079225 3300005289 Bacteria 4220
2 SwRhRL2b_contig_1489105 2162886007 Bacteria 7422
3 SwRhRL2b_contig_2402994 2162886007 Bacteria 55296
4 JGI24752J21851_1000048 3300001976 Bacteria 14796
5 JGI24739J22299_10000251 3300001989 Bacteria 18071
6 JGI24739J22299_10001511 3300001989 Bacteria 8783
7 JGI24739J22299_10002733 3300001989 Bacteria 6794
8 JGI24739J22299_10023091 3300001989 Bacteria 2201
9 JGI24739J22299_10027769 3300001989 Bacteria 1976
10 JGI24737J22298_10001603 3300001990 Bacteria 8047
11 JGI24737J22298_10002940 3300001990 Bacteria 6039
12 JGI24737J22298_10007027 3300001990 Bacteria 3816
13 JGI24737J22298_10013657 3300001990 Bacteria 2640
14 JGI24743J22301_10049053 3300001991 Bacteria 858
15 JGI24735J21928_10002659 3300002067 Bacteria 6178
16 JGI24735J21928_10003032 3300002067 Bacteria 5764
17 JGI24735J21928_10003729 3300002067 Bacteria 5170
18 JGI24735J21928_10010426 3300002067 Bacteria 2963
19 JGI24750J21931_1000042 3300002070 Bacteria 16868
20 JGI24750J21931_1011003 3300002070 Bacteria 1185
21 JGI24748J21848_1000063 3300002074 Bacteria 40664
22 JGI24738J21930_10000468 3300002075 Bacteria 11470
23 JGI24738J21930_10000632 3300002075 Bacteria 10141
24 JGI24738J21930_10009517 3300002075 Bacteria 2184
25 JGI24749J21850_1000252 3300002076 Bacteria 8384
26 JGI24749J21850_1000472 3300002076 Bacteria 5977
27 JGI24034J26672_10000007 3300002239 Bacteria 224370
28 JGI24742J22300_10004892 3300002244 Bacteria 2198
29 JGI24751J29686_10000046 3300002459 Bacteria 73259
30 JGI24751J29686_10000473 3300002459 Bacteria 12068
31 JGI24751J29686_10003360 3300002459 Bacteria 3227
32 JGI24751J29686_10033737 3300002459 Bacteria 1061
33 JGI25165J46597_1000112 3300003214 Bacteria 147097
34 rootH1_10346595 3300003323 Bacteria 1408
35 Ga0055536_1001242 3300003781 Bacteria 15709
36 Ga0055536_1001703 3300003781 Bacteria 13019
37 Ga0055530_10012661 3300003791 Bacteria 2927
38 Ga0065704_10000191 3300005289 Bacteria 318191
39 Ga0065704_10002210 3300005289 Bacteria 5634
40 Ga0065704_10072419 3300005289 Bacteria 8555
41 Ga0065707_10082140 3300005295 Bacteria 21029
42 Ga0065707_10114593 3300005295 Bacteria 2293
43 Ga0070658_10000089 3300005327 Bacteria 83791
44 Ga0070658_10001742 3300005327 Bacteria 18340
45 Ga0070658_10004304 3300005327 Bacteria 11636
46 Ga0070658_10016592 3300005327 Bacteria 5893
47 Ga0070658_10030940 3300005327 Bacteria 4299
48 Ga0070658_10129269 3300005327 Bacteria 2104
49 Ga0070658_10169252 3300005327 Bacteria 1835
50 Ga0070676_10000909 3300005328 Bacteria 14655
51 Ga0070690_100000110 3300005330 Bacteria 42574
52 Ga0070670_100000006 3300005331 Bacteria 319420
53 Ga0070670_100000068 3300005331 Bacteria 106494
54 Ga0070670_100004402 3300005331 Bacteria 11793
55 Ga0070670_100011758 3300005331 Bacteria 7487
56 Ga0070670_100017184 3300005331 Bacteria 6205
57 Ga0070670_100054238 3300005331 Bacteria 3441
58 Ga0068869_100004212 3300005334 Bacteria 8929
59 Ga0070666_10000068 3300005335 Bacteria 76194
60 Ga0070666_10000417 3300005335 Bacteria 26409
61 Ga0070666_10003859 3300005335 Bacteria 9097
62 Ga0070666_10027816 3300005335 Bacteria 3706
63 Ga0070666_10214903 3300005335 Bacteria 1355
64 Ga0070680_100007674 3300005336 Bacteria 8231
65 Ga0068868_100000023 3300005338 Bacteria 85334
66 Ga0070660_100000916 3300005339 Bacteria 19719
67 Ga0070660_100004613 3300005339 Bacteria 9537
68 Ga0070660_100014971 3300005339 Bacteria 5594
69 Ga0070660_100023922 3300005339 Bacteria 4530
70 Ga0070660_100048126 3300005339 Bacteria 3274
71 Ga0070660_100054117 3300005339 Bacteria 3098
72 Ga0070660_100563887 3300005339 Bacteria 950
73 Ga0070661_100008440 3300005344 Bacteria 7122
74 Ga0070661_100272667 3300005344 Bacteria 1311
75 Ga0070661_100527374 3300005344 Bacteria 948
76 Ga0070692_10148947 3300005345 Bacteria 1331
77 Ga0070668_100000026 3300005347 Bacteria 92584
78 Ga0070668_100002833 3300005347 Bacteria 12778
79 Ga0070668_100007337 3300005347 Bacteria 8177
80 Ga0070668_100010222 3300005347 Bacteria 6962
81 Ga0070668_100023436 3300005347 Bacteria 4669
82 Ga0070668_100023648 3300005347 Bacteria 4649
83 Ga0070668_100039261 3300005347 Bacteria 3621
84 Ga0070668_100136399 3300005347 Bacteria 1974
85 Ga0070668_100264567 3300005347 Bacteria 1431
86 Ga0070668_100433211 3300005347 Bacteria 1127
87 Ga0070669_100000018 3300005353 Bacteria 195789
88 Ga0070669_100000083 3300005353 Bacteria 91096
89 Ga0070669_100000102 3300005353 Bacteria 82010
90 Ga0070669_100000193 3300005353 Bacteria 53850
91 Ga0070669_100000332 3300005353 Bacteria 36750
92 Ga0070669_100064196 3300005353 Bacteria 2704
93 Ga0070669_100407873 3300005353 Bacteria 1113
94 Ga0070671_100000011 3300005355 Bacteria 202057
95 Ga0070671_100000107 3300005355 Bacteria 52884
96 Ga0070671_100000266 3300005355 Bacteria 35281
97 Ga0070671_100001068 3300005355 Bacteria 20213
98 Ga0070671_100020174 3300005355 Bacteria 5432
99 Ga0070671_100048676 3300005355 Bacteria 3526
100 Ga0070671_100055799 3300005355 Bacteria 3287
101 Ga0070671_100273701 3300005355 Bacteria 1435
102 Ga0070674_100144483 3300005356 Bacteria 1789
103 Ga0070673_100000001 3300005364 Bacteria 239842
104 Ga0070688_100002132 3300005365 Bacteria 9972
105 Ga0070659_100043766 3300005366 Bacteria 3503
106 Ga0070659_100084366 3300005366 Bacteria 2540
107 Ga0070659_100228119 3300005366 Bacteria 1539
108 Ga0070667_100000019 3300005367 Bacteria 224710
109 Ga0070667_100000098 3300005367 Bacteria 108706
110 Ga0070667_100001002 3300005367 Bacteria 25860
111 Ga0070667_100004151 3300005367 Bacteria 12245
112 Ga0070667_100004153 3300005367 Bacteria 12243
113 Ga0070667_100005317 3300005367 Bacteria 10754
114 Ga0070667_100009896 3300005367 Bacteria 7904
115 Ga0070667_100048771 3300005367 Bacteria 3565
116 Ga0070667_100118697 3300005367 Bacteria 2299
117 Ga0070663_100024996 3300005455 Bacteria 4028
118 Ga0070663_100045390 3300005455 Bacteria 3104
119 Ga0070663_100134867 3300005455 Bacteria 1879
120 Ga0070678_100029355 3300005456 Bacteria 3764
121 Ga0070678_100194887 3300005456 Bacteria 1668
122 Ga0070662_100000887 3300005457 Bacteria 18289
123 Ga0070662_100009685 3300005457 Bacteria 6303
124 Ga0070662_100190414 3300005457 Bacteria 1622
125 Ga0070662_100229419 3300005457 Bacteria 1485
126 Ga0070662_100266757 3300005457 Bacteria 1381
127 Ga0070681_10004470 3300005458 Bacteria 13326
128 Ga0068867_100000027 3300005459 Bacteria 90445
129 Ga0070685_10000036 3300005466 Bacteria 80641
130 Ga0070707_100182464 3300005468 Bacteria 2046
131 Ga0070679_100012621 3300005530 Bacteria 8080
132 Ga0070679_100022533 3300005530 Bacteria 6157
133 Ga0070679_100030802 3300005530 Bacteria 5299
134 Ga0070679_100612007 3300005530 Bacteria 1032
135 Ga0070684_100023818 3300005535 Bacteria 5128
136 Ga0068853_100004246 3300005539 Bacteria 11067
137 Ga0068853_100017555 3300005539 Bacteria 5906
138 Ga0068853_100042359 3300005539 Bacteria 3892
139 Ga0068853_100597048 3300005539 Bacteria 1048
140 Ga0070672_100088116 3300005543 Bacteria 2499
141 Ga0070686_100000045 3300005544 Bacteria 101988
142 Ga0070686_100071892 3300005544 Bacteria 2266
143 Ga0070665_100000042 3300005548 Bacteria 292582
144 Ga0070665_100000269 3300005548 Bacteria 85401
145 Ga0070665_100037764 3300005548 Bacteria 4855
146 Ga0070665_100057760 3300005548 Bacteria 3890
147 Ga0070665_100065726 3300005548 Bacteria 3638
148 Ga0070665_100088255 3300005548 Bacteria 3107
149 Ga0070665_100112938 3300005548 Bacteria 2719
150 Ga0070665_100194116 3300005548 Bacteria 2031
151 Ga0068855_100000092 3300005563 Bacteria 107195
152 Ga0068855_100010472 3300005563 Bacteria 11188
153 Ga0068855_100024314 3300005563 Bacteria 7252
154 Ga0068855_100038768 3300005563 Bacteria 5660
155 Ga0068855_100044343 3300005563 Bacteria 5263
156 Ga0068855_100056220 3300005563 Bacteria 4618
157 Ga0068855_100117473 3300005563 Bacteria 3047
158 Ga0070664_100120328 3300005564 Bacteria 2298
159 Ga0068857_100012124 3300005577 Bacteria 7497
160 Ga0068857_100017141 3300005577 Bacteria 6345
161 Ga0068857_100112698 3300005577 Bacteria 2445
162 Ga0068857_100345836 3300005577 Bacteria 1376
163 Ga0068857_100566885 3300005577 Bacteria 1071
164 Ga0068854_100000684 3300005578 Bacteria 20204
165 Ga0068854_100010675 3300005578 Bacteria 5962
166 Ga0068854_100013424 3300005578 Bacteria 5377
167 Ga0068854_100018762 3300005578 Bacteria 4649
168 Ga0068854_100044644 3300005578 Bacteria 3147
169 Ga0068854_100130588 3300005578 Bacteria 1918
170 Ga0068854_100273112 3300005578 Bacteria 1358
171 Ga0068854_100456003 3300005578 Bacteria 1069
172 Ga0068856_100014407 3300005614 Bacteria 7641
173 Ga0068856_100028654 3300005614 Bacteria 5440
174 Ga0068856_100029700 3300005614 Bacteria 5340
175 Ga0068856_100040569 3300005614 Bacteria 4573
176 Ga0068856_100480172 3300005614 Bacteria 1264
177 Ga0068852_100002388 3300005616 Bacteria 12937
178 Ga0068852_100008366 3300005616 Bacteria 7623
179 Ga0068852_100038495 3300005616 Bacteria 4020
180 Ga0068852_100121455 3300005616 Bacteria 2393
181 Ga0068852_100214724 3300005616 Bacteria 1827
182 Ga0068852_100247162 3300005616 Bacteria 1708
183 Ga0068852_100256372 3300005616 Bacteria 1678
184 Ga0068859_100006602 3300005617 Bacteria 11776
185 Ga0068859_100007283 3300005617 Bacteria 11222
186 Ga0068859_100009002 3300005617 Bacteria 10084
187 Ga0068859_100010776 3300005617 Bacteria 9202
188 Ga0068859_100039024 3300005617 Bacteria 4762
189 Ga0068859_100039829 3300005617 Bacteria 4716
190 Ga0068859_100358142 3300005617 Bacteria 1554
191 Ga0068859_100574468 3300005617 Bacteria 1221
192 Ga0068864_100000014 3300005618 Bacteria 308927
193 Ga0068864_100000019 3300005618 Bacteria 271650
194 Ga0068864_100001740 3300005618 Bacteria 17896
195 Ga0068864_100007768 3300005618 Bacteria 8838
196 Ga0068864_100018289 3300005618 Bacteria 5853
197 Ga0068864_100018652 3300005618 Bacteria 5798
198 Ga0068864_100020326 3300005618 Bacteria 5554
199 Ga0068864_100104581 3300005618 Bacteria 2515
200 Ga0068866_10206302 3300005718 Bacteria 1177
201 Ga0068861_100006194 3300005719 Bacteria 8142
202 Ga0068861_100009141 3300005719 Bacteria 6835
203 Ga0068861_100028058 3300005719 Bacteria 4105
204 Ga0068861_100054223 3300005719 Bacteria 3053
205 Ga0068851_10059906 3300005834 Bacteria 1948
206 Ga0068851_10259249 3300005834 Bacteria 988
207 Ga0068863_100000015 3300005841 Bacteria 214824
208 Ga0068863_100000138 3300005841 Bacteria 77596
209 Ga0068863_100000280 3300005841 Bacteria 52729
210 Ga0068863_100002835 3300005841 Bacteria 17168
211 Ga0068863_100003685 3300005841 Bacteria 15137
212 Ga0068863_100003927 3300005841 Bacteria 14689
213 Ga0068863_100004738 3300005841 Bacteria 13405
214 Ga0068863_100012255 3300005841 Bacteria 8278
215 Ga0068863_100050813 3300005841 Bacteria 3929
216 Ga0068863_100150305 3300005841 Bacteria 2228
217 Ga0068863_100568864 3300005841 Bacteria 1120
218 Ga0068858_100003226 3300005842 Bacteria 16280
219 Ga0068858_100005917 3300005842 Bacteria 11936
220 Ga0068858_100006381 3300005842 Bacteria 11489
221 Ga0068858_100007900 3300005842 Bacteria 10254
222 Ga0068858_100045666 3300005842 Bacteria 4060
223 Ga0068858_100220756 3300005842 Bacteria 1795
224 Ga0068860_100000028 3300005843 Bacteria 266461
225 Ga0068860_100000036 3300005843 Bacteria 234917
226 Ga0068860_100000164 3300005843 Bacteria 108706
227 Ga0068860_100000182 3300005843 Bacteria 100888
228 Ga0068860_100006964 3300005843 Bacteria 11334
229 Ga0068860_100014112 3300005843 Bacteria 7835
230 Ga0068860_100019551 3300005843 Bacteria 6566
231 Ga0068860_100039405 3300005843 Bacteria 4519
232 Ga0068860_100086950 3300005843 Bacteria 2975
233 Ga0068862_100000007 3300005844 Bacteria 313933
234 Ga0068862_100000067 3300005844 Bacteria 123668
235 Ga0068862_100000094 3300005844 Bacteria 106159
236 Ga0068862_100000308 3300005844 Bacteria 53687
237 Ga0068862_100000543 3300005844 Bacteria 39504
238 Ga0068862_100002528 3300005844 Bacteria 16189
239 Ga0068862_100006100 3300005844 Bacteria 10033
240 Ga0068862_100010416 3300005844 Bacteria 7676
241 Ga0075368_10000033 3300006042 Bacteria 32184
242 Ga0075368_10000095 3300006042 Bacteria 22249
243 Ga0075363_100001584 3300006048 Bacteria 8748
244 Ga0075364_10003212 3300006051 Bacteria 9267
245 Ga0075362_10000054 3300006177 Bacteria 37332
246 Ga0075362_10000265 3300006177 Bacteria 14605
247 Ga0075367_10001701 3300006178 Bacteria 9616
248 Ga0075369_10000150 3300006186 Bacteria 19561
249 Ga0075366_10000376 3300006195 Bacteria 20753
250 Ga0075366_10016501 3300006195 Bacteria 4247
251 Ga0075366_10033312 3300006195 Bacteria 3034
252 Ga0075366_10069306 3300006195 Bacteria 2099
253 Ga0075366_10358444 3300006195 Bacteria 896
254 Ga0097621_100281049 3300006237 Bacteria 1465
255 Ga0075370_10000018 3300006353 Bacteria 59800
256 Ga0075370_10001563 3300006353 Bacteria 10048
257 Ga0075370_10001922 3300006353 Bacteria 9359
258 Ga0075370_10067685 3300006353 Bacteria 2039
259 Ga0075370_10072304 3300006353 Bacteria 1974
260 Ga0068871_100197641 3300006358 Bacteria 1735
261 Ga0068865_100000030 3300006881 Bacteria 88854
262 Ga0097620_100006602 3300006931 Bacteria 11776
263 Ga0097620_100007283 3300006931 Bacteria 11222
264 Ga0097620_100009002 3300006931 Bacteria 10084
265 Ga0097620_100010776 3300006931 Bacteria 9202
266 Ga0097620_100039023 3300006931 Bacteria 4762
267 Ga0097620_100039829 3300006931 Bacteria 4716
268 Ga0097620_100358177 3300006931 Bacteria 1554
269 Ga0097620_100574479 3300006931 Bacteria 1221
270 Ga0079104_1011365 3300006946 Bacteria 2866
271 Ga0075435_100548087 3300007076 Bacteria 1001
272 Ga0105251_10000853 3300009011 Bacteria 27320
273 Ga0105251_10002316 3300009011 Bacteria 15078
274 Ga0105250_10063100 3300009092 Bacteria 1491
275 Ga0105240_10007666 3300009093 Bacteria 15628
276 Ga0105240_10015794 3300009093 Bacteria 10244
277 Ga0105240_10026155 3300009093 Bacteria 7658
278 Ga0105240_10042646 3300009093 Bacteria 5781
279 Ga0105240_10048773 3300009093 Bacteria 5350
280 Ga0105240_10886414 3300009093 Bacteria 961
281 Ga0105245_10003967 3300009098 Bacteria 13153
282 Ga0105247_10003627 3300009101 Bacteria 10024
283 Ga0105247_10006168 3300009101 Bacteria 7439
284 Ga0105247_10031044 3300009101 Bacteria 3241
285 Ga0105247_10041519 3300009101 Bacteria 2816
286 Ga0114129_10128773 3300009147 Bacteria 3478
287 Ga0105243_10000389 3300009148 Bacteria 46747
288 Ga0105241_10120389 3300009174 Bacteria 2113
289 Ga0105242_10016891 3300009176 Bacteria 5680
290 Ga0105248_10000311 3300009177 Bacteria 57870
291 Ga0105248_10000651 3300009177 Bacteria 39450
292 Ga0105248_10003293 3300009177 Bacteria 17921
293 Ga0105248_10021266 3300009177 Bacteria 7189
294 Ga0105248_10048979 3300009177 Bacteria 4739
295 Ga0105248_10060981 3300009177 Bacteria 4234
296 Ga0105248_10083782 3300009177 Bacteria 3586
297 Ga0105248_10088933 3300009177 Bacteria 3476
298 Ga0105248_10103354 3300009177 Bacteria 3211
299 Ga0105248_10250096 3300009177 Bacteria 1995
300 Ga0105237_10009418 3300009545 Bacteria 10463
301 Ga0105237_10031194 3300009545 Bacteria 5406
302 Ga0105237_10495230 3300009545 Bacteria 1229
303 Ga0105238_10040689 3300009551 Bacteria 4709
304 Ga0105238_10161361 3300009551 Bacteria 2217
305 Ga0105238_10374791 3300009551 Bacteria 1414
306 Ga0105238_10379805 3300009551 Bacteria 1404
307 Ga0105249_10000012 3300009553 Bacteria 292640
308 Ga0105249_10000105 3300009553 Bacteria 117181
309 Ga0105249_10000568 3300009553 Bacteria 33920
310 Ga0105249_10003294 3300009553 Bacteria 13998
311 Ga0105249_10015137 3300009553 Bacteria 6825
312 Ga0105239_10000183 3300010375 Bacteria 91439
313 Ga0105246_10000730 3300011119 Bacteria 18634
314 Ga0105246_10017619 3300011119 Bacteria 4543
315 Ga0157373_10012241 3300013100 Bacteria 6307
316 Ga0157373_10045323 3300013100 Bacteria 3139
317 Ga0157373_10158932 3300013100 Bacteria 1590
318 Ga0157371_10002824 3300013102 Bacteria 16252
319 Ga0157371_10029859 3300013102 Bacteria 3936
320 Ga0157371_10070962 3300013102 Bacteria 2466
321 Ga0157370_10013144 3300013104 Bacteria 8539
322 Ga0157370_10097070 3300013104 Bacteria 2764
323 Ga0157369_10003242 3300013105 Bacteria 19373
324 Ga0157369_10013185 3300013105 Bacteria 9354
325 Ga0157369_10031631 3300013105 Bacteria 5825
326 Ga0157369_10255826 3300013105 Bacteria 1827
327 Ga0157374_10025842 3300013296 Bacteria 5278
328 Ga0157378_10038350 3300013297 Bacteria 4246
329 Ga0163162_10008723 3300013306 Bacteria 9865
330 Ga0157372_10011931 3300013307 Bacteria 9259
331 Ga0157372_10065914 3300013307 Bacteria 4068
332 Ga0157372_10074192 3300013307 Bacteria 3836
333 Ga0157372_10126062 3300013307 Bacteria 2944
334 Ga0157372_10217553 3300013307 Bacteria 2214
335 Ga0157372_10578941 3300013307 Bacteria 1308
336 Ga0157375_10000776 3300013308 Bacteria 28021
337 Ga0157375_10828136 3300013308 Bacteria 1073
338 Ga0163163_10067350 3300014325 Bacteria 3560
339 Ga0163163_10233366 3300014325 Bacteria 1889
340 Ga0163163_10577781 3300014325 Bacteria 1187
341 Ga0157380_10000014 3300014326 Bacteria 130737
342 Ga0157380_10000151 3300014326 Bacteria 39765
343 Ga0157380_10003723 3300014326 Bacteria 10487
344 Ga0157377_10066200 3300014745 Bacteria 2077
345 Ga0157379_10062412 3300014968 Bacteria 3333
346 Ga0157376_10000145 3300014969 Bacteria 48872
347 Ga0163161_10000202 3300017792 Bacteria 54518
348 Ga0163161_10012008 3300017792 Bacteria 6010
349 Ga0163161_10085572 3300017792 Bacteria 2326
350 Ga0207672_1000690 3300025223 Bacteria 3889
351 Ga0207427_100820 3300025231 Bacteria 14004
352 Ga0209026_1003814 3300025250 Bacteria 4759
353 Ga0209148_1000133 3300025254 Bacteria 171351
354 Ga0209233_1000078 3300025261 Bacteria 348118
355 Ga0209455_1000592 3300025272 Bacteria 23349
356 Ga0209676_1008949 3300025292 Bacteria 4394
357 Ga0209676_1048247 3300025292 Bacteria 1139
358 Ga0209050_1001308 3300025298 Bacteria 27984
359 Ga0209257_1000987 3300025304 Bacteria 38577
360 Ga0207697_10000184 3300025315 Bacteria 32509
361 Ga0207713_1002057 3300025735 Bacteria 15050
362 Ga0207713_1002657 3300025735 Bacteria 12826
363 Ga0207713_1044565 3300025735 Bacteria 1821
364 Ga0207710_10006133 3300025900 Bacteria 5147
365 Ga0207710_10022311 3300025900 Bacteria 2717
366 Ga0207710_10036560 3300025900 Bacteria 2165
367 Ga0207680_10000012 3300025903 Bacteria 293810
368 Ga0207680_10002312 3300025903 Bacteria 8878
369 Ga0207680_10012031 3300025903 Bacteria 4397
370 Ga0207680_10075062 3300025903 Bacteria 2108
371 Ga0207680_10130668 3300025903 Bacteria 1655
372 Ga0207647_10000293 3300025904 Bacteria 40991
373 Ga0207647_10000789 3300025904 Bacteria 24590
374 Ga0207647_10015957 3300025904 Bacteria 5135
375 Ga0207647_10026801 3300025904 Bacteria 3765
376 Ga0207645_10002416 3300025907 Bacteria 14712
377 Ga0207645_10103028 3300025907 Bacteria 1842
378 Ga0207705_10000009 3300025909 Bacteria 576128
379 Ga0207705_10000018 3300025909 Bacteria 319792
380 Ga0207705_10000140 3300025909 Bacteria 78223
381 Ga0207705_10000468 3300025909 Bacteria 34564
382 Ga0207705_10002762 3300025909 Bacteria 13421
383 Ga0207705_10051777 3300025909 Bacteria 2955
384 Ga0207705_10055151 3300025909 Bacteria 2865
385 Ga0207705_10118671 3300025909 Bacteria 1961
386 Ga0207654_10001661 3300025911 Bacteria 11622
387 Ga0207707_10136464 3300025912 Bacteria 2145
388 Ga0207695_10000641 3300025913 Bacteria 69705
389 Ga0207695_10006576 3300025913 Bacteria 15034
390 Ga0207695_10012328 3300025913 Bacteria 10269
391 Ga0207695_10036598 3300025913 Bacteria 5304
392 Ga0207695_10041984 3300025913 Bacteria 4890
393 Ga0207671_10002738 3300025914 Bacteria 18433
394 Ga0207671_10042781 3300025914 Bacteria 3352
395 Ga0207671_10394088 3300025914 Bacteria 1101
396 Ga0207660_10006580 3300025917 Bacteria 7544
397 Ga0207657_10001013 3300025919 Bacteria 29888
398 Ga0207657_10025295 3300025919 Bacteria 5477
399 Ga0207657_10027635 3300025919 Bacteria 5193
400 Ga0207657_10066223 3300025919 Bacteria 3076
401 Ga0207657_10080800 3300025919 Bacteria 2732
402 Ga0207649_10018237 3300025920 Bacteria 3987
403 Ga0207652_10010744 3300025921 Bacteria 7371
404 Ga0207652_10028408 3300025921 Bacteria 4667
405 Ga0207681_10000001 3300025923 Bacteria 1105841
406 Ga0207681_10000008 3300025923 Bacteria 414329
407 Ga0207681_10000060 3300025923 Bacteria 102672
408 Ga0207681_10000076 3300025923 Bacteria 89353
409 Ga0207681_10000176 3300025923 Bacteria 52358
410 Ga0207681_10045165 3300025923 Bacteria 2957
411 Ga0207681_10269809 3300025923 Bacteria 1335
412 Ga0207681_10293069 3300025923 Bacteria 1285
413 Ga0207681_10309369 3300025923 Bacteria 1253
414 Ga0207694_10001461 3300025924 Bacteria 20212
415 Ga0207694_10039785 3300025924 Bacteria 3619
416 Ga0207650_10000023 3300025925 Bacteria 308148
417 Ga0207650_10000054 3300025925 Bacteria 162602
418 Ga0207650_10000657 3300025925 Bacteria 27265
419 Ga0207650_10057574 3300025925 Bacteria 2891
420 Ga0207650_10133041 3300025925 Bacteria 1948
421 Ga0207687_10002491 3300025927 Bacteria 12497
422 Ga0207644_10000004 3300025931 Bacteria 566613
423 Ga0207644_10000006 3300025931 Bacteria 408793
424 Ga0207644_10000067 3300025931 Bacteria 76116
425 Ga0207644_10002492 3300025931 Bacteria 11852
426 Ga0207644_10013127 3300025931 Bacteria 5514
427 Ga0207644_10032632 3300025931 Bacteria 3634
428 Ga0207644_10060614 3300025931 Bacteria 2738
429 Ga0207644_10146333 3300025931 Bacteria 1824
430 Ga0207690_10029576 3300025932 Bacteria 3485
431 Ga0207690_10125628 3300025932 Bacteria 1870
432 Ga0207690_10187264 3300025932 Bacteria 1563
433 Ga0207690_10210726 3300025932 Bacteria 1481
434 Ga0207690_10271229 3300025932 Bacteria 1318
435 Ga0207706_10000554 3300025933 Bacteria 39755
436 Ga0207706_10003511 3300025933 Bacteria 14975
437 Ga0207706_10014020 3300025933 Bacteria 7267
438 Ga0207706_10017119 3300025933 Bacteria 6536
439 Ga0207706_10018187 3300025933 Bacteria 6322
440 Ga0207706_10106441 3300025933 Bacteria 2468
441 Ga0207706_10355218 3300025933 Bacteria 1274
442 Ga0207686_10002215 3300025934 Bacteria 10686
443 Ga0207709_10000203 3300025935 Bacteria 77491
444 Ga0207670_10087894 3300025936 Bacteria 2191
445 Ga0207704_10000032 3300025938 Bacteria 108408
446 Ga0207691_10074908 3300025940 Bacteria 3052
447 Ga0207711_10000017 3300025941 Bacteria 441730
448 Ga0207711_10002909 3300025941 Bacteria 15006
449 Ga0207711_10007104 3300025941 Bacteria 9380
450 Ga0207711_10028990 3300025941 Bacteria 4665
451 Ga0207711_10068532 3300025941 Bacteria 3073
452 Ga0207711_10115399 3300025941 Bacteria 2393
453 Ga0207711_10216704 3300025941 Bacteria 1750
454 Ga0207711_10326683 3300025941 Bacteria 1418
455 Ga0207689_10000108 3300025942 Bacteria 68132
456 Ga0207661_10117279 3300025944 Bacteria 2261
457 Ga0207679_10195064 3300025945 Bacteria 1687
458 Ga0207679_10489509 3300025945 Bacteria 1096
459 Ga0207667_10000013 3300025949 Bacteria 435875
460 Ga0207667_10004663 3300025949 Bacteria 16793
461 Ga0207667_10006842 3300025949 Bacteria 13779
462 Ga0207667_10017750 3300025949 Bacteria 8002
463 Ga0207667_10069701 3300025949 Bacteria 3660
464 Ga0207667_10069703 3300025949 Bacteria 3660
465 Ga0207667_10125810 3300025949 Bacteria 2640
466 Ga0207667_10144188 3300025949 Bacteria 2452
467 Ga0207667_10672478 3300025949 Bacteria 1039
468 Ga0207651_10000001 3300025960 Bacteria 516823
469 Ga0207712_10000015 3300025961 Bacteria 346689
470 Ga0207712_10000021 3300025961 Bacteria 292649
471 Ga0207712_10000163 3300025961 Bacteria 68522
472 Ga0207712_10006075 3300025961 Bacteria 7623
473 Ga0207712_10077855 3300025961 Bacteria 2405
474 Ga0207668_10000081 3300025972 Bacteria 72145
475 Ga0207668_10000706 3300025972 Bacteria 20420
476 Ga0207668_10079196 3300025972 Bacteria 2376
477 Ga0207668_10117830 3300025972 Bacteria 2005
478 Ga0207668_10129130 3300025972 Bacteria 1927
479 Ga0207668_10387276 3300025972 Bacteria 1178
480 Ga0207668_10500130 3300025972 Bacteria 1045
481 Ga0207640_10000050 3300025981 Bacteria 96203
482 Ga0207640_10004057 3300025981 Bacteria 7912
483 Ga0207640_10006582 3300025981 Bacteria 6378
484 Ga0207640_10043702 3300025981 Bacteria 2865
485 Ga0207640_10077581 3300025981 Bacteria 2259
486 Ga0207640_10105407 3300025981 Bacteria 1987
487 Ga0207640_10145707 3300025981 Bacteria 1732
488 Ga0207658_10000002 3300025986 Bacteria 1364188
489 Ga0207658_10000196 3300025986 Bacteria 63933
490 Ga0207658_10000223 3300025986 Bacteria 59510
491 Ga0207658_10001629 3300025986 Bacteria 17221
492 Ga0207658_10004644 3300025986 Bacteria 9522
493 Ga0207658_10006781 3300025986 Bacteria 7799
494 Ga0207658_10027929 3300025986 Bacteria 3969
495 Ga0207658_10049470 3300025986 Bacteria 3089
496 Ga0207658_10151211 3300025986 Bacteria 1891
497 Ga0207677_10000214 3300026023 Bacteria 46317
498 Ga0207703_10007829 3300026035 Bacteria 8451
499 Ga0207703_10012705 3300026035 Bacteria 6565
500 Ga0207703_10022029 3300026035 Bacteria 4991
501 Ga0207703_10027135 3300026035 Bacteria 4510
502 Ga0207703_10327271 3300026035 Bacteria 1405
503 Ga0207639_10001919 3300026041 Bacteria 13963
504 Ga0207639_10007281 3300026041 Bacteria 7537
505 Ga0207639_10029801 3300026041 Bacteria 3999
506 Ga0207639_10033617 3300026041 Bacteria 3784
507 Ga0207639_10140035 3300026041 Bacteria 2014
508 Ga0207639_10361804 3300026041 Bacteria 1298
509 Ga0207639_10463823 3300026041 Bacteria 1152
510 Ga0207678_10003417 3300026067 Bacteria 14294
511 Ga0207678_10005375 3300026067 Bacteria 11472
512 Ga0207678_10046697 3300026067 Bacteria 3745
513 Ga0207678_10073264 3300026067 Bacteria 2935
514 Ga0207678_10436419 3300026067 Bacteria 1137
515 Ga0207678_10439874 3300026067 Bacteria 1132
516 Ga0207702_10002016 3300026078 Bacteria 19681
517 Ga0207702_10002082 3300026078 Bacteria 19328
518 Ga0207702_10008254 3300026078 Bacteria 8801
519 Ga0207702_10038451 3300026078 Bacteria 4007
520 Ga0207702_10284530 3300026078 Bacteria 1564
521 Ga0207702_10751777 3300026078 Bacteria 962
522 Ga0207641_10000008 3300026088 Bacteria 424415
523 Ga0207641_10000195 3300026088 Bacteria 82043
524 Ga0207641_10000414 3300026088 Bacteria 49835
525 Ga0207641_10000657 3300026088 Bacteria 37717
526 Ga0207641_10002967 3300026088 Bacteria 15351
527 Ga0207641_10012207 3300026088 Bacteria 7050
528 Ga0207641_10016785 3300026088 Bacteria 5995
529 Ga0207641_10080470 3300026088 Bacteria 2826
530 Ga0207641_10089559 3300026088 Bacteria 2689
531 Ga0207641_10130432 3300026088 Bacteria 2256
532 Ga0207641_10964004 3300026088 Bacteria 849
533 Ga0207648_10000073 3300026089 Bacteria 94751
534 Ga0207676_10000017 3300026095 Bacteria 308709
535 Ga0207676_10000019 3300026095 Bacteria 305653
536 Ga0207676_10003099 3300026095 Bacteria 11861
537 Ga0207676_10004129 3300026095 Bacteria 10252
538 Ga0207676_10009609 3300026095 Bacteria 6885
539 Ga0207676_10011403 3300026095 Bacteria 6352
540 Ga0207676_10415560 3300026095 Bacteria 1260
541 Ga0207674_10019146 3300026116 Bacteria 7421
542 Ga0207674_10036832 3300026116 Bacteria 5092
543 Ga0207674_10041562 3300026116 Bacteria 4753
544 Ga0207674_10047233 3300026116 Bacteria 4415
545 Ga0207674_10103694 3300026116 Bacteria 2823
546 Ga0207674_10307026 3300026116 Bacteria 1536
547 Ga0207675_100000227 3300026118 Bacteria 53090
548 Ga0207675_100000341 3300026118 Bacteria 44495
549 Ga0207675_100025073 3300026118 Bacteria 5550
550 Ga0207683_10053845 3300026121 Bacteria 3529
551 Ga0207698_10000541 3300026142 Bacteria 21921
552 Ga0207698_10010737 3300026142 Bacteria 5907
553 Ga0207698_10040877 3300026142 Bacteria 3451
554 Ga0207698_10041529 3300026142 Bacteria 3428
555 Ga0207698_10134591 3300026142 Bacteria 2118
556 Ga0207698_10158087 3300026142 Bacteria 1978
557 Ga0207698_10162666 3300026142 Bacteria 1954
558 Ga0207698_10191798 3300026142 Bacteria 1821
559 Ga0207698_10221442 3300026142 Bacteria 1710
560 Ga0207698_10264605 3300026142 Bacteria 1582
561 Ga0207698_10272570 3300026142 Bacteria 1561
562 Ga0207698_10467386 3300026142 Bacteria 1221
563 Ga0209813_10000013 3300027866 Bacteria 89768
564 Ga0268266_10000054 3300028379 Bacteria 292717
565 Ga0268266_10000334 3300028379 Bacteria 73724
566 Ga0268266_10012828 3300028379 Bacteria 7235
567 Ga0268266_10020141 3300028379 Bacteria 5686
568 Ga0268266_10048874 3300028379 Bacteria 3626
569 Ga0268266_10083699 3300028379 Bacteria 2785
570 Ga0268266_10103047 3300028379 Bacteria 2518
571 Ga0268266_10234301 3300028379 Bacteria 1692
572 Ga0268265_10000002 3300028380 Bacteria 1035381
573 Ga0268265_10000011 3300028380 Bacteria 343832
574 Ga0268265_10000021 3300028380 Bacteria 272292
575 Ga0268265_10000433 3300028380 Bacteria 44275
576 Ga0268265_10001980 3300028380 Bacteria 16210
577 Ga0268265_10004916 3300028380 Bacteria 9189
578 Ga0268265_10005892 3300028380 Bacteria 8351
579 Ga0268265_10063534 3300028380 Bacteria 2840
580 Ga0268264_10000001 3300028381 Bacteria 1221000
581 Ga0268264_10000010 3300028381 Bacteria 596543
582 Ga0268264_10000066 3300028381 Bacteria 285125
583 Ga0268264_10000074 3300028381 Bacteria 259555
584 Ga0268264_10000228 3300028381 Bacteria 108722
585 Ga0268264_10003652 3300028381 Bacteria 13230
586 Ga0268264_10018854 3300028381 Bacteria 5641
587 Ga0268264_10021334 3300028381 Bacteria 5289
588 Ga0268264_10027561 3300028381 Bacteria 4644
589 Ga0268264_10041094 3300028381 Bacteria 3823
590 Ga0268264_10338754 3300028381 Bacteria 1428
591 Ga0268264_10424034 3300028381 Bacteria 1284
592 Ga0265331_10146796 3300031250 Bacteria 1071
593 Ga0307513_10079230 3300031456 Bacteria 3395
594 Ga0307408_100005065 3300031548 Bacteria 8843
595 Ga0307408_100049229 3300031548 Bacteria 3026
596 Ga0307408_100064439 3300031548 Bacteria 2684
597 Ga0307408_100159006 3300031548 Bacteria 1792
598 Ga0307408_100226455 3300031548 Bacteria 1529
599 Ga0307508_10167737 3300031616 Bacteria 1799
600 Ga0316579_10145580 3300031691 Bacteria 1142
601 Ga0307516_10139362 3300031730 Bacteria 2197
602 Ga0307405_10004121 3300031731 Bacteria 6829
603 Ga0307405_10060786 3300031731 Bacteria 2385
604 Ga0307405_10209361 3300031731 Bacteria 1422
605 Ga0307405_10338884 3300031731 Bacteria 1155
606 Ga0307413_10011789 3300031824 Bacteria 4317
607 Ga0307413_10096814 3300031824 Bacteria 1938
608 Ga0307410_10221593 3300031852 Bacteria 1455
609 Ga0307412_10000453 3300031911 Bacteria 24741
610 Ga0307412_10009214 3300031911 Bacteria 5658
611 Ga0307412_10012078 3300031911 Bacteria 5021
612 Ga0307412_10045512 3300031911 Bacteria 2869
613 Ga0307412_10249572 3300031911 Bacteria 1377
614 Ga0307412_10659606 3300031911 Bacteria 893
615 Ga0307409_100054392 3300031995 Bacteria 3082
616 Ga0307409_100626795 3300031995 Bacteria 1066
617 Ga0307416_100073601 3300032002 Bacteria 2849
618 Ga0307416_100090147 3300032002 Bacteria 2628
619 Ga0307416_100320071 3300032002 Bacteria 1552
620 Ga0307416_100717436 3300032002 Bacteria 1090
621 Ga0307416_100767007 3300032002 Bacteria 1058
622 Ga0307414_10000248 3300032004 Bacteria 33977
623 Ga0307414_10001322 3300032004 Bacteria 12801
624 Ga0307414_10046944 3300032004 Bacteria 2969
625 Ga0307411_10020048 3300032005 Bacteria 3879
626 Ga0307411_10334890 3300032005 Bacteria 1228
627 Ga0307411_10494636 3300032005 Bacteria 1033
628 Ga0307415_100306820 3300032126 Bacteria 1317
629 Ga0316583_10005084 3300032133 Bacteria 4709
630 Ga0373943_0113108 3300035170 Bacteria 1434
631 Ga0373931_0030223 3300035691 Bacteria 2788
632 Ga0316582_0001383 3300036647 Bacteria 10561
633 Ga0395899_0014090 3300037312 Bacteria 6104
634 Ga0395900_0360006 3300037418 Bacteria 1426
635 Ga0395905_0118962 3300037471 Bacteria 2483
636 Ga0395901_0379831 3300038443 Bacteria 1454
637 Ga0237819_00867 3300038705 Bacteria 9511
638 Ga0451802_1385565 3300041460 Bacteria 3103
639 Ga0439448_0000324 3300042005 Bacteria 10592
640 Ga0439448_0007182 3300042005 Bacteria 3220
641 Ga0439448_0010488 3300042005 Bacteria 2750
642 Ga0439448_0043183 3300042005 Bacteria 1463
643 Ga0439455_0000320 3300042012 Bacteria 6073
644 Ga0439455_0006017 3300042012 Bacteria 2495
645 Ga0439458_0000018 3300042157 Bacteria 26069
646 Ga0439458_0001408 3300042157 Bacteria 6066
647 Ga0439435_0011236 3300042436 Bacteria 2145
648 Ga0466966_0205751 3300044684 Bacteria 1190
649 Ga0466961_0050001 3300044693 Bacteria 2670
650 Ga0466963_0013645 3300044694 Bacteria 4994
651 Ga0466957_0005926 3300044842 Bacteria 6886
652 Ga0466959_0125302 3300045049 Bacteria 1823
653 Ga0451576_0000023 3300045051 Bacteria 477965
654 Ga0451576_0264963 3300045051 Bacteria 1796
655 Ga0466958_0025469 3300045836 Bacteria 3489
656 Ga0466967_0085645 3300045976 Bacteria 2853
657 Ga0495617_002497 3300046452 Bacteria 7301
658 Ga0495627_000124 3300046453 Bacteria 93651
659 Ga0495627_005805 3300046453 Bacteria 4912
660 Ga0495638_0013799 3300046460 Bacteria 5486
661 Ga0495638_0168798 3300046460 Bacteria 1257
662 Ga0495650_0000647 3300046471 Bacteria 45905
663 Ga0495596_0000204 3300046500 Bacteria 40606
664 Ga0495596_0006154 3300046500 Bacteria 5572
665 Ga0495607_0005890 3300046501 Bacteria 8704
666 Ga0495583_0000010 3300046506 Bacteria 353523
667 Ga0495606_0000837 3300046507 Bacteria 46284
668 Ga0495606_0028847 3300046507 Bacteria 3907
669 Ga0495610_0000022 3300046512 Bacteria 317107
670 Ga0495610_0000094 3300046512 Bacteria 105131
671 Ga0495610_0000206 3300046512 Bacteria 65469
672 Ga0495610_0001863 3300046512 Bacteria 18268
673 Ga0495616_0000189 3300046513 Bacteria 51610
674 Ga0495616_0033455 3300046513 Bacteria 2678
675 Ga0495620_0019022 3300046515 Bacteria 3389
676 Ga0495631_0103860 3300046518 Bacteria 1223
677 Ga0495632_0001275 3300046519 Bacteria 21330
678 Ga0495637_0036823 3300046520 Bacteria 2128
679 Ga0495637_0047857 3300046520 Bacteria 1803
680 Ga0495643_0000054 3300046522 Bacteria 198757
681 Ga0495643_0059481 3300046522 Bacteria 2031
682 Ga0495643_0109608 3300046522 Bacteria 1405
683 Ga0495648_0054412 3300046524 Bacteria 2418
684 Ga0495654_0045829 3300046530 Bacteria 2156
685 Ga0495654_0057571 3300046530 Bacteria 1877
686 Ga0495654_0063612 3300046530 Bacteria 1766
687 Ga0495598_0003104 3300046537 Bacteria 3498
688 Ga0495609_0004390 3300046538 Bacteria 7738
689 Ga0495622_0083810 3300046557 Bacteria 1466
690 Ga0495668_0000001 3300046616 Bacteria 1013420
691 Ga0495668_0034893 3300046616 Bacteria 2820
692 Ga0495668_0081418 3300046616 Bacteria 1776
693 Ga0495668_0104249 3300046616 Bacteria 1551
694 Ga0495668_0151025 3300046616 Bacteria 1272
695 Ga0495611_0180523 3300046648 Bacteria 986
696 Ga0495625_0002892 3300046660 Bacteria 17941
697 Ga0495625_0003219 3300046660 Bacteria 16539
698 Ga0495625_0011306 3300046660 Bacteria 7288
699 Ga0495625_0151816 3300046660 Bacteria 1557
700 Ga0495661_0071006 3300046665 Bacteria 2036
701 Ga0495671_0065087 3300046692 Bacteria 1794
702 Ga0495671_0139996 3300046692 Bacteria 1179
703 Ga0495649_0076419 3300046694 Bacteria 1793
704 Ga0495673_0012038 3300047469 Bacteria 4614
705 Ga0495681_0000106 3300047470 Bacteria 72369
706 Ga0495681_0000187 3300047470 Bacteria 52995
707 Ga0495686_0000278 3300047472 Bacteria 90520
708 Ga0495686_0000366 3300047472 Bacteria 73243
709 Ga0495686_0000986 3300047472 Bacteria 34762
710 Ga0495686_0006371 3300047472 Bacteria 9052
711 Ga0495686_0015352 3300047472 Bacteria 5232
712 Ga0495686_0069590 3300047472 Bacteria 2169
713 Ga0495686_0111285 3300047472 Bacteria 1642
714 Ga0495615_0000162 3300048090 Bacteria 16971
715 Ga0495626_0004324 3300048091 Bacteria 8754
716 Ga0496100_0042368 3300048903 Bacteria 2907
717 Ga0496100_0047375 3300048903 Bacteria 2769
718 Ga0496100_0160795 3300048903 Bacteria 1610
719 Ga0496101_0004642 3300048904 Bacteria 8687
720 Ga0496101_0053758 3300048904 Bacteria 2907
721 Ga0496101_0137103 3300048904 Bacteria 1863
722 Ga0496101_0361114 3300048904 Bacteria 1142
723 Ga0496102_0000308 3300048905 Bacteria 62245
724 Ga0496102_0029156 3300048905 Bacteria 4935
725 Ga0496102_0295344 3300048905 Bacteria 1527
726 Ga0496103_0000021 3300048906 Bacteria 229062
727 Ga0496103_0001901 3300048906 Bacteria 13580
728 Ga0496103_0012595 3300048906 Bacteria 5016
729 Ga0496103_0094882 3300048906 Bacteria 1885
730 Ga0496103_0113703 3300048906 Bacteria 1721
731 Ga0496103_0151067 3300048906 Bacteria 1488
732 Ga0496104_0000131 3300048907 Bacteria 69658
733 Ga0496104_0040263 3300048907 Bacteria 4379
734 Ga0496104_0073721 3300048907 Bacteria 3248
735 Ga0496104_0124392 3300048907 Bacteria 2476
736 Ga0496104_0595467 3300048907 Bacteria 1016
737 Ga0496105_0000111 3300048908 Bacteria 55868
738 Ga0496105_0001688 3300048908 Bacteria 15747
739 Ga0496105_0081331 3300048908 Bacteria 2675
740 Ga0496106_0001103 3300048909 Bacteria 19971
741 Ga0496106_0737854 3300048909 Bacteria 783
742 Ga0496107_0000975 3300048910 Bacteria 16984
743 Ga0496107_0040979 3300048910 Bacteria 3325
744 Ga0496107_0082643 3300048910 Bacteria 2342
745 Ga0496107_0196806 3300048910 Bacteria 1498
746 Ga0496108_0013686 3300048911 Bacteria 6623
747 Ga0496109_0018196 3300048912 Bacteria 6170
748 Ga0496109_0085274 3300048912 Bacteria 2915
749 Ga0496110_0138322 3300048913 Bacteria 2202
750 Ga0496111_0021644 3300048914 Bacteria 4494
751 Ga0496111_0133783 3300048914 Bacteria 1836
752 Ga0496112_0000957 3300048915 Bacteria 21009
753 Ga0496112_0078645 3300048915 Bacteria 3261
754 Ga0496113_0000112 3300048916 Bacteria 35072
755 Ga0496113_0000648 3300048916 Bacteria 17543
756 Ga0496114_0028698 3300048917 Bacteria 4568
757 Ga0496114_0077633 3300048917 Bacteria 2800
758 Ga0496116_0000039 3300048919 Bacteria 349134
759 Ga0496116_0007876 3300048919 Bacteria 9349
760 Ga0496116_0011817 3300048919 Bacteria 7187
761 Ga0496116_0072490 3300048919 Bacteria 2176
762 Ga0496116_0098742 3300048919 Bacteria 1751
763 Ga0496117_0000284 3300048920 Bacteria 92675
764 Ga0496117_0003796 3300048920 Bacteria 17237
765 Ga0496117_0006080 3300048920 Bacteria 12379
766 Ga0496117_0011471 3300048920 Bacteria 7936
767 Ga0496117_0015913 3300048920 Bacteria 6373
768 Ga0496117_0031009 3300048920 Bacteria 4090
769 Ga0496117_0138507 3300048920 Bacteria 1462
770 Ga0496117_0187512 3300048920 Bacteria 1182
771 Ga0496118_0000870 3300048921 Bacteria 47798
772 Ga0496118_0004782 3300048921 Bacteria 15825
773 Ga0496118_0021045 3300048921 Bacteria 5758
774 Ga0496118_0027199 3300048921 Bacteria 4847
775 Ga0496118_0042271 3300048921 Bacteria 3597
776 Ga0496118_0059631 3300048921 Bacteria 2839
777 Ga0496118_0146582 3300048921 Bacteria 1485
778 Ga0496118_0206876 3300048921 Bacteria 1156
779 Ga0496119_0000339 3300048922 Bacteria 65402
780 Ga0496119_0048032 3300048922 Bacteria 2650
781 Ga0496120_0000334 3300048923 Bacteria 78728
782 Ga0496121_0000175 3300048924 Bacteria 142910
783 Ga0496121_0000650 3300048924 Bacteria 65007
784 Ga0496121_0000733 3300048924 Bacteria 60446
785 Ga0496121_0001098 3300048924 Bacteria 47733
786 Ga0496121_0002945 3300048924 Bacteria 24853
787 Ga0496121_0004766 3300048924 Bacteria 17897
788 Ga0496121_0074007 3300048924 Bacteria 2727
789 Ga0496121_0153766 3300048924 Bacteria 1690
790 Ga0496122_0001086 3300048925 Bacteria 47240
791 Ga0496122_0001206 3300048925 Bacteria 44057
792 Ga0496122_0001526 3300048925 Bacteria 36870
793 Ga0496122_0006643 3300048925 Bacteria 13186
794 Ga0496122_0025699 3300048925 Bacteria 5104
795 Ga0496122_0031675 3300048925 Bacteria 4393
796 Ga0496122_0046186 3300048925 Bacteria 3376
797 Ga0496123_0000367 3300048926 Bacteria 84634
798 Ga0496123_0000536 3300048926 Bacteria 65382
799 Ga0496123_0000804 3300048926 Bacteria 50773
800 Ga0496123_0002207 3300048926 Bacteria 24751
801 Ga0496123_0003565 3300048926 Bacteria 17252
802 Ga0496123_0015818 3300048926 Bacteria 6163
803 Ga0496124_0003977 3300048927 Bacteria 17619
804 Ga0496124_0004725 3300048927 Bacteria 15729
805 Ga0496124_0007994 3300048927 Bacteria 11129
806 Ga0496124_0017269 3300048927 Bacteria 6807
807 Ga0496124_0066867 3300048927 Bacteria 2992
808 Ga0496124_0298201 3300048927 Bacteria 1166
809 Ga0496124_0316618 3300048927 Bacteria 1119
810 Ga0496124_0482984 3300048927 Bacteria 836
811 Ga0496125_0002033 3300048928 Bacteria 27406
812 Ga0496125_0004368 3300048928 Bacteria 16377
813 Ga0496125_0007177 3300048928 Bacteria 11883
814 Ga0496125_0017851 3300048928 Bacteria 6752
815 Ga0496125_0055142 3300048928 Bacteria 3241
816 Ga0496125_0056955 3300048928 Bacteria 3170
817 Ga0496125_0355345 3300048928 Bacteria 873
818 Ga0496126_0000041 3300048929 Bacteria 340389
819 Ga0496126_0000175 3300048929 Bacteria 146389
820 Ga0496126_0004825 3300048929 Bacteria 15816
821 Ga0496126_0005044 3300048929 Bacteria 15331
822 Ga0496126_0005910 3300048929 Bacteria 13803
823 Ga0496126_0030518 3300048929 Bacteria 5105
824 Ga0496126_0069424 3300048929 Bacteria 3143
825 Ga0496126_0081882 3300048929 Bacteria 2853
826 Ga0496126_0117565 3300048929 Bacteria 2309
827 Ga0501290_000205 3300049513 Bacteria 9770
828 Ga0501292_000189 3300049515 Bacteria 9869
829 Ga0501293_003299 3300049516 Bacteria 1244
830 Ga0501300_000660 3300049523 Bacteria 5171
831 Ga0501031_0043575 3300049568 Bacteria 2928
832 Ga0501032_0034947 3300049569 Bacteria 3437
833 Ga0501032_0106253 3300049569 Bacteria 1859
834 Ga0501033_0007801 3300049570 Bacteria 8292
835 Ga0501033_0036932 3300049570 Bacteria 3659
836 Ga0501033_0064870 3300049570 Bacteria 2687
837 Ga0501033_0409935 3300049570 Bacteria 944
838 Ga0501034_0026214 3300049571 Bacteria 5936
839 Ga0501034_0409921 3300049571 Bacteria 1277
840 Ga0501036_0008497 3300049572 Bacteria 8416
841 Ga0501036_0613802 3300049572 Bacteria 902
842 Ga0501037_0048952 3300049573 Bacteria 3095
843 Ga0501038_0036353 3300049574 Bacteria 4322
844 Ga0501039_0041950 3300049575 Bacteria 3535
845 Ga0501043_0025689 3300049579 Bacteria 4621
846 Ga0501043_0156189 3300049579 Bacteria 1784
847 Ga0501046_0055695 3300049580 Bacteria 3106
848 Ga0501046_0093053 3300049580 Bacteria 2317
849 Ga0501047_0000277 3300049581 Bacteria 59304
850 Ga0501047_0052860 3300049581 Bacteria 3927
851 Ga0501047_0108798 3300049581 Bacteria 2654
852 Ga0501047_0116918 3300049581 Bacteria 2548
853 Ga0501047_0352436 3300049581 Bacteria 1308
854 Ga0501048_0038246 3300049582 Bacteria 3444
855 Ga0501070_0359653 3300049586 Bacteria 1181
856 Ga0501206_001832 3300049653 Bacteria 2667
857 Ga0501222_001312 3300049662 Bacteria 3482
858 Ga0501223_000317 3300049663 Bacteria 12000
859 Ga0501223_003158 3300049663 Bacteria 3601
860 Ga0501224_000076 3300049664 Bacteria 10275
861 Ga0501227_013899 3300049665 Bacteria 1780
862 Ga0501233_000558 3300049668 Bacteria 6046
863 Ga0501235_030555 3300049669 Bacteria 1214
864 Ga0501249_000121 3300049679 Bacteria 23955
865 Ga0501257_000008 3300049686 Bacteria 54624
866 Ga0501259_001343 3300049688 Bacteria 4115
867 Ga0501261_000148 3300049690 Bacteria 10156
868 Ga0501221_002919 3300049704 Bacteria 2816
869 Ga0501225_0001994 3300049705 Bacteria 6378
870 Ga0501225_0012545 3300049705 Bacteria 2379
871 Ga0501279_000145 3300049775 Bacteria 9968
872 Ga0501281_00174 3300049777 Bacteria 7389
873 Ga0501282_000075 3300049778 Bacteria 11879
874 Ga0501283_000488 3300049779 Bacteria 5221
875 Ga0501035_0017136 3300049822 Bacteria 6675
876 Ga0501035_0300994 3300049822 Bacteria 1351
877 Ga0501044_0000053 3300049823 Bacteria 141732
878 Ga0501044_0046760 3300049823 Bacteria 4479
879 Ga0501044_0237237 3300049823 Bacteria 1769
880 Ga0501044_0237278 3300049823 Bacteria 1769
881 Ga0501044_0408972 3300049823 Bacteria 1268
882 Ga0501044_0543842 3300049823 Bacteria 1059
883 Ga0501226_000183 3300049853 Bacteria 10218
884 nmdc:mga03683_28_c2 3300050489 Bacteria 61805
885 nmdc:mga03683_41_c1 3300050489 Bacteria 60927
886 nmdc:mga03n38_176_c1 3300050490 Bacteria 14308
887 nmdc:mga00v17_18164_c1 3300050491 Bacteria 3990
888 nmdc:mga00v17_2587_c1 3300050491 Bacteria 9275
889 nmdc:mga00v17_80678_c1 3300050491 Bacteria 2030
890 nmdc:mga0k408_242422_c1 3300050493 Bacteria 1076
891 nmdc:mga0k408_256099_c1 3300050493 Bacteria 1045
892 nmdc:mga0k408_9_c1 3300050493 Bacteria 82578
893 nmdc:mga06z11_49_c1 3300050494 Bacteria 50406
894 nmdc:mga07m45_130768_c1 3300050496 Bacteria 1452
895 nmdc:mga07m45_13_c2 3300050496 Bacteria 88503
896 nmdc:mga07m45_1455_c1 3300050496 Bacteria 10863
897 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
898 nmdc:mga0sz30_106_c1 3300050516 Bacteria 31275
899 Ga0500643_000004 3300053087 Bacteria 857484
900 Ga0500643_000169 3300053087 Bacteria 64699
901 Ga0500643_002115 3300053087 Bacteria 10549
902 Ga0500643_005518 3300053087 Bacteria 5439
903 Ga0500643_005814 3300053087 Bacteria 5256
904 Ga0500643_022686 3300053087 Bacteria 2017
905 Ga0500583_0290108 3300053092 Bacteria 802
906 Ga0500651_0041970 3300053093 Bacteria 2883
907 Ga0500555_000684 3300053103 Bacteria 12890
908 Ga0500556_0000013 3300053104 Bacteria 243797
909 Ga0500592_000050 3300053116 Bacteria 35179
910 Ga0500592_000243 3300053116 Bacteria 9903
911 Ga0500594_0005354 3300053118 Bacteria 2845
912 Ga0500594_0013050 3300053118 Bacteria 1969
913 Ga0500597_007259 3300053120 Bacteria 3739
914 Ga0500607_000140 3300053121 Bacteria 60736
915 Ga0500607_000188 3300053121 Bacteria 55367
916 Ga0500608_000566 3300053122 Bacteria 13807
917 Ga0500608_013074 3300053122 Bacteria 3668
918 Ga0500642_0000002 3300053130 Bacteria 795093
919 Ga0500642_0043025 3300053130 Bacteria 1960
920 Ga0500658_0038015 3300053134 Bacteria 1917
921 Ga0500559_0000722 3300053136 Bacteria 21736
922 Ga0500559_0000883 3300053136 Bacteria 19195
923 Ga0500559_0016726 3300053136 Bacteria 3098
924 Ga0500559_0020301 3300053136 Bacteria 2809
925 Ga0500564_000123 3300053138 Bacteria 19609
926 Ga0500573_0040821 3300053140 Bacteria 2680
927 Ga0500590_001058 3300053148 Bacteria 10777
928 Ga0500604_0026205 3300053151 Bacteria 1680
929 Ga0500604_0052207 3300053151 Bacteria 1265
930 Ga0500604_0127237 3300053151 Bacteria 855
931 Ga0500616_0002623 3300053153 Bacteria 14681
932 Ga0500616_0007941 3300053153 Bacteria 6665
933 Ga0500624_000038 3300053157 Bacteria 93803
934 Ga0500624_000324 3300053157 Bacteria 16298
935 Ga0500627_0000004 3300053158 Bacteria 174208
936 Ga0500627_0000081 3300053158 Bacteria 34802
937 Ga0500627_0000452 3300053158 Bacteria 11132
938 Ga0500639_141310 3300053163 Bacteria 1125
939 Ga0500636_0006654 3300053177 Bacteria 6646
940 Ga0500637_0000047 3300053178 Bacteria 43949
941 Ga0500567_000691 3300053723 Bacteria 12345
942 Ga0500570_002110 3300053724 Bacteria 9674
943 Ga0500611_000358 3300053727 Bacteria 4660
944 Ga0500625_000035 3300053729 Bacteria 47893
945 Ga0500645_001027 3300053730 Bacteria 15634
946 Ga0500645_001749 3300053730 Bacteria 10535
947 Ga0500645_046732 3300053730 Bacteria 1270
948 Ga0466962_0000605 3300061719 Bacteria 15878
949 2511126364 2510917021 Bacteria 5705459
950 2585260775 2582581305 Bacteria 4895574
951 2643728696 2643221541 Bacteria 5498788
952 2643823517 2643221560 Bacteria 4801179
953 2643948825 2643221588 Bacteria 3692460
954 2644037965 2643221605 Bacteria 4772303
955 2644044711 2643221606 Bacteria 5588032
956 2644390884 2643221671 Bacteria 5496681
957 2738709903 2738541275 Bacteria 4830863
958 2738848328 2738541301 Bacteria 4834102
959 2738864057 2738541304 Bacteria 4833665
960 2739296575 2738543022 Bacteria 4835059
961 2739358253 2738543033 Bacteria 4833336
962 2739650543 2739367664 Bacteria 4114334
963 2740029016 2739367865 Bacteria 4114482
964 2819550676 2818991438 Bacteria 5793701
965 2852655501 2852653556 Bacteria 4050083
966 2852681109 2852680915 Bacteria 4100189
967 2882808240 2882806704 Bacteria 3007728
968 2895882723 2895880812 Bacteria 11255272
969 2896185244 2896184354 Bacteria 3258548
970 2896255655 2896253425 Bacteria 3418029
971 2919142635 2919138771 Bacteria 5281312
972 2919713339 2919709256 Bacteria 4318106
973 2928101451 2928100450 Bacteria 4837635
974 2928960138 2928959182 Bacteria 4725774
975 3000867757 3000865235 Bacteria 3106258
976 8054305609 8054302542 Bacteria 5698134
977 Ga0065704_10079225
978 SwRhRL2b_contig_1489105
979 SwRhRL2b_contig_2402994
980 JGI24752J21851_1000048
981 JGI24739J22299_10000251
982 JGI24739J22299_10001511
983 JGI24739J22299_10002733
984 JGI24739J22299_10023091
985 JGI24739J22299_10027769
986 JGI24737J22298_10001603
987 JGI24737J22298_10002940
988 JGI24737J22298_10007027
989 JGI24737J22298_10013657
990 JGI24743J22301_10049053
991 JGI24735J21928_10002659
992 JGI24735J21928_10003032
993 JGI24735J21928_10003729
994 JGI24735J21928_10010426
995 JGI24750J21931_1000042
996 JGI24750J21931_1011003
997 JGI24748J21848_1000063
998 JGI24738J21930_10000468
999 JGI24738J21930_10000632
1000 JGI24738J21930_10009517
1001 JGI24749J21850_1000252
1002 JGI24749J21850_1000472
1003 JGI24034J26672_10000007
1004 JGI24742J22300_10004892
1005 JGI24751J29686_10000046
1006 JGI24751J29686_10000473
1007 JGI24751J29686_10003360
1008 JGI24751J29686_10033737
1009 JGI25165J46597_1000112
1010 rootH1_10346595
1011 Ga0055536_1001242
1012 Ga0055536_1001703
1013 Ga0055530_10012661
1014 Ga0065704_10000191
1015 Ga0065704_10002210
1016 Ga0065704_10072419
1017 Ga0065707_10082140
1018 Ga0065707_10114593
1019 Ga0070658_10000089
1020 Ga0070658_10001742
1021 Ga0070658_10004304
1022 Ga0070658_10016592
1023 Ga0070658_10030940
1024 Ga0070658_10129269
1025 Ga0070658_10169252
1026 Ga0070676_10000909
1027 Ga0070690_100000110
1028 Ga0070670_100000006
1029 Ga0070670_100000068
1030 Ga0070670_100004402
1031 Ga0070670_100011758
1032 Ga0070670_100017184
1033 Ga0070670_100054238
1034 Ga0068869_100004212
1035 Ga0070666_10000068
1036 Ga0070666_10000417
1037 Ga0070666_10003859
1038 Ga0070666_10027816
1039 Ga0070666_10214903
1040 Ga0070680_100007674
1041 Ga0068868_100000023
1042 Ga0070660_100000916
1043 Ga0070660_100004613
1044 Ga0070660_100014971
1045 Ga0070660_100023922
1046 Ga0070660_100048126
1047 Ga0070660_100054117
1048 Ga0070660_100563887
1049 Ga0070661_100008440
1050 Ga0070661_100272667
1051 Ga0070661_100527374
1052 Ga0070692_10148947
1053 Ga0070668_100000026
1054 Ga0070668_100002833
1055 Ga0070668_100007337
1056 Ga0070668_100010222
1057 Ga0070668_100023436
1058 Ga0070668_100023648
1059 Ga0070668_100039261
1060 Ga0070668_100136399
1061 Ga0070668_100264567
1062 Ga0070668_100433211
1063 Ga0070669_100000018
1064 Ga0070669_100000083
1065 Ga0070669_100000102
1066 Ga0070669_100000193
1067 Ga0070669_100000332
1068 Ga0070669_100064196
1069 Ga0070669_100407873
1070 Ga0070671_100000011
1071 Ga0070671_100000107
1072 Ga0070671_100000266
1073 Ga0070671_100001068
1074 Ga0070671_100020174
1075 Ga0070671_100048676
1076 Ga0070671_100055799
1077 Ga0070671_100273701
1078 Ga0070674_100144483
1079 Ga0070673_100000001
1080 Ga0070688_100002132
1081 Ga0070659_100043766
1082 Ga0070659_100084366
1083 Ga0070659_100228119
1084 Ga0070667_100000019
1085 Ga0070667_100000098
1086 Ga0070667_100001002
1087 Ga0070667_100004151
1088 Ga0070667_100004153
1089 Ga0070667_100005317
1090 Ga0070667_100009896
1091 Ga0070667_100048771
1092 Ga0070667_100118697
1093 Ga0070663_100024996
1094 Ga0070663_100045390
1095 Ga0070663_100134867
1096 Ga0070678_100029355
1097 Ga0070678_100194887
1098 Ga0070662_100000887
1099 Ga0070662_100009685
1100 Ga0070662_100190414
1101 Ga0070662_100229419
1102 Ga0070662_100266757
1103 Ga0070681_10004470
1104 Ga0068867_100000027
1105 Ga0070685_10000036
1106 Ga0070707_100182464
1107 Ga0070679_100012621
1108 Ga0070679_100022533
1109 Ga0070679_100030802
1110 Ga0070679_100612007
1111 Ga0070684_100023818
1112 Ga0068853_100004246
1113 Ga0068853_100017555
1114 Ga0068853_100042359
1115 Ga0068853_100597048
1116 Ga0070672_100088116
1117 Ga0070686_100000045
1118 Ga0070686_100071892
1119 Ga0070665_100000042
1120 Ga0070665_100000269
1121 Ga0070665_100037764
1122 Ga0070665_100057760
1123 Ga0070665_100065726
1124 Ga0070665_100088255
1125 Ga0070665_100112938
1126 Ga0070665_100194116
1127 Ga0068855_100000092
1128 Ga0068855_100010472
1129 Ga0068855_100024314
1130 Ga0068855_100038768
1131 Ga0068855_100044343
1132 Ga0068855_100056220
1133 Ga0068855_100117473
1134 Ga0070664_100120328
1135 Ga0068857_100012124
1136 Ga0068857_100017141
1137 Ga0068857_100112698
1138 Ga0068857_100345836
1139 Ga0068857_100566885
1140 Ga0068854_100000684
1141 Ga0068854_100010675
1142 Ga0068854_100013424
1143 Ga0068854_100018762
1144 Ga0068854_100044644
1145 Ga0068854_100130588
1146 Ga0068854_100273112
1147 Ga0068854_100456003
1148 Ga0068856_100014407
1149 Ga0068856_100028654
1150 Ga0068856_100029700
1151 Ga0068856_100040569
1152 Ga0068856_100480172
1153 Ga0068852_100002388
1154 Ga0068852_100008366
1155 Ga0068852_100038495
1156 Ga0068852_100121455
1157 Ga0068852_100214724
1158 Ga0068852_100247162
1159 Ga0068852_100256372
1160 Ga0068859_100006602
1161 Ga0068859_100007283
1162 Ga0068859_100009002
1163 Ga0068859_100010776
1164 Ga0068859_100039024
1165 Ga0068859_100039829
1166 Ga0068859_100358142
1167 Ga0068859_100574468
1168 Ga0068864_100000014
1169 Ga0068864_100000019
1170 Ga0068864_100001740
1171 Ga0068864_100007768
1172 Ga0068864_100018289
1173 Ga0068864_100018652
1174 Ga0068864_100020326
1175 Ga0068864_100104581
1176 Ga0068866_10206302
1177 Ga0068861_100006194
1178 Ga0068861_100009141
1179 Ga0068861_100028058
1180 Ga0068861_100054223
1181 Ga0068851_10059906
1182 Ga0068851_10259249
1183 Ga0068863_100000015
1184 Ga0068863_100000138
1185 Ga0068863_100000280
1186 Ga0068863_100002835
1187 Ga0068863_100003685
1188 Ga0068863_100003927
1189 Ga0068863_100004738
1190 Ga0068863_100012255
1191 Ga0068863_100050813
1192 Ga0068863_100150305
1193 Ga0068863_100568864
1194 Ga0068858_100003226
1195 Ga0068858_100005917
1196 Ga0068858_100006381
1197 Ga0068858_100007900
1198 Ga0068858_100045666
1199 Ga0068858_100220756
1200 Ga0068860_100000028
1201 Ga0068860_100000036
1202 Ga0068860_100000164
1203 Ga0068860_100000182
1204 Ga0068860_100006964
1205 Ga0068860_100014112
1206 Ga0068860_100019551
1207 Ga0068860_100039405
1208 Ga0068860_100086950
1209 Ga0068862_100000007
1210 Ga0068862_100000067
1211 Ga0068862_100000094
1212 Ga0068862_100000308
1213 Ga0068862_100000543
1214 Ga0068862_100002528
1215 Ga0068862_100006100
1216 Ga0068862_100010416
1217 Ga0075368_10000033
1218 Ga0075368_10000095
1219 Ga0075363_100001584
1220 Ga0075364_10003212
1221 Ga0075362_10000054
1222 Ga0075362_10000265
1223 Ga0075367_10001701
1224 Ga0075369_10000150
1225 Ga0075366_10000376
1226 Ga0075366_10016501
1227 Ga0075366_10033312
1228 Ga0075366_10069306
1229 Ga0075366_10358444
1230 Ga0097621_100281049
1231 Ga0075370_10000018
1232 Ga0075370_10001563
1233 Ga0075370_10001922
1234 Ga0075370_10067685
1235 Ga0075370_10072304
1236 Ga0068871_100197641
1237 Ga0068865_100000030
1238 Ga0097620_100006602
1239 Ga0097620_100007283
1240 Ga0097620_100009002
1241 Ga0097620_100010776
1242 Ga0097620_100039023
1243 Ga0097620_100039829
1244 Ga0097620_100358177
1245 Ga0097620_100574479
1246 Ga0079104_1011365
1247 Ga0075435_100548087
1248 Ga0105251_10000853
1249 Ga0105251_10002316
1250 Ga0105250_10063100
1251 Ga0105240_10007666
1252 Ga0105240_10015794
1253 Ga0105240_10026155
1254 Ga0105240_10042646
1255 Ga0105240_10048773
1256 Ga0105240_10886414
1257 Ga0105245_10003967
1258 Ga0105247_10003627
1259 Ga0105247_10006168
1260 Ga0105247_10031044
1261 Ga0105247_10041519
1262 Ga0114129_10128773
1263 Ga0105243_10000389
1264 Ga0105241_10120389
1265 Ga0105242_10016891
1266 Ga0105248_10000311
1267 Ga0105248_10000651
1268 Ga0105248_10003293
1269 Ga0105248_10021266
1270 Ga0105248_10048979
1271 Ga0105248_10060981
1272 Ga0105248_10083782
1273 Ga0105248_10088933
1274 Ga0105248_10103354
1275 Ga0105248_10250096
1276 Ga0105237_10009418
1277 Ga0105237_10031194
1278 Ga0105237_10495230
1279 Ga0105238_10040689
1280 Ga0105238_10161361
1281 Ga0105238_10374791
1282 Ga0105238_10379805
1283 Ga0105249_10000012
1284 Ga0105249_10000105
1285 Ga0105249_10000568
1286 Ga0105249_10003294
1287 Ga0105249_10015137
1288 Ga0105239_10000183
1289 Ga0105246_10000730
1290 Ga0105246_10017619
1291 Ga0157373_10012241
1292 Ga0157373_10045323
1293 Ga0157373_10158932
1294 Ga0157371_10002824
1295 Ga0157371_10029859
1296 Ga0157371_10070962
1297 Ga0157370_10013144
1298 Ga0157370_10097070
1299 Ga0157369_10003242
1300 Ga0157369_10013185
1301 Ga0157369_10031631
1302 Ga0157369_10255826
1303 Ga0157374_10025842
1304 Ga0157378_10038350
1305 Ga0163162_10008723
1306 Ga0157372_10011931
1307 Ga0157372_10065914
1308 Ga0157372_10074192
1309 Ga0157372_10126062
1310 Ga0157372_10217553
1311 Ga0157372_10578941
1312 Ga0157375_10000776
1313 Ga0157375_10828136
1314 Ga0163163_10067350
1315 Ga0163163_10233366
1316 Ga0163163_10577781
1317 Ga0157380_10000014
1318 Ga0157380_10000151
1319 Ga0157380_10003723
1320 Ga0157377_10066200
1321 Ga0157379_10062412
1322 Ga0157376_10000145
1323 Ga0163161_10000202
1324 Ga0163161_10012008
1325 Ga0163161_10085572
1326 Ga0207672_1000690
1327 Ga0207427_100820
1328 Ga0209026_1003814
1329 Ga0209148_1000133
1330 Ga0209233_1000078
1331 Ga0209455_1000592
1332 Ga0209676_1008949
1333 Ga0209676_1048247
1334 Ga0209050_1001308
1335 Ga0209257_1000987
1336 Ga0207697_10000184
1337 Ga0207713_1002057
1338 Ga0207713_1002657
1339 Ga0207713_1044565
1340 Ga0207710_10006133
1341 Ga0207710_10022311
1342 Ga0207710_10036560
1343 Ga0207680_10000012
1344 Ga0207680_10002312
1345 Ga0207680_10012031
1346 Ga0207680_10075062
1347 Ga0207680_10130668
1348 Ga0207647_10000293
1349 Ga0207647_10000789
1350 Ga0207647_10015957
1351 Ga0207647_10026801
1352 Ga0207645_10002416
1353 Ga0207645_10103028
1354 Ga0207705_10000009
1355 Ga0207705_10000018
1356 Ga0207705_10000140
1357 Ga0207705_10000468
1358 Ga0207705_10002762
1359 Ga0207705_10051777
1360 Ga0207705_10055151
1361 Ga0207705_10118671
1362 Ga0207654_10001661
1363 Ga0207707_10136464
1364 Ga0207695_10000641
1365 Ga0207695_10006576
1366 Ga0207695_10012328
1367 Ga0207695_10036598
1368 Ga0207695_10041984
1369 Ga0207671_10002738
1370 Ga0207671_10042781
1371 Ga0207671_10394088
1372 Ga0207660_10006580
1373 Ga0207657_10001013
1374 Ga0207657_10025295
1375 Ga0207657_10027635
1376 Ga0207657_10066223
1377 Ga0207657_10080800
1378 Ga0207649_10018237
1379 Ga0207652_10010744
1380 Ga0207652_10028408
1381 Ga0207681_10000001
1382 Ga0207681_10000008
1383 Ga0207681_10000060
1384 Ga0207681_10000076
1385 Ga0207681_10000176
1386 Ga0207681_10045165
1387 Ga0207681_10269809
1388 Ga0207681_10293069
1389 Ga0207681_10309369
1390 Ga0207694_10001461
1391 Ga0207694_10039785
1392 Ga0207650_10000023
1393 Ga0207650_10000054
1394 Ga0207650_10000657
1395 Ga0207650_10057574
1396 Ga0207650_10133041
1397 Ga0207687_10002491
1398 Ga0207644_10000004
1399 Ga0207644_10000006
1400 Ga0207644_10000067
1401 Ga0207644_10002492
1402 Ga0207644_10013127
1403 Ga0207644_10032632
1404 Ga0207644_10060614
1405 Ga0207644_10146333
1406 Ga0207690_10029576
1407 Ga0207690_10125628
1408 Ga0207690_10187264
1409 Ga0207690_10210726
1410 Ga0207690_10271229
1411 Ga0207706_10000554
1412 Ga0207706_10003511
1413 Ga0207706_10014020
1414 Ga0207706_10017119
1415 Ga0207706_10018187
1416 Ga0207706_10106441
1417 Ga0207706_10355218
1418 Ga0207686_10002215
1419 Ga0207709_10000203
1420 Ga0207670_10087894
1421 Ga0207704_10000032
1422 Ga0207691_10074908
1423 Ga0207711_10000017
1424 Ga0207711_10002909
1425 Ga0207711_10007104
1426 Ga0207711_10028990
1427 Ga0207711_10068532
1428 Ga0207711_10115399
1429 Ga0207711_10216704
1430 Ga0207711_10326683
1431 Ga0207689_10000108
1432 Ga0207661_10117279
1433 Ga0207679_10195064
1434 Ga0207679_10489509
1435 Ga0207667_10000013
1436 Ga0207667_10004663
1437 Ga0207667_10006842
1438 Ga0207667_10017750
1439 Ga0207667_10069701
1440 Ga0207667_10069703
1441 Ga0207667_10125810
1442 Ga0207667_10144188
1443 Ga0207667_10672478
1444 Ga0207651_10000001
1445 Ga0207712_10000015
1446 Ga0207712_10000021
1447 Ga0207712_10000163
1448 Ga0207712_10006075
1449 Ga0207712_10077855
1450 Ga0207668_10000081
1451 Ga0207668_10000706
1452 Ga0207668_10079196
1453 Ga0207668_10117830
1454 Ga0207668_10129130
1455 Ga0207668_10387276
1456 Ga0207668_10500130
1457 Ga0207640_10000050
1458 Ga0207640_10004057
1459 Ga0207640_10006582
1460 Ga0207640_10043702
1461 Ga0207640_10077581
1462 Ga0207640_10105407
1463 Ga0207640_10145707
1464 Ga0207658_10000002
1465 Ga0207658_10000196
1466 Ga0207658_10000223
1467 Ga0207658_10001629
1468 Ga0207658_10004644
1469 Ga0207658_10006781
1470 Ga0207658_10027929
1471 Ga0207658_10049470
1472 Ga0207658_10151211
1473 Ga0207677_10000214
1474 Ga0207703_10007829
1475 Ga0207703_10012705
1476 Ga0207703_10022029
1477 Ga0207703_10027135
1478 Ga0207703_10327271
1479 Ga0207639_10001919
1480 Ga0207639_10007281
1481 Ga0207639_10029801
1482 Ga0207639_10033617
1483 Ga0207639_10140035
1484 Ga0207639_10361804
1485 Ga0207639_10463823
1486 Ga0207678_10003417
1487 Ga0207678_10005375
1488 Ga0207678_10046697
1489 Ga0207678_10073264
1490 Ga0207678_10436419
1491 Ga0207678_10439874
1492 Ga0207702_10002016
1493 Ga0207702_10002082
1494 Ga0207702_10008254
1495 Ga0207702_10038451
1496 Ga0207702_10284530
1497 Ga0207702_10751777
1498 Ga0207641_10000008
1499 Ga0207641_10000195
1500 Ga0207641_10000414
1501 Ga0207641_10000657
1502 Ga0207641_10002967
1503 Ga0207641_10012207
1504 Ga0207641_10016785
1505 Ga0207641_10080470
1506 Ga0207641_10089559
1507 Ga0207641_10130432
1508 Ga0207641_10964004
1509 Ga0207648_10000073
1510 Ga0207676_10000017
1511 Ga0207676_10000019
1512 Ga0207676_10003099
1513 Ga0207676_10004129
1514 Ga0207676_10009609
1515 Ga0207676_10011403
1516 Ga0207676_10415560
1517 Ga0207674_10019146
1518 Ga0207674_10036832
1519 Ga0207674_10041562
1520 Ga0207674_10047233
1521 Ga0207674_10103694
1522 Ga0207674_10307026
1523 Ga0207675_100000227
1524 Ga0207675_100000341
1525 Ga0207675_100025073
1526 Ga0207683_10053845
1527 Ga0207698_10000541
1528 Ga0207698_10010737
1529 Ga0207698_10040877
1530 Ga0207698_10041529
1531 Ga0207698_10134591
1532 Ga0207698_10158087
1533 Ga0207698_10162666
1534 Ga0207698_10191798
1535 Ga0207698_10221442
1536 Ga0207698_10264605
1537 Ga0207698_10272570
1538 Ga0207698_10467386
1539 Ga0209813_10000013
1540 Ga0268266_10000054
1541 Ga0268266_10000334
1542 Ga0268266_10012828
1543 Ga0268266_10020141
1544 Ga0268266_10048874
1545 Ga0268266_10083699
1546 Ga0268266_10103047
1547 Ga0268266_10234301
1548 Ga0268265_10000002
1549 Ga0268265_10000011
1550 Ga0268265_10000021
1551 Ga0268265_10000433
1552 Ga0268265_10001980
1553 Ga0268265_10004916
1554 Ga0268265_10005892
1555 Ga0268265_10063534
1556 Ga0268264_10000001
1557 Ga0268264_10000010
1558 Ga0268264_10000066
1559 Ga0268264_10000074
1560 Ga0268264_10000228
1561 Ga0268264_10003652
1562 Ga0268264_10018854
1563 Ga0268264_10021334
1564 Ga0268264_10027561
1565 Ga0268264_10041094
1566 Ga0268264_10338754
1567 Ga0268264_10424034
1568 Ga0265331_10146796
1569 Ga0307513_10079230
1570 Ga0307408_100005065
1571 Ga0307408_100049229
1572 Ga0307408_100064439
1573 Ga0307408_100159006
1574 Ga0307408_100226455
1575 Ga0307508_10167737
1576 Ga0316579_10145580
1577 Ga0307516_10139362
1578 Ga0307405_10004121
1579 Ga0307405_10060786
1580 Ga0307405_10209361
1581 Ga0307405_10338884
1582 Ga0307413_10011789
1583 Ga0307413_10096814
1584 Ga0307410_10221593
1585 Ga0307412_10000453
1586 Ga0307412_10009214
1587 Ga0307412_10012078
1588 Ga0307412_10045512
1589 Ga0307412_10249572
1590 Ga0307412_10659606
1591 Ga0307409_100054392
1592 Ga0307409_100626795
1593 Ga0307416_100073601
1594 Ga0307416_100090147
1595 Ga0307416_100320071
1596 Ga0307416_100717436
1597 Ga0307416_100767007
1598 Ga0307414_10000248
1599 Ga0307414_10001322
1600 Ga0307414_10046944
1601 Ga0307411_10020048
1602 Ga0307411_10334890
1603 Ga0307411_10494636
1604 Ga0307415_100306820
1605 Ga0316583_10005084
1606 Ga0373943_0113108
1607 Ga0373931_0030223
1608 Ga0316582_0001383
1609 Ga0395899_0014090
1610 Ga0395900_0360006
1611 Ga0395905_0118962
1612 Ga0395901_0379831
1613 Ga0237819_00867
1614 Ga0451802_1385565
1615 Ga0439448_0000324
1616 Ga0439448_0007182
1617 Ga0439448_0010488
1618 Ga0439448_0043183
1619 Ga0439455_0000320
1620 Ga0439455_0006017
1621 Ga0439458_0000018
1622 Ga0439458_0001408
1623 Ga0439435_0011236
1624 Ga0466966_0205751
1625 Ga0466961_0050001
1626 Ga0466963_0013645
1627 Ga0466957_0005926
1628 Ga0466959_0125302
1629 Ga0451576_0000023
1630 Ga0451576_0264963
1631 Ga0466958_0025469
1632 Ga0466967_0085645
1633 Ga0495617_002497
1634 Ga0495627_000124
1635 Ga0495627_005805
1636 Ga0495638_0013799
1637 Ga0495638_0168798
1638 Ga0495650_0000647
1639 Ga0495596_0000204
1640 Ga0495596_0006154
1641 Ga0495607_0005890
1642 Ga0495583_0000010
1643 Ga0495606_0000837
1644 Ga0495606_0028847
1645 Ga0495610_0000022
1646 Ga0495610_0000094
1647 Ga0495610_0000206
1648 Ga0495610_0001863
1649 Ga0495616_0000189
1650 Ga0495616_0033455
1651 Ga0495620_0019022
1652 Ga0495631_0103860
1653 Ga0495632_0001275
1654 Ga0495637_0036823
1655 Ga0495637_0047857
1656 Ga0495643_0000054
1657 Ga0495643_0059481
1658 Ga0495643_0109608
1659 Ga0495648_0054412
1660 Ga0495654_0045829
1661 Ga0495654_0057571
1662 Ga0495654_0063612
1663 Ga0495598_0003104
1664 Ga0495609_0004390
1665 Ga0495622_0083810
1666 Ga0495668_0000001
1667 Ga0495668_0034893
1668 Ga0495668_0081418
1669 Ga0495668_0104249
1670 Ga0495668_0151025
1671 Ga0495611_0180523
1672 Ga0495625_0002892
1673 Ga0495625_0003219
1674 Ga0495625_0011306
1675 Ga0495625_0151816
1676 Ga0495661_0071006
1677 Ga0495671_0065087
1678 Ga0495671_0139996
1679 Ga0495649_0076419
1680 Ga0495673_0012038
1681 Ga0495681_0000106
1682 Ga0495681_0000187
1683 Ga0495686_0000278
1684 Ga0495686_0000366
1685 Ga0495686_0000986
1686 Ga0495686_0006371
1687 Ga0495686_0015352
1688 Ga0495686_0069590
1689 Ga0495686_0111285
1690 Ga0495615_0000162
1691 Ga0495626_0004324
1692 Ga0496100_0042368
1693 Ga0496100_0047375
1694 Ga0496100_0160795
1695 Ga0496101_0004642
1696 Ga0496101_0053758
1697 Ga0496101_0137103
1698 Ga0496101_0361114
1699 Ga0496102_0000308
1700 Ga0496102_0029156
1701 Ga0496102_0295344
1702 Ga0496103_0000021
1703 Ga0496103_0001901
1704 Ga0496103_0012595
1705 Ga0496103_0094882
1706 Ga0496103_0113703
1707 Ga0496103_0151067
1708 Ga0496104_0000131
1709 Ga0496104_0040263
1710 Ga0496104_0073721
1711 Ga0496104_0124392
1712 Ga0496104_0595467
1713 Ga0496105_0000111
1714 Ga0496105_0001688
1715 Ga0496105_0081331
1716 Ga0496106_0001103
1717 Ga0496106_0737854
1718 Ga0496107_0000975
1719 Ga0496107_0040979
1720 Ga0496107_0082643
1721 Ga0496107_0196806
1722 Ga0496108_0013686
1723 Ga0496109_0018196
1724 Ga0496109_0085274
1725 Ga0496110_0138322
1726 Ga0496111_0021644
1727 Ga0496111_0133783
1728 Ga0496112_0000957
1729 Ga0496112_0078645
1730 Ga0496113_0000112
1731 Ga0496113_0000648
1732 Ga0496114_0028698
1733 Ga0496114_0077633
1734 Ga0496116_0000039
1735 Ga0496116_0007876
1736 Ga0496116_0011817
1737 Ga0496116_0072490
1738 Ga0496116_0098742
1739 Ga0496117_0000284
1740 Ga0496117_0003796
1741 Ga0496117_0006080
1742 Ga0496117_0011471
1743 Ga0496117_0015913
1744 Ga0496117_0031009
1745 Ga0496117_0138507
1746 Ga0496117_0187512
1747 Ga0496118_0000870
1748 Ga0496118_0004782
1749 Ga0496118_0021045
1750 Ga0496118_0027199
1751 Ga0496118_0042271
1752 Ga0496118_0059631
1753 Ga0496118_0146582
1754 Ga0496118_0206876
1755 Ga0496119_0000339
1756 Ga0496119_0048032
1757 Ga0496120_0000334
1758 Ga0496121_0000175
1759 Ga0496121_0000650
1760 Ga0496121_0000733
1761 Ga0496121_0001098
1762 Ga0496121_0002945
1763 Ga0496121_0004766
1764 Ga0496121_0074007
1765 Ga0496121_0153766
1766 Ga0496122_0001086
1767 Ga0496122_0001206
1768 Ga0496122_0001526
1769 Ga0496122_0006643
1770 Ga0496122_0025699
1771 Ga0496122_0031675
1772 Ga0496122_0046186
1773 Ga0496123_0000367
1774 Ga0496123_0000536
1775 Ga0496123_0000804
1776 Ga0496123_0002207
1777 Ga0496123_0003565
1778 Ga0496123_0015818
1779 Ga0496124_0003977
1780 Ga0496124_0004725
1781 Ga0496124_0007994
1782 Ga0496124_0017269
1783 Ga0496124_0066867
1784 Ga0496124_0298201
1785 Ga0496124_0316618
1786 Ga0496124_0482984
1787 Ga0496125_0002033
1788 Ga0496125_0004368
1789 Ga0496125_0007177
1790 Ga0496125_0017851
1791 Ga0496125_0055142
1792 Ga0496125_0056955
1793 Ga0496125_0355345
1794 Ga0496126_0000041
1795 Ga0496126_0000175
1796 Ga0496126_0004825
1797 Ga0496126_0005044
1798 Ga0496126_0005910
1799 Ga0496126_0030518
1800 Ga0496126_0069424
1801 Ga0496126_0081882
1802 Ga0496126_0117565
1803 Ga0501290_000205
1804 Ga0501292_000189
1805 Ga0501293_003299
1806 Ga0501300_000660
1807 Ga0501031_0043575
1808 Ga0501032_0034947
1809 Ga0501032_0106253
1810 Ga0501033_0007801
1811 Ga0501033_0036932
1812 Ga0501033_0064870
1813 Ga0501033_0409935
1814 Ga0501034_0026214
1815 Ga0501034_0409921
1816 Ga0501036_0008497
1817 Ga0501036_0613802
1818 Ga0501037_0048952
1819 Ga0501038_0036353
1820 Ga0501039_0041950
1821 Ga0501043_0025689
1822 Ga0501043_0156189
1823 Ga0501046_0055695
1824 Ga0501046_0093053
1825 Ga0501047_0000277
1826 Ga0501047_0052860
1827 Ga0501047_0108798
1828 Ga0501047_0116918
1829 Ga0501047_0352436
1830 Ga0501048_0038246
1831 Ga0501070_0359653
1832 Ga0501206_001832
1833 Ga0501222_001312
1834 Ga0501223_000317
1835 Ga0501223_003158
1836 Ga0501224_000076
1837 Ga0501227_013899
1838 Ga0501233_000558
1839 Ga0501235_030555
1840 Ga0501249_000121
1841 Ga0501257_000008
1842 Ga0501259_001343
1843 Ga0501261_000148
1844 Ga0501221_002919
1845 Ga0501225_0001994
1846 Ga0501225_0012545
1847 Ga0501279_000145
1848 Ga0501281_00174
1849 Ga0501282_000075
1850 Ga0501283_000488
1851 Ga0501035_0017136
1852 Ga0501035_0300994
1853 Ga0501044_0000053
1854 Ga0501044_0046760
1855 Ga0501044_0237237
1856 Ga0501044_0237278
1857 Ga0501044_0408972
1858 Ga0501044_0543842
1859 Ga0501226_000183
1860 nmdc:mga03683_28_c2
1861 nmdc:mga03683_41_c1
1862 nmdc:mga03n38_176_c1
1863 nmdc:mga00v17_18164_c1
1864 nmdc:mga00v17_2587_c1
1865 nmdc:mga00v17_80678_c1
1866 nmdc:mga0k408_242422_c1
1867 nmdc:mga0k408_256099_c1
1868 nmdc:mga0k408_9_c1
1869 nmdc:mga06z11_49_c1
1870 nmdc:mga07m45_130768_c1
1871 nmdc:mga07m45_13_c2
1872 nmdc:mga07m45_1455_c1
1873 nmdc:mga07m45_16_c1
1874 nmdc:mga0sz30_106_c1
1875 Ga0500643_000004
1876 Ga0500643_000169
1877 Ga0500643_002115
1878 Ga0500643_005518
1879 Ga0500643_005814
1880 Ga0500643_022686
1881 Ga0500583_0290108
1882 Ga0500651_0041970
1883 Ga0500555_000684
1884 Ga0500556_0000013
1885 Ga0500592_000050
1886 Ga0500592_000243
1887 Ga0500594_0005354
1888 Ga0500594_0013050
1889 Ga0500597_007259
1890 Ga0500607_000140
1891 Ga0500607_000188
1892 Ga0500608_000566
1893 Ga0500608_013074
1894 Ga0500642_0000002
1895 Ga0500642_0043025
1896 Ga0500658_0038015
1897 Ga0500559_0000722
1898 Ga0500559_0000883
1899 Ga0500559_0016726
1900 Ga0500559_0020301
1901 Ga0500564_000123
1902 Ga0500573_0040821
1903 Ga0500590_001058
1904 Ga0500604_0026205
1905 Ga0500604_0052207
1906 Ga0500604_0127237
1907 Ga0500616_0002623
1908 Ga0500616_0007941
1909 Ga0500624_000038
1910 Ga0500624_000324
1911 Ga0500627_0000004
1912 Ga0500627_0000081
1913 Ga0500627_0000452
1914 Ga0500639_141310
1915 Ga0500636_0006654
1916 Ga0500637_0000047
1917 Ga0500567_000691
1918 Ga0500570_002110
1919 Ga0500611_000358
1920 Ga0500625_000035
1921 Ga0500645_001027
1922 Ga0500645_001749
1923 Ga0500645_046732
1924 Ga0466962_0000605
1925 2511126364
1926 2585260775
1927 2643728696
1928 2643823517
1929 2643948825
1930 2644037965
1931 2644044711
1932 2644390884
1933 2738709903
1934 2738848328
1935 2738864057
1936 2739296575
1937 2739358253
1938 2739650543
1939 2740029016
1940 2819550676
1941 2852655501
1942 2852681109
1943 2882808240
1944 2895882723
1945 2896185244
1946 2896255655
1947 2919142635
1948 2919713339
1949 2928101451
1950 2928960138
1951 3000867757
1952 8054305609

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

8

67

0.97

PF03466

LysR_substrate

LysR substrate binding domain

89

274

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eo3-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c p212121 0.9104 4 50
4ldz-assembly1.cif.gz_B crystal structure of the full-length response regulator desr in the active state 0.9101 9 49
6cbq-assembly1.cif.gz_A crystal structure of qscr bound to agonist s3 0.9087 10 50
6eo2-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed 0.9063 6 50
5o8y-assembly1.cif.gz_D conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. 0.9052 6 50
ID Description Score Start End Superfamily
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9439 7 77 1.10.10.10
af_Q2FZS7_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9429 7 87 1.10.10.10
3p7nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9391 9 50 1.10.10.10
af_P0A8R9_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9388 8 85 1.10.10.10
af_P77309_1_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9347 7 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6N3U979-F1-model_v4 deleted 0.9558 7 75
AF-A0A1Q5IPR2-F1-model_v4 Transcriptional regulator 0.9203 7 90 GO:0000976
GO:0003700
AF-E8UYI9-F1-model_v4 Regulatory protein LysR 0.9172 1 80 GO:0003700
AF-A0A3C1Y027-F1-model_v4 LysR family transcriptional regulator 0.9025 7 91 GO:0003700
GO:0005829
AF-A0A2D7YXU8-F1-model_v4 deleted 0.8978 7 92

Map