F487250

General Info

Members Datasets Scaffolds Average Seq Length
976 278 1952 114

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10238573|Ga0065704_102385732
Length 127
Sequence MINSNLGFGVWDLGFPNLIAMATPSQASPSPWLQFVPFVLVLGIFYFIILLPMKKRQQKVQAFLGALKVNDKVITSGGIYGTITKVSDASVQLQVANNVRIDVSRAAIVGYQGQEPVGEALSQSKTE

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
105 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
200 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
201 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
204 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
205 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
213 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
234 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
254 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
255 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
262 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.33
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 17.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10238573 3300005289 Bacteria 1022
2 JGI24746J21847_1010804 3300001977 Bacteria 1347
3 JGI24035J26624_1009785 3300002126 Unclassified 947
4 JGI24033J26618_1022121 3300002155 Archaea 821
5 JGI24034J26672_10083343 3300002239 Archaea 586
6 JGI24751J29686_10039974 3300002459 Archaea 971
7 JGI24751J29686_10063087 3300002459 Bacteria 763
8 Ga0058861_11795853 3300004800 Unclassified 820
9 Ga0065714_10085582 3300005288 Bacteria 2142
10 Ga0065714_10131696 3300005288 Unclassified 1244
11 Ga0065714_10139313 3300005288 Bacteria 1184
12 Ga0065704_10263811 3300005289 Archaea 956
13 Ga0065704_10280339 3300005289 Unclassified 924
14 Ga0065712_10009945 3300005290 Bacteria 3847
15 Ga0065712_10026972 3300005290 Bacteria 1634
16 Ga0065712_10068029 3300005290 Bacteria 16684
17 Ga0065712_10074468 3300005290 Bacteria 4086
18 Ga0065712_10172488 3300005290 Bacteria 1236
19 Ga0065715_10004827 3300005293 Bacteria 3943
20 Ga0065715_10007485 3300005293 Bacteria 6998
21 Ga0065715_10071301 3300005293 Unclassified 634
22 Ga0065715_10156526 3300005293 Bacteria 1671
23 Ga0065715_10179119 3300005293 Bacteria 1489
24 Ga0065707_10008321 3300005295 Bacteria 2505
25 Ga0065707_10012615 3300005295 Bacteria 2600
26 Ga0065707_10036311 3300005295 Bacteria 1232
27 Ga0065707_10177573 3300005295 Bacteria 1440
28 Ga0065707_10294736 3300005295 Bacteria 1017
29 Ga0065707_10513075 3300005295 Unclassified 747
30 Ga0070658_10681076 3300005327 Unclassified 892
31 Ga0070676_10004892 3300005328 Bacteria 7098
32 Ga0070676_10028131 3300005328 Bacteria 3192
33 Ga0070676_10116384 3300005328 Bacteria 1672
34 Ga0070676_10209629 3300005328 Bacteria 1282
35 Ga0070683_100307950 3300005329 Bacteria 1507
36 Ga0070683_100339982 3300005329 Unclassified 1429
37 Ga0070683_101058910 3300005329 Unclassified 779
38 Ga0070690_100020399 3300005330 Bacteria 4037
39 Ga0070690_100195332 3300005330 Bacteria 1405
40 Ga0070690_100236311 3300005330 Bacteria 1287
41 Ga0070690_100538619 3300005330 Bacteria 878
42 Ga0070670_100002473 3300005331 Bacteria 15248
43 Ga0070670_100006795 3300005331 Bacteria 9685
44 Ga0070670_100308078 3300005331 Bacteria 1386
45 Ga0070670_100372748 3300005331 Bacteria 1257
46 Ga0070670_100721919 3300005331 Bacteria 897
47 Ga0070677_10355963 3300005333 Bacteria 760
48 Ga0070677_10902812 3300005333 Archaea 511
49 Ga0068869_100015575 3300005334 Bacteria 5105
50 Ga0068869_100134140 3300005334 Bacteria 1906
51 Ga0068869_100168473 3300005334 Bacteria 1710
52 Ga0068869_100351982 3300005334 Bacteria 1201
53 Ga0070666_10017347 3300005335 Bacteria 4615
54 Ga0070666_10045843 3300005335 Bacteria 2931
55 Ga0070666_10427074 3300005335 Bacteria 955
56 Ga0070666_10576985 3300005335 Bacteria 819
57 Ga0070680_100967993 3300005336 Unclassified 735
58 Ga0068868_100028174 3300005338 Bacteria 4292
59 Ga0068868_100590139 3300005338 Bacteria 983
60 Ga0068868_101184660 3300005338 Unclassified 706
61 Ga0070660_101366093 3300005339 Unclassified 602
62 Ga0070660_101829905 3300005339 Bacteria 517
63 Ga0070689_100013831 3300005340 Bacteria 5847
64 Ga0070689_100113078 3300005340 Bacteria 2162
65 Ga0070689_100219937 3300005340 Bacteria 1557
66 Ga0070689_100457581 3300005340 Bacteria 1087
67 Ga0070689_100462733 3300005340 Bacteria 1081
68 Ga0070689_100496396 3300005340 Bacteria 1045
69 Ga0070689_100622486 3300005340 Bacteria 937
70 Ga0070689_101957773 3300005340 Bacteria 536
71 Ga0070689_102055714 3300005340 Unclassified 523
72 Ga0070691_10276112 3300005341 Bacteria 910
73 Ga0070687_100012056 3300005343 Bacteria 3803
74 Ga0070687_100120732 3300005343 Bacteria 1499
75 Ga0070687_100149692 3300005343 Bacteria 1369
76 Ga0070687_100801030 3300005343 Bacteria 667
77 Ga0070661_100284445 3300005344 Bacteria 1283
78 Ga0070661_100311862 3300005344 Bacteria 1227
79 Ga0070661_100434878 3300005344 Bacteria 1042
80 Ga0070692_10314873 3300005345 Bacteria 960
81 Ga0070692_10571464 3300005345 Bacteria 744
82 Ga0070692_10844979 3300005345 Unclassified 629
83 Ga0070668_100054752 3300005347 Bacteria 3077
84 Ga0070668_100171496 3300005347 Bacteria 1767
85 Ga0070668_100415741 3300005347 Bacteria 1151
86 Ga0070668_100781962 3300005347 Bacteria 847
87 Ga0070668_101305000 3300005347 Bacteria 660
88 Ga0070669_100024441 3300005353 Bacteria 4331
89 Ga0070669_100046285 3300005353 Bacteria 3172
90 Ga0070669_100094522 3300005353 Bacteria 2246
91 Ga0070669_100216571 3300005353 Bacteria 1513
92 Ga0070669_100348850 3300005353 Bacteria 1201
93 Ga0070669_100572461 3300005353 Bacteria 944
94 Ga0070669_100655190 3300005353 Bacteria 884
95 Ga0070669_101010391 3300005353 Unclassified 714
96 Ga0070669_101745864 3300005353 Bacteria 543
97 Ga0070675_100010643 3300005354 Bacteria 7191
98 Ga0070675_100026955 3300005354 Bacteria 4614
99 Ga0070675_100031699 3300005354 Bacteria 4275
100 Ga0070675_100051450 3300005354 Bacteria 3385
101 Ga0070675_100051531 3300005354 Bacteria 3382
102 Ga0070675_100054369 3300005354 Bacteria 3294
103 Ga0070675_100192394 3300005354 Bacteria 1768
104 Ga0070675_100210327 3300005354 Bacteria 1691
105 Ga0070675_100267127 3300005354 Bacteria 1500
106 Ga0070675_100389407 3300005354 Bacteria 1242
107 Ga0070675_100747922 3300005354 Bacteria 892
108 Ga0070675_101161058 3300005354 Unclassified 711
109 Ga0070675_101232846 3300005354 Bacteria 689
110 Ga0070675_101523782 3300005354 Unclassified 617
111 Ga0070671_100182084 3300005355 Unclassified 1779
112 Ga0070671_100411174 3300005355 Bacteria 1158
113 Ga0070671_100690875 3300005355 Bacteria 885
114 Ga0070671_100724560 3300005355 Bacteria 863
115 Ga0070674_100013105 3300005356 Bacteria 5114
116 Ga0070674_100535233 3300005356 Bacteria 981
117 Ga0070674_100754336 3300005356 Bacteria 836
118 Ga0070674_101397833 3300005356 Archaea 627
119 Ga0070673_100002298 3300005364 Bacteria 11610
120 Ga0070673_100011536 3300005364 Bacteria 6035
121 Ga0070673_100041539 3300005364 Bacteria 3538
122 Ga0070673_100044468 3300005364 Bacteria 3439
123 Ga0070673_100058219 3300005364 Bacteria 3054
124 Ga0070673_100178201 3300005364 Bacteria 1818
125 Ga0070673_100227528 3300005364 Bacteria 1617
126 Ga0070673_100727245 3300005364 Bacteria 913
127 Ga0070673_101641790 3300005364 Unclassified 608
128 Ga0070688_100102547 3300005365 Bacteria 1889
129 Ga0070688_100132670 3300005365 Bacteria 1683
130 Ga0070688_100363799 3300005365 Bacteria 1062
131 Ga0070688_100687743 3300005365 Bacteria 791
132 Ga0070688_100723809 3300005365 Unclassified 772
133 Ga0070688_100749471 3300005365 Bacteria 760
134 Ga0070659_100097397 3300005366 Bacteria 2364
135 Ga0070659_101025996 3300005366 Unclassified 725
136 Ga0070659_101199739 3300005366 Bacteria 671
137 Ga0070659_101696806 3300005366 Unclassified 565
138 Ga0070667_100022929 3300005367 Bacteria 5175
139 Ga0070667_100231914 3300005367 Bacteria 1646
140 Ga0070667_101549870 3300005367 Unclassified 623
141 Ga0070667_101602042 3300005367 Unclassified 612
142 Ga0070714_100001653 3300005435 Bacteria 16226
143 Ga0070701_10084109 3300005438 Bacteria 1730
144 Ga0070705_101031282 3300005440 Unclassified 669
145 Ga0070705_101040559 3300005440 Bacteria 667
146 Ga0070705_101177031 3300005440 Bacteria 630
147 Ga0070700_100181401 3300005441 Bacteria 1465
148 Ga0070700_100541694 3300005441 Bacteria 903
149 Ga0070700_100782494 3300005441 Bacteria 767
150 Ga0070694_100274786 3300005444 Bacteria 1283
151 Ga0070694_100321052 3300005444 Bacteria 1192
152 Ga0070694_100740583 3300005444 Archaea 802
153 Ga0070694_101047917 3300005444 Bacteria 679
154 Ga0070694_101322810 3300005444 Unclassified 606
155 Ga0070663_100259133 3300005455 Bacteria 1379
156 Ga0070678_100014125 3300005456 Bacteria 5028
157 Ga0070678_100173722 3300005456 Bacteria 1757
158 Ga0070678_100195696 3300005456 Unclassified 1665
159 Ga0070678_100679285 3300005456 Bacteria 926
160 Ga0070678_100830645 3300005456 Bacteria 841
161 Ga0070678_102237291 3300005456 Unclassified 519
162 Ga0070678_102237483 3300005456 Unclassified 519
163 Ga0070662_100027802 3300005457 Bacteria 3931
164 Ga0070662_100049208 3300005457 Bacteria 3039
165 Ga0070662_100089007 3300005457 Bacteria 2315
166 Ga0070662_100175462 3300005457 Bacteria 1686
167 Ga0070662_100274708 3300005457 Bacteria 1362
168 Ga0070662_101042959 3300005457 Bacteria 701
169 Ga0070681_11071047 3300005458 Unclassified 727
170 Ga0070681_11600664 3300005458 Unclassified 577
171 Ga0068867_100075291 3300005459 Bacteria 2532
172 Ga0068867_100199926 3300005459 Unclassified 1599
173 Ga0068867_100235396 3300005459 Bacteria 1482
174 Ga0068867_100424721 3300005459 Bacteria 1127
175 Ga0070685_10044463 3300005466 Bacteria 2542
176 Ga0070685_10085366 3300005466 Bacteria 1901
177 Ga0070685_10140010 3300005466 Bacteria 1522
178 Ga0070685_10189349 3300005466 Unclassified 1330
179 Ga0070685_10492493 3300005466 Bacteria 866
180 Ga0070707_100649286 3300005468 Bacteria 1018
181 Ga0070698_101398033 3300005471 Bacteria 651
182 Ga0070698_101768074 3300005471 Unclassified 571
183 Ga0070699_100057206 3300005518 Bacteria 3378
184 Ga0070699_100310293 3300005518 Bacteria 1416
185 Ga0070679_100746102 3300005530 Bacteria 922
186 Ga0070679_101264771 3300005530 Unclassified 683
187 Ga0070684_100351027 3300005535 Bacteria 1357
188 Ga0070697_100042970 3300005536 Bacteria 3658
189 Ga0070697_100148337 3300005536 Bacteria 1976
190 Ga0070672_100070216 3300005543 Bacteria 2783
191 Ga0070672_100153693 3300005543 Bacteria 1905
192 Ga0070672_100239578 3300005543 Bacteria 1525
193 Ga0070672_100302331 3300005543 Bacteria 1356
194 Ga0070672_100327978 3300005543 Bacteria 1302
195 Ga0070672_100734927 3300005543 Archaea 865
196 Ga0070686_100023123 3300005544 Bacteria 3712
197 Ga0070686_100065493 3300005544 Bacteria 2361
198 Ga0070686_100452164 3300005544 Bacteria 988
199 Ga0070686_100920107 3300005544 Archaea 713
200 Ga0070695_100001180 3300005545 Bacteria 14364
201 Ga0070695_100134955 3300005545 Bacteria 1705
202 Ga0070693_101410087 3300005547 Unclassified 542
203 Ga0070665_100363420 3300005548 Bacteria 1453
204 Ga0070665_102249190 3300005548 Bacteria 549
205 Ga0070704_100003047 3300005549 Bacteria 9536
206 Ga0070704_100129380 3300005549 Bacteria 1954
207 Ga0070704_100131876 3300005549 Bacteria 1938
208 Ga0070704_100339769 3300005549 Bacteria 1264
209 Ga0070704_100689817 3300005549 Bacteria 905
210 Ga0070664_100000586 3300005564 Bacteria 27743
211 Ga0070664_100028549 3300005564 Bacteria 4642
212 Ga0070664_100045139 3300005564 Bacteria 3722
213 Ga0070664_100094627 3300005564 Bacteria 2591
214 Ga0070664_100113742 3300005564 Bacteria 2364
215 Ga0070664_100153819 3300005564 Bacteria 2031
216 Ga0070664_100193616 3300005564 Bacteria 1812
217 Ga0070664_100906184 3300005564 Bacteria 827
218 Ga0070664_101119940 3300005564 Bacteria 742
219 Ga0070664_101176678 3300005564 Bacteria 723
220 Ga0070664_101815782 3300005564 Unclassified 578
221 Ga0068857_100094387 3300005577 Bacteria 2679
222 Ga0068857_100634226 3300005577 Bacteria 1012
223 Ga0068857_100695118 3300005577 Bacteria 966
224 Ga0068857_102504351 3300005577 Unclassified 507
225 Ga0068857_102562388 3300005577 Archaea 501
226 Ga0068854_100446566 3300005578 Unclassified 1079
227 Ga0068854_100775348 3300005578 Bacteria 834
228 Ga0068854_101212023 3300005578 Bacteria 677
229 Ga0068854_101927090 3300005578 Bacteria 544
230 Ga0068854_102232259 3300005578 Unclassified 507
231 Ga0070702_100058054 3300005615 Bacteria 2240
232 Ga0070702_100602296 3300005615 Unclassified 824
233 Ga0070702_100873489 3300005615 Archaea 702
234 Ga0068852_100694770 3300005616 Bacteria 1027
235 Ga0068852_101082062 3300005616 Bacteria 822
236 Ga0068859_100016878 3300005617 Bacteria 7328
237 Ga0068859_100027171 3300005617 Bacteria 5742
238 Ga0068859_100031700 3300005617 Bacteria 5308
239 Ga0068859_100137409 3300005617 Bacteria 2518
240 Ga0068859_100137882 3300005617 Bacteria 2513
241 Ga0068859_100154339 3300005617 Bacteria 2372
242 Ga0068859_100269810 3300005617 Unclassified 1794
243 Ga0068859_100285022 3300005617 Bacteria 1745
244 Ga0068859_100554065 3300005617 Bacteria 1244
245 Ga0068859_100616260 3300005617 Bacteria 1178
246 Ga0068859_100722804 3300005617 Unclassified 1086
247 Ga0068864_100012301 3300005618 Bacteria 7073
248 Ga0068864_100013736 3300005618 Bacteria 6717
249 Ga0068864_100244407 3300005618 Bacteria 1664
250 Ga0068864_100526900 3300005618 Unclassified 1140
251 Ga0068864_100715766 3300005618 Bacteria 979
252 Ga0068864_100921277 3300005618 Bacteria 864
253 Ga0068864_100943079 3300005618 Unclassified 854
254 Ga0068864_101993177 3300005618 Unclassified 587
255 Ga0068866_10331526 3300005718 Archaea 961
256 Ga0068866_11030466 3300005718 Unclassified 586
257 Ga0068861_100064192 3300005719 Bacteria 2824
258 Ga0068861_100088426 3300005719 Bacteria 2440
259 Ga0068861_100113088 3300005719 Bacteria 2178
260 Ga0068851_10608267 3300005834 Bacteria 666
261 Ga0068870_10037950 3300005840 Bacteria 2485
262 Ga0068870_10146966 3300005840 Bacteria 1385
263 Ga0068870_10500800 3300005840 Bacteria 810
264 Ga0068870_10930615 3300005840 Bacteria 616
265 Ga0068863_100046319 3300005841 Bacteria 4127
266 Ga0068863_100079308 3300005841 Bacteria 3110
267 Ga0068863_100632378 3300005841 Archaea 1061
268 Ga0068863_101079771 3300005841 Unclassified 807
269 Ga0068858_100073462 3300005842 Bacteria 3174
270 Ga0068858_100090118 3300005842 Bacteria 2853
271 Ga0068858_100258874 3300005842 Bacteria 1654
272 Ga0068858_100408647 3300005842 Bacteria 1305
273 Ga0068858_101026418 3300005842 Bacteria 808
274 Ga0068860_100202145 3300005843 Bacteria 1925
275 Ga0068860_100309486 3300005843 Bacteria 1549
276 Ga0068860_101379386 3300005843 Bacteria 726
277 Ga0068862_100070124 3300005844 Bacteria 3026
278 Ga0068862_100084833 3300005844 Bacteria 2752
279 Ga0068862_100394176 3300005844 Bacteria 1294
280 Ga0068862_100443243 3300005844 Bacteria 1223
281 Ga0068862_100650127 3300005844 Bacteria 1017
282 Ga0068862_100806812 3300005844 Bacteria 917
283 Ga0068862_101295591 3300005844 Unclassified 730
284 Ga0068862_101846704 3300005844 Bacteria 614
285 Ga0081539_10029084 3300005985 Bacteria 3462
286 Ga0075432_10223521 3300006058 Unclassified 754
287 Ga0075432_10254257 3300006058 Unclassified 714
288 Ga0070716_100295681 3300006173 Bacteria 1124
289 Ga0070712_100334364 3300006175 Bacteria 1235
290 Ga0097621_100860532 3300006237 Bacteria 843
291 Ga0097621_100879077 3300006237 Bacteria 834
292 Ga0068871_100053491 3300006358 Bacteria 3273
293 Ga0068871_100335133 3300006358 Bacteria 1335
294 Ga0068871_100431941 3300006358 Bacteria 1178
295 Ga0068871_100462484 3300006358 Bacteria 1139
296 Ga0068871_101319808 3300006358 Bacteria 679
297 Ga0075428_100000284 3300006844 Bacteria 49693
298 Ga0075428_100001176 3300006844 Bacteria 28020
299 Ga0075428_100030746 3300006844 Bacteria 5937
300 Ga0075428_100055909 3300006844 Bacteria 4323
301 Ga0075428_100061209 3300006844 Bacteria 4122
302 Ga0075428_100062542 3300006844 Bacteria 4075
303 Ga0075428_100092312 3300006844 Bacteria 3301
304 Ga0075428_100109766 3300006844 Bacteria 3005
305 Ga0075428_100412681 3300006844 Bacteria 1447
306 Ga0075428_100574562 3300006844 Bacteria 1205
307 Ga0075430_100007284 3300006846 Bacteria 9338
308 Ga0075430_100016847 3300006846 Bacteria 6225
309 Ga0075430_100034006 3300006846 Bacteria 4325
310 Ga0075430_100045040 3300006846 Bacteria 3729
311 Ga0075430_100051294 3300006846 Bacteria 3478
312 Ga0075430_100052018 3300006846 Bacteria 3449
313 Ga0075430_100090817 3300006846 Bacteria 2554
314 Ga0075430_100265976 3300006846 Bacteria 1420
315 Ga0075430_100333305 3300006846 Bacteria 1254
316 Ga0075430_100440196 3300006846 Bacteria 1076
317 Ga0075430_100726594 3300006846 Bacteria 819
318 Ga0075431_100003965 3300006847 Bacteria 14420
319 Ga0075431_100007807 3300006847 Bacteria 10657
320 Ga0075431_100008897 3300006847 Bacteria 10058
321 Ga0075431_100009529 3300006847 Bacteria 9755
322 Ga0075431_100020930 3300006847 Bacteria 6683
323 Ga0075431_100062847 3300006847 Bacteria 3831
324 Ga0075431_100126095 3300006847 Bacteria 2641
325 Ga0075431_100536181 3300006847 Bacteria 1159
326 Ga0075431_100627278 3300006847 Unclassified 1057
327 Ga0075433_10006016 3300006852 Bacteria 9559
328 Ga0075433_10010139 3300006852 Bacteria 7554
329 Ga0075433_10051341 3300006852 Bacteria 3591
330 Ga0075433_10065223 3300006852 Bacteria 3194
331 Ga0075433_10098544 3300006852 Bacteria 2588
332 Ga0075433_10455126 3300006852 Bacteria 1128
333 Ga0075433_10562871 3300006852 Bacteria 1001
334 Ga0075433_11103709 3300006852 Bacteria 690
335 Ga0075434_100010577 3300006871 Bacteria 8657
336 Ga0075434_100016832 3300006871 Bacteria 7033
337 Ga0075434_100017717 3300006871 Bacteria 6866
338 Ga0075434_100040403 3300006871 Bacteria 4618
339 Ga0075434_100078955 3300006871 Bacteria 3288
340 Ga0075434_100144644 3300006871 Bacteria 2398
341 Ga0075434_100160283 3300006871 Bacteria 2269
342 Ga0075434_100291799 3300006871 Bacteria 1651
343 Ga0075434_100584670 3300006871 Bacteria 1136
344 Ga0075434_101301769 3300006871 Unclassified 738
345 Ga0075429_100004197 3300006880 Bacteria 12338
346 Ga0075429_100009769 3300006880 Bacteria 8318
347 Ga0075429_100025829 3300006880 Bacteria 5100
348 Ga0075429_100031404 3300006880 Bacteria 4616
349 Ga0075429_100055647 3300006880 Bacteria 3442
350 Ga0075429_100095838 3300006880 Bacteria 2588
351 Ga0075429_100183248 3300006880 Bacteria 1835
352 Ga0075429_100193064 3300006880 Unclassified 1784
353 Ga0075429_100315394 3300006880 Bacteria 1368
354 Ga0075429_100557032 3300006880 Unclassified 1005
355 Ga0075429_100777492 3300006880 Unclassified 839
356 Ga0075429_100779165 3300006880 Bacteria 838
357 Ga0075429_101514358 3300006880 Unclassified 583
358 Ga0068865_100105404 3300006881 Bacteria 2071
359 Ga0068865_100132505 3300006881 Bacteria 1869
360 Ga0068865_100203585 3300006881 Unclassified 1538
361 Ga0068865_100302455 3300006881 Bacteria 1281
362 Ga0068865_101039397 3300006881 Bacteria 719
363 Ga0068865_101566687 3300006881 Bacteria 592
364 Ga0075436_100247270 3300006914 Bacteria 1269
365 Ga0097620_100016878 3300006931 Bacteria 7328
366 Ga0097620_100027171 3300006931 Bacteria 5742
367 Ga0097620_100031701 3300006931 Bacteria 5308
368 Ga0097620_100137405 3300006931 Bacteria 2518
369 Ga0097620_100137872 3300006931 Bacteria 2513
370 Ga0097620_100154336 3300006931 Bacteria 2372
371 Ga0097620_100269821 3300006931 Unclassified 1794
372 Ga0097620_100285032 3300006931 Bacteria 1745
373 Ga0097620_100554102 3300006931 Bacteria 1244
374 Ga0097620_100616189 3300006931 Bacteria 1178
375 Ga0097620_100722727 3300006931 Unclassified 1086
376 Ga0075435_100021650 3300007076 Bacteria 4948
377 Ga0075435_100110594 3300007076 Bacteria 2285
378 Ga0075435_100308202 3300007076 Bacteria 1355
379 Ga0105250_10369461 3300009092 Unclassified 631
380 Ga0105240_10152291 3300009093 Bacteria 2753
381 Ga0105240_11096188 3300009093 Unclassified 847
382 Ga0111539_10000306 3300009094 Bacteria 59726
383 Ga0111539_10000755 3300009094 Bacteria 42078
384 Ga0111539_10008742 3300009094 Bacteria 12847
385 Ga0111539_10009063 3300009094 Bacteria 12594
386 Ga0111539_10020960 3300009094 Bacteria 8047
387 Ga0111539_10046513 3300009094 Bacteria 5189
388 Ga0111539_10065215 3300009094 Bacteria 4304
389 Ga0111539_10096271 3300009094 Bacteria 3477
390 Ga0111539_10108999 3300009094 Bacteria 3249
391 Ga0111539_10305421 3300009094 Bacteria 1852
392 Ga0111539_10346671 3300009094 Bacteria 1728
393 Ga0111539_10430974 3300009094 Bacteria 1535
394 Ga0111539_11778179 3300009094 Unclassified 715
395 Ga0111539_11986943 3300009094 Bacteria 674
396 Ga0111539_12096497 3300009094 Unclassified 656
397 Ga0111539_13075629 3300009094 Unclassified 539
398 Ga0105245_10549944 3300009098 Bacteria 1176
399 Ga0105245_11361450 3300009098 Bacteria 759
400 Ga0105245_12821488 3300009098 Bacteria 538
401 Ga0105245_12828056 3300009098 Unclassified 538
402 Ga0105247_10042623 3300009101 Bacteria 2780
403 Ga0105247_10498168 3300009101 Bacteria 887
404 Ga0114129_10011461 3300009147 Bacteria 12623
405 Ga0114129_10015037 3300009147 Bacteria 11018
406 Ga0114129_10020716 3300009147 Bacteria 9344
407 Ga0114129_10029973 3300009147 Bacteria 7704
408 Ga0114129_10041091 3300009147 Bacteria 6518
409 Ga0114129_10052707 3300009147 Bacteria 5710
410 Ga0114129_10071381 3300009147 Bacteria 4842
411 Ga0114129_10088461 3300009147 Bacteria 4293
412 Ga0114129_10097771 3300009147 Bacteria 4064
413 Ga0114129_10161305 3300009147 Bacteria 3062
414 Ga0114129_11025944 3300009147 Bacteria 1037
415 Ga0114129_13427606 3300009147 Unclassified 509
416 Ga0105243_10489768 3300009148 Bacteria 1162
417 Ga0105243_11098730 3300009148 Bacteria 803
418 Ga0105243_11179696 3300009148 Bacteria 778
419 Ga0105243_11459078 3300009148 Bacteria 707
420 Ga0105243_12091718 3300009148 Unclassified 602
421 Ga0105242_10485248 3300009176 Bacteria 1172
422 Ga0105242_10543991 3300009176 Bacteria 1112
423 Ga0105242_12058796 3300009176 Unclassified 614
424 Ga0105242_12261840 3300009176 Bacteria 590
425 Ga0105248_10286403 3300009177 Unclassified 1855
426 Ga0105248_10381767 3300009177 Bacteria 1586
427 Ga0105248_12497464 3300009177 Bacteria 589
428 Ga0105237_12785171 3300009545 Bacteria 500
429 Ga0105238_11290638 3300009551 Unclassified 756
430 Ga0105249_10009569 3300009553 Bacteria 8493
431 Ga0105249_10055766 3300009553 Bacteria 3617
432 Ga0105249_10492529 3300009553 Bacteria 1270
433 Ga0105249_10709139 3300009553 Bacteria 1067
434 Ga0105249_11002137 3300009553 Bacteria 904
435 Ga0105249_11012239 3300009553 Bacteria 900
436 Ga0105249_12125889 3300009553 Bacteria 634
437 Ga0105249_12528720 3300009553 Bacteria 586
438 Ga0105246_10012256 3300011119 Bacteria 5345
439 Ga0105246_10386002 3300011119 Bacteria 1159
440 Ga0105246_10482864 3300011119 Bacteria 1049
441 Ga0105246_11004191 3300011119 Bacteria 756
442 Ga0157346_1009653 3300012480 Unclassified 687
443 Ga0157323_1014743 3300012495 Unclassified 674
444 Ga0157371_10376531 3300013102 Bacteria 1036
445 Ga0157370_10680047 3300013104 Bacteria 940
446 Ga0157369_11790139 3300013105 Unclassified 624
447 Ga0157374_10058009 3300013296 Bacteria 3617
448 Ga0157374_10338931 3300013296 Unclassified 1492
449 Ga0157378_10445215 3300013297 Bacteria 1285
450 Ga0157378_11308270 3300013297 Bacteria 766
451 Ga0157378_11536325 3300013297 Unclassified 711
452 Ga0157378_12146722 3300013297 Bacteria 609
453 Ga0163162_10008524 3300013306 Bacteria 9993
454 Ga0163162_10594590 3300013306 Bacteria 1233
455 Ga0163162_10655876 3300013306 Unclassified 1173
456 Ga0157372_11157983 3300013307 Bacteria 894
457 Ga0157372_11377976 3300013307 Bacteria 813
458 Ga0157375_10053871 3300013308 Bacteria 3960
459 Ga0157375_10375202 3300013308 Bacteria 1589
460 Ga0157375_10889915 3300013308 Bacteria 1035
461 Ga0157375_10896538 3300013308 Unclassified 1031
462 Ga0157375_12052295 3300013308 Unclassified 680
463 Ga0157375_12916576 3300013308 Unclassified 571
464 Ga0163163_10022722 3300014325 Bacteria 5943
465 Ga0163163_10078874 3300014325 Bacteria 3290
466 Ga0163163_10172038 3300014325 Bacteria 2213
467 Ga0163163_10176303 3300014325 Bacteria 2184
468 Ga0163163_11314973 3300014325 Bacteria 785
469 Ga0163163_12870914 3300014325 Bacteria 538
470 Ga0157380_10029501 3300014326 Bacteria 4192
471 Ga0157380_10062932 3300014326 Bacteria 2974
472 Ga0157380_10079032 3300014326 Bacteria 2685
473 Ga0157380_10146465 3300014326 Bacteria 2036
474 Ga0157380_10547370 3300014326 Bacteria 1134
475 Ga0157380_11440734 3300014326 Unclassified 740
476 Ga0157380_12581491 3300014326 Unclassified 574
477 Ga0157380_13058894 3300014326 Unclassified 533
478 Ga0157380_13531499 3300014326 Bacteria 501
479 Ga0157377_10005968 3300014745 Bacteria 5769
480 Ga0157377_10066351 3300014745 Bacteria 2074
481 Ga0157377_10111326 3300014745 Bacteria 1646
482 Ga0157377_10839215 3300014745 Bacteria 681
483 Ga0157379_10003064 3300014968 Bacteria 14133
484 Ga0157379_10005539 3300014968 Bacteria 10848
485 Ga0157379_10074359 3300014968 Bacteria 3042
486 Ga0157379_10622765 3300014968 Bacteria 1009
487 Ga0157379_11933437 3300014968 Bacteria 582
488 Ga0157376_10066871 3300014969 Bacteria 3039
489 Ga0157376_10146519 3300014969 Bacteria 2124
490 Ga0157376_10452981 3300014969 Bacteria 1252
491 Ga0157376_11517805 3300014969 Archaea 703
492 Ga0163161_10028324 3300017792 Bacteria 3978
493 Ga0163161_10039607 3300017792 Bacteria 3384
494 Ga0163161_10329549 3300017792 Bacteria 1209
495 Ga0207672_1006080 3300025223 Archaea 694
496 Ga0207697_10002059 3300025315 Bacteria 10589
497 Ga0207697_10020303 3300025315 Bacteria 2720
498 Ga0207697_10100323 3300025315 Bacteria 1233
499 Ga0207697_10316673 3300025315 Unclassified 692
500 Ga0207697_10425285 3300025315 Unclassified 589
501 Ga0207696_1150937 3300025711 Unclassified 620
502 Ga0207682_10061815 3300025893 Unclassified 1569
503 Ga0207682_10353181 3300025893 Unclassified 693
504 Ga0207682_10513646 3300025893 Unclassified 567
505 Ga0207710_10165396 3300025900 Bacteria 1079
506 Ga0207688_10011929 3300025901 Bacteria 4730
507 Ga0207688_10117851 3300025901 Bacteria 1547
508 Ga0207688_10203312 3300025901 Archaea 1188
509 Ga0207688_10361160 3300025901 Unclassified 896
510 Ga0207680_10140575 3300025903 Bacteria 1600
511 Ga0207680_10272872 3300025903 Bacteria 1173
512 Ga0207680_10530980 3300025903 Bacteria 839
513 Ga0207680_10574123 3300025903 Bacteria 806
514 Ga0207645_10051615 3300025907 Bacteria 2628
515 Ga0207645_10071891 3300025907 Bacteria 2214
516 Ga0207645_10140632 3300025907 Bacteria 1573
517 Ga0207645_10208134 3300025907 Bacteria 1288
518 Ga0207645_10465105 3300025907 Bacteria 854
519 Ga0207643_10014099 3300025908 Bacteria 4339
520 Ga0207643_10029188 3300025908 Bacteria 3067
521 Ga0207643_10156941 3300025908 Bacteria 1367
522 Ga0207643_10316273 3300025908 Bacteria 974
523 Ga0207684_11442527 3300025910 Bacteria 562
524 Ga0207695_10110371 3300025913 Bacteria 2731
525 Ga0207695_10797727 3300025913 Unclassified 824
526 Ga0207693_10381053 3300025915 Bacteria 1103
527 Ga0207660_10463954 3300025917 Unclassified 1025
528 Ga0207660_10535784 3300025917 Bacteria 952
529 Ga0207662_10022979 3300025918 Bacteria 3579
530 Ga0207662_10068981 3300025918 Bacteria 2136
531 Ga0207662_10129759 3300025918 Unclassified 1588
532 Ga0207662_10161409 3300025918 Bacteria 1432
533 Ga0207657_10612677 3300025919 Bacteria 849
534 Ga0207649_10023474 3300025920 Bacteria 3573
535 Ga0207649_10123466 3300025920 Bacteria 1749
536 Ga0207649_10207488 3300025920 Bacteria 1388
537 Ga0207649_11285241 3300025920 Unclassified 579
538 Ga0207652_10426207 3300025921 Bacteria 1196
539 Ga0207646_10176874 3300025922 Bacteria 1927
540 Ga0207681_10038068 3300025923 Bacteria 3183
541 Ga0207681_10088080 3300025923 Bacteria 2210
542 Ga0207681_10098151 3300025923 Bacteria 2107
543 Ga0207681_10214078 3300025923 Bacteria 1487
544 Ga0207681_10234283 3300025923 Bacteria 1426
545 Ga0207681_10245883 3300025923 Bacteria 1395
546 Ga0207681_10849554 3300025923 Bacteria 763
547 Ga0207681_11337461 3300025923 Bacteria 601
548 Ga0207650_10008408 3300025925 Bacteria 7046
549 Ga0207650_10216970 3300025925 Bacteria 1538
550 Ga0207650_10341737 3300025925 Bacteria 1229
551 Ga0207650_10378069 3300025925 Bacteria 1169
552 Ga0207650_11314223 3300025925 Unclassified 615
553 Ga0207659_10004148 3300025926 Bacteria 8745
554 Ga0207659_10009478 3300025926 Bacteria 6087
555 Ga0207659_10016839 3300025926 Bacteria 4766
556 Ga0207659_10036189 3300025926 Bacteria 3417
557 Ga0207659_10036422 3300025926 Bacteria 3408
558 Ga0207659_10107144 3300025926 Bacteria 2117
559 Ga0207659_10144191 3300025926 Bacteria 1852
560 Ga0207659_10246304 3300025926 Bacteria 1448
561 Ga0207659_10248867 3300025926 Bacteria 1441
562 Ga0207659_10260097 3300025926 Bacteria 1411
563 Ga0207659_10501468 3300025926 Bacteria 1028
564 Ga0207659_10697319 3300025926 Bacteria 869
565 Ga0207659_11394337 3300025926 Bacteria 601
566 Ga0207664_10028758 3300025929 Bacteria 4227
567 Ga0207644_10073010 3300025931 Bacteria 2515
568 Ga0207644_10662566 3300025931 Bacteria 869
569 Ga0207644_10915089 3300025931 Bacteria 735
570 Ga0207644_11118781 3300025931 Bacteria 662
571 Ga0207690_10420306 3300025932 Unclassified 1069
572 Ga0207690_10505589 3300025932 Unclassified 978
573 Ga0207690_10836519 3300025932 Unclassified 762
574 Ga0207706_10027855 3300025933 Bacteria 5051
575 Ga0207706_10038926 3300025933 Bacteria 4217
576 Ga0207706_10107569 3300025933 Bacteria 2454
577 Ga0207706_10158425 3300025933 Bacteria 1991
578 Ga0207706_10351216 3300025933 Bacteria 1282
579 Ga0207706_11161877 3300025933 Unclassified 643
580 Ga0207686_10748549 3300025934 Unclassified 780
581 Ga0207686_10934872 3300025934 Unclassified 701
582 Ga0207709_10956887 3300025935 Bacteria 698
583 Ga0207670_10195723 3300025936 Bacteria 1532
584 Ga0207670_10254989 3300025936 Bacteria 1357
585 Ga0207670_10324941 3300025936 Bacteria 1211
586 Ga0207670_10398434 3300025936 Bacteria 1100
587 Ga0207670_10524131 3300025936 Bacteria 965
588 Ga0207670_11038803 3300025936 Unclassified 690
589 Ga0207669_10016067 3300025937 Bacteria 3792
590 Ga0207669_10068122 3300025937 Bacteria 2221
591 Ga0207669_10366017 3300025937 Unclassified 1119
592 Ga0207669_10492500 3300025937 Bacteria 979
593 Ga0207669_10765135 3300025937 Unclassified 799
594 Ga0207669_11042207 3300025937 Bacteria 689
595 Ga0207704_10543167 3300025938 Bacteria 943
596 Ga0207704_10842829 3300025938 Bacteria 768
597 Ga0207665_10175780 3300025939 Bacteria 1548
598 Ga0207691_10006894 3300025940 Bacteria 10958
599 Ga0207691_10023881 3300025940 Bacteria 5754
600 Ga0207691_10051607 3300025940 Bacteria 3759
601 Ga0207691_10051671 3300025940 Bacteria 3756
602 Ga0207691_10111507 3300025940 Bacteria 2432
603 Ga0207691_10125050 3300025940 Bacteria 2276
604 Ga0207691_10302750 3300025940 Unclassified 1373
605 Ga0207691_10525625 3300025940 Bacteria 1004
606 Ga0207691_10641627 3300025940 Bacteria 898
607 Ga0207691_10937716 3300025940 Bacteria 724
608 Ga0207711_10107229 3300025941 Bacteria 2480
609 Ga0207711_10116745 3300025941 Bacteria 2380
610 Ga0207689_10006638 3300025942 Bacteria 10203
611 Ga0207689_10066540 3300025942 Bacteria 2962
612 Ga0207689_10073683 3300025942 Bacteria 2805
613 Ga0207689_10164159 3300025942 Bacteria 1830
614 Ga0207689_10207102 3300025942 Bacteria 1620
615 Ga0207689_11272182 3300025942 Unclassified 618
616 Ga0207661_10043583 3300025944 Bacteria 3542
617 Ga0207679_10007694 3300025945 Bacteria 6844
618 Ga0207679_10072733 3300025945 Bacteria 2598
619 Ga0207679_10268894 3300025945 Bacteria 1457
620 Ga0207679_10282284 3300025945 Bacteria 1424
621 Ga0207679_10442857 3300025945 Bacteria 1151
622 Ga0207679_10471757 3300025945 Unclassified 1116
623 Ga0207679_10853464 3300025945 Unclassified 832
624 Ga0207679_11176945 3300025945 Bacteria 703
625 Ga0207651_10002212 3300025960 Bacteria 9201
626 Ga0207651_10074395 3300025960 Bacteria 2419
627 Ga0207651_10082130 3300025960 Bacteria 2325
628 Ga0207651_10183494 3300025960 Bacteria 1662
629 Ga0207651_10188674 3300025960 Bacteria 1642
630 Ga0207651_10270489 3300025960 Bacteria 1399
631 Ga0207651_10394009 3300025960 Bacteria 1176
632 Ga0207651_11213175 3300025960 Bacteria 677
633 Ga0207712_10023448 3300025961 Bacteria 4072
634 Ga0207712_11111695 3300025961 Bacteria 704
635 Ga0207712_12103689 3300025961 Archaea 505
636 Ga0207668_10160384 3300025972 Bacteria 1752
637 Ga0207668_10710017 3300025972 Bacteria 884
638 Ga0207640_10132555 3300025981 Bacteria 1804
639 Ga0207640_10148930 3300025981 Unclassified 1717
640 Ga0207640_10857698 3300025981 Bacteria 791
641 Ga0207640_11130389 3300025981 Bacteria 694
642 Ga0207658_10043526 3300025986 Bacteria 3264
643 Ga0207658_10148154 3300025986 Bacteria 1909
644 Ga0207658_10435606 3300025986 Bacteria 1158
645 Ga0207658_10532335 3300025986 Bacteria 1050
646 Ga0207658_11962727 3300025986 Unclassified 533
647 Ga0207677_10054266 3300026023 Bacteria 2734
648 Ga0207677_10128062 3300026023 Bacteria 1922
649 Ga0207677_10624927 3300026023 Unclassified 948
650 Ga0207677_11740030 3300026023 Unclassified 578
651 Ga0207703_10028221 3300026035 Bacteria 4422
652 Ga0207703_10290096 3300026035 Bacteria 1489
653 Ga0207703_10525303 3300026035 Bacteria 1114
654 Ga0207678_10082154 3300026067 Bacteria 2757
655 Ga0207678_10586738 3300026067 Bacteria 976
656 Ga0207678_11021847 3300026067 Unclassified 732
657 Ga0207708_10084950 3300026075 Bacteria 2434
658 Ga0207708_10363917 3300026075 Bacteria 1189
659 Ga0207708_10780312 3300026075 Unclassified 822
660 Ga0207641_10204287 3300026088 Bacteria 1824
661 Ga0207641_10653180 3300026088 Archaea 1033
662 Ga0207641_10675788 3300026088 Unclassified 1015
663 Ga0207641_11226263 3300026088 Bacteria 750
664 Ga0207648_10023072 3300026089 Bacteria 5581
665 Ga0207648_10031931 3300026089 Bacteria 4652
666 Ga0207648_10119107 3300026089 Bacteria 2320
667 Ga0207648_10138033 3300026089 Bacteria 2148
668 Ga0207648_10391102 3300026089 Bacteria 1259
669 Ga0207648_10568499 3300026089 Bacteria 1043
670 Ga0207648_11254370 3300026089 Unclassified 696
671 Ga0207676_10038193 3300026095 Bacteria 3662
672 Ga0207676_10153225 3300026095 Bacteria 1988
673 Ga0207676_10156361 3300026095 Bacteria 1970
674 Ga0207676_10201180 3300026095 Bacteria 1760
675 Ga0207676_10452835 3300026095 Bacteria 1210
676 Ga0207676_10536862 3300026095 Bacteria 1116
677 Ga0207674_10123356 3300026116 Bacteria 2557
678 Ga0207674_10138458 3300026116 Bacteria 2395
679 Ga0207674_10164806 3300026116 Bacteria 2170
680 Ga0207674_10208160 3300026116 Bacteria 1905
681 Ga0207674_11316252 3300026116 Unclassified 692
682 Ga0207675_100035858 3300026118 Bacteria 4626
683 Ga0207675_100057612 3300026118 Bacteria 3625
684 Ga0207675_100072977 3300026118 Bacteria 3210
685 Ga0207675_100080301 3300026118 Bacteria 3058
686 Ga0207675_100222288 3300026118 Bacteria 1820
687 Ga0207675_100555107 3300026118 Bacteria 1148
688 Ga0207675_102041456 3300026118 Bacteria 590
689 Ga0207683_10007767 3300026121 Bacteria 9177
690 Ga0207683_10147538 3300026121 Bacteria 2122
691 Ga0207683_10278216 3300026121 Bacteria 1529
692 Ga0207683_10679813 3300026121 Archaea 954
693 Ga0207683_10947911 3300026121 Bacteria 799
694 Ga0207683_11251034 3300026121 Unclassified 687
695 Ga0207683_11783227 3300026121 Bacteria 565
696 Ga0207698_10914614 3300026142 Bacteria 885
697 Ga0207698_11117337 3300026142 Bacteria 801
698 Ga0207698_11238304 3300026142 Bacteria 760
699 Ga0209999_1078874 3300027543 Unclassified 634
700 Ga0210002_1039797 3300027617 Bacteria 797
701 Ga0209974_10013867 3300027876 Bacteria 2685
702 Ga0209974_10063137 3300027876 Bacteria 1256
703 Ga0209974_10066431 3300027876 Bacteria 1225
704 Ga0207428_10000690 3300027907 Bacteria 39183
705 Ga0207428_10003602 3300027907 Bacteria 14959
706 Ga0207428_10006364 3300027907 Bacteria 10922
707 Ga0207428_10007135 3300027907 Bacteria 10222
708 Ga0207428_10047890 3300027907 Bacteria 3432
709 Ga0207428_10232302 3300027907 Bacteria 1380
710 Ga0207428_10286830 3300027907 Bacteria 1221
711 Ga0207428_10330353 3300027907 Bacteria 1124
712 Ga0207428_10333215 3300027907 Unclassified 1119
713 Ga0207428_10769437 3300027907 Unclassified 685
714 Ga0268266_10377133 3300028379 Bacteria 1337
715 Ga0268265_10283603 3300028380 Bacteria 1483
716 Ga0268265_10314010 3300028380 Bacteria 1416
717 Ga0268265_10461428 3300028380 Bacteria 1189
718 Ga0268265_11624661 3300028380 Unclassified 651
719 Ga0268265_12218439 3300028380 Unclassified 556
720 Ga0268265_12636490 3300028380 Bacteria 508
721 Ga0268264_10135603 3300028381 Bacteria 2188
722 Ga0268264_10173986 3300028381 Bacteria 1950
723 Ga0268264_10241736 3300028381 Bacteria 1673
724 Ga0268264_10262106 3300028381 Bacteria 1611
725 Ga0268264_10383459 3300028381 Bacteria 1346
726 Ga0268264_11214925 3300028381 Bacteria 763
727 Ga0268264_11552364 3300028381 Bacteria 673
728 Ga0307408_100005337 3300031548 Bacteria 8608
729 Ga0307408_100131640 3300031548 Bacteria 1952
730 Ga0307408_100856354 3300031548 Bacteria 829
731 Ga0307408_101727238 3300031548 Unclassified 597
732 Ga0307405_10004965 3300031731 Bacteria 6355
733 Ga0307405_10006136 3300031731 Bacteria 5884
734 Ga0307405_10110521 3300031731 Bacteria 1861
735 Ga0307405_10195963 3300031731 Bacteria 1463
736 Ga0307413_10041777 3300031824 Bacteria 2688
737 Ga0307413_10246706 3300031824 Bacteria 1322
738 Ga0307410_10001041 3300031852 Bacteria 12033
739 Ga0307410_10030463 3300031852 Bacteria 3449
740 Ga0307410_10172661 3300031852 Bacteria 1630
741 Ga0307410_10296611 3300031852 Bacteria 1274
742 Ga0307410_10326807 3300031852 Bacteria 1219
743 Ga0307406_10011560 3300031901 Bacteria 5016
744 Ga0307406_10023602 3300031901 Bacteria 3662
745 Ga0307406_10448903 3300031901 Bacteria 1034
746 Ga0307407_10002185 3300031903 Bacteria 7538
747 Ga0307407_10006683 3300031903 Bacteria 5156
748 Ga0307407_10008661 3300031903 Bacteria 4685
749 Ga0307407_10616850 3300031903 Bacteria 809
750 Ga0307407_10653161 3300031903 Unclassified 788
751 Ga0307412_10006626 3300031911 Bacteria 6562
752 Ga0307412_10019036 3300031911 Bacteria 4147
753 Ga0307412_10085240 3300031911 Bacteria 2195
754 Ga0307412_10285258 3300031911 Bacteria 1298
755 Ga0307409_100005560 3300031995 Bacteria 7279
756 Ga0307409_100027658 3300031995 Bacteria 4024
757 Ga0307409_100096351 3300031995 Bacteria 2440
758 Ga0307409_100227714 3300031995 Bacteria 1687
759 Ga0307409_102302079 3300031995 Unclassified 568
760 Ga0307409_102441834 3300031995 Bacteria 552
761 Ga0307416_100007599 3300032002 Bacteria 6912
762 Ga0307416_100012407 3300032002 Bacteria 5741
763 Ga0307416_100020499 3300032002 Bacteria 4720
764 Ga0307416_100278820 3300032002 Bacteria 1647
765 Ga0307416_100305556 3300032002 Bacteria 1584
766 Ga0307416_100834867 3300032002 Bacteria 1019
767 Ga0307416_101060604 3300032002 Bacteria 914
768 Ga0307416_101554435 3300032002 Bacteria 767
769 Ga0307414_10023679 3300032004 Bacteria 3900
770 Ga0307414_10050145 3300032004 Bacteria 2890
771 Ga0307414_10066944 3300032004 Bacteria 2570
772 Ga0307414_10158817 3300032004 Bacteria 1793
773 Ga0307411_10003369 3300032005 Bacteria 7402
774 Ga0307411_10018126 3300032005 Bacteria 4031
775 Ga0307411_10024943 3300032005 Bacteria 3573
776 Ga0307411_10048122 3300032005 Bacteria 2762
777 Ga0307411_10388768 3300032005 Bacteria 1150
778 Ga0307411_10567011 3300032005 Bacteria 971
779 Ga0307415_100012041 3300032126 Bacteria 4984
780 Ga0307415_100087789 3300032126 Bacteria 2242
781 Ga0307415_101113346 3300032126 Bacteria 740
782 Ga0307415_101417589 3300032126 Unclassified 662
783 Ga0373932_0184177 3300035112 Unclassified 734
784 Ga0373960_0350446 3300035121 Bacteria 560
785 Ga0373961_0096490 3300035241 Bacteria 952
786 Ga0373931_0360102 3300035691 Unclassified 913
787 Ga0439439_0030271 3300041406 Bacteria 1376
788 Ga0439453_0003587 3300041408 Bacteria 2243
789 Ga0451795_1213003 3300041456 Bacteria 726
790 Ga0439433_0040335 3300041999 Bacteria 1086
791 Ga0439433_0213453 3300041999 Unclassified 513
792 Ga0439443_036869 3300042003 Bacteria 824
793 Ga0439443_045458 3300042003 Unclassified 758
794 Ga0439450_027769 3300042008 Unclassified 1255
795 Ga0439456_068446 3300042013 Bacteria 785
796 Ga0439457_039011 3300042014 Bacteria 1057
797 Ga0450920_067381 3300042122 Bacteria 726
798 Ga0450920_083914 3300042122 Unclassified 654
799 Ga0450890_088259 3300042127 Unclassified 512
800 Ga0450894_006981 3300042131 Bacteria 1456
801 Ga0439446_0195039 3300042156 Unclassified 682
802 Ga0439434_0038168 3300042435 Bacteria 1472
803 Ga0439434_0330459 3300042435 Unclassified 530
804 Ga0439435_0049424 3300042436 Bacteria 1200
805 Ga0439435_0098848 3300042436 Unclassified 895
806 Ga0439444_0050498 3300042437 Bacteria 844
807 Ga0439464_0031568 3300042439 Bacteria 1487
808 Ga0439464_0078464 3300042439 Bacteria 984
809 Ga0439460_0129669 3300042461 Bacteria 830
810 Ga0450916_006011 3300042530 Bacteria 1418
811 Ga0439440_0120505 3300042993 Unclassified 730
812 Ga0453683_0758109 3300044673 Unclassified 638
813 Ga0466963_0473724 3300044694 Bacteria 884
814 Ga0466964_0865252 3300044706 Bacteria 515
815 Ga0451576_0519841 3300045051 Bacteria 1250
816 Ga0451576_0587816 3300045051 Bacteria 1170
817 Ga0466967_0230110 3300045976 Bacteria 1765
818 Ga0495584_0034244 3300046491 Unclassified 2570
819 Ga0495594_0065323 3300046499 Bacteria 2018
820 Ga0495598_0070578 3300046537 Bacteria 1099
821 Ga0495598_0113047 3300046537 Unclassified 912
822 Ga0495598_0138449 3300046537 Unclassified 840
823 Ga0495621_0420692 3300046539 Unclassified 569
824 Ga0495656_0006702 3300046615 Bacteria 4043
825 Ga0495636_0698195 3300047318 Unclassified 501
826 Ga0495677_0353738 3300047445 Unclassified 580
827 Ga0496103_0594593 3300048906 Bacteria 705
828 Ga0496108_0720673 3300048911 Bacteria 864
829 Ga0496108_0854356 3300048911 Unclassified 783
830 Ga0496108_1496146 3300048911 Bacteria 562
831 Ga0496109_0110924 3300048912 Bacteria 2551
832 Ga0496109_0129207 3300048912 Bacteria 2357
833 Ga0496109_0235737 3300048912 Bacteria 1722
834 Ga0496111_0470664 3300048914 Bacteria 926
835 Ga0496112_0176680 3300048915 Bacteria 2100
836 Ga0496113_0049179 3300048916 Bacteria 3139
837 Ga0496113_0508867 3300048916 Unclassified 967
838 Ga0496114_0127115 3300048917 Bacteria 2198
839 Ga0501291_071558 3300049514 Bacteria 673
840 Ga0501292_027441 3300049515 Bacteria 944
841 Ga0501299_066872 3300049522 Unclassified 772
842 Ga0501031_0451062 3300049568 Bacteria 831
843 Ga0501033_0556441 3300049570 Bacteria 790
844 Ga0501036_0051933 3300049572 Bacteria 3472
845 Ga0501036_0126418 3300049572 Bacteria 2159
846 Ga0501038_1218417 3300049574 Bacteria 546
847 Ga0501039_0016762 3300049575 Bacteria 5615
848 Ga0501039_0120454 3300049575 Bacteria 2056
849 Ga0501040_0357532 3300049576 Unclassified 1046
850 Ga0501041_0002498 3300049577 Bacteria 10468
851 Ga0501041_0002879 3300049577 Bacteria 9851
852 Ga0501041_0590124 3300049577 Bacteria 709
853 Ga0501042_0011677 3300049578 Bacteria 5934
854 Ga0501042_0025943 3300049578 Bacteria 4118
855 Ga0501042_0791502 3300049578 Bacteria 690
856 Ga0501046_0189929 3300049580 Bacteria 1533
857 Ga0501048_0617519 3300049582 Unclassified 778
858 Ga0501068_0663943 3300049584 Unclassified 681
859 Ga0501070_0818211 3300049586 Bacteria 731
860 Ga0501071_0177634 3300049587 Bacteria 1595
861 Ga0501071_0440219 3300049587 Bacteria 997
862 Ga0501071_0728274 3300049587 Bacteria 764
863 Ga0501074_0822061 3300049590 Unclassified 654
864 Ga0501075_0128948 3300049591 Bacteria 1926
865 Ga0501075_0365637 3300049591 Bacteria 1100
866 Ga0501076_0011199 3300049592 Bacteria 6676
867 Ga0501076_1513172 3300049592 Unclassified 551
868 Ga0501076_1659453 3300049592 Unclassified 524
869 Ga0501077_0057339 3300049593 Bacteria 2473
870 Ga0501077_0094148 3300049593 Bacteria 1899
871 Ga0501077_0407901 3300049593 Bacteria 869
872 Ga0501202_059244 3300049652 Unclassified 862
873 Ga0501257_056364 3300049686 Bacteria 987
874 Ga0501258_042547 3300049687 Unclassified 611
875 Ga0501221_198029 3300049704 Unclassified 557
876 Ga0501079_0053734 3300049741 Bacteria 3107
877 Ga0501079_0232707 3300049741 Bacteria 1439
878 Ga0501079_0978269 3300049741 Unclassified 666
879 Ga0501080_0273987 3300049742 Bacteria 1535
880 Ga0501081_0011798 3300049743 Bacteria 5724
881 Ga0501081_0034579 3300049743 Bacteria 3439
882 Ga0501083_0595102 3300049744 Bacteria 720
883 Ga0501265_059244 3300049762 Unclassified 621
884 Ga0501274_044320 3300049771 Unclassified 542
885 Ga0501035_0945422 3300049822 Unclassified 680
886 Ga0501045_0263942 3300049824 Bacteria 1282
887 Ga0501045_0862712 3300049824 Bacteria 666
888 nmdc:mga05p37_1149796_c1 3300050507 Bacteria 807
889 nmdc:mga05p37_1775854_c1 3300050507 Unclassified 597
890 nmdc:mga05p37_277213_c1 3300050507 Bacteria 2001
891 nmdc:mga05p37_62008_c1 3300050507 Bacteria 4602
892 nmdc:mga05p37_62595_c1 3300050507 Bacteria 4579
893 nmdc:mga05p37_6472_c1 3300050507 Bacteria 13815
894 nmdc:mga05p37_68721_c1 3300050507 Bacteria 4357
895 nmdc:mga05p37_717761_c1 3300050507 Bacteria 1108
896 nmdc:mga05p37_7428_c1 3300050507 Bacteria 12930
897 nmdc:mga05p37_78942_c1 3300050507 Bacteria 4053
898 nmdc:mga05p37_93689_c1 3300050507 Bacteria 3701
899 nmdc:mga05p37_954583_c1 3300050507 Unclassified 917
900 nmdc:mga09592_159989_c1 3300050508 Bacteria 1945
901 nmdc:mga09592_204154_c1 3300050508 Bacteria 1712
902 nmdc:mga09592_20748_c1 3300050508 Bacteria 5407
903 nmdc:mga09592_24473_c1 3300050508 Bacteria 4994
904 nmdc:mga09592_287129_c1 3300050508 Bacteria 1427
905 nmdc:mga09592_296869_c1 3300050508 Bacteria 1401
906 nmdc:mga09592_3707_c1 3300050508 Bacteria 12320
907 nmdc:mga09592_41340_c1 3300050508 Bacteria 3876
908 nmdc:mga09592_4664_c1 3300050508 Bacteria 11097
909 nmdc:mga09592_6060_c1 3300050508 Bacteria 9857
910 nmdc:mga09592_704253_c1 3300050508 Unclassified 859
911 nmdc:mga09592_761574_c1 3300050508 Bacteria 821
912 nmdc:mga09592_771136_c1 3300050508 Unclassified 815
913 nmdc:mga0qj67_1127171_c1 3300050509 Bacteria 612
914 nmdc:mga0qj67_14220_c1 3300050509 Bacteria 6015
915 nmdc:mga0qj67_144399_c1 3300050509 Bacteria 1930
916 nmdc:mga0qj67_161722_c1 3300050509 Bacteria 1817
917 nmdc:mga0qj67_2106_c1 3300050509 Bacteria 14178
918 nmdc:mga0qj67_2598_c1 3300050509 Bacteria 12929
919 nmdc:mga0qj67_260352_c1 3300050509 Bacteria 1407
920 nmdc:mga0qj67_288054_c1 3300050509 Bacteria 1331
921 nmdc:mga0qj67_41459_c1 3300050509 Bacteria 3621
922 nmdc:mga0qj67_57517_c1 3300050509 Bacteria 3082
923 nmdc:mga0qj67_808670_c1 3300050509 Unclassified 742
924 nmdc:mga0qj67_8509_c1 3300050509 Bacteria 7613
925 nmdc:mga0qj67_942996_c1 3300050509 Unclassified 679
926 nmdc:mga06r32_10914_c1 3300050510 Bacteria 8179
927 nmdc:mga06r32_13698_c1 3300050510 Bacteria 7355
928 nmdc:mga06r32_18593_c1 3300050510 Bacteria 6365
929 nmdc:mga06r32_192768_c1 3300050510 Bacteria 2025
930 nmdc:mga06r32_4912_c1 3300050510 Bacteria 12044
931 nmdc:mga06r32_576955_c1 3300050510 Unclassified 1097
932 nmdc:mga06r32_722755_c1 3300050510 Bacteria 960
933 nmdc:mga06r32_93975_c1 3300050510 Bacteria 2934
934 nmdc:mga08y16_105_c1 3300050511 Bacteria 70187
935 nmdc:mga08y16_18317_c1 3300050511 Bacteria 7378
936 nmdc:mga08y16_190078_c1 3300050511 Bacteria 2130
937 nmdc:mga08y16_1992_c1 3300050511 Bacteria 20862
938 nmdc:mga08y16_2433_c2 3300050511 Bacteria 16697
939 nmdc:mga08y16_298447_c1 3300050511 Bacteria 1661
940 nmdc:mga08y16_33645_c1 3300050511 Bacteria 5382
941 nmdc:mga08y16_360075_c1 3300050511 Bacteria 1493
942 nmdc:mga08y16_48497_c1 3300050511 Bacteria 4445
943 nmdc:mga08y16_727661_c1 3300050511 Unclassified 990
944 nmdc:mga0n895_10056_c1 3300050512 Bacteria 8325
945 nmdc:mga0n895_194937_c1 3300050512 Bacteria 2057
946 nmdc:mga0n895_222478_c1 3300050512 Bacteria 1916
947 nmdc:mga0n895_2345_c1 3300050512 Bacteria 14753
948 nmdc:mga0n895_318942_c1 3300050512 Bacteria 1575
949 nmdc:mga0n895_389882_c1 3300050512 Bacteria 1409
950 nmdc:mga0n895_65296_c1 3300050512 Bacteria 3602
951 nmdc:mga0n895_7550_c1 3300050512 Bacteria 9346
952 nmdc:mga0n895_77955_c1 3300050512 Bacteria 3297
953 nmdc:mga0n895_975192_c1 3300050512 Unclassified 830
954 nmdc:mga0rr50_1349105_c1 3300050513 Bacteria 604
955 nmdc:mga0rr50_272559_c1 3300050513 Bacteria 1411
956 nmdc:mga0rr50_477152_c1 3300050513 Bacteria 1059
957 nmdc:mga0rr50_50304_c1 3300050513 Bacteria 3088
958 nmdc:mga08x19_228297_c1 3300050514 Bacteria 1281
959 nmdc:mga08x19_47535_c1 3300050514 Bacteria 2747
960 nmdc:mga0a205_1093_c1 3300050515 Bacteria 22518
961 nmdc:mga0a205_11081_c1 3300050515 Bacteria 8296
962 nmdc:mga0a205_1517634_c1 3300050515 Bacteria 518
963 nmdc:mga0a205_20268_c1 3300050515 Bacteria 6272
964 nmdc:mga0a205_51408_c1 3300050515 Bacteria 3978
965 nmdc:mga0a205_547441_c1 3300050515 Bacteria 1012
966 nmdc:mga0a205_721735_c1 3300050515 Bacteria 846
967 nmdc:mga0a205_72556_c1 3300050515 Bacteria 3326
968 nmdc:mga0a205_8089_c1 3300050515 Bacteria 9558
969 Ga0501084_0023342 3300054114 Bacteria 5163
970 Ga0501084_0044676 3300054114 Bacteria 3709
971 Ga0590077_155665 3300059426 Unclassified 548
972 Ga0587106_109685 3300059605 Unclassified 573
973 Ga0501082_0075363 3300060353 Bacteria 2907
974 Ga0530510_0003783 3300061734 Bacteria 10422
975 Ga0530510_0279412 3300061734 Bacteria 1247
976 Ga0530510_0839787 3300061734 Unclassified 701
977 Ga0065704_10238573
978 JGI24746J21847_1010804
979 JGI24035J26624_1009785
980 JGI24033J26618_1022121
981 JGI24034J26672_10083343
982 JGI24751J29686_10039974
983 JGI24751J29686_10063087
984 Ga0058861_11795853
985 Ga0065714_10085582
986 Ga0065714_10131696
987 Ga0065714_10139313
988 Ga0065704_10263811
989 Ga0065704_10280339
990 Ga0065712_10009945
991 Ga0065712_10026972
992 Ga0065712_10068029
993 Ga0065712_10074468
994 Ga0065712_10172488
995 Ga0065715_10004827
996 Ga0065715_10007485
997 Ga0065715_10071301
998 Ga0065715_10156526
999 Ga0065715_10179119
1000 Ga0065707_10008321
1001 Ga0065707_10012615
1002 Ga0065707_10036311
1003 Ga0065707_10177573
1004 Ga0065707_10294736
1005 Ga0065707_10513075
1006 Ga0070658_10681076
1007 Ga0070676_10004892
1008 Ga0070676_10028131
1009 Ga0070676_10116384
1010 Ga0070676_10209629
1011 Ga0070683_100307950
1012 Ga0070683_100339982
1013 Ga0070683_101058910
1014 Ga0070690_100020399
1015 Ga0070690_100195332
1016 Ga0070690_100236311
1017 Ga0070690_100538619
1018 Ga0070670_100002473
1019 Ga0070670_100006795
1020 Ga0070670_100308078
1021 Ga0070670_100372748
1022 Ga0070670_100721919
1023 Ga0070677_10355963
1024 Ga0070677_10902812
1025 Ga0068869_100015575
1026 Ga0068869_100134140
1027 Ga0068869_100168473
1028 Ga0068869_100351982
1029 Ga0070666_10017347
1030 Ga0070666_10045843
1031 Ga0070666_10427074
1032 Ga0070666_10576985
1033 Ga0070680_100967993
1034 Ga0068868_100028174
1035 Ga0068868_100590139
1036 Ga0068868_101184660
1037 Ga0070660_101366093
1038 Ga0070660_101829905
1039 Ga0070689_100013831
1040 Ga0070689_100113078
1041 Ga0070689_100219937
1042 Ga0070689_100457581
1043 Ga0070689_100462733
1044 Ga0070689_100496396
1045 Ga0070689_100622486
1046 Ga0070689_101957773
1047 Ga0070689_102055714
1048 Ga0070691_10276112
1049 Ga0070687_100012056
1050 Ga0070687_100120732
1051 Ga0070687_100149692
1052 Ga0070687_100801030
1053 Ga0070661_100284445
1054 Ga0070661_100311862
1055 Ga0070661_100434878
1056 Ga0070692_10314873
1057 Ga0070692_10571464
1058 Ga0070692_10844979
1059 Ga0070668_100054752
1060 Ga0070668_100171496
1061 Ga0070668_100415741
1062 Ga0070668_100781962
1063 Ga0070668_101305000
1064 Ga0070669_100024441
1065 Ga0070669_100046285
1066 Ga0070669_100094522
1067 Ga0070669_100216571
1068 Ga0070669_100348850
1069 Ga0070669_100572461
1070 Ga0070669_100655190
1071 Ga0070669_101010391
1072 Ga0070669_101745864
1073 Ga0070675_100010643
1074 Ga0070675_100026955
1075 Ga0070675_100031699
1076 Ga0070675_100051450
1077 Ga0070675_100051531
1078 Ga0070675_100054369
1079 Ga0070675_100192394
1080 Ga0070675_100210327
1081 Ga0070675_100267127
1082 Ga0070675_100389407
1083 Ga0070675_100747922
1084 Ga0070675_101161058
1085 Ga0070675_101232846
1086 Ga0070675_101523782
1087 Ga0070671_100182084
1088 Ga0070671_100411174
1089 Ga0070671_100690875
1090 Ga0070671_100724560
1091 Ga0070674_100013105
1092 Ga0070674_100535233
1093 Ga0070674_100754336
1094 Ga0070674_101397833
1095 Ga0070673_100002298
1096 Ga0070673_100011536
1097 Ga0070673_100041539
1098 Ga0070673_100044468
1099 Ga0070673_100058219
1100 Ga0070673_100178201
1101 Ga0070673_100227528
1102 Ga0070673_100727245
1103 Ga0070673_101641790
1104 Ga0070688_100102547
1105 Ga0070688_100132670
1106 Ga0070688_100363799
1107 Ga0070688_100687743
1108 Ga0070688_100723809
1109 Ga0070688_100749471
1110 Ga0070659_100097397
1111 Ga0070659_101025996
1112 Ga0070659_101199739
1113 Ga0070659_101696806
1114 Ga0070667_100022929
1115 Ga0070667_100231914
1116 Ga0070667_101549870
1117 Ga0070667_101602042
1118 Ga0070714_100001653
1119 Ga0070701_10084109
1120 Ga0070705_101031282
1121 Ga0070705_101040559
1122 Ga0070705_101177031
1123 Ga0070700_100181401
1124 Ga0070700_100541694
1125 Ga0070700_100782494
1126 Ga0070694_100274786
1127 Ga0070694_100321052
1128 Ga0070694_100740583
1129 Ga0070694_101047917
1130 Ga0070694_101322810
1131 Ga0070663_100259133
1132 Ga0070678_100014125
1133 Ga0070678_100173722
1134 Ga0070678_100195696
1135 Ga0070678_100679285
1136 Ga0070678_100830645
1137 Ga0070678_102237291
1138 Ga0070678_102237483
1139 Ga0070662_100027802
1140 Ga0070662_100049208
1141 Ga0070662_100089007
1142 Ga0070662_100175462
1143 Ga0070662_100274708
1144 Ga0070662_101042959
1145 Ga0070681_11071047
1146 Ga0070681_11600664
1147 Ga0068867_100075291
1148 Ga0068867_100199926
1149 Ga0068867_100235396
1150 Ga0068867_100424721
1151 Ga0070685_10044463
1152 Ga0070685_10085366
1153 Ga0070685_10140010
1154 Ga0070685_10189349
1155 Ga0070685_10492493
1156 Ga0070707_100649286
1157 Ga0070698_101398033
1158 Ga0070698_101768074
1159 Ga0070699_100057206
1160 Ga0070699_100310293
1161 Ga0070679_100746102
1162 Ga0070679_101264771
1163 Ga0070684_100351027
1164 Ga0070697_100042970
1165 Ga0070697_100148337
1166 Ga0070672_100070216
1167 Ga0070672_100153693
1168 Ga0070672_100239578
1169 Ga0070672_100302331
1170 Ga0070672_100327978
1171 Ga0070672_100734927
1172 Ga0070686_100023123
1173 Ga0070686_100065493
1174 Ga0070686_100452164
1175 Ga0070686_100920107
1176 Ga0070695_100001180
1177 Ga0070695_100134955
1178 Ga0070693_101410087
1179 Ga0070665_100363420
1180 Ga0070665_102249190
1181 Ga0070704_100003047
1182 Ga0070704_100129380
1183 Ga0070704_100131876
1184 Ga0070704_100339769
1185 Ga0070704_100689817
1186 Ga0070664_100000586
1187 Ga0070664_100028549
1188 Ga0070664_100045139
1189 Ga0070664_100094627
1190 Ga0070664_100113742
1191 Ga0070664_100153819
1192 Ga0070664_100193616
1193 Ga0070664_100906184
1194 Ga0070664_101119940
1195 Ga0070664_101176678
1196 Ga0070664_101815782
1197 Ga0068857_100094387
1198 Ga0068857_100634226
1199 Ga0068857_100695118
1200 Ga0068857_102504351
1201 Ga0068857_102562388
1202 Ga0068854_100446566
1203 Ga0068854_100775348
1204 Ga0068854_101212023
1205 Ga0068854_101927090
1206 Ga0068854_102232259
1207 Ga0070702_100058054
1208 Ga0070702_100602296
1209 Ga0070702_100873489
1210 Ga0068852_100694770
1211 Ga0068852_101082062
1212 Ga0068859_100016878
1213 Ga0068859_100027171
1214 Ga0068859_100031700
1215 Ga0068859_100137409
1216 Ga0068859_100137882
1217 Ga0068859_100154339
1218 Ga0068859_100269810
1219 Ga0068859_100285022
1220 Ga0068859_100554065
1221 Ga0068859_100616260
1222 Ga0068859_100722804
1223 Ga0068864_100012301
1224 Ga0068864_100013736
1225 Ga0068864_100244407
1226 Ga0068864_100526900
1227 Ga0068864_100715766
1228 Ga0068864_100921277
1229 Ga0068864_100943079
1230 Ga0068864_101993177
1231 Ga0068866_10331526
1232 Ga0068866_11030466
1233 Ga0068861_100064192
1234 Ga0068861_100088426
1235 Ga0068861_100113088
1236 Ga0068851_10608267
1237 Ga0068870_10037950
1238 Ga0068870_10146966
1239 Ga0068870_10500800
1240 Ga0068870_10930615
1241 Ga0068863_100046319
1242 Ga0068863_100079308
1243 Ga0068863_100632378
1244 Ga0068863_101079771
1245 Ga0068858_100073462
1246 Ga0068858_100090118
1247 Ga0068858_100258874
1248 Ga0068858_100408647
1249 Ga0068858_101026418
1250 Ga0068860_100202145
1251 Ga0068860_100309486
1252 Ga0068860_101379386
1253 Ga0068862_100070124
1254 Ga0068862_100084833
1255 Ga0068862_100394176
1256 Ga0068862_100443243
1257 Ga0068862_100650127
1258 Ga0068862_100806812
1259 Ga0068862_101295591
1260 Ga0068862_101846704
1261 Ga0081539_10029084
1262 Ga0075432_10223521
1263 Ga0075432_10254257
1264 Ga0070716_100295681
1265 Ga0070712_100334364
1266 Ga0097621_100860532
1267 Ga0097621_100879077
1268 Ga0068871_100053491
1269 Ga0068871_100335133
1270 Ga0068871_100431941
1271 Ga0068871_100462484
1272 Ga0068871_101319808
1273 Ga0075428_100000284
1274 Ga0075428_100001176
1275 Ga0075428_100030746
1276 Ga0075428_100055909
1277 Ga0075428_100061209
1278 Ga0075428_100062542
1279 Ga0075428_100092312
1280 Ga0075428_100109766
1281 Ga0075428_100412681
1282 Ga0075428_100574562
1283 Ga0075430_100007284
1284 Ga0075430_100016847
1285 Ga0075430_100034006
1286 Ga0075430_100045040
1287 Ga0075430_100051294
1288 Ga0075430_100052018
1289 Ga0075430_100090817
1290 Ga0075430_100265976
1291 Ga0075430_100333305
1292 Ga0075430_100440196
1293 Ga0075430_100726594
1294 Ga0075431_100003965
1295 Ga0075431_100007807
1296 Ga0075431_100008897
1297 Ga0075431_100009529
1298 Ga0075431_100020930
1299 Ga0075431_100062847
1300 Ga0075431_100126095
1301 Ga0075431_100536181
1302 Ga0075431_100627278
1303 Ga0075433_10006016
1304 Ga0075433_10010139
1305 Ga0075433_10051341
1306 Ga0075433_10065223
1307 Ga0075433_10098544
1308 Ga0075433_10455126
1309 Ga0075433_10562871
1310 Ga0075433_11103709
1311 Ga0075434_100010577
1312 Ga0075434_100016832
1313 Ga0075434_100017717
1314 Ga0075434_100040403
1315 Ga0075434_100078955
1316 Ga0075434_100144644
1317 Ga0075434_100160283
1318 Ga0075434_100291799
1319 Ga0075434_100584670
1320 Ga0075434_101301769
1321 Ga0075429_100004197
1322 Ga0075429_100009769
1323 Ga0075429_100025829
1324 Ga0075429_100031404
1325 Ga0075429_100055647
1326 Ga0075429_100095838
1327 Ga0075429_100183248
1328 Ga0075429_100193064
1329 Ga0075429_100315394
1330 Ga0075429_100557032
1331 Ga0075429_100777492
1332 Ga0075429_100779165
1333 Ga0075429_101514358
1334 Ga0068865_100105404
1335 Ga0068865_100132505
1336 Ga0068865_100203585
1337 Ga0068865_100302455
1338 Ga0068865_101039397
1339 Ga0068865_101566687
1340 Ga0075436_100247270
1341 Ga0097620_100016878
1342 Ga0097620_100027171
1343 Ga0097620_100031701
1344 Ga0097620_100137405
1345 Ga0097620_100137872
1346 Ga0097620_100154336
1347 Ga0097620_100269821
1348 Ga0097620_100285032
1349 Ga0097620_100554102
1350 Ga0097620_100616189
1351 Ga0097620_100722727
1352 Ga0075435_100021650
1353 Ga0075435_100110594
1354 Ga0075435_100308202
1355 Ga0105250_10369461
1356 Ga0105240_10152291
1357 Ga0105240_11096188
1358 Ga0111539_10000306
1359 Ga0111539_10000755
1360 Ga0111539_10008742
1361 Ga0111539_10009063
1362 Ga0111539_10020960
1363 Ga0111539_10046513
1364 Ga0111539_10065215
1365 Ga0111539_10096271
1366 Ga0111539_10108999
1367 Ga0111539_10305421
1368 Ga0111539_10346671
1369 Ga0111539_10430974
1370 Ga0111539_11778179
1371 Ga0111539_11986943
1372 Ga0111539_12096497
1373 Ga0111539_13075629
1374 Ga0105245_10549944
1375 Ga0105245_11361450
1376 Ga0105245_12821488
1377 Ga0105245_12828056
1378 Ga0105247_10042623
1379 Ga0105247_10498168
1380 Ga0114129_10011461
1381 Ga0114129_10015037
1382 Ga0114129_10020716
1383 Ga0114129_10029973
1384 Ga0114129_10041091
1385 Ga0114129_10052707
1386 Ga0114129_10071381
1387 Ga0114129_10088461
1388 Ga0114129_10097771
1389 Ga0114129_10161305
1390 Ga0114129_11025944
1391 Ga0114129_13427606
1392 Ga0105243_10489768
1393 Ga0105243_11098730
1394 Ga0105243_11179696
1395 Ga0105243_11459078
1396 Ga0105243_12091718
1397 Ga0105242_10485248
1398 Ga0105242_10543991
1399 Ga0105242_12058796
1400 Ga0105242_12261840
1401 Ga0105248_10286403
1402 Ga0105248_10381767
1403 Ga0105248_12497464
1404 Ga0105237_12785171
1405 Ga0105238_11290638
1406 Ga0105249_10009569
1407 Ga0105249_10055766
1408 Ga0105249_10492529
1409 Ga0105249_10709139
1410 Ga0105249_11002137
1411 Ga0105249_11012239
1412 Ga0105249_12125889
1413 Ga0105249_12528720
1414 Ga0105246_10012256
1415 Ga0105246_10386002
1416 Ga0105246_10482864
1417 Ga0105246_11004191
1418 Ga0157346_1009653
1419 Ga0157323_1014743
1420 Ga0157371_10376531
1421 Ga0157370_10680047
1422 Ga0157369_11790139
1423 Ga0157374_10058009
1424 Ga0157374_10338931
1425 Ga0157378_10445215
1426 Ga0157378_11308270
1427 Ga0157378_11536325
1428 Ga0157378_12146722
1429 Ga0163162_10008524
1430 Ga0163162_10594590
1431 Ga0163162_10655876
1432 Ga0157372_11157983
1433 Ga0157372_11377976
1434 Ga0157375_10053871
1435 Ga0157375_10375202
1436 Ga0157375_10889915
1437 Ga0157375_10896538
1438 Ga0157375_12052295
1439 Ga0157375_12916576
1440 Ga0163163_10022722
1441 Ga0163163_10078874
1442 Ga0163163_10172038
1443 Ga0163163_10176303
1444 Ga0163163_11314973
1445 Ga0163163_12870914
1446 Ga0157380_10029501
1447 Ga0157380_10062932
1448 Ga0157380_10079032
1449 Ga0157380_10146465
1450 Ga0157380_10547370
1451 Ga0157380_11440734
1452 Ga0157380_12581491
1453 Ga0157380_13058894
1454 Ga0157380_13531499
1455 Ga0157377_10005968
1456 Ga0157377_10066351
1457 Ga0157377_10111326
1458 Ga0157377_10839215
1459 Ga0157379_10003064
1460 Ga0157379_10005539
1461 Ga0157379_10074359
1462 Ga0157379_10622765
1463 Ga0157379_11933437
1464 Ga0157376_10066871
1465 Ga0157376_10146519
1466 Ga0157376_10452981
1467 Ga0157376_11517805
1468 Ga0163161_10028324
1469 Ga0163161_10039607
1470 Ga0163161_10329549
1471 Ga0207672_1006080
1472 Ga0207697_10002059
1473 Ga0207697_10020303
1474 Ga0207697_10100323
1475 Ga0207697_10316673
1476 Ga0207697_10425285
1477 Ga0207696_1150937
1478 Ga0207682_10061815
1479 Ga0207682_10353181
1480 Ga0207682_10513646
1481 Ga0207710_10165396
1482 Ga0207688_10011929
1483 Ga0207688_10117851
1484 Ga0207688_10203312
1485 Ga0207688_10361160
1486 Ga0207680_10140575
1487 Ga0207680_10272872
1488 Ga0207680_10530980
1489 Ga0207680_10574123
1490 Ga0207645_10051615
1491 Ga0207645_10071891
1492 Ga0207645_10140632
1493 Ga0207645_10208134
1494 Ga0207645_10465105
1495 Ga0207643_10014099
1496 Ga0207643_10029188
1497 Ga0207643_10156941
1498 Ga0207643_10316273
1499 Ga0207684_11442527
1500 Ga0207695_10110371
1501 Ga0207695_10797727
1502 Ga0207693_10381053
1503 Ga0207660_10463954
1504 Ga0207660_10535784
1505 Ga0207662_10022979
1506 Ga0207662_10068981
1507 Ga0207662_10129759
1508 Ga0207662_10161409
1509 Ga0207657_10612677
1510 Ga0207649_10023474
1511 Ga0207649_10123466
1512 Ga0207649_10207488
1513 Ga0207649_11285241
1514 Ga0207652_10426207
1515 Ga0207646_10176874
1516 Ga0207681_10038068
1517 Ga0207681_10088080
1518 Ga0207681_10098151
1519 Ga0207681_10214078
1520 Ga0207681_10234283
1521 Ga0207681_10245883
1522 Ga0207681_10849554
1523 Ga0207681_11337461
1524 Ga0207650_10008408
1525 Ga0207650_10216970
1526 Ga0207650_10341737
1527 Ga0207650_10378069
1528 Ga0207650_11314223
1529 Ga0207659_10004148
1530 Ga0207659_10009478
1531 Ga0207659_10016839
1532 Ga0207659_10036189
1533 Ga0207659_10036422
1534 Ga0207659_10107144
1535 Ga0207659_10144191
1536 Ga0207659_10246304
1537 Ga0207659_10248867
1538 Ga0207659_10260097
1539 Ga0207659_10501468
1540 Ga0207659_10697319
1541 Ga0207659_11394337
1542 Ga0207664_10028758
1543 Ga0207644_10073010
1544 Ga0207644_10662566
1545 Ga0207644_10915089
1546 Ga0207644_11118781
1547 Ga0207690_10420306
1548 Ga0207690_10505589
1549 Ga0207690_10836519
1550 Ga0207706_10027855
1551 Ga0207706_10038926
1552 Ga0207706_10107569
1553 Ga0207706_10158425
1554 Ga0207706_10351216
1555 Ga0207706_11161877
1556 Ga0207686_10748549
1557 Ga0207686_10934872
1558 Ga0207709_10956887
1559 Ga0207670_10195723
1560 Ga0207670_10254989
1561 Ga0207670_10324941
1562 Ga0207670_10398434
1563 Ga0207670_10524131
1564 Ga0207670_11038803
1565 Ga0207669_10016067
1566 Ga0207669_10068122
1567 Ga0207669_10366017
1568 Ga0207669_10492500
1569 Ga0207669_10765135
1570 Ga0207669_11042207
1571 Ga0207704_10543167
1572 Ga0207704_10842829
1573 Ga0207665_10175780
1574 Ga0207691_10006894
1575 Ga0207691_10023881
1576 Ga0207691_10051607
1577 Ga0207691_10051671
1578 Ga0207691_10111507
1579 Ga0207691_10125050
1580 Ga0207691_10302750
1581 Ga0207691_10525625
1582 Ga0207691_10641627
1583 Ga0207691_10937716
1584 Ga0207711_10107229
1585 Ga0207711_10116745
1586 Ga0207689_10006638
1587 Ga0207689_10066540
1588 Ga0207689_10073683
1589 Ga0207689_10164159
1590 Ga0207689_10207102
1591 Ga0207689_11272182
1592 Ga0207661_10043583
1593 Ga0207679_10007694
1594 Ga0207679_10072733
1595 Ga0207679_10268894
1596 Ga0207679_10282284
1597 Ga0207679_10442857
1598 Ga0207679_10471757
1599 Ga0207679_10853464
1600 Ga0207679_11176945
1601 Ga0207651_10002212
1602 Ga0207651_10074395
1603 Ga0207651_10082130
1604 Ga0207651_10183494
1605 Ga0207651_10188674
1606 Ga0207651_10270489
1607 Ga0207651_10394009
1608 Ga0207651_11213175
1609 Ga0207712_10023448
1610 Ga0207712_11111695
1611 Ga0207712_12103689
1612 Ga0207668_10160384
1613 Ga0207668_10710017
1614 Ga0207640_10132555
1615 Ga0207640_10148930
1616 Ga0207640_10857698
1617 Ga0207640_11130389
1618 Ga0207658_10043526
1619 Ga0207658_10148154
1620 Ga0207658_10435606
1621 Ga0207658_10532335
1622 Ga0207658_11962727
1623 Ga0207677_10054266
1624 Ga0207677_10128062
1625 Ga0207677_10624927
1626 Ga0207677_11740030
1627 Ga0207703_10028221
1628 Ga0207703_10290096
1629 Ga0207703_10525303
1630 Ga0207678_10082154
1631 Ga0207678_10586738
1632 Ga0207678_11021847
1633 Ga0207708_10084950
1634 Ga0207708_10363917
1635 Ga0207708_10780312
1636 Ga0207641_10204287
1637 Ga0207641_10653180
1638 Ga0207641_10675788
1639 Ga0207641_11226263
1640 Ga0207648_10023072
1641 Ga0207648_10031931
1642 Ga0207648_10119107
1643 Ga0207648_10138033
1644 Ga0207648_10391102
1645 Ga0207648_10568499
1646 Ga0207648_11254370
1647 Ga0207676_10038193
1648 Ga0207676_10153225
1649 Ga0207676_10156361
1650 Ga0207676_10201180
1651 Ga0207676_10452835
1652 Ga0207676_10536862
1653 Ga0207674_10123356
1654 Ga0207674_10138458
1655 Ga0207674_10164806
1656 Ga0207674_10208160
1657 Ga0207674_11316252
1658 Ga0207675_100035858
1659 Ga0207675_100057612
1660 Ga0207675_100072977
1661 Ga0207675_100080301
1662 Ga0207675_100222288
1663 Ga0207675_100555107
1664 Ga0207675_102041456
1665 Ga0207683_10007767
1666 Ga0207683_10147538
1667 Ga0207683_10278216
1668 Ga0207683_10679813
1669 Ga0207683_10947911
1670 Ga0207683_11251034
1671 Ga0207683_11783227
1672 Ga0207698_10914614
1673 Ga0207698_11117337
1674 Ga0207698_11238304
1675 Ga0209999_1078874
1676 Ga0210002_1039797
1677 Ga0209974_10013867
1678 Ga0209974_10063137
1679 Ga0209974_10066431
1680 Ga0207428_10000690
1681 Ga0207428_10003602
1682 Ga0207428_10006364
1683 Ga0207428_10007135
1684 Ga0207428_10047890
1685 Ga0207428_10232302
1686 Ga0207428_10286830
1687 Ga0207428_10330353
1688 Ga0207428_10333215
1689 Ga0207428_10769437
1690 Ga0268266_10377133
1691 Ga0268265_10283603
1692 Ga0268265_10314010
1693 Ga0268265_10461428
1694 Ga0268265_11624661
1695 Ga0268265_12218439
1696 Ga0268265_12636490
1697 Ga0268264_10135603
1698 Ga0268264_10173986
1699 Ga0268264_10241736
1700 Ga0268264_10262106
1701 Ga0268264_10383459
1702 Ga0268264_11214925
1703 Ga0268264_11552364
1704 Ga0307408_100005337
1705 Ga0307408_100131640
1706 Ga0307408_100856354
1707 Ga0307408_101727238
1708 Ga0307405_10004965
1709 Ga0307405_10006136
1710 Ga0307405_10110521
1711 Ga0307405_10195963
1712 Ga0307413_10041777
1713 Ga0307413_10246706
1714 Ga0307410_10001041
1715 Ga0307410_10030463
1716 Ga0307410_10172661
1717 Ga0307410_10296611
1718 Ga0307410_10326807
1719 Ga0307406_10011560
1720 Ga0307406_10023602
1721 Ga0307406_10448903
1722 Ga0307407_10002185
1723 Ga0307407_10006683
1724 Ga0307407_10008661
1725 Ga0307407_10616850
1726 Ga0307407_10653161
1727 Ga0307412_10006626
1728 Ga0307412_10019036
1729 Ga0307412_10085240
1730 Ga0307412_10285258
1731 Ga0307409_100005560
1732 Ga0307409_100027658
1733 Ga0307409_100096351
1734 Ga0307409_100227714
1735 Ga0307409_102302079
1736 Ga0307409_102441834
1737 Ga0307416_100007599
1738 Ga0307416_100012407
1739 Ga0307416_100020499
1740 Ga0307416_100278820
1741 Ga0307416_100305556
1742 Ga0307416_100834867
1743 Ga0307416_101060604
1744 Ga0307416_101554435
1745 Ga0307414_10023679
1746 Ga0307414_10050145
1747 Ga0307414_10066944
1748 Ga0307414_10158817
1749 Ga0307411_10003369
1750 Ga0307411_10018126
1751 Ga0307411_10024943
1752 Ga0307411_10048122
1753 Ga0307411_10388768
1754 Ga0307411_10567011
1755 Ga0307415_100012041
1756 Ga0307415_100087789
1757 Ga0307415_101113346
1758 Ga0307415_101417589
1759 Ga0373932_0184177
1760 Ga0373960_0350446
1761 Ga0373961_0096490
1762 Ga0373931_0360102
1763 Ga0439439_0030271
1764 Ga0439453_0003587
1765 Ga0451795_1213003
1766 Ga0439433_0040335
1767 Ga0439433_0213453
1768 Ga0439443_036869
1769 Ga0439443_045458
1770 Ga0439450_027769
1771 Ga0439456_068446
1772 Ga0439457_039011
1773 Ga0450920_067381
1774 Ga0450920_083914
1775 Ga0450890_088259
1776 Ga0450894_006981
1777 Ga0439446_0195039
1778 Ga0439434_0038168
1779 Ga0439434_0330459
1780 Ga0439435_0049424
1781 Ga0439435_0098848
1782 Ga0439444_0050498
1783 Ga0439464_0031568
1784 Ga0439464_0078464
1785 Ga0439460_0129669
1786 Ga0450916_006011
1787 Ga0439440_0120505
1788 Ga0453683_0758109
1789 Ga0466963_0473724
1790 Ga0466964_0865252
1791 Ga0451576_0519841
1792 Ga0451576_0587816
1793 Ga0466967_0230110
1794 Ga0495584_0034244
1795 Ga0495594_0065323
1796 Ga0495598_0070578
1797 Ga0495598_0113047
1798 Ga0495598_0138449
1799 Ga0495621_0420692
1800 Ga0495656_0006702
1801 Ga0495636_0698195
1802 Ga0495677_0353738
1803 Ga0496103_0594593
1804 Ga0496108_0720673
1805 Ga0496108_0854356
1806 Ga0496108_1496146
1807 Ga0496109_0110924
1808 Ga0496109_0129207
1809 Ga0496109_0235737
1810 Ga0496111_0470664
1811 Ga0496112_0176680
1812 Ga0496113_0049179
1813 Ga0496113_0508867
1814 Ga0496114_0127115
1815 Ga0501291_071558
1816 Ga0501292_027441
1817 Ga0501299_066872
1818 Ga0501031_0451062
1819 Ga0501033_0556441
1820 Ga0501036_0051933
1821 Ga0501036_0126418
1822 Ga0501038_1218417
1823 Ga0501039_0016762
1824 Ga0501039_0120454
1825 Ga0501040_0357532
1826 Ga0501041_0002498
1827 Ga0501041_0002879
1828 Ga0501041_0590124
1829 Ga0501042_0011677
1830 Ga0501042_0025943
1831 Ga0501042_0791502
1832 Ga0501046_0189929
1833 Ga0501048_0617519
1834 Ga0501068_0663943
1835 Ga0501070_0818211
1836 Ga0501071_0177634
1837 Ga0501071_0440219
1838 Ga0501071_0728274
1839 Ga0501074_0822061
1840 Ga0501075_0128948
1841 Ga0501075_0365637
1842 Ga0501076_0011199
1843 Ga0501076_1513172
1844 Ga0501076_1659453
1845 Ga0501077_0057339
1846 Ga0501077_0094148
1847 Ga0501077_0407901
1848 Ga0501202_059244
1849 Ga0501257_056364
1850 Ga0501258_042547
1851 Ga0501221_198029
1852 Ga0501079_0053734
1853 Ga0501079_0232707
1854 Ga0501079_0978269
1855 Ga0501080_0273987
1856 Ga0501081_0011798
1857 Ga0501081_0034579
1858 Ga0501083_0595102
1859 Ga0501265_059244
1860 Ga0501274_044320
1861 Ga0501035_0945422
1862 Ga0501045_0263942
1863 Ga0501045_0862712
1864 nmdc:mga05p37_1149796_c1
1865 nmdc:mga05p37_1775854_c1
1866 nmdc:mga05p37_277213_c1
1867 nmdc:mga05p37_62008_c1
1868 nmdc:mga05p37_62595_c1
1869 nmdc:mga05p37_6472_c1
1870 nmdc:mga05p37_68721_c1
1871 nmdc:mga05p37_717761_c1
1872 nmdc:mga05p37_7428_c1
1873 nmdc:mga05p37_78942_c1
1874 nmdc:mga05p37_93689_c1
1875 nmdc:mga05p37_954583_c1
1876 nmdc:mga09592_159989_c1
1877 nmdc:mga09592_204154_c1
1878 nmdc:mga09592_20748_c1
1879 nmdc:mga09592_24473_c1
1880 nmdc:mga09592_287129_c1
1881 nmdc:mga09592_296869_c1
1882 nmdc:mga09592_3707_c1
1883 nmdc:mga09592_41340_c1
1884 nmdc:mga09592_4664_c1
1885 nmdc:mga09592_6060_c1
1886 nmdc:mga09592_704253_c1
1887 nmdc:mga09592_761574_c1
1888 nmdc:mga09592_771136_c1
1889 nmdc:mga0qj67_1127171_c1
1890 nmdc:mga0qj67_14220_c1
1891 nmdc:mga0qj67_144399_c1
1892 nmdc:mga0qj67_161722_c1
1893 nmdc:mga0qj67_2106_c1
1894 nmdc:mga0qj67_2598_c1
1895 nmdc:mga0qj67_260352_c1
1896 nmdc:mga0qj67_288054_c1
1897 nmdc:mga0qj67_41459_c1
1898 nmdc:mga0qj67_57517_c1
1899 nmdc:mga0qj67_808670_c1
1900 nmdc:mga0qj67_8509_c1
1901 nmdc:mga0qj67_942996_c1
1902 nmdc:mga06r32_10914_c1
1903 nmdc:mga06r32_13698_c1
1904 nmdc:mga06r32_18593_c1
1905 nmdc:mga06r32_192768_c1
1906 nmdc:mga06r32_4912_c1
1907 nmdc:mga06r32_576955_c1
1908 nmdc:mga06r32_722755_c1
1909 nmdc:mga06r32_93975_c1
1910 nmdc:mga08y16_105_c1
1911 nmdc:mga08y16_18317_c1
1912 nmdc:mga08y16_190078_c1
1913 nmdc:mga08y16_1992_c1
1914 nmdc:mga08y16_2433_c2
1915 nmdc:mga08y16_298447_c1
1916 nmdc:mga08y16_33645_c1
1917 nmdc:mga08y16_360075_c1
1918 nmdc:mga08y16_48497_c1
1919 nmdc:mga08y16_727661_c1
1920 nmdc:mga0n895_10056_c1
1921 nmdc:mga0n895_194937_c1
1922 nmdc:mga0n895_222478_c1
1923 nmdc:mga0n895_2345_c1
1924 nmdc:mga0n895_318942_c1
1925 nmdc:mga0n895_389882_c1
1926 nmdc:mga0n895_65296_c1
1927 nmdc:mga0n895_7550_c1
1928 nmdc:mga0n895_77955_c1
1929 nmdc:mga0n895_975192_c1
1930 nmdc:mga0rr50_1349105_c1
1931 nmdc:mga0rr50_272559_c1
1932 nmdc:mga0rr50_477152_c1
1933 nmdc:mga0rr50_50304_c1
1934 nmdc:mga08x19_228297_c1
1935 nmdc:mga08x19_47535_c1
1936 nmdc:mga0a205_1093_c1
1937 nmdc:mga0a205_11081_c1
1938 nmdc:mga0a205_1517634_c1
1939 nmdc:mga0a205_20268_c1
1940 nmdc:mga0a205_51408_c1
1941 nmdc:mga0a205_547441_c1
1942 nmdc:mga0a205_721735_c1
1943 nmdc:mga0a205_72556_c1
1944 nmdc:mga0a205_8089_c1
1945 Ga0501084_0023342
1946 Ga0501084_0044676
1947 Ga0590077_155665
1948 Ga0587106_109685
1949 Ga0501082_0075363
1950 Ga0530510_0003783
1951 Ga0530510_0279412
1952 Ga0530510_0839787

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02699

YajC

Preprotein translocase subunit

33

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p4f-assembly1.cif.gz_Z structural insights into human co-transcriptional capping - structure 6 0.8706 60 101
6rm3-assembly1.cif.gz_SE0 evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome 0.8589 58 104
6nby-assembly1.cif.gz_S t.elongatus ndh (composite model) 0.8331 58 101
8p5d-assembly1.cif.gz_SE0 spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.8324 58 101
5fhg-assembly2.cif.gz_B structure of unliganded pif1 from bacteroides sp 0.8149 58 95
ID Description Score Start End Superfamily
af_A0A1D6JMV5_458_522_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.88 58 101 2.30.30.30
af_P9WL75_5_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8738 25 100 2.40.50.140
4ytlB01 Mainly Beta;Roll;SH3 type barrels.; 0.8725 58 101 2.30.30.30
af_O13936_472_519_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8704 58 100 2.30.30.30
af_A4I326_463_511_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8615 58 98 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A836TGG7-F1-model_v4 Preprotein translocase subunit YajC 0.9327 30 103 GO:0005886
GO:0015031
AF-A0A7V7B1V3-F1-model_v4 Preprotein translocase subunit YajC 0.9231 25 105 GO:0005886
GO:0015031
AF-A0A7C6GX53-F1-model_v4 Preprotein translocase subunit YajC 0.9196 25 104 GO:0005886
GO:0015031
AF-A0A357NA30-F1-model_v4 Preprotein translocase subunit YajC 0.9196 24 103 GO:0005886
GO:0015031
AF-A0A7C6S739-F1-model_v4 Preprotein translocase subunit YajC 0.9122 20 103 GO:0005886
GO:0015031

Map